2ZATA

Crystal structure of a mammalian reductase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
KPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTASRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for peroxisomal localization of tetrameric carbonyl reductase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords Dehydrogenase/reductase SDR family member 4
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zatA00
4BNMA 2NVUA 5FF9A 1NVGA 2Y99A 1WP4A 4CJXA 1PJBA 1R66A 4AG3A 2Q99A 3OEYA 4MVJI 1FDUA 3HADA 4I5GA 1GDHA 1JTVA 2BH9A 5L4LA 3DZHA 5AXDA 2YV1A 2NV6A 4DPKA 1YS4A 1V3VA 2O3RA 2O3JA 3GFGA 1H6DA 2YFHA 3FSRA 4FFLA 3PXXA 2DT5A 4O1MA 1KVTA 3E6AA 3C7DB 1WLYA 4UVEA 4XB1A 3JYLA 3AWDA 3D7LA 5CHEA 3V2UA 4DYVA 3LK7A 2I65A 1C1DA 2ZTLA 3O38A 3OM9A 2B4QA 5AOVA 3MJSA 2Y1EA 1Y8RB 4CM9D 4CMCA 5L45A 2J5KA 5IZCA 4OSPA 1LLUA 1Q7CA 4IQGA 1LI4A 3KYDB 4FN4A 1U4OA 4YRDA 5T57A 3VPHA 2RAFA 5JPIA 3I52A 4KOAA 3NDIA 3LT0A 3OP4A 4YT8A 2PD3A 5CEEA 1IYZA 1PJSA 3RUCA 2I9PA 5KTKA 1P33A 4N5MA 4OL9A 4TZTA 5EQDA 3HHPA 1K0UA 1NR1A 5H82A 2NNLD 3UKOA 3UAGA 4MIYA 3ZNPA 3AOEC 2G0TA 8LDHA 3BXXA 1HDGO 1T25A 2ET6A 2VUSA 3GOHA 4WLFA 4RO0A 4Z9FA 3I9KA 4GX1A 1Z45A 1KVRA 2R00C 3H5NA 4JLWA 5F1OA 1ZNQO 2VTDA 2YV2A 3KB6A 1WW8A 3CUKA 3Q11A 4D3FA 1AGNA 1U8XX 2BFOA 2C20A 5JDIA 1YONA 9LDTA 4NDNE 4Q3BA 4DREA 1PU2A 1U1IA 2YHUA 1EBFA 3H5RA 3RAJA 3I4FA 1MXHA 2GN8A 1BW9B 5TC4A 3I4CA 3SEFA 3FI9A 4HY3A 4YJGA 2X7HA 1Q1NA 4JX8A 3BMCB 1DPGA 4DVJA 5A9SB 4A26A 2B37A 3F4LA 3I9MA 5EN4A 3O8QA 5JMPA 3RI3A 1HYEA 3QW2A 3VH2A 3AFMA 1HDCA 3T7EA 1RPNA 3GN2A 4XYEA 1OAAA 3FRJA 3EZLA 3QV1A 4K26A 2B35A 4XQGA 2VZ8A 1N2SA 3R0IA 4WOJA 4J1SA 3I3OA 4R3NA 5DZSA 3ROPA 4YAGA 3L77A 4R69A 5DCUA 3UGKA 4D45A 4C7KA 2JL1A 2YFQA 3JD4A 3K31A 3NTRA 1P9LA 3CINA 3I6QA 1PZFA 2HCTA 3O8QB 5HA5A 1F12A 5CDSA 3IP1A 4L4SA 5IDYA 4B3IA 2GGSA 4DIBA 1O9BA 3JQ7B 1ISIA 4HFMA 1Z75A 4EZBA 3EC7A 1M75A 1BW9A 1QSGA 3ITKA 5COBA 5B12A 4BNZA 3SX2A 2P9EA 4FBGA 5IZ4A 4EUEA 3GK3A 2C7GA 3I23A 3KUXA 4CUKA 2HUNA 3LYLA 2FN7A 4PZEA 4WCFC 3KETA 3OA2A 3WQSB 3P7MA 4JP2A 2VYNA 2JD1A 3VH1A 1PX0A 3EMKA 4TVOA 4Y9DA 4MDHA 4JQCA 1LQUA 2V6MA 4WNIA 2I5PO 5JS6A 4L74A 1L1FA 4ND3A 3WGQA 2ZB3A 4AJOA 4NU5A 2I76A 1PJLA 2UUPA 4ZD6A 4NK4A 3EW7A 2AA3A 4UEKA 5AXBA 4NPCA 1W6UA 2EW2A 4QFCA 1GUFA 2AQ8A 2ZCUA 1U8FO 1VPDA 3F9IA 3WYEA 3LQFA 5B1YA 4AJJA 1D8AA 1XWFA 4QEDA 3V2GA 5FWNA 1A5ZA 5A03A 3KSDO 4GKVA 4W7IA 1IHYA 2OXIA 4NR0A 3EHEA 1O5IA 3CXRA 1XQ6A 4BO0A 2H1SA 5GMOA 2NVUB 3V8BA 3PYLA 4BNUA 3ZCXA 2EF1A 4XGNA 1PWZA 4YDRA 1Z7EA 5EPOA 4K6CA 4YEDA 2D5CA 4I8XA 4GMFA 4HXYA 4YBZA 4RGBA 3D3WA 4NBUA 3BMNB 2ZJ0A 1ADGA 5EL0A 3WQRA 2ZYDA 2DLDA 3WNVA 3HSKA 3E9MA 4U7WA 2NWQA 1E92A 3ZI0A 2J3JA 4ZN6A 4AICA 3FNGA 1S6YA 3N7UA 1Y7TA 4CV2A 4Y67A 4KWIA 5JW6A 2O4CA 4LMPA 1I0ZA 4XD2A 3CSDA 1LQTA 3TWOA 1C3VA 3ZV3A 2WE7A 3H8VA 2VHVA 1MC4A 4J91A 4ZRNA 3H9UA 2DBRA 4FJ1A 2C5EA 2BGKA 3C8MA 2JHGA 3E1KA 1RM0A 4IQ8A 5EESA 2WWRA 4L0QA 4LSMA 2E82A 1PZEA 4E2YA 2R00A 4FJ0A 3BZUA 3VKUA 4O5OA 3VHRA 4TRJA 1I5RA 3NTQA 5IF3A 3KSZO 3QP9A 3D4OA 4DC0A 4CMIB 2QRKA 1TXGA 2NU7A 3GZNA 4UVIA 5DULA 5THKA 2GN9A 1YL5A 3RBVA 4YTEA 1FF9A 1FK8A 5BSHA 2VNAA 4BNYA 4H16A 3WIDA 4AJ2A 1K6JA 3ETEA 1E7SA 3GDFA 3TL3A 1OOEA 3F1KA 3FF4A 3QVSA 3HDQA 4W82A 4Q3DA 4W6ZA 1MG0A 3L4SO 4PG5A 1UXHA 3N74A 5EMHA 2FSVA 3ZV4A 5B37A 3FTPA 1O95A 2RHCA 3VAZA 4E5MA 3MWEB 4XQEA 1GD1O 1E0DA 1ZSNA 1C1XA 1E6WA 1TB4A 3E48A 3JQ8A 5U1PA 3RC2A 4D46A 4ND2A 1NQAO 3WMWA 1I10A 1P44A 3PIDA 4G5HA 3B20A 3WWYA 3ULKA 4E2ZA 2OOSA 3AUAA 2AE2A 4BOYA 4QTZA 5DOVA 1LSSA 1MG5A 1M66A 3OQ1A 2CDBA 2BGLA 5JNLA 2VHXA 1E7MA 4J2OA 4EEZA 3R1IA 3RCBA 3TL2A 1B3BA 2HJRA 2W4QA 2CUKA 3H9JA 4G65A 1N8KA 5I7VA 4EW6A 1VJTA 1TEHA 4QO7A 5B4VA 4FFRA 4HNGA 1QXSA 3OJ0A 3PYMA 1UH5A 2BI7A 3DDNA 4J6FA 3ZU5A 2BFAA 5A9RA 1ZXLA 1E7RA 4IDDA 4CLOB 4CM8B 3DFUA 5CG2A 1YBAA 4MVJA 2FPPA 4IINA 4U5QA 1IE3A 3RJ9A 1GQQA 1RYEA 5TGDA 1FDVA 1PJQA 3C85A 3GDGA 4BKUA 4NIMA 1VM6A 4NMHA 1B0AA 1U9JA 4KUHA 2OORA 5JE8A 1CERA 2W2KB 4UEJA 3BIOA 1ZMTA 4NFSA 5TRTA 5BSEA 5K9ZA 1ISGA 4E2WA 3I9NA 3JD2A 4BO6A 4D0SA 3K73O 3GG2A 2AQIA 5KJFA 1B7GO 1FDTA 1I01A 4NU6A 5EINA 1R12A 5LCXA 5JDCC 4OJNA 4RPKA 4D3DA 5TF4A 1I33A 1U5AA 2CDCA 2JD0A 4IDEA 2Y68A 5DN9A 3GAZA 2QRLA 4X54A 3U49A 4E6PA 3DAGA 1SPXA 1CJCA 4I1IA 3WWZA 4EJ0A 1CIVA 2X4GA 4Z0HO 2V7PA 3I9OA 3NGXA 2D5AA 5B4TA 5F3RA 3IUPA 1DDOA 2G17A 1YH3A 1MLDA 1ZH8A 4BO7A 4BO2A 3KYDA 3RUAA 1HETA 3CZRA 1MX3A 2DBVO 2JHFA 4LVUA 3ZU4A 2HSDA 3DAFA 1TA4A 1X0XA 5F21A 2NLOA 4IJUA 3UICA 8ADHA 4Q3EA 4TKMA 1DJQA 1X7HA 4RVSA 1P77A 4NFHA 3BMQA 1C1DB 1XYGA 3WLFA 3OHSX 2PGLA 1DIRA 4RF4A 2DVMA 5FEUA 1I3MA 4LW8A 2ZKLA 4E13A 1W73A 2VN8A 5JCXA 1E7WA 4H3VA 3ST7A 3TDKA 3INGA 4PG8A 3ADPA 2Z1NA 4XYLA 2X9VA 4R68A 1QYXA 4CLDA 1RM4A 4O0LA 5IXSA 4FPXA 3F4BA 5TT1A 4YRBA 3ADOA 4CUZA 3A28A 1PJCA 3G1TA 4BVAA 4YRAA 4E32A 2AQHA 2Y93A 4HBGA 2UV8A 5TS3A 3KXDA 5JDCA 1U3WA 3ORFA 3H65A 3I5MA 3KZVA 3WNQA 4EUHA 3JD1A 5LDGA 2HMUA 4DLLA 5CP8A 1ZK3A 2V6FA 2VRCD 3DEYX 3TJRA 3OQ6A 3RU7A 4DUPA 4BB5A 3CMMA 1EQUA 