2ZBWA

Crystal structure of thioredoxin reductase-like protein from thermus thermophilus hb8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
333
structure length
333
Chain Sequence
ADHTDVLIVGAGPTGLFAGFYVGMRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVTTSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAEFQGKRVLIVGGGDSAVDWALNLLDTARRITLIHRRPQFRAHEASVKELMKAHEEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYITKLGPLANWGLALEKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Crystal structure of thioredoxin reductase-like protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 90
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2zbwA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2zbwA02
3AE5A 2GB0A 4ECHA 1PJ6A 3BI2A 3GSIA 3GMCA 5GRTA 3GYIA 1B37A 1TRBA 3UTHA 2E4GA 2Y6QA 4CNKA 2BACA 1PDHA 3K30A 4RG4A 1LV0A 3KLJA 3H4KA 3Q6JA 4YWOA 3COXA 4K8DA 3EPTA 5EBKA 1O95A 2Q7VA 4N9XA 1NHRA 3BNUA 1TDNA 2BYBA 4TLZA 2IVDA 4A5LA 1COYA 3ADAB 1IUVA 1TDOA 4B64A 3G5QA 2XFNA 3Q9TA 3SFDA 4OPUA 1PBEA 3IHMA 3VRBA 4A6NB 4CBQA 1Z6LA 3DH9A 4J33A 4DSGA 2A8XA 3EF6A 4DGKA 1DOCA 4UP3A 3AEFA 3FBSA 1N4UA 3RNMA 4NTDA 1H7WA 1GNDA 4H4UA 1GOSA 3V3OA 1YQ4A 5IQ1A 2OLNA 5FS8A 1JRZA 1O94A 3LXDA 4CY6A 4GDPA 1RP0A 1YY5A 2B9WA 5KXJA 1Y56A 2O9ZA 3NTAA 1IUWA 5FS7A 5HYMA 1IUSA 1XANA 2Z5XA 3CPJG 4YTMA 2I0ZA 2YM2A 3NTDA 3K7QX 4U2LA 1F8WA 1F8SA 1RSGA 2WP5A 4HB9A 3CTYA 3CGEA 4J57A 3FIMB 2WOWA 4ADWA 1GESA 3CNSA 5FS9A 1EL7A 2YVGA 1S2QA 4Z25A 4YT0A 4YTNA 1ZX9A 2XFPA 3NHOX 4LIIA 1YQZA 4J31A 1L9DA 2EQ8A 1ELIA 2V3AA 2XLSA 3UOZA 2JB1A 3F8PA 1Q1WA 5IQ4A 2WHDA 3V3NA 4O5UA 5JCIA 2XLRA 1FL2A 3NYCA 2Z5YA 1S3BA 2XLUA 3OC4A 1Y56B 2WBAA 3NT6A 1W4XA 1ZOVA 2OLOA 3FG2P 1TYTA 2WEUA 4GUVA 2BCGG 4UDRA 1L9CA 