3OEWA 1P31A 4IDCA 4GI2A 3OJLA 2P5UA 2ZYGA 3LVFO 2W90A 2LDBA 4GVLA 4FOOA 2J3HA 5CDGA 1ISFA 1ZVMA 3ZU2A 3CZMA 5JO0A 4ZU3A 2OHXA 4WLUA 4Q3CA 4OO3A 3PQFA 3Q2KA 3FN4A 4ESOA 4B3HA 4A73A 5HM8A 1WPQA 4BNVA 4OKNA 6ADHA 1H5QA 4IPTA 3WJAA 5IDWA 4IJWA 3UCEA 2DQ4A 5A4DA 4RDHA 2HU2A 3DHNA 4ZQFA 4Y8VA 1E3WA 2P68A 4PLWA 4TRRA 2AEFA 4DYDA 3PFWO 3NTOA 4L76A 4MOWA 4TWRA 1FXSA 1E1KA 4RPGA 3A4VA 2DUWA 5DCYA 3PDJA 4GWKA 4BNKA 2HMWA 4CM7A 1E77A 4CODB 3RFVA 3VVBA 1LXCA 3IOYA 2Q4BA 4PLVA 4YJHB 4EDFA 1FDSA 4ILKA 3PGXA 1HLDA 2I3AA 5A04A 5KNLA 3DONA 5L3ZA 4Y6PA 2ZATA 5A05A 5TSDA 1Y81A 1GPJA 3ZGYA 2CVZA 3AI1A 2W98A 1N9GB 1I24A 1GQYA 1QG6A 1EE2A 3PJEA 5JLAA 4GSLA 3L4BC 3TZCA 2VZ0A 2YDXA 4UUNA 5JCJD 4DGSA 1UAGA 4OOEA 1N5DA 1EVJA 1ZK4A 5BSGA 1IY8A 3DZKA 3WGIA 1HXHA 3BA1A 3JQAA 3JQ8B 1M6HA 3WLEA 5CPFA 2BGMA 1HDRA 3DZJA 4IJVA 5LC1A 1DC5A 3PJDA 4IS3A 4BGVA 1UP4A 3JYPA 4DPMA 1HE4A 2D0IA 2DPGA 1GZ4A 4INAA 5LDHA 5L7YA 4OMUA 2QG4A 2HK8A 2VWHA 4XRGA 1WMBA 3EY4A 5U9CA 3CKYA 4YT5A 1HWYA 4OQYA 1T1SA 4E3ZA 2WTBA 3ZHBA 1J49A 1Y6JA 2GNAA 4S1VA 1AE1A 4PN3A 1LRJA 3BHIA 1A9YA 4A5OA 3GA0A 1I3LA 4NFYA 4GWGA 5A1TA 1D4FA 2CVQA 2EJVA 1YKFA 2O7SA 1EVZA 1GY8A 4YVFA 2Q2QA 4WCFB 1PJ4A 1NXQA 3IUSA 3NKLA 3QWHA 5DT9A 1Y1PA 4CMBA 4R54A 3F46A 1Q7GA 1T2AA 3QVWA 2EKQA 4GH5A 1P74A 1E1LA 4Y98A 4XGKA 4RZHA 4ZQHA 3ICPA 4JK3A 4AJHA 5ILOA 1H9BA 2CSUA 1XG5A 1AXEA 2XOXA 3GDOA 1R16A 4H7PA 4ID9A 4PVCA 4W9NA 3STHA 5I7SA 2P4QA 4Y6SA 2X0JA 4NZ9A 4I9UA 4PG6A 2O3QA 3JQFA 5DP2A 4UUMA 4GL4A 4K1LA 1E6UA 3HUDA 1LRKA 2NTJA 4ZHSA 3GQVA 3OFSA 4KQXA 4CL3A 5L4NA 2A4KA 1EFKA 3NX4A 3UF0A 3BMQB 4B7XA 4XDZA 3K8ZA 2GO1A 4XX0A 4ZQEA 1AHHA 4JJIA 3EZYA 4M49A 4OAQA 4JBGA 4PLGA 4XGIA 4WE3A 4YCAA 1P45A 2F00A 2VZ9A 5AXCA 2FY8A 2IDZA 4TRMA 2NTVA 1JVBA 3KYCB 4B3JA 4FOSA 4IXWA 1J0XO 4E0BA 2FHSA 4YT4A 4XJSA 1MFPA 3RWBA 4BGEA 1DOHA 3I83A 4Q9NA 3T4EA 4IDGA 3S55A 3NDRA 5I9MA 3JQ9C 4JP3A 5F5NA 3FPCA 4I5EA 3WSVA 2VUUA 3JYOA 4E33A 1H9AA 2IODA 4BB6A 1SC6A 3AK4A 1Z82A 4QFDA 1PGPA 5JMWA 1LNQA 1B2LA 3TOZA 4E21A 4ZICA 2OBYA 3GEMA 4RORA 3PJFA 4FFPA 2HRZA 3MWDB 4IJKA 3EYWA 1Y9AA 3JTMA 4J4HA 2YW9A 2D3TA 2LDXA 3U4CA 3VPXA 4IMRA 4Y6RA 5KWEA 4JGBA 4UVGA 1HLPA 1IPEA 2RHRA 4B7CA 4YAJA 3JQBC 5DP1A 3U9LA 1TT7A 2Q1SA 2Y1CA 1FJHA 2W2LD 2X0IA 5ENDA 3W8EA 1VL8A 1EK5A 3ZWXA 1Y5RA 1IOLA 3WGGA 3RKUA 4JROA 4HP8A 4UAGA 2GZ3A 1PJ3A 3E82A 1DJNA 1PQWA 1JKFA 1R4MA 4EGFA 3DBLB 4RVFA 1P1IA 4FR5A 2C2XA 4L9RA 2EV9A 5KKAA 3ENKA 2X8LA 1ZK0A 1TVEA 3PWSA 2JD2A 3FBGA 2DFDA 4RF2A 3LT1A 2QYSA 1EQ2A 4JCOA 4XQ9A 3X2FA 4GAEA 4CQLB 4QUKA 1LLDA 3FCOA 2X86A 3DZGA 4F6CA 4CV3A 3RIHA 1BDBA 5DDIP 4KDFA 4Z3KA 2AXQA 3DMTA 3GHHA 3RUEA 4MP8A 2JFGA 4LVCA 3VVCA 2IRWA 1F0YA 2UUOA 2JAHA 4J0EA 3PYXA 5JDIC 3G79A 4B8WA 4UUOA 3C7AA 5DOZA 1CEQA 1B26A 4DBVO 4ND1A 5G0WA 1NAHA 1XU7A 3RVDA 3V1YA 1NQTA 3CTMA 3TZ6A 3U4IA 4A0SA 3VDQA 2X58A 2EXXA 1A71A 3TPCA 4BNNA 1A7AA 2C82A 2WJPA 3GVPA 4IXTA 1UDCA 4XYBA 4L73A 1YVEI 4CM3A 5DF1A 1WVGA 5IAAA 1LX6A 3LC7O 3QIVA 4KWHA 2UDPA 4ZA2A 5G4KB 5AYVA 1BHSA 1O94A 1R6DA 1UJMA 2GF2A 2B5VA 1E1NA 4LK3A 4BV9A 4OSOA 1DIAA 1ZEJA 4WOKA 1XDWA 4YXFA 4R1UA 1Q0QA 3A9WA 5K6AA 3C1OA 5I8ZA 1V3TA 2C7VA 1PR3A 3FNHA 3H9QA 1IHXA 4CV1A 4WGGA 2Y1GA 3QWAA 4N18A 3Q6IA 4LN1A 5I9LA 5JAZA 1V3UA 3Q0EA 4MO2A 5IZCC 1E6EA 2IEBA 2EKLA 2O50A 4BO1A 2C2YA 1BXKA 3UXYA 4WECA 2GZ2A 3PQEA 4L4XA 1MV8A 1WXDA 1H93A 1A4IA 3DZBA 2CD9A 2O3TA 1GAEO 4HNHA 3LC2O 3PJGA 2X23A 1E3JA 3OECA 6LDHA 3FNEA 5TLSA 1ADFA 4J16A 3TFQA 4J3FA 4YT2A 3IMFA 4JIGA 3INRA 2HQ1A 3ZWAA 2JJYA 4QX6A 5A5FA 1Y9EA 3Q2IA 5JBIA 1DRVA 2BHLA 3U09A 2C07A 2P9GA 4GX2A 2GLXA 4J2HA 5BQFA 1A7KA 4BGUA 3F5QA 2PH3A 3GFBA 1ZIDA 1ARZA 3CIFA 4FGWA 4LRSB 4CLXA 1MC5A 5KVVA 4I9NA 5F1PA 3B70A 2Q50A 3GG9A 3NJ8A 4I5FA 4NK5A 2FZWA 1T2FA 2XAAA 4G2NA 4U6SA 1KY4A 4NQZA 2Q1WA 4YWJA 3W1VA 3DMTC 2Y1DA 5JCJA 3SC6A 2AG8A 1CDOA 4KTVE 5TJHA 1K6IA 2BFMA 1KBZA 5JFOA 3EDMA 3FNFA 3ZW9A 1PL6A 4WJZA 3HZZA 1JKJA 3AY7A 4CMKA 1DXYA 1OMOA 3CEAA 3H3JA 1CQIA 1SEPA 3DBRA 2PH5A 3I6IA 4BNIA 1GUZA 3UHAA 4EEXA 1CYDA 1B14A 1KEPA 2WE8A 3O26A 4XB2A 2X5JO 5DBGA 4K9DA 1XEAA 1LC3A 3JQAD 1WDLA 1IL0A 5JAMA 1VE9A 1G0OA 4ND5A 4PLTA 2IYPA 3W6UA 3HN2A 3FR8A 3SJUA 5CPBA 2VRBA 3JCZA 4IS2A 1NR7A 2FR0A 2DM6A 5GY7A 3GN1A 3KLPX 3JQ7A 4QECA 3DFZA 3UFXA 1JKIA 4TMFA 2PK3A 4UULA 1HL3A 1XQ1A 2BI8A 5JAQA 3WJ7A 5CFZA 4P4LA 3RC1A 1OZAA 3GGOA 3ZNNA 5G4LA 3WGOA 1YBMA 1LDMA 5L53A 1H2HA 1DHTA 4CM4B 4HFJA 4P22A 1MXFA 5JYEA 1BXGB 1ENPA 1GYQA 2J6IA 4XR4A 3GUCA 3S2GA 3HDYA 4CM9A 2NACA 4BNFA 2JAPA 1LTHR 1UZMA 2PZMA 4RDIA 3ZHZA 4YPOA 4A10A 2ZK7A 1CQJA 1LJ8A 4XJTA 5A9SA 5I7FA 4ITUA 5U4QA 3DTTA 1DC6A 5CDTA 2EIHA 1Y5MA 4ZRMA 1TT5A 2WD7A 1QLHA 3W4IA 1PGQA 3WGTA 2ZTUA 4OHUA 4II3A 3ONDA 2RCYA 1NPDA 2GYYA 4GQAA 1DAOA 1DLJA 4MVJH 3E9NA 1I3NA 3RD5A 3PHHA 1E7QA 3ANLA 4WPGA 3DQPA 4GX5A 5I7EA 4CMEA 4WUVA 1ZXBA 3V5NA 3VPGA 3GNQA 4LMRA 1CF2O 1LDBA 1ZMOA 3OBBA 1JLLA 2JCVA 1QV7A 4TSKA 1EVYA 2DPHA 1NP3A 5CDUA 3OH8A 4EUFA 5AXAA 1VSUA 3DBLA 1SO8A 4DBZA 1BWSA 4R4JA 4AJKA 4MKXA 3OICA 1LSJA 4XDYA 4NH4A 4HUJA 4QQRA 1ZW1A 4WCDA 3NV9A 3QVTA 2DAPA 4FC7A 2HMSA 1DHRA 2GR9A 1DFIA 5TT0A 4IDFA 4AFNA 2BLLA 4K28A 2P2SA 1KY5A 2WYUA 5HWSA 2Z95A 1YXMA 2BKAA 1H94A 1N7HA 1NX6A 3AY3A 2X22A 3ROMA 3KVOA 4TRNA 4CQMB 3QSGA 1DAPA 4ZJUA 4YAEA 1OBFO 1Y8RA 4GLLA 4CL8A 4F45A 1M76A 3GT0A 3PP8A 1PS0A 2PZKA 4RVDA 1PSDA 1NQ5A 2HLPA 3S1LA 2PGJA 3X2EA 2AHRA 5JAIA 1UXIA 3WDSA 1ZSVA 1GZ6A 4EI2A 2YDYA 4II2A 2H6EA 1BSVA 4XIYA 3RUDA 1JA9A 1KIFA 3MJVA 1P0FA 1YOVA 1VSVA 3FPLA 2J5QA 1EDOA 4E5YA 3AU9A 3KLMX 4WASA 5K0ZA 3PWKA 1F8GA 1LRLA 1QV6A 2FZEA 1T26A 1VJ1A 5KJ6A 1F14A 3L4BA 4N5LA 2VOJA 3L6OO 2Z1MA 2TMGA 1GCUA 4J1NA 3SC4A 3SXPA 4AJPA 3QQPA 1Y8QA 4R01A 3HG7A 1QRRA 2IXBA 3TZQA 2DKNA 1GU7A 3AJRA 4HX5A 1X7GA 1VRWA 3HFSA 3UOGA 1RM3A 3TN7A 4DQXA 2O2YA 2IYOA 3GVHA 1YQXA 3GRKA 4C4OA 2WMDA 2YZ7A 3L6DA 1SMKA 1UDBA 2GZ1A 5A9TA 3W8DA 1FDWA 5IXYA 3HB5X 1XSEA 3RFTA 1DO8A 1EUZA 2ZQYA 1R37A 3OETA 3AUTA 3AOEA 5IFLA 1U3UA 2X6TA 1N7GA 4CV0A 2SCUA 4DRYA 1TI7A 4RVHA 3B1FA 3D4NA 3H9GA 2BF7A 3PHLA 1YRLA 2I66A 2VRCA 3C3XA 4MVJP 3SBOA 4XKJA 4A7PA 4JN6B 1PZHA 3TZHA 3SVTA 4IY1A 1IPFA 2VTEA 1GZ3A 3ENNA 2NU9A 4RJTA 1IZ0A 3QE3A 3DR3A 4PG7A 1YGYA 1H6AA 3HFGA 3U62A 2IZ0A 3BMOA 2A92A 4MIEA 1J4AA 2QHXA 3GEDA 3FBTA 4CMAA 4ALIA 1H6BA 2Y67A 3PGJA 2PWZA 3V2HA 4Z9XA 2HK7A 3ANNA 5K6AC 3V1UA 1KYQA 4CLHA 1SAYA 1AUPA 1DRWA 1R4NA 3EVTA 4K6FA 4TZKA 4WLVA 2X9NA 1GADO 3GVXA 4BNHA 3QHAA 5KVSA 3KEQA 5I8WA 1QR6A 2XXJA 2VYND 4WKGA 2ZTVA 4XZ3A 3VOSA 4D3SA 1I8TA 2BFPA 2JFFA 5GZ6A 4EBFA 3MCVA 2H63A 4J90A 4DWVA 2P4HX 3VZQA 2UAGA 3GMDA 4O59O 4OXYA 4P4NA 1HDOA 4PLPA 4E2XA 3JQGA 2EWMA 3KHUA 1PEDA 2C59A 2HAEA 5F5LA 4TROA 3IL2A 1EDZA 3AI2A 1EK6A 5H83A 1E1MA 1ADBA 1P1HA 4CQLA 5ITVA 2IZZA 3GGGA 4IZIA 4FQ8A 2AEMA 3I9JA 4DMLA 5BR7A 2HMTA 3BHJA 1K3TA 4RPHA 4BKRA 3H5AA 1WAMA 4M55A 3DB2A 5HS4A 2OL4A 3H2ZA 2WSBA 2RH8A 1RKXA 1NFFA 1PJ2A 1R4MB 1SNYA 1I2CA 3JQCA 3NGLA 2G1UA 4FFMA 3JQGB 2AQKA 2CDAA 4Z6KA 2EW8A 5EIOA 3BMOB 2YQ4A 2O2SA 1QYWA 1EBUA 2EGGA 4RQUA 4CR6A 3R6DA 3EGOA 5HTOA 4J43A 5HRUA 3QWBA 1JU9A 1H6CA 1OC4A 1WWKA 4R3WA 2VYVA 1PQPA 3K6JA 2AE1A 1I36A 4L8VA 3BAZA 5C7OO 2A9FA 3SLKA 1R0LA 4RZIA 2ZQZA 4RL6A 1K89A 4JJFA 2V6BA 1QLJA 4HADA 1DRUA 2CVOA 4OGWA 3VZPA 4I9HA 5GZ3A 3LSYA 3IDSA 3JD3A 2VOEA 2FR8A 4N5NA 4HFRA 2GUGA 4IGFA 2DC1A 1PZGA 3M6IA 4F6LA 4R51A 5L7WA 4LCEA 3OQBA 2O23A 3ZZNA 1P1RA 4R41A 3PHJA 3VH4A 4YA6A 3ZW8A 1EMDA 2VHYA 3T4XA 2PKQO 1S7CA 5IJZA 4ALNA 2AG5A 2BRUA 2GASA 2ZB7A 4UEOA 3RBZA 2PKRA 2VWQA 4CMGA 3WFIA 1HE2A 2PLAA 1X0VA 2OZPA 3HNPA 2W2LA 4MJLA 4DC1A 3NT4A 4RPJA 1GR0A 3OSUA 2Z5LA 2GN4A 4DMMA 3G1UA 1JDJA 3WGZA 3WR5A 4BNJA 1Z73A 1QORA 2EP7A 4RVGA 2E49A 4IDBA 3GLQA 3O03A 3QLJA 2PD4A 3BHMA 3QWIA 3H4VA 3ZWMA 3DAPA 1JW9B 5JC1A 9LDBA 4AJEA 3JYQA 5CAEA 1LU9A 2NSDA 2I99A 3DL2A 1MA0A 4HFNA 1U7HA 1X15A 2Q2VA 1Y8QB 4NBTA 1ADCA 1CWUA 2J5RA 3WQQA 2J8ZA 4BNLA 1GUYA 1W0CA 1R15A 3D64A 1NQOA 4RF3A 3LT2A 4PZDA 5T64A 4CQMA 4E5KA 1P1KA 3F5SA 3KBOA 1YDWA 2YJZA 4J0FA 3IJRA 4IGEA 1ISJA 4ND4A 5H81A 2DU8A 3V1TC 3LLVA 4CLRA 2ILTA 1X7DA 1E5QA 1ONOA 1EVIA 1IUKA 4B4UA 2GDZA 5C7LO 5FI3A 3DHYA 1ZJZA 3IC5A 4MVJE 1NPYA 4W9NC 1QYCA 1NASA 3DZIA 3UW3A 4A03A 3ICCA 1ML3A 4YB8A 3RJ5A 3JQDA 3G49A 2QYTA 3GNSA 4FD3A 4FGSA 1D3AA 3WXBA 2DFVA 4OOFA 3WX0A 3IS3A 1P0CA 3WBBA 3BYZA 1IB6A 3NDJA 1BTOA 2OMEA 1BRMA 4D0RA 1B8UA 3VZRA 1E3LA 2OGUA 4DL9A 4PFJA 3RC7A 3F47A 5BNIA 3GR6A 1VL6A 1RWBA 4R9SA 2VUTA 5DBFA 3WOHA 4ALMA 3H6KA 4QT0A 1OFGA 3E5RA 1SBYA 4WLEA 1LSOA 1YB5A 5MDHA 4BNWA 3D1LA 2EERA 4J1QA 3ZH2A 2IEDA 5G0UA 1B8VA 1UAYA 4NJMB 2C5AA 3INTA 5EJ2A 4GMGA 1GV1A 1YB4A 4IDAA 5KJEA 2HRBA 4CMHA 3PHIA 2D4AA 1U28A 1EZ4A 1QP8A 2WD7B 4FC6A 4MVJG 1A9ZA 1QYVA 3MTJA 2B4TO 3ZDFA 1KS9A 4D44A 3ASVA 4OXKA 1YL6A 4BKQA 1VI2A 1T2DA 2DBZA 2Y1OA 2FSSA 2O3SA 1B8PA 3G3EA 1PGOA 5EERA 4IQ0A 4IM7A 4CPDA 4YJFB 4E31A 3COSA 2B4RO 2POQX 1EUDA 2FPIA 4RF5A 2EP5A 2IXAA 3M2TA 3AM3A 1JWAB 3ZHYA 3N58A 3UUWA 3FR7A 4ZVVA 2CNBA 4QO8A 3GUYA 1KEUA 1I2ZA 2B0JA 1RJWA 2H5LA 2WEKA 2I67A 5BSFA 2C54A 4DQUA 1GTMA 3MTGA 3U3XA 4D7AA 1A4UA 1C1XB 3W8FA 5TJ9A 4FS3A 1BVUA 4BKPA 2NTNA 2FP4A 1ONPA 3BTUA 2V65A 4ZGWA 5IDQA 3L0DA 3NEPX 4DQVA 3TF5A 2ZJ1A 4GVXA 1PL8A 1SEVA 3M1LA 4OKIA 4GGPA 3PHGA 2DUUA 3OJOA 4AL4A 4CM4A 1XELA 3ZV5A 2QRJA 1XA0A 3D3EA 3DOCA 3RUHA 5IG2A 1UZLA 4PLHA 3DBRB 1IZ9A 1DFHA 2Q1TA 1YJ8A 1BVRA 4TQGA 3G0OA 5F1KA 2PNFA 1BXZA 1ID1A 1PGNA 1PWXA 1R0KA 2P5YA 3LZ6A 1H0KA 3PLNA 7ADHA 5JYDA 4J9UE 1E3EA 2TMDA 3IJPA 4XIJA 3KEOA 3H9EO 5COQA 3LF2A 3QWFA 4RPLA 1XHLA 5AVOA 1JQBA 4NNJA 3HE3A 2HMVA 3PVZA 3PLRA 4RV9A 3WFJA 2EJWA 2CF6A 3U4DA 4IBOA 1YOVB 5BNTA 3AFNA 5KOIA 4UVHA 2DBQA 1NPTO 1YL7A 3GZ4A 1CRWG 4JBIA 3D3WB 5JY1A 4GGOA 1X14A 2QZZA 5CEFA 3WTCA 1YE3A 4BNGA 3GAFA 2W8ZA 3L9WA 4BV8A 4CMEC 5CG1A 3SLGA 2YV3A 1XGKA 4OH1A 1JAYA 1JAXA 1RYDA 1EFLA 1L7EA 1LBEA 3O4RA 4AJ4A 3IP3A 2YHIA 3IIEA 2DTDA 4IMPA 4ALJA 4OXNA 1WZEA 2NQ8A 1VL0A 2E37A 2Y05A 1E3SA 3OIDA 5L51A 1Q7BA 1NVTA 2PY6A 3P2YA 1T1RA 2X9GA 3AY6A 3OF2A 1BDMA 2QW8A 3ZNOA 2GSDA 4KUGA 1ZKMA 1ULUA 3U5TA 2J3KA 5J23A 1D1TA 1EUCA 3CMCO 1ENOA 1ORRA 3EUWA 4PRKA 3RU9A 3U0BA 5ER6A 3FHLA 1G0NA 3DOOA 