1QLBA 4BK2A 4U8MA 1M6IA 2BABA 4OPGA 2GR1A 5FS6A 3S61A 3RP6A 4OPIA 3RHAA 1P2HA 2BK4A 4H4SA 5DBJA 5U1OA 2FBWA 2BXSA 1GPEA 1RYIA 2E1MA 1S3EA 2DKHA 3UKKA 1NHPA 4RSLA 3UOYA 3CNJA 1CF3A 1E1NA 1BZLA 3OZ2A 2X8CA 3ALJA 5TR3A 1LVLA 1OJ9A 1EL9A 4K5RA 4KPRA 4Y4LA 2BS2A 2C3DA 1ZDLA 3P9UA 2BA9A 1GRTA 3QFBA 1BWCA 2WPEA 3ICRA 2XLTA 3R9UA 2GAHB 1BKWA 2PYXA 2WS3A 2XVFA 1CHUA 3D1CA 4X9MA 4AOSA 2BK5A 4Y4MA 4A65A 3AE2A 2GV8A 4B68A 3ALMA 4U2SA 2C64A 2QA2A 4GF7A 5HHFA 4H4QA 3LJPA 1ONFA 4NEWA 3DJEA 1KDGA 5EB4A 1JNZA 3NK2X 3AEAA 4DSHA 2WDVA 4JDRA 4BK1A 3QJ4A 4AT0A 3DJJA 4JNQA 4C77A 2B76A 2C3CA 2B9XA 1JEHA 2B9YA 4LA1A 1N1PA 1FOHA 4REKA 2FJAA 1PXCA 1YKJA 3M0OA 1BGNA 3ICSA 2GMHA 2YQUA 3AE8A 5EB5A 4Z44A 1AOGA 2V60A 1F3PA 1JRXA 2BXRA 2GR0A 1GTEA 2H88A 2YVJA 2UZZA 3AYIA 3UTEA 1JU2A 3CGCA 5LV9A 1VG0A 2AAQA 2YG6A 2C67A 2C72A 3DMEA 3NLCA 4TM1A 1GERA 1NHSA 2CDUA 3AE1A 4Z26A 1BF3A 3LADA 2YLXA 4AP3A 2APGA 2YWLA 3CGBA 4X9NA 4XWRA 2XVEA 2ZZ0A 4EIPA 5KVHA 3ABVA 3CNPA 1TYPA 4C74A 2R45A 3P4RA 3KVEA 2CVJA 3QSSA 4EMIA 1GEUA 3ICTA 1PBBA 2C66A 3SGLA 1K0IA 5FMHA 3G5RA 3M13A 2XVIA 2HQMA 1OJTA 2DKIA 4JQ9A 2C76A 2C7GA 3DJGX 3LZXA 3H8LA 3NYEA 2Q6UA 2VZ2A 4NZHA 1NG3A 3C4NA 4OVIA 2EQ9A 2XVHA 5JCKA 1GALA 3C96A 2QA1A 4J34A 5KWFA 3P4QA 4YSZA 4B66A 1DXLA 3CGDA 4B69A 1BGJA 3DK4A 3RP7A 1E6EA 1VDCA 3GDNA 3P1WA 2WDQA 1JNRA 3GD3A 4FX9A 4B1BA 4IA6A 3PVCA 1ZK7A 4GRTA 1M64A 1X31B 2EQ7A 3UKAA 1NAAA 1CC2A 1KNPA 5CQFA 4B67A 3NN0X 2V3BA 1DOBA 1GETA 3NH3X 3B3RA 1OJCA 3GD4A 4ZN0A 4WCTA 4BJYA 3UKFA 4YKFA 1GSNA 3T37A 4BJZA 1ZKQA 2XCGA 5JCLA 5KOXA 2XDOA 2R4JA 3AEEA 4A7AA 2X50A 2C75A 2IVEA 3UKHA 1N4WA 1D7YA 5ER0A 3UCLA 3B6DA 1MO9A 3V76A 2AQJA 4UDQA 1H81A 2XLPA 2CFYA 1K4QA 1KSUA 4J2WA 1GRFA 3AE7A 1H6VA 3UKQA 1CC6A 3H8IA 3CIRA 3AE9A 1HYUA 1CL0A 