4M87A 3WS7A 3ETDA 1O6ZA 3GH3A 5L4SA 3FWZA 5G0VA 3PDUA 1GPDG 1I2BA 4GPD1 3H2SA 3CH6A 3A1NA 3H7AA 5A3VA 1H2BA 4P38A 4B4VA 3C1TA 4A27A 1T24A 2A35A 3Q3CA 1NFRA 3WMXA 1K5HA 3EVNA 2WM3A 3B1JA 3JQEA 3B6ZA 4IUYA 5G4KA 4JBHA 4EJ6A 2I3GA 1V35A 4ALKA 2JKVA 1KVSA 1UP7A 1XLTA 2W2KA 1LLQA 1E3IA 3L07A 3GPIA 3UN1A 2RBEA 3NT2A 4E12A 5ADHA 4FFNA 5FI5A 1X1EA 2E48A 3F3SA 4BKOA 2VT3A 4CLOA 3MOIA 2XPCA 2E4AA 1DEHA 3F1LA 3TQHA 2VQ3A 4E30A 3E9QA 1RM5A 4E4YA 3D5TA 3HDHA 2D1YA 1DFGA 3JSAA 1U4SA 1U3VA 1VKNA 1UXJA 2RH4A 3ETGA 3Q9UA 4DLBA 2WD8A 3ZWNA 2VHZA 2CF5A 3RROA 1VJ0A 1J6UA 2QZ9A 1VLLA 1BXGA 5A02A 3D5QA 1SOVA 4YJFA 1PL7A 3DO5A 2C29D 4MKRA 3VPFA 4DLAA 3AM4A 3TZKA 3PQDA 4DIOA 2D2IA 1ZUD1 2NVBA 4WK6A 1F06A 3ZWOA 2NU6A 1F8FA 1GQ2A 1LLCA 4ONEA 4KUEA 2O48X 2XF8A 3R3SA 5CDYA 3NJ4A 1BG6A 3ZWWA 2F1KA 3BMCA 4TKLA 1Q0LA 2Q1UA 4PRLA 4NJMA 4B4OA 4PLFA 1HYGA 4Q39A 4QXMA 5L7TA 4LISA 4N7RA 4P4GA 3P19A 4XCVA 1HYHA 1U7TA 3KRTA 2GRAA 1MUUA 1HTBA 3IAHA 7MDHA 4GBJA 1AN9A 4B79A 3ON5A 4DXHA 5GZ1A 3GZNB 1MFZA 2VT2A 1DIGA 4RQTA 4CMIA 2O7QA 5FYDA 3P5SA 1WNTA 1GV0A 1QMGA 2X1HA 3BTSA 4CR8A 1PIWA 1LDYA 4RLSA 3ONFA 4J9VA 5JC8A 2QQ5A 2X5KO 3TSCA 2PZJA 3G17A 3PK0A 3S2IA 1NHWA 2R2GA 3MJTA 2DTXA 3K9QO 3IKTA 1LSUA 1MP0A 4IZHA 1BGVA 4U0KA 3KYBA 4PVDA 5BNFA 1LDGA 4BMSA 1TLTA 3RFXA 1N1EA 2B83A 3LF1A 5L9AA 3ONEA 3AUSA 5A3JA 2BD0A 5HBRA 1I3KA 5KIAA 4NG5A 1PR9A 1V0JA 4J4TA 4ZQBA 4W4TA 1DLIA 2YY7A 2WYVA 1Q0HA 4D43A 4WNCA 2YUTA 1WZIA 2E6UX 4RCVA 1EE9A 1DC3A 4J1TA 4M1QA 5ITWA 5JSFA 3UVEA 4YAIA 2Q3EA 4XWYA 2YHIB 4MP3A 3WYCA 5ER9A 2VWGA 4YQZA 4N54A 4BO3A 1X1TA 4CM5A 2G5CA 4BMVA 3MJEA 1HDYA 1KC3A 3C1AA 4XQCA 3WB9A 3QVOA 5C3MA 3RUIA 1DC4A 3S8MA 5DBIA 1ZO8A 1NBOA 4KTTE 1T4DA 3OMLA 5G2OA 2PTGA 2EHDA 4J4BA 4KP7A 4CUJA 1HDZA 4Z0PA 1YQDA 1B16A 3GRPA 3PZRA 3KYCA 1M67A 3TFOA 3ANMA 3GGPA 3QVXA 4UVDA 1PGJA 5T8KA 1E5LA 1HZZA 5FFFA 3WG9A 4BQRA 1QKIA 3ROKA 3SJ7A 2HJSA 2PA3A 3HJAA 1A27A 4MVJF 4D79A 1MB4A 1C0LA 3ASUA 3OIFA 4TVBA 3S2EA 5C7IO 2NUAA 4B4WA 3RUFA 4R9RA 4AJIA 4XRRA 1UP6A 3LU1A 3PFFA 4LGVA 4B8ZA 4BUCA 3H3FA 3FWNA 3HWRA 4KQWA 3DWFA 1NM5A 2DTEA 4S3MA 4CM6A 1K2WA 3DMYA 3K92A 1XR3A 1ZFNA 3UCXA 3PIIA 4CQMD 4D42A 2O4UX 3AI3A 3PZBA 3PWZA 2VNSA 3RC9A 2FMUA 1Q2XA 3LT4A 3W4KA 5L95A 1GCOA 4FW8A 3JQBA 3DBHB 5A06A 2EG9A 3K30A 2Y0EA 4URFA 3C24A 1YB1A 5G0TA 1GYRA 3CPSA 3KSUA 2GCGA 1OI7A 3E03A 4IIUA 1HZJA 1VC2A 5EQFA 3WIEA 2H9IA 4J7XA 3ZWPA 2C0CA 4NBRA 4BO8A 1YQGA 4BS9A 1JN0A 4NI5A 3ZN2A 4LSWA 1JVSA 4MKZA 3ZV6A 1MGOA 1U2DA 2PV7A 4W7HA 1Z7BA 1ZK2A 2IE0A 3ABIA 1J5PA 4L4RA 4BO9A 4E5NA 4H15A 4DPLA 3PI7A 2OFPA 1OC2A 5CEJA 4BHTA 2V6GA 3GNTA 4R16A 1HE5A 2ZYAA 2D59A 4GSKA 4ROSA 1XIVA 5ILGA 3MJCA 1I30A 4BMNA 1M2WA 1G1AA 3QA9A 4FJ2A 2CMDA 3DOJA 3O9ZA 1HT0A 1UXKA 2Y0CA 1KC1A 2Q4EA 3DTYA 1LA2A 1NYTA 4L75A 4Q3NA 5TIIA 2UVDA 1CETA 4YJGB 3CE6A 1D7OA 4BO4A 1K6XA 3MEQA 2AMFA 2FR1A 4XR9A 4EYEA 4F46A 1E3WB 5T6BA 3ZHXA 1LDNA 3RSHA 2IZ1A 3GF4A 3RASA 1UR5A 2B69A 3PPIA 4YACA 2GN6A 3RBXA 4PLZA 3QY9A 5ES3A 5T67A 4F3YA 1R4NB 5ICMA 3GEGA 1DBVO 1HDXA 1U5CA 1SB9A 2FWMX 3EAGA 1VKOA 2RIRA 4I08A 4M89A 4YR9A 2YYYA 3JQFC 3KV3O 3VDRA 4ZQGA 2FOIA 1G6KA 4Z0TA 2PGDA 4YJHA 2BELA 4G81A 3OJFA 3Q9NA 4IIVA 5THQA 3RKRA 5DNAA 1KERA 3I1JA 3ITDA 4OYRA 3WGYA 1NHGA 4AJ1A 4DIFA 4WLOA 4HV4A 4CLEA 1HE3A 1O8CA 3IKVA 4U0JA 2NVWA 3KTDA 4HKTA 3P2OA 4WEQA 3VH3A 2CFCA 3W4JA 4FSHA 1HSOA 2PKQP 3GVCA 1GEGA 4CLRB 2VYVD 4QSMA 5T5QA 3JQ6A 2G82A 3HQ4O 4YQYA 3D0OA 3KO8A 1C0PA 4RLHA 2OP1A 3JYNA 4M8SA 1C0KA 5IDXA 3W6ZA 1XKQA 3AM5A 1XCBA 4J7UA 4FCCA 2HDHA 5IN5A 1HF3A 3L9XA 4CR7A 3GY0A 2HKIA 1IULA 3DHEA 3DC2A 4KMSA 1O89A 3LDHA 3S2FA 3T7CA 3AOGA 3K5PA 1YWGO 4PIVA 3WYBA 1GL3A 4NJOA 3PRJA 3JV7A 2VHWA 3RQSA 4BGIA 4R5HA 2Y66A 2AEJA 4KZPA 1HSZA 2FRDA 3WICA 3JD0A 5COAA 1JWBB 1UDAA 4PG4A 3FD8A 3FTNA 3AW9A 4W99A 1V9LA 3C7CB 4JJGA 4MPDA 1B15A 3E5MA 4JNKA 1GFSA 4FIZA 5B4UA 3PTZA 3DBVO 1B3RA 1ONNA 3QRWA 1ULSA 3ZU3A 1W4ZA 3TRIA 3ZWYA 3Q1LA 3VKVA 3M1AA 1ENYA 4XEHA 1QYDA 1KVQA 1PJTA 3E18A 1NTOA 2XXBA 4FDAA 4FFOA 5JXWA 3R3JA 4FB5A 3QJ5A 1Z74A 4D41A 3AUUA 3F6YA 5KVCA 4OM8A 1P1FA 1L7DA 2GERA 4WEOA 5HS6A 1XU9A 1ZJYA 2X0NA 1KOLA 3EK2A 4YAKA 4LCJA 1ENZA 3M2PA 4AJLA 4NHEA 3OIGA 4WLNA 4XA8A 2NM0A 3UH1A 5ENVA 2B36A 4O6VA 2EKPA 2UYYA 1T4BA 2WYWA 5AQ1A 1Z6ZA 4BL5A 4BNXA 2HK9A 1V6AA 2ZB4A 2B5WA 2Q45A 1PS8A 1SZJG 4GLOA 2HO5A 1YBVA 4XYGA 4CMJA 4EJMA 1BMDA 2PR2A 2G76A 5IN4A 1GEEA 3AU8A 3VC7A 4PLYA 4WCFA 1R0SA 4UUPA 1U3TA 2CZCA 3ZWBA 3WSWA 3VTFA 3ZNQA 3WGHA 1KETA 4HWKA 4MINA 2NU8A 3ZWVA 1W8DA 2YQ5A 5KJ1A 5G0SA 1ZK1A 4ALLA 3D4PA 1UUFA 3UCFA 4EITA 4YJDA 1NAIA 1YDEA 4C7JA 4M54A 1FMCA 3OJEA 1F17A 3ROQA 4R1NA 3WTBA 3U4HA 3MJ4A 1N9GA 4LRTB 2ZIZA 2PD6A 3LLSA 3B1KA 1LDEA 3MOGA 4AJNA 1HRDA 2NADA 4PLCA 5JY6A 1ISHA 5C37A 1PS9A 1U2GA 1LEHA 5A5EA 1WMAA 2ZTMA 1DIBA 3WBFA 3L6EA 4DTIA 4GKBA 1A72A 3K2BA 1HEUA 3A14A 4PGFA 4I5DA 3MZ0A 1UZNA 3VPSA 3ZWCA 4BIIA 4OQZA 4U8GA 2OUIA 1LUAA 4MP6A 4XYMA 5T8KC 5KJCA 1D1SA 1P3DA 2BMAA 3JQAB 1YO6A 1ZCJA 3TNLA 4OIMA 3GC6A 1WDMA 4CM8A 1TT5B 2J3IA 5DCWA 3DXFA 3DZFA 3K96A 1DSSG 1ZZEA 