1PXAA 4USQA 4CRTA 4EQRA 1NG4A 5HY5A 1EBDA 4BK3A 3BI4A 2VVLG 4YTPA 3EAOA 4PAAA 2Q0KA 4Z43A 1NHQA 3I3LA 1EL5A 2ZZBA 3UKPA 2C65A 2OALA 2OAMA 2GAGB 2BK3A 4CCRA 3AYLA 2B7RA 1K0JA 2OA1A 4K7ZA 3E1TA 1PS9A 1H86A 1S2YA 4H4TA 1PJ7A 4K2XA 4H2NA 1TDFA 2YLTA 3FMWA 3KU9A 2GMJA 4EM4A 3LZWA 1E1LA 4HA6A 3UTGA 2H89A 4ZCCA 1H7XA 1FECA 4TLXA 1GXFA 4TM0A 3BHKA 2X3NA 1YQ3A 2Y6RA 5KVIA 5BUKA 1FCDA 4H4RA 3GDPA 2ACZA 3I6DA 1XPQA 2XFQA 3GRSA 1L0VA 3VQRA 1LJ1A 2X8HA 2BS4A 2V6OA 2YG7A 2YLSA 4U8OA 4OPCA 1TDEA 2YVFA 4U2TA 1ZY8A 3NIXA 4P9SA 1E1MA 4CNJA 3GWDA 3DK9A 4XXGA 4UDPA 1F6MA 3HZLA 3PS9A 1KFYA 1XDIA 1NPXA 2CULA 2GR2A 2R46A 4H50A 3AB1A 2R0CA 3KPFA 5BVAA 2W0HA 3BNMA 4H4ZA 5CKUA 2VOUA 3VR8A 4CCQA 2WU5A 5BRTA 4IA5A 1N4VA 3QVPA 2V5ZA 4H2QA 4H4PA 5EOWA 1ZOYA 2YG3A 2WQYA 3UTFA 1NEKA 3CNTA 2ZZCA 1LQTA 1PJ5A 3VRAA 3UOXA 3KD9A 3QSEA 2B7SA 3AEBA 4USRA 3AXBA 3LOVA 4U8NA 4EIQA 2WOIA 1GRHA 3NYFA 4B65A 2RABA 1CJ4A 2YLWA 3AD8B 4H4XA 2VQBA 1CJ3A 4BURA 3ZYXA 4EM3A 3KA7A 3GYJA 3NN6X 5HXIA 1Q1RA 2FJEA 2GQFA 2QCUA 2VVMA 4Z24A 3NG7X 4IVMB 3ZDNA 4JY3A 4I58A 5M0ZA 4NTEA 3AEGA 4JY2A 1KSSA 1PN0A 3REDA 1O5WA 2C70A 4OPDA 4U8KA 1H83A 3P4SA 2X99A 2JBVA 3CPIG 3K7MX 1P2EA 1VRQB 3AYJA 4A6NA 1E1KA 2JB3A 3GMBA 3P4PA 3O0HA 2TPRA 1KF6A 3K7TA 4RG3A 3NRNA 2GRTA 2PHHA 3AWIA 4YSYA 2YM1A 4YXDA 3DGZA 1IUXA 3ISHA 3GWFA 4A99A 2YAUA 1D4CA 2WOVA 3DGHA 2GQWA 3WE0A 4C3YA 3KKJA 3LB8A 3UKLA 4OPTA 4OPLA 4XWZA 2JAEA 4AT2A 3PO7A 3UP4A 4NTCA 2A89A 1GRGA 2GEWA 4YSHA 1OJAA 1D7LA 2WESA 2WETA 1REOA 1LPFA 2YG5A 3AE4A 5JCNA 1D4EA 2WP9A 1Y0PA 2ZBWA 3D8XA 4D04A 2FJDA 4JNAA 1DOEA 2ARDA 5U63A 2NPXA 2JK6A 4WX1A 2YR5A 2WU2A 4Z2UA 2XVJA 4KX6A 2BC1A 3DK8A 1V59A 1CJ2A 1PXBA 5U25A 2BC0A 4EQSA 3URHA 1CBOA 1VG9A 2YR6A 4YSXA 1KNRA 1K0LA 2E5VA 3UP5A 3IHGA 1VQWA 