3BTOA 4DA9A 4CM1A 1KEVA 4R1SA 2QIOA 2VCYA 1SCUA 3TOXA 4U6QA 3VTZA 4AVYA 5C5IA 2O3UA 2P9CA 3KM0A 4BO5A 3NUGA 5JO9A 2JCXA 2I6TA 3HB4X 4MVJM 5MGBA 1HKUA 4P8RA 3VZSA 2Q49A 4JXKA 1LC0A 2R6JA 4GX0A 2X0RA 4BNTA 4R1TA 5L40A 1N92A 4NBWA 4RVUA 1NVMB 3A06A 2OO5A 4E5PA 4MIOA 5BT9A 2OP0A 4B7UA 2WDZA 3NYWA 4UREA 1C14A 2JCYA 1UXGA 3NRCA 3GPDG 1EEHA 5KCZA 2AW5A 3GVIA 3LC1O 1PTJA 1X13A 1T2EA 2EGHA 2JFHA 4PCVA 5TNXA 4J7CA 1NFQA 1SOWA 3OA0A 4Q3AA 4BQPA 1DB3A 1AHIA 3NAQA 2ZCVA 2FPGA 2GPTA 1ISMA 1N1GA 1NNUA 1NWHA 2GD1O 1ZEMA 2VWPA 3PEFA 5KKCA 4A2CA 2D8AA 1KEWA 1KVUA 1ZSYA 2PFGA 1WDKA 4R5MA 5TX7A 3GMSA 2X5OA 4Z3DA 2Y0DA 4O63O 5KVQA 5ICSA 3E8XA 1GYPA 2ZB8A 3HN7A 3NT5A 2Q46A 4KDEA 3DBHA 3I9LA 1SB8A 5TQVA 3KOUA 3HDJA 3JQ9A 3IQDB 4MVJD 2Q2WA 1T2CA 3K2EA 2OBNA 4M86A 1O0SA 2P91A 1DIHA 1YJQA 2CY0A 1V8BA 1M6WA 2PZLA 3BMNA 1P1JA 1E7YA 1PQUA 2A94A 1AXGA 2Y1FA 5I9NA 4PZCA 4Z9YA 1NWCA 4NBVA 2QX7A 2EEZA 1C0IA 1ZBQA 2NQTA 3BTVA 4YYZA 4J49A 3GHYA 1I32A
chains in the Genus database with same CATH superfamily
1GKLA 3UA3A 1FP7A 5EHQA 1D0VA 3I05A 2YJNA 5FF9A 4CJXA 4DYHA 1PJBA 3HM2A 2F59A 1K2VN 2QG6A 1Z18A 4LWQA 1PDWA 5AD1A 2ZTHA 4MTCA 1M8JA 3OEYA 4QPCA 3FKSA 1LS1A 2B9VA 4J76A 2GD2A 4XD7D 1K98A 1FDUA 3WNZA 1E9FA 4MAFA 1VRCA 4HWTA 1TYEB 3DZHA 1GFIA 1KDTA 2NV6A 5AXDA 4YC7A 3AFOA 2BTEA 1H6DA 3CPJB 1IG3A 3FSRA 4EIWA 1PBNA 1NBEA 4O1MA 1GVHA 1QFXA 3PUHA 1AU9A 1CTQA 3C7DB 3E6AA 3IERA 4UVEA 1SXJE 4OX9B 3D7LA 4OFZA 5CHEA 4DYVA 3PPWA 1TO6A 2QOEA 4QYWA 4BJ3A 1KJ8A 3K94A 3GB9A 2FZ5A 3C3AA 5AOVA 1M1YA 1XZFA 2FKAA 2HA7A 1E2DA 1OY1A 2OV3A 3CS3A 3JATA 3MIIA 3AB8A 5J9FA 3WADA 5I4IA 3SWWA 2CL7X 2QM0A 4Q1EA 3UPDA 3A31A 2QWXA 4NBLA 4ON9A 3A6PC 5KWIA 3ZTYA 5D3MA 5ICEA 3AQ4A 1U4OA 5AI4A 5ALXA 3RIYA 2P9YA 2QJFA 5JPIA 4XUEA 4CW7A 3FWYA 1E3DA 4JCCA 5IKXA 4G2TA 5BSTA 3BD6A 3LT0A 5CA0A 4YUZA 1O6FA 2C95A 3DCYA 4ZYWA 4KLNA 3KVNA 2NXNA 4D9FA 1ZRSA 2PBZA 4CEIA 2WSSA 3FLBA 4A8JB 2FCRA 2ZRCA 1GFWA 1PJSA 2Q2NA 5C5EA 3MJRA 4ETNA 1QHEA 3BH7A 1ZH4A 5EQDA 1XTVA 4YK7A 3VDNB 1YT5A 1F5SA 4KWTA 1JJBA 3EEYA 3G68A 4X84A 2VQEB 1WHTB 3AOEC 4YLYA 1LFDB 5HKLA 3R5HA 3I0ZA 2R97A 3MD0A 3EF3A 1O77A 2A14A 2R8EA 5EIBD 3BXXA 2JAWA 2ET6A 5A6VA 1NXPA 1T3ZA 4RO0A 4Z9FA 2DFPA 4CKEB 1XZCA 3U7HB 1DGQA 3BXOA 1BE6A 3G0CA 3FY4A 1OWNA 3SQDA 1G3UA 2QRVB 3H5NA 3Q0IA 2QENA 5CT4A 1Y3HA 2X3YA 2KE5A 5F73A 5JD5A 4J7AA 5AVSA 3IVCA 4NYJR 4B3CA 2BFOA 2BL4A 2C20A 2RB5A 3AZPA 5HCIA 2IPLA 1U0EA 1N6OA 3ZXUB 5I8PA 1YONA 2B7BA 3NJRA 4GMDA 4Q3BA 2EYUA 2P62A 5KYWA 5HMMA 2YHUA 1Z0ZA 3H5RA 1Z4PX 4NL4H 4EMTA 3UXEA 3SQMA 2GN8A 4KFRA 1BW9B 1TRKA 4EZEA 1F7VA 3I4CA 2WPDA 1DKOA 3SEFA 5B1EA 4YJGA 5K20A 1Q1NA 1DXQA 1KO7A 2C0PA 3BEOA 2GMWA 4OJYA 4Q93A 5HZMA 4Q1FA 4INZA 1PZNA 4JMPA 2A78A 4MUKA 3B3FA 4RSMA 1L5YA 2ZLBA 3T9FA 5E1MA 2EKBA 1L8LA 1Q6YA 2B37A 2HT6A 3RI3A 3O8QA 3VH2A 3OO1A 1AUXA 1HYEA 2OKGA 3AYXB 5FJJA 2OAGA 5F33A 1RD4A 3T7EA 2R6DA 1RPNA 2Z2ZA 3EOBI 1KWGA 3BH6A 4JJAA 1JVNA 4I81A 4KQCA 3IB3A 4XQGA 3JX9A 3I3OA 4K9QA 2R0QC 1ECGA 5CD1A 4HH4A 2AR0A 4RWZA 4RVCA 3VU9B 3KVYA 1VIMA 4RKFA 5ALVA 2HREA 3EVAA 4EQ6A 1PT5A 2B8WA 4KPUB 3ILSA 5C1BA 1MV5A 3BKWA 4I14A 1L8QA 2HCTA 1H8HA 3O8QB 4UASA 5HA5A 1F12A 1E2QA 2PYZA 2M6RA 4GICA 3QXSA 1VHLA 4M4SA 4B3IA 5CDSA 5KPDA 1FUKA 1MB0A 2CKMA 4W5WA 4ZOEA 4EZBA 3KTOA 4GOXA 1GTZA 2YXPX 3WP0A 1KDOA 1ZMBA 3OIUA 3ITKA 5COBA 1F8UA 5KSPA 4OUKX 3MUNA 3PENA 3QUCA 5D3ZA 5K8TA 5B12A 4ZVRA 1VGVA 3FPAA 3N8IA 2XR1A 1VMKA 2Q5JA 4C0BA 4C87A 3CSSA 4DADA 4H7DA 5IZ4A 3AVUA 1PK7A 2C7GA 4ZARA 1E5VA 4I55F 1IOWA 2HB6A 1N7IA 3I6MA 1UJCA 3LYLA 1YR9A 4V0QA 1MORA 1G21A 3OA2A 2XT6A 4JP2A 5AOAA 2GA9A 3MUEA 4YIHA 2VYNA 2JD1A 4LQDA 3S1AA 5DLYA 3LCCA 2IT1A 2ZJOA 1TO2E 1BA3A 4YAFA 4CKEA 5JCZA 4Y9DA 2FN8A 1ZJ6A 4WKBA 1O94D 1GDDA 2Y92A 4WNIA 1XALA 3JWPA 3V1LA 2PZGA 5LQJA 5KOYA 2G1PA 1U0NA 1QUFA 2EHJA 1L1FA 1CC1S 4MW5A 4RJ2A 2V96A 3Q0TA 1AGYA 4NU5A 3SZLA 1SC3A 1PDVA 3AR8A 1L4KA 4ZD6A 1C4KA 1QRAA 3TSOA 3THXA 3CF4A 4NPCA 4WI1A 3UHOA 4KR2A 2EW2A 3EGXB 3VPBA 4D0LB 4R6XA 4UKDA 4E70A 3IBFA 3ETNA 5KQGA 3F9IA 4DLNA 3LQFA 5B1YA 1HGXA 2D7CA 5KX5A 3TZLA 1JQKA 4ZVUA 3IT2A 5FIUA 1A5ZA 2R8YA 5KREA 3JAKB 4OXRA 2OXIA 2FPRA 1XNGA 1O5IA 3CXRA 2VAXA 5AVJA 3TXAA 3S81A 3EUEA 3W5DA 5KAMA 4CF7A 2H1SA 2JLWA 4TV9B 4J2TA 5CT9A 3QE9Y 2FZCA 5TV2A 3W2HA 3RYHB 2VO1A 5GMOA 2NVUB 1RHKA 3PYLA 4LRUA 2BSXA 5LYJA 4AKIA 4QJBA 4IJMA 4H0CA 3W7AA 2XRMA 3ZCQA 2IIVA 2LR0A 3ZCXA 2BIFA 4JUCA 4C2BA 5HKOA 5J2TB 1EQAA 3GXOA 1IONA 2Q5LA 4K6CA 4KMRA 3F6SA 3I5XA 4HXYA 1EFTA 4GZ6A 4ZT7A 1GZVA 4UM9D 1R50A 2IJGX 2I7VA 2BCJQ 2NYVA 3BMNB 1XXHA 1QCYA 3Q6NA 1JG7A 2DLDA 4MRAA 2AD5A 3NBZC 3KKEA 2GEJA 4Z7QB 1HRKA 3ZI0A 1E92A 2WTAA 4HQRA 2UYHA 3S68A 1S3GA 1VJDA 2BPOA 5HFAA 4B3XA 3N7UA 3QMVA 4DV6B 3ESBA 4NLLA 1Y7TA 1C30A 2A33A 5FUQA 2EG5A 1L7AA 2B99A 4KWIA 3KCQA 4W5OA 5IVDA 1CFJA 1Y7PA 3RVNA 1LQTA 1R0ZA 2EFDB 4IKOA 1DNPA 1Q21A 3M4NA 2WE7A 1KDZA 3H8VA 5A2QA 5DEOA 3QTTA 2D5IA 3H9UA 3TLYA 1KXZA 2F48A 3REGA 5EESA 1VMAA 2A1IA 3B38A 1W4AA 3B6JA 1Y1LA 3C98A 3NP7A 1PZEA 1RLJA 2JJQA 2H4WA 3BWXA 4XDGA 4E2YA 3IMGA 4BLSA 