3NK0X 2XFOA 1DODA 2AR8A 5J60A 3QSMA 3CPHG 1DNCA 1GREA 4EQXA 4B63A 1GT8A 1B8SA 2BCPA 4H4YA 1DJNA 2GVCA 2GH5A 3C4AA 5JCMA 3EANA 2QAEA 4A79A 2V61A 1L9EA 1H84A 3NGCX 4EMWA 4NEVA 3IC9A 1H82A 4H7UA 4ZCDA 4H2RA 3AE3A 3VR9A 1IUTA 1B5QA 1MXTA 2C73A 2JKCA 2WDRA 3DJDA 2RGJA 5KRQA 3ATQA 1GTHA 1CC4A 2RGHA 2VVLA 3CNDA 3NK1X 2FJBA 2R9ZA 4EMJA 4TM4A 2VRLA 1D4DA 1DJQA 4H4WA 4LU6A 3F8RA 2Q0LA 4AP1A 1B4VA 2WPCA 3DA1A 3SFEA 2R0PA 4GCMA 2X8GA 1D5TA 3BI5A 4CY8A 3FPZA 3NNEA 4H2PA 4X4JA 3AD9B 2BS3A 2EQ6A 4U8IA 1NENA 1IJHA 2XFUA 2TMDA 3CN8A 4Z2RA 1QJDA 5BULA 2YG4A 4IV9A 1NDAA 4DNAA 2GR3A 1F8RA 1OJDA 4GDEA 4JN9A 1EL8A 4Y4NA 5J7XA 5M10A 1JOAA 4U8LA 2R4EA 4A9WA 1SEZA 1IUUA 1TDKA 3JSKA 4K22A 4ICYA 4O5QA 3SM8A 4AOXA 3IWAA 1LQUA 3SQPA 2RGOA 3II4A 5C3JA 4FK1A 4FDCB 3F8DA 4IVOB 3ATRA 2YR4A 3G5SA 1PHHA 3M12A 4MJWA 4PABA 4BV6A 1E7PA 3AECA 1Q9IA 1PBFA 3L8KA 3VRDB 1UKVG 4C3XA 4M52A 5KOWA 3ALLA 1PBDA 4EQWA 1FEAA 1CJCA 4J56A 4E0VA 4APNA 2A87A 4K5SA 2WP6A 2JB2A 3RP8A 5IPYA 4U8JA 4YKGA 4FK1C 5GSNA 2WPFA 3AE6A 2R0GA 1PBCA 2GF3A 1GV4A 2VRMA 3AD7B 3BHFA 3ITJA 3NKSA 5C2TA 1ZMCA 4H4VA 2NVKX 1GRBA 1E39A 1XHCA 2F5ZA 3GRTA 4GR1A 4TM3A 3S5WA 1GRAA 1FEBA 3IF9A 1LTXR 4C5OA 1QO8A 2VQ7A 2YLZA 2IIDA 3L1RA 4I59A 2XYOA 4D03A 4U8PA 1JRYA 3AEDA 3QFAA 3UOVA 1ZP0A 1MOKA 2YLRA 4J36A 2J3NA 4Z2TA 5L46A 1ZMDA 3QVRA 4OCGA
chains in the Genus database with same CATH superfamily
3AE5A 4G9KA 2GB0A 4ECHA 1PJ6A 3BI2A 3GSIA 3GMCA 5GRTA 3GYIA 1B37A 1TRBA 3UTHA 2E4GA 2Y6QA 4CNKA 2BACA 1PDHA 3K30A 4RG4A 1LV0A 3KLJA 3H4KA 3Q6JA 4YWOA 3COXA 4K8DA 3EPTA 5EBKA 1O95A 2Q7VA 4N9XA 1NHRA 3BNUA 1TDNA 2BYBA 4TLZA 2IVDA 4A5LA 1COYA 3ADAB 1IUVA 1TDOA 4B64A 2BRYA 3G5QA 2XFNA 3Q9TA 3SFDA 4OPUA 1PBEA 3IHMA 3VRBA 4A6NB 4CBQA 1Z6LA 3DH9A 4J33A 4DSGA 2A8XA 3EF6A 4DGKA 1DOCA 4UP3A 3AEFA 3FBSA 1N4UA 3RNMA 4NTDA 1H7WA 1GNDA 4H4UA 1GOSA 3V3OA 1YQ4A 5IQ1A 4GAPA 2OLNA 5FS8A 1JRZA 1O94A 3LXDA 4CY6A 4GDPA 1RP0A 1YY5A 2B9WA 5KXJA 1Y56A 2O9ZA 5KMPA 3NTAA 1IUWA 5FS7A 5HYMA 1IUSA 1XANA 2Z5XA 3CPJG 4G74A 4YTMA 2I0ZA 2YM2A 3NTDA 3K7QX 4U2LA 1F8WA 1F8SA 1RSGA 2WP5A 4HB9A 3CTYA 3CGEA 4J57A 3FIMB 2WOWA 4ADWA 1GESA 4II2A 3CNSA 5FS9A 1EL7A 2YVGA 1S2QA 4Z25A 4YT0A 4YTNA 1ZX9A 2XFPA 3NHOX 4LIIA 1YQZA 4J31A 1L9DA 2EQ8A 1ELIA 2V3AA 2XLSA 3UOZA 2JB1A 3F8PA 1Q1WA 5IQ4A 2WHDA 3V3NA 4O5UA 5JCIA 2XLRA 1FL2A 3NYCA 2Z5YA 1S3BA 2XLUA 3OC4A 1Y56B 2WBAA 3NT6A 1W4XA 1ZOVA 2OLOA 3FG2P 1TYTA 2WEUA 3SX6A 4GUVA 2BCGG 4UDRA 1L9CA 1QLBA 4BK2A 4U8MA 1M6IA 2BABA 4OPGA 2GR1A 5FS6A 3S61A 3RP6A 4OPIA 3RHAA 1P2HA 2BK4A 4H4SA 5DBJA 5U1OA 2FBWA 2BXSA 1GPEA 1RYIA 2E1MA 1S3EA 2DKHA 3UKKA 1NHPA 4RSLA 3UOYA 3CNJA 1CF3A 1E1NA 1BZLA 3OZ2A 2X8CA 3ALJA 5TR3A 1LVLA 1OJ9A 1EL9A 4K5RA 4KPRA 4Y4LA 2BS2A 2C3DA 1ZDLA 3P9UA 2BA9A 1GRTA 3QFBA 1BWCA 2WPEA 3ICRA 2XLTA 3R9UA 2GAHB 1BKWA 2PYXA 2WS3A 2XVFA 1CHUA 3D1CA 4X9MA 4AOSA 2BK5A 4Y4MA 4A65A 3AE2A 2GV8A 4B68A 3ALMA 4U2SA 2C64A 4G6HA 2QA2A 3T2YA 4GF7A 5HHFA 4H4QA 3LJPA 1ONFA 4NEWA 3DJEA 1KDGA 5EB4A 1JNZA 3NK2X 3AEAA 4DSHA 2WDVA 4JDRA 4BK1A 3QJ4A 4AT0A 3DJJA 4JNQA 4C77A 2B76A 2C3CA 2B9XA 1JEHA 2B9YA 4LA1A 1N1PA 1FOHA 4REKA 2FJAA 1PXCA 1YKJA 3M0OA 1BGNA 3ICSA 2GMHA 2YQUA 3AE8A 3HYVA 5EB5A 4Z44A 1AOGA 2V60A 1F3PA 1JRXA 2BXRA 3T0KA 2GR0A 1GTEA 2H88A 2YVJA 2UZZA 3AYIA 3UTEA 1JU2A 3CGCA 5LV9A 1VG0A 2AAQA 2YG6A 2C67A 2C72A 3DMEA 3NLCA 4TM1A 1GERA 1NHSA 2CDUA 3AE1A 4Z26A 1BF3A 3LADA 2YLXA 4AP3A 2APGA 2YWLA 3HYWA 3CGBA 4X9NA 4XWRA 2XVEA 2ZZ0A 4EIPA 5KVHA 3ABVA 3CNPA 1TYPA 4C74A 2R45A 3P4RA 3KVEA 2CVJA 3QSSA 4EMIA 1GEUA 3ICTA 1PBBA 2C66A 3SGLA 