1H2WA 2VK1A 4WZBE 1H8EA 5EG5A 4F93B 5KTSA 2QBYA 3BZUA 3JVDA 1WP9A 4DR6B 1AGXA 1CUWA 3QF4A 4RD1A 5F9FA 4TRJA 3ABZA 3KSZO 3D4OA 4YMUA 5JH7A 4XLZA 3R23A 3IBGA 3STVA 3GZNA 4DDUA 4O3MA 1VIVA 2G80A 2IPXA 1NC1A 1YL5A 3GFPA 4PEVA 4YJ3B 2EJUA 1RS0A 3USES 1BQ4A 2CLLB 2DUJA 1SOUA 4JLPA 4AJ2A 3HJHA 1JIQA 2B2CA 5B1SA 3VHXB 2XUFA 2YCBA 3DQZA 4L57A 1I0IA 3VNQA 1OOEA 1NW3A 3E4CA 3FF4A 3QVSA 4PICA 5BQ5A 1YZKA 3R5JA 1TQ4A 2JVKA 4Q3DA 1MG0A 4JLKA 4RADA 3VAAA 3EUFA 1S4MA 3K35A 2Q0SA 1C29B 2RAUA 3DYVA 1WXFA 3U17A 5B37A 5BUZA 1XP5A 3TIFA 4Q01A 2JK1A 1HR0B 3KQPA 4XQEA 1GD1O 5B1IA 3UMGA 4EI8A 2ZS7A 4JASB 5FHQA 4BMDA 1TO1E 4GBMA 3VR1A 3OPQA 2C5HA 2A5DA 3PIDA 3I2KA 3B20A 3PQCA 3WWYA 3FOCA 3R24A 3UUGA 4P3YA 2YC4C 4E2ZA 2V7QD 3SBDA 3D7SA 4HYTA 2OOSA 4Q4JA 4TQAA 5JBQA 1KYVA 2Q7XA 3MBIA 4JBYA 2JJ1D 2YN4A 4OPMA 1MG5A 1E64A 4HTFB 2PT6A 1M66A 1PFQA 1XC7A 4PQRA 5LR6A 1EPUA 4D9BA 2VHXA 1XCGB 4J2OA 4EEZA 3A6GA 2JKYA 1PD0A 3L1IA 2WKSA 2CUKA 2O2XA 4G65A 3RSSA 1VJTA 2YR0A 3ZS8A 3PWTA 3ESDA 4QO7A 5B4VA 9GPBA 4DT1A 3DFIA 4K2HA 4NATA 4RK7A 4L6IA 1QU2A 3PYMA 1UH5A 1NUTA 4J6FA 4MWBA 5CJPA 2HSWA 3DE0X 1OGYA 4HZUB 1ZXLA 3R7AA 2I62A 1AIPA 1QZ3A 2W2NA 4KQ2A 2FPPA 1S3IA 3HSSA 1UADA 1P4RA 3B8EA 3HBJA 3K8YA 1IE3A 3KTFA 5JWHA 1GQQA 1F5NA 3PFHA 4ZT5A 1YCGA 2X77A 3IEXA 3DM9B 4CT5A 3GDGA 1PJQA 2A9KA 4F7DA 2BHTA 2ZKIA 3RT1A 1TM1E 1WA5A 1MJFA 4HG2A 1SK9A 4KUHA 4ZO7A 3D2LA 1XRLA 4H60A 1U11A 5TRTA 1FFGA 1K7YA 4OREX 3V34A 1MJGM 1OI2A 4NXNB 1TD1A 2FDRA 2O5RA 2TS1A 3CUVA 3D6AA 4H6VA 1ZGGA 4D0SA 1DG9A 1UBLS 2XEXA 3K73O 1PFGA 3K0FB 2AQIA 5K3OA 3ZZTA 1B7GO 2IUEA 3ZOKA 2CUZA 5KPJA 4NU6A 2CV0A 1G20E 1RLUA 1CP3A 1R12A 1WF3A 2QX6A 3BGIA 3L0IB 1L4MA 4ZOLB 5LCXA 3GYGA 5JCPA 3K0CA 1KJQA 4OJNA 2O1EA 2QV0A 3VR4D 4D3DA 2P6PA 1D0SA 1I33A 1U8UA 1XMXA 4ZAZA 4IDEA 5CVCA 5DN9A 3AP3A 1YZLA 5JSYA 4ZT2A 4MVXA 2AYXA 4E6PA 4PXAA 1NDHA 3NEYA 4FR0A 1CRZA 2IV2X 2EJCA 1JSRA 3WLPA 3KFVA 4AG5A 1TVKB 3BF8A 4JB8A 1SC1A 2X4GA 4F4UA 3IVXA 4DQDA 2V7PA 1HA3A 2FG7C 3I9OA 4ZU6X 4D56A 4WFIA 1CZRA 1FLAA 2XVZA 1DDOA 3TCXB 5FLKA 4BO2A 3VGPA 5EXTA 4LHWA 2A7XA 2JHFA 3EZFA 4RULA 3WLIA 3DV9A 4WOCA 2FN3A 4WT7A 2NLOA 3WKDA 4PYKA 4HGNA 2EFHB 3N2IA 1LW7A 2J09A 3TQTA 2NUBA 1DJQA 4FFVA 5FLXA 1HZZC 1G9SA 1ZA1A 1X7HA 4RVSA 3WLRA 4BFSA 3CVYA 2RHMA 4AKSA 2N47A 8OHMA 4CKBA 4OM7A 1GCGA 3U1VA 2IBTA 3EZXA 3RS0A 4O02B 3S40A 3X1MA 4Q9DA 2R48A 4RKYA 3NC0C 3W8RA 2W0SA 1Z9BA 1N0IA 3T95A 1FTGA 1X8XA 4LW8A 2ZKLA 1G4AE 4NP6A 2VN8A 2PDAA 1TJNA 2MSWA 4KGZA 4ARVA 4E13A 4ZMSA 3TDKA 2DPMA 2IYSA 1YVDA 3D7RA 4J0JA 1JLMA 1F0KA 4ZEOA 3ADPA 2Z1NA 2P4UA 1A9PA 2VPYA 3FAKA 3DF9A 5FP0A 2X9VA 5ERGB 4X6YA 1L2TA 3KZXA 1RM4A 3KUDA 3WLJA 5IXSA 4FPXA 5EJ6A 3BXGA 2GYUA 1QFMA 5CB4A 2J45A 3A28A 3G1TA 1W19A 3EODA 3OLWA 3QPDA 2C61A 4YRAA 4AKGA 2AQHA 2H2GA 3GXBA 4TQUS 4WSOA 4KHPB 2UV8A 4UEWA 1SJ9A 3V4SA 1E1YA 1IHDA 3H65A 3KSRA 4XYBA 3MWYW 4EUHA 3VXKA 4URVR 2RI1A 2HMUA 4XWGA 2KMLA 5FR2A 2V6FA 3DEYX 3DDOA 4ENVA 4BB5A 2WHYA 5GV8A 4IDCA 4AS3A 1SXJD 3HEBA 3HJUA 2W90A 1T4CA 1L3IA 1PHRA 2LDBA 4GVLA 4JI1B 4YP0A 2Q21A 2C31A 1COWD 3FPEA 4LF5B 3CEMA 5K0LA 4I1OA 4JUAA 3CZMA 2BDUA 3ESRA 4ZU3A 1GRQA 4OTZA 4FCTA 4UU8A 1QAMA 1EGQA 3K0FA 3SFVA 5BYKA 3CW2A 1UJ2A 3HKDA 4IFIA 2CB0A 2DH5A 4MQEA 1JYFA 4JP5A 2C9CA 5CHYA 5EFZA 3UHFA 1KR2A 4QQFA 3WQHA 1WPQA 2R7MA 2HN9A 2XB8A 4FSDA 3H2KA 1D03A 2D1SA 1SCDA 4IO1A 4LWOA 4OKNA 1E99A 4OI1A 3WJAA 4YYEA 4RTLA 1HQKA 2J48A 1UKVY 1AGRA 3CE9A 3MS7A 2ES4A 5ECWA 1DE0A 3DPIA 1PT6A 4RDHA 3V3TA 4L8GA 3CONA 4ZQFA 3DOIA 1E3WA 4JT8A 4Y8VA 4LBWA 2GCNA 3BILA 4EFMA 5BUSA 1IQUA 2OG1A 1NMSA 2ZBDA 4DYDA 3QPUA 1YAJA 2YUIA 3NTOA 1U2QA 1T0IA 2CXXA 1U0HC 2ZGVA 2N46A 3NWBA 3V8PA 2Z9DA 3VVLA 1YZUA 3QEBZ 3X43A 3WLHA 4AB1A 1XFAA 1E77A 4XQ0A 1XQXA 3HFJA 4O08A 1O4VA 1PT9A 3RFVA 2DR0A 2HF7A 2FUKA 4DG9A 2Q4BA 4FZVA 1CV2A 4YJHB 5SZIA 3SC2A 1R8XA 4EDFA 4Z1OA 5C8YF 3R3ZA 2R1UA 3V97A 3U60B 3IVRA 3KHTA 5IMBA 5LB2A 2PKYX 2WM2A 3RSCA 1CUFA 1D4AA 5KMGB 5I9IA 3QXHA 2OWDA 4Y6PA 5A05A 2WKWA 3PTLA 2GCOB 4Q1BA 4L27A 4EO7A 7ABPA 2ZIFA 2O6LA 1Q0RA 2Y27A 1E0AA 1T3TA 2CVZA 3HKCB 1BAPA 4QPNA 5H70A 1HT1E 4KXNA 1EE2A 1OYOA 5F3WB 2HHCA 3TZCA 2P79A 4UUNA 3HYCA 3KALA 3VSBA 3VR4A 1UAGA 4TOIA 1N5DA 1DDIA 3O21A 4YGYA 5KC9A 2I03A 2ZOSA 3JQAA 4NABA 1M6HA 1TW2A 1I1NA 1YZFA 3E9YA 1CY8A 1SKYE 5CPFA 1M7GA 5ARBA 5LC1A 1DC5A 2X8AA 2Y9MB 3UK7A 3PD1A 1NQXA 3HC7A 4BGVA 2QMEA 1UP4A 1Z2PX 1YZVA 3LRPA 2AEEA 2JH9A 1QGAA 2MYUA 3HUTA 2WMNB 4LTDA 3CO5A 1X6VA 1EM8B 3OJXA 2GA8A 4WV3A 1ULTA 2ONJA 4XM0A 1WMBA 1PSZA 4PFKA 4G8BA 3DP7A 1RYMA 4NRDA 3SSMA 3KT0A 4E3ZA 3W5BA 2WTBA 3LRXA 4DHEA 3KZOA 1Y6JA 3LZDA 4RD4A 1AE1A 1HL7A 2TYSB 1KK1A 4PPQA 2WZBA 2W22A 2ZI4A 4P7GA 2CUTA 2DHEA 4A5OA 3GA0A 4LZWA 1PEKE 3B3AA 3CW9A 3EOZA 1D4FA 1DAIA 2ABWA 3QMWA 4GWGA 4WNAB 3S70A 3VO1A 4TTVA 1ZM7A 2AMVA 3UGJA 2O7SA 4QYIB 3NS7A 4BAZA 1D0IA 4IWXA 4QU0A 3UKJA 4C4AA 1MF7A 3NM5A 2W9XA 3FYTA 2RKWA 3UT6A 1IIBA 2ZG6A 1PJ4A 4OP1A 4WCFB 2CV2A 1QRSA 1RQLA 3IUSA 3Q7RA 2O8CB 3KR9A 5DT9A 3TBKA 3AI7A 4R54A 3MFYA 1P6UA 2WAXA 3NWEA 4M36A 5KNDD 4BFTA 2ZYIA 3F46A 1DARA 2EKQA 4XJXA 5D84A 2H1FA 3C3JA 3I42A 4HQFA 1XTJA 4RZHA 4ZQHA 5BN4A 5K0TA 4L7VA 4QICA 3ZDXB 4AJHA 3CYFA 1H9BA 2CSUA 3QVJA 2XOXA 5AW8A 3NTVA 3KQYA 3LKVA 5CDFE 2ATCA 3STHA 4KPFC 4RA9B 2P2GA 4AW9A 1DCTA 3I72A 1IWPB 2YIDA 4UUMA 5DP2A 3PC8C 4K1LA 5EXSA 2XB6A 4Q48A 5F78A 3WV4A 4BEBA 2HF9A 4KQXA 2O7NA 3MWFA 3HXTA 5J2UA 3NX4A 1IQRA 1XEWY 3BMQB 4EFLA 3HB0A 4NEQA 1II8B 2ZBRA 4Z1MA 4EFKA 3KB2A 3NIBA 4TMZA 4JJIA 1FW6A 1JR3E 1R9JA 3RYHA 3F3YA 2XGOA 3G2OA 3N2ZB 1KF0A 3DEHA 3F97A 1Z07A 4OAQA 4XGIA 3STUA 2PUGA 3DKIA 4YCAA 1TYDE 1VECA 2F00A 3ORRA 3QKTA 2B82A 3AUXA 1HG0A 1I3OA 4TXJA 1ZVKA 3GI1A 4NV3A 4XFKA 4WCVA 3RRBA 5BR1A 3GJXC 2QJOA 1X7XA 1JVBA 1RXCA 2NTVA 4TRMA 5AI6A 1H8ED 4IRMA 2YXLA 1SZDA 1R18A 3EIOA 4LX8A 3V4PB 2FHSA 4X71A 4YT4A 3WQBA 1Q16A 3PR1A 3T41A 1USVA 3AUFA 4FDUA 1M1XB 2JFVA 3I83A 3H13A 5K1ZA 1GTJ1 4Q9NA 1FTQA 1V48A 3T4EA 3S55A 3THXB 1G8GA 1YJXA 3E7WA 4BTVA 5TARA 1B8NA 2C4TA 4PY2A 3IQWA 3AB7A 1R5BA 4CHGA 1H9AA 1B93A 2IODA 3UY4A 2A7QA 2K2QB 4KEAA 2O2CA 2QZSA 4L50A 1N6LA 2ZBUA 3LQRA 2XGSA 5AVZA 2H5JA 5EC8A 1Q11A 2FF5A 5IP5A 1RHRA 4Y0NA 3N8KA 3QEKA 5IBPA 3GEMA 3PHBE 4AF7A 2BHNA 2HRZA 2FPWA 4L78A 4MW0A 4IJKA 1GA4A 3I1YA 2ZIGA 3EISA 2D3TA 2LDXA 3RS9A 3KKZA 5BO5A 3VPXA 2O14A 3P94A 1HNWB 2WWWA 5HMLA 4Y6RA 4A0RA 2IH2A 3FBWA 4BB0A 5KWEA 3RS2A 1JAZA 2YRXA 3C0KA 1QDEA 1H0SA 4IXDA 4I5IA 3FVQA 3UMRA 2AK3A 4YAJA 3KUUA 1Q1QA 1E4EA 1TUGA 5JNTA 4LI0A 2XDQA 1TA0A 2Y1CA 5TPZA 3PXEA 4V0NA 4FFWA 1VL8A 3ELDA 3MCUA 4P54A 2X40A 1OLOA 4A6DA 2IP4A 4RY2A 4IMIB 5K01A 4KDCA 1DRJA 3RKUA 4HP8A 2GZ3A 1RQRA 3B9BA 3ITNA 5EAIA 4EGFA 4YRNA 2VXCA 1UMBB 4IIBA 3DBLB 3D6JA 3MINB 3P9CA 5G40A 3H1TA 6Q21A 4KPUA 3GJ3A 4ED9A 1K8YB 3ENKA 3TMKA 2NO5A 2C77A 4C7OA 3FBGA 2D54A 3R7BA 2VJQA 2QYSA 4JCOA 4EKNB 3SFZA 4G5QA 1W4BA 2XKJE 5CR9A 1LD3A 4FX5A 1LLDA 5EJFA 2O2IA 4AZ0A 2PQMA 2ECPA 3STXA 2BFWA 2ZRQA 5HJ2A 3RIHA 5C53B 2I4TA 5DDIP 4DCUA 3QXJA 4DV2B 2AXQA 3GHHA 5JALA 1LTKA 3QKRA 2DKFA 2XYPA 1QKJA 1JB9A 1GTG1 1SHLA 2QM8A 3C7TA 1A5BB 3DUFA 5SZJA 3VVCA 1VE6A 2JAHA 1E59A 1R0RE 3QLVA 4JNCA 4F7WA 3VR5A 3MRSA 4ZMRA 2W0MA 2FLVA 2BCEA 3BRCA 5LXTF 5JDIC 1W2WB 3GLGB 3ADCA 3L7NA 2XE4A 4LWPA 1X80B 1CEQA 1B26A 4ENTA 2P65A 4DMHA 1UBMS 1ACMA 1NAHA 1EG7A 1NQTA 3TZ6A 3U4IA 1B2RA 3U7GA 1UPTA 4IV5A 4UU7A 4BRUA 5EP4A 2GN1A 3OO0A 2JBAA 1EGAA 1ODKA 1A7AA 1A7JA 1B4DA 2WJPA 1FNSA 4IXTA 4HPWA 5IHXA 2WKRA 4CM3A 5BRNA 3LYAA 3AEQB 4D9KA 3FCEA 1GPH1 5FORA 3UH0A 2PSDA 3GD7A 5GJBA 3QIVA 1UDWA 1VDMA 2UDPA 4TUYF 5G4KB 1BHSA 1E5DA 3AKCA 4MHOA 4G1MB 1BHQ1 1WTAA 5IARA 1SH7A 3MS2A 3SF0A 3VOTA 1ZEJA 2NUPA 3GT4A 3HKEB 5JANA 3WXMA 4YXFA 3EGVA 2CXQA 4F60A 2ZT5A 3IFSA 1EWTA 5K6AA 1M2FA 1V3TA 2C7VA 1WRBA 1ULAA 3H9QA 1IHXA 1AMOA 3GYBA 4ZCQA 1AOXA 3DEIA 2Z4SA 3QWAA 4WXHA 4N18A 1LJLA 2CCKA 2I29A 4LN1A 1OLSA 4X6LA 5I9LA 3WYDA 1NIPA 1Z2AA 2FW0A 5JAZA 1RWVA 5HQ3B 1LF5A 2GBCA 1UMKA 2H7XA 3LNTA 4X1OA 5IZCC 4I55A 4Y6GB 3TXXA 5ICGA 1TC2A 1ZCZA 4JV5B 1C0EA 1PR0A 2FWBA 3EWNA 3GLHA 1Y63A 4PYIA 3WL3A 5J5CA 1GAEO 5CH8A 2CN1A 4ZK6A 3PJGA 2VEDA 1R0CA 4ZYLA 3OECA 3C3CA 1R1DA 5AM1A 3ZD8A 6LDHA 5IKPA 1A9RA 1CHDA 5K05A 5TLSA 1CHNA 4RTPA 5B7GA 3I28A 4J3FA 4BWVA 4MR7B 1TUIA 4QREA 1WCWA 2WQ6A 4UNIA 1NVEA 4I2VA 3B3QA 4G9GA 4QX6A 5DN6D 1KAMA 1C7JA 1Y9EA 4XSHA 2OXTA 2GBIA 1XA4A 3QEOA 2G5GX 5HCNA 2E3JA 5A3SA 4QULA 1A7KA 2VLIA 1NJ5A 4G86A 4JODA 4AMVA 2ONZA 4MW2A 3KJNA 2RGWA 3BL6A 1ARZA 4KQIA 5IX8A 4LRSB 3IUEA 3A36A 2DB3A 3B82A 1CLUA 2C9ZA 3NJ8A 4NK5A 4NENB 5KTNA 1P81A 1ECCA 1P2DA 4L22A 1LLFA 3QLVC 1P7YA 4H1TA 4XH9B 1BEUB 2Q1WA 2IX9A 3R41A 4WIAA 2RKBA 2F64A 3DMTC 5T41A 2AN3A 1NVUQ 4BPRA 2ONKA 4HYYA 3IEMA 2WFLA 5CT8A 5JFOA 3EDMA 5K09A 4D8YA 1G6OA 3FNFA 3G2JA 2FE1A 3TVTA 1JKMA 2DG2A 1RE0A 2R68A 1JKJA 3AY7A 5JPDA 4CMKA 3VR4H 5BVGA 3V4FA 1CQIA 1KAGA 2PH5A 3O0DA 2FQYA 1GUZA 2G63A 3CZ4A 3H2GA 2P30A 2Z8YM 5D2CA 1CYDA 5UKDA 4RABA 1KEPA 4N5DA 1RAEA 4KNWA 2QNBA 2W37A 5DBGA 2X5JO 3U80A 5B6PA 1M8PA 521PA 1XEAA 3HR4A 1LC3A 2UXCB 2JFXA 4DEVA 4E5DA 4A2QA 3BFPA 4C03A 2JF0A 1QTQA 4G4JA 3OZVA 5JAMA 4Z8YA 4GKAA 1CLEA 4PLTA 2IYPA 3GLVA 3FR8A 2EW1A 3ZXYA 2IYQA 2B1QA 4XOUA 3WIBA 1AJEA 1DAFA 3PR3A 4YI3A 1W85A 2DM6A 3A7DA 5CTJA 4ZO6A 2GX6A 5I9TA 3TW8A 3UFXA 3DFZA 4YUYA 3R44A 1JKIA 3DUWA 3DXZA 2PK3A 3UOWA 2AJCA 5LQMA 3F6PA 3I53A 4LNAA 5JAQA 1XNRB 1R9MA 5A0FA 4NSNA 5DGIA 5AW7A 3TLKA 4D5GA 3A58B 4O1IA 2BGJA 1S2IA 2P2ZA 2QVLA 4MGYR 4P4LA 2OECA 4IMJB 1E1CB 1OZAA 4OIFA 4YRFA 3ZCRA 3EXEA 4UZEA 1OV4A 3QITA 3WGOA 4DG8A 1OJLA 5JSUA 2GBPA 3PC3A 221PA 1FY2A 3Q5DA 5E7JA 1JHQA 2LNDA 1RI5A 4UHFA 3NHYA 1Q91A 2GHRA 1F0NA 1P73A 2V3VA 3Q72A 5DBEX 3ZX4A 2OXCA 3LBHA 4N39A 3PEWA 3ONVA 1ZMRA 4ECEA 1TYCA 4PNHA 2FMFA 4CM9A 5JCOC 1Z25A 1IZ7A 4LY6A 3U4GA 2MYTA 4OH7A 1LTHR 2PZMA 1GL7A 3GZTB 4RDIA 3UYLA 5GIPE 4YPOA 5IWAB 1Z83A 1X92A 3VC2A 2ZK7A 4DJDC 5TEVA 1CQJA 4MWTA 3LHSA 4ITUA 4D5EA 4ZVSA 1L9XA 1G18A 1W87A 4PPGA 3RR2A 1MJGA 4LRWA 1RI4A 3SOZA 3BE6A 4UBKA 3EXFA 5CDTA 3H1AA 1V1RB 4KNYA 1Y5MA 4N9QA 3P4YA 4ZRMA 2HJVA 3LC0A 2BZ0A 2H07A 3P4XA 3OZXA 4M99A 3HVJA 2JH3A 4KMOA 5KHAA 1Q6ZA 4OHUA 3T0FA 3P2KA 3WGTA 1T3SA 3HGQA 4V0LA 4EO9A 1LX7A 4R8MA 1JUDA 2RCYA 1NPDA 4ISCA 3EJ6A 4N9WA 1VYVA 3AKEA 4MVJH 2XUAA 5B64A 5FWYA 1I3NA 2I91A 2H8GA 4C4XA 1UBHS 3N2KA 1HLGA 1TX4B 1PG2A 3DQPA 4DV7B 1SXJA 2WINI 3RTAA 4CMEA 4YMHA 1JHMA 4H9GA 1OTXA 1ZXBA 4DGQA 5ALOA 1B6SA 3TR6A 1FCJA 3IOCA 2ZRDA 2NAPA 2JFYA 2XRFA 2AD1A 2OGTA 2FOLA 1Y7IA 2CYCA 4HAUA 1PFYA 1UQUA 1BKYA 3DT9A 1A2BA 3Q3GE 4MCHA 4EF5A 1OF1A 3QVUA 4TSKA 5EYPA 2JVJA 5CIQA 3VX3A 1QVVA 4JBLA 3OH8A 1LPAB 5JOQA 3TECE 1FQKA 5AXAA 1VSUA 1AS0A 1R8JA 5KX5F 2ID7A 2AR7A 3HNOA 2VJNA 5LN1A 1MMFB 4OYYA 3NIGB 1G3RA 3OICA 4G5GA 4RMJA 4ERXA 5JD6A 5LMCA 2O0JA 1Q15A 4XDYA 3CSUA 1FP1D 3NHFA 1QIFA 1T5TA 4GR9A 1NP6A 4D8TA 2DAPA 1ZGCA 5CFLA 4Y2XA 3PGKA 4HQKA 1SA0A 1WR8A 4EYOA 2GR9A 1DFIA 3KAJA 4AO7A 2JIDA 4Z99A 4HL6A 5AI5A 5EVCA 2QRHA 4CEHB 1IIRA 1J2UA 2Z95A 5HIMA 5IS2A 2O8DB 5TPWA 3FETA 2GAJA 2ZUVA 4IOLA 2FLKA 4V1CA 2X22A 4QNMA 2IW1A 3K1AB 3ROMA 3NIWA 4OXXA 5AH0A 2CC2A 3KVOA 2P9ZA 3MM4A 3N59A 2DWPA 3AFIA 3QSGA 5EMMA 3BRQA 1QH9A 1W88B 2VATA 5B2EA 1DAPA 1YDHA 4CMGA 1J7JA 1S01A 1OBFO 1Y8RA 4CL8A 4C78A 5JWOA 1OH5A 3C6MA 1M76A 3MAGA 1PS0A 2JGAA 4WQMA 1K8ZB 1O3YA 2PZKA 4RVDA 4V0SA 2JJ1A 2HLPA 4O1HA 3O4JA 1GPMA 3KHSA 2AHRA 5JAIA 1UXIA 3IE1A 1J0BA 4IQFA 3WDSA 1GZ6A 2YDYA 3OFND 2NPIA 1BVYF 2NYUA 2H6EA 2EYQA 3FUVA 2VHCA 5DLPA 2PX3A 3WLNA 4HB0A 2R84A 2C58A 2H2DA 3D6HA 1ZM9A 3K72B 5DNVA 2O2EA 1NUAA 3RRNA 3MJVA 3ASYA 2ZJFA 1Y6ZA 2J5QA 3FPLA 2CNLA 3T5BA 3AU9A 3E7FA 5K7SA 5E8RA 2E4ZA 3PWKA 4C7MA 2X4LA 3BOSA 2FZEA 1EVEA 3SU8A 3OKFA 3VRHA 3QEAZ 4P86A 1GSIA 3G0IA 5KJ6A 3F5DA 2Q3FA 3EYAA 1FXWF 2X8WA 2OYSA 1PT8A 3L4BA 4MROA 1MJ5A 4UAJA 4ARCA 4DHWA 2CD7A 4J1NA 2OO3A 1G7SA 5AI8A 1FZTA 5BV8A 3TZQA 2B3TA 3KYIB 3RW9A 1W93A 4F3NA 1N36B 3R6LA 2Q3HA 1N5OX 3W2TA 3JTEA 3T5AA 1TM7E 2HXGA 3I1IA 4DQXA 2YH2A 4F4JA 4MR7A 1ZRHA 4JLAA 1T2VA 3DYIA 2WMDA 3H2YA 4G4IA 4MWOA 1YCDA 4NARA 3RJTA 1DDGA 3CB2A 5DWQA 3HB5X 3QVLA 1FFAA 5TPZD 2BGUA 1GPYA 3AJ8A 3TX2A 1FTSA 2AUNA 2SKCA 1EUZA 2ZQYA 3L4JA 3AOEA 3SLRA 1AKWA 1XWIA 1CZUA 2CVFA 5AJXA 5LYYA 1U3UA 5DEIA 1N7GA 3U6KA 3VJLA 1DKRA 2PJDA 2SCUA 2AB0A 3A3PA 4DDMA 4DRYA 2XITA 3H99A 4UQLA 5LQNA 2VF7A 1OXUA 2XD4A 1GNQA 3D4NA 3FTCA 4HB4A 4DJFC 3AX6A 5E1DA 5CLLA 1YRLA 1NBIA 1OYVA 4MVJP 4U6NA 1SVUA 4XKJA 5H3CA 3IRVA 3TZHA 2V1XA 2YN0A 3K1JA 4IY1A 5CNJA 5B7NA 1GZ3A 3ENNA 2ODWA 5E1OA 2NU9A 3PPVA 2A0UA 3AGQA 1ZRNA 4A0QA 4RJTA 3HV2A 2W71A 3DR3A 3G0HA 4H7EA 1H6AA 3G8BA 3BMOA 1AXRA 2GRUA 3GEDA 2R8XA 1MPXA 4FZJA 5JS2A 2CXHA 1UK7A 1Q12A 2DY1A 1GRRA 1IH8A 2GB4A 3HV0A 3INYA 4EYGA 5K0JA 4JOSA 3R6WA 4ZYTA 1MAUA 2IHZA 1XMSA 1KYQA 1FRFS 2FN4A 4L6AA 1GO2A 2DECA 2PLWA 4A0GA 4B6OA 4TZKA 4I6EA 4LJ4A 1V2GA 2WU4A 2CGEA 4FVTA 1GADO 2QZPA 2UZAA 3B5JA 3L6UA 3IHWA 5ISMA 3JWJA 5KVSA 2YWRA 3WBKA 1M5UA 2IUYA 3JAMA 1M5RA 3G7SA 1KDYA 2Y4NA 4OHWA 1QJ4A 1V1MA 5AW1A 3QTLA 1B42A 5JECA 2BFPA 3ZXSA 5HKKA 3HO1A 5GZ6A 3CH4B 3LH5A 3MCVA 4EBFA 4DSTA 5IM4A 4J90A 1UCFA 4U3JB 4Y0VA 1M7HA 3IOBA 1IK4A 5IM5A 1RI1A 2UAGA 1FP4A 4AROA 4ND8A 4OXYA 3SIXA 3W6PA 4G0VA 1HDOA 4V0OA 2ZDGA 4F72A 1RPAA 1PEDA 2C59A 1PWEA 2HH9A 3ENZA 3W78A 4PAQA 3ROXA 3ZHUA 4QOJA 3ZHQA 1EK6A 2AUMA 1YZQA 3L82B 5ALQA 3VVMA 3MCTA 3EQ2A 2J0VA 3R7WA 4CQLA 3FUTA 4DMGA 5KHOC 1CQPA 4G8JA 1JKXA 3I9JA 5KTPA 2QRQA 4CIDA 1YNOA 3KQNA 3RSZA 2OL4A 3B2EA 5HW0A 3HBLA 2QL6A 3NGLA 1SNYA 5REQB 4FFMA 3S27A 4RTKA 2H7YA 2XUIA 3I09A 2AQKA 2CDAA 4HEJA 5E7IA 4Z6KA 1RJFA 3D7NA 3C43A 1YJ5A 2QM3A 5EIOA 4BX9A 1GU0A 2GVDC 4B44A 5I7RA 2CB9A 2KBFA 1MT0A 5DFAA 1XP8A 5CLJA 5HTOA 1SCJA 2KS6A 3TBFA 3V8MA 1IBLB 1GAXA 2HEGA 3NH9A 2R7NA 4J43A 4EY6A 1L9KA 3QWBA 4IIJA 1NKVA 4GBGA 3OM0A 4N12A 2I6UA 2QRZA 4R3WA 4LJ5A 2VYVA 3G23A 1SQ6A 4FBLA 1FX0B 4UBNA 5TQ0A 1NVXQ 2P2NA 1I36A 4HYQA 1R0LA 4RZIA 4UFPA 3I30X 3ZQKA 1QK4A 3WKAA 4GQBA 1NRWA 3F3MA 1QLJA 1DRUA 3R4CA 3TUZC 4OGWA 4DS3A 5CYOA 4F21A 3PRHA 3TLJA 4FXOA 3BE8A 4HT3B 1AZTA 5C46F 4LNHA 3JD3A 2VOEA 2FR8A 3MFQA 1KU0A 1NMYA 2GUGA 2RGAA 3HYNA 4IGFA 2DC1A 4QOSA 3EA4A 3F5MA 5JQWA 3LQ1A 3AFHA 4LCEA 2V5AA 2WUGA 4RJKA 2C78A 3OQVA 4R41A 1RAHA 1NN3A 3PHJA 5IUJC 3WGMA 2JS7A 3FMVA 4I1SA 4LHSA 4Z0NA 5JXGA 4P0PB 5AW5A 2VHYA 5L3RA 2PKQO 1IXZA 2VS1A 2ZQ5A 3QLUC 6REQA 2BRUA 1DG3A 4FE4A 4KJZA 2BFNA 2ZB7A 4FHCA 2PX2A 1MOPA 3UTDA 3NFYA 2ZR7A 2NO4A 2OZPA 2PLAA 5E3IA 3BRWD 1A3CA 2ILVA 3KJFA 1A50B 3NT4A 3L49A 1UBEA 4RPJA 3USZA 1DADA 3QNWA 4BATA 2AYZA 2JCSA 1JHPA 3TLZA 3C39A 1K5DA 4P7FA 5D01A 1II9A 3A0RB 1QIHA 3GEHA 2YZMA 3W3AD 2IY9A 1QORA 4B84A 1PV2A 4AS1A 4HUTA 3O03A 3QLJA 3BHMA 1M1UA 4ARBA 3RQIA 4B3MB 3ZWMA 1N2GA 5K0NA 3BZWA 4CCSA 4EJSB 5JC1A 4BZXA 1RIIA 1TVMA 2IOFK 4X97A 3VR2A 3MK31 5B3LA 4NEHB 3PI6A 3HUEA 4HFNA 1KBOA 1X15A 2Q2VA 4Y9UA 5G53C 1Y8QB 2IHBA 3AV3A 4NBTA 1CWUA 2BDEA 4P33A 2HC9A 2J8ZA 4WK0B 1GUYA 1Z6QA 1R15A 3IDZA 1NQOA 2CEKA 2YW2A 2J3MA 5IBCA 1P1KA 1GPNA 3NXKA 3O3NB 4J0FA 4UMVA 2PGXA 5JYBA 3AR7A 3KEGA 2QTGA 3QM1A 5TQ0B 1CDZA 2DU8A 2XUHA 1RRPA 1BJTA 3BCSA 2O1SA 2OK7A 5EXDA 3U7EB 5D1NA 1GQOA 1ONOA 1EVIA 1IUKA 1NQVA 4B4UA 2GDZA 2OFWA 5FI3A 1SQSA 3M3PA 1SBHA 5JFGA 4MVJE 1FXWA 3C74A