1K0IA 5FMHA 3G5RA 3M13A 2XVIA 2HQMA 1OJTA 2DKIA 4JQ9A 2C76A 2C7GA 3DJGX 3LZXA 3H8LA 3NYEA 2Q6UA 2VZ2A 4NZHA 1NG3A 3C4NA 4OVIA 2EQ9A 2XVHA 5JCKA 1GALA 3C96A 2QA1A 4J34A 5KWFA 3P4QA 4YSZA 4B66A 1DXLA 3CGDA 4B69A 1BGJA 3DK4A 3RP7A 1E6EA 1VDCA 3GDNA 3P1WA 2WDQA 1JNRA 3GD3A 4FX9A 2C4CA 4B1BA 4IA6A 3PVCA 1ZK7A 4GRTA 1M64A 1X31B 2EQ7A 3UKAA 1NAAA 1CC2A 1KNPA 5CQFA 4B67A 3NN0X 2V3BA 1DOBA 1GETA 3NH3X 3B3RA 1OJCA 3GD4A 4ZN0A 3CMMA 4WCTA 4BJYA 3UKFA 4YKFA 1GSNA 3T37A 4BJZA 1ZKQA 2XCGA 5JCLA 5KOXA 2XDOA 2R4JA 3AEEA 4A7AA 2X50A 2C75A 2IVEA 3UKHA 1N4WA 1D7YA 5ER0A 3UCLA 3B6DA 1MO9A 3V76A 2AQJA 4UDQA 1H81A 5KNLA 2XLPA 2CFYA 3SXIA 1K4QA 1KSUA 4J2WA 1GRFA 3AE7A 1H6VA 3UKQA 1CC6A 3H8IA 3CIRA 3AE9A 1HYUA 1CL0A 1PXAA 4USQA 4CRTA 4EQRA 1NG4A 5HY5A 1EBDA 4BK3A 3BI4A 2VVLG 4YTPA 3EAOA 4PAAA 2Q0KA 4Z43A 1NHQA 3I3LA 1EL5A 2ZZBA 3UKPA 2C65A 2OALA 2OAMA 2GAGB 2BK3A 4CCRA 3AYLA 2B7RA 1K0JA 2OA1A 4K7ZA 3E1TA 1PS9A 1H86A 1S2YA 4H4TA 4II3A 1PJ7A 4K2XA 4H2NA 1TDFA 2YLTA 3FMWA 3KU9A 2GMJA 4EM4A 3LZWA 1E1LA 4HA6A 3UTGA 2H89A 4ZCCA 4G73A 1H7XA 1FECA 4TLXA 1GXFA 4TM0A 3BHKA 2X3NA 1YQ3A 2Y6RA 5KVIA 5BUKA 1FCDA 4H4RA 5KMRA 3GDPA 2ACZA 3I6DA 1XPQA 2XFQA 3GRSA 1L0VA 3VQRA 1LJ1A 2X8HA 2BS4A 2V6OA 2YG7A 2YLSA 4U8OA 4OPCA 1TDEA 2YVFA 4U2TA 1ZY8A 3SY4A 3NIXA 4P9SA 1E1MA 4CNJA 3GWDA 3DK9A 5KMQA 4XXGA 4UDPA 1F6MA 3HZLA 3PS9A 1KFYA 1XDIA 1NPXA 2CULA 2GR2A 2R46A 4H50A 3AB1A 2R0CA 3KPFA 5BVAA 2W0HA 3BNMA 4H4ZA 5CKUA 2VOUA 3VR8A 4CCQA 2WU5A 5BRTA 4IA5A 1N4VA 3QVPA 2V5ZA 4H2QA 4H4PA 5EOWA 1ZOYA 2YG3A 2WQYA 3UTFA 1NEKA 3CNTA 2ZZCA 1LQTA 1PJ5A 3VRAA 3UOXA 3KD9A 3HYXA 3QSEA 2B7SA 3AEBA 4USRA 3AXBA 3LOVA 4U8NA 4EIQA 2WOIA 1GRHA 3NYFA 4B65A 2RABA 1CJ4A 2YLWA 3AD8B 4H4XA 2VQBA 1CJ3A 4BURA 3ZYXA 3SZ0A 4EM3A 3KA7A 3GYJA 3NN6X 5HXIA 4G6GA 1Q1RA 2FJEA 2GQFA 2QCUA 2VVMA 4Z24A 3GYXA 3NG7X 4IVMB 3ZDNA 4JY3A 4I58A 5M0ZA 4NTEA 3AEGA 4JY2A 1KSSA 1PN0A 3REDA 1O5WA 2C70A 4OPDA 4U8KA 1H83A 3P4SA 2X99A 2JBVA 3CPIG 3K7MX 1P2EA 1VRQB 3AYJA 4A6NA 1E1KA 2JB3A 3GMBA 3P4PA 3O0HA 2TPRA 1KF6A 3K7TA 4RG3A 3NRNA 2GRTA 2PHHA 3AWIA 4YSYA 2YM1A 4YXDA 3DGZA 1IUXA 3ISHA 3GWFA 4A99A 2YAUA 1D4CA 2WOVA 3DGHA 2GQWA 3WE0A 4C3YA 3KKJA 3LB8A 3UKLA 4OPTA 4OPLA 4XWZA 2JAEA 4AT2A 3PO7A 3UP4A 4NTCA 2A89A 3T2KA 1GRGA 2GEWA 4YSHA 1OJAA 1D7LA 2WESA 2WETA 1REOA 1LPFA 2YG5A 3AE4A 3T2ZA 1D4EA 5JCNA 2WP9A 1Y0PA 3SZFA 2ZBWA 3D8XA 4D04A 2FJDA 4JNAA 1DOEA 2ARDA 5U63A 2NPXA 3T31A 2JK6A 4WX1A 2YR5A 2WU2A 4Z2UA 2XVJA 4KX6A 2BC1A 3DK8A 1V59A 1CJ2A 1PXBA 5U25A 2BC0A 4EQSA 3URHA 1CBOA 1VG9A 2YR6A 3T14A 4YSXA 1KNRA 1K0LA 2E5VA 3UP5A 3IHGA 1VQWA 3NK0X 2XFOA 1DODA 2AR8A 5J60A 3QSMA 3CPHG 1DNCA 1GREA 4EQXA 4B63A 1GT8A 1B8SA 2BCPA 4H4YA 1DJNA 2GVCA 2GH5A 3C4AA 5JCMA 3EANA 2QAEA 4A79A 2V61A 1L9EA 1H84A 3KPKA 3NGCX 4EMWA 4NEVA 3IC9A 1H82A 4H7UA 4ZCDA 4H2RA 3AE3A 3VR9A 1IUTA 1B5QA 1MXTA 2C73A 2JKCA 2WDRA 3DJDA 2RGJA 5KRQA 3ATQA 3SYIA 1GTHA 1CC4A 2RGHA 2VVLA 3CNDA 3NK1X 2FJBA 2R9ZA 4EMJA 4TM4A 2VRLA 1D4DA 1DJQA 4H4WA 4LU6A 3F8RA 2Q0LA 4GAVA 1B4VA 2WPCA 3DA1A 4AP1A 3SFEA 2R0PA 4GCMA 2X8GA 1D5TA 3BI5A 4CY8A 3FPZA 3NNEA 4H2PA 4X4JA 3AD9B 2BS3A 2EQ6A 4U8IA 1NENA 1IJHA 2XFUA 2TMDA 3SZCA 2BRAA 3CN8A 4Z2RA 1QJDA 5BULA 2YG4A 4IV9A 1NDAA 4DNAA 4NWZA 2GR3A 1F8RA 1OJDA 4GDEA 4JN9A 1EL8A 4Y4NA 5J7XA 5M10A 1JOAA 4U8LA 2R4EA 4A9WA 1SEZA 1IUUA 1TDKA 3JSKA 4K22A 4ICYA 4O5QA 3SM8A 4AOXA 3IWAA 1LQUA 3SQPA 2RGOA 3II4A 5C3JA 4FK1A 4FDCB 3F8DA 4IVOB 3ATRA 2YR4A 3G5SA 1PHHA 3M12A 4MJWA 4PABA 4BV6A 1E7PA 3AECA 1Q9IA 1PBFA 3L8KA 3VRDB 1UKVG 4C3XA 4M52A 5KOWA 3ALLA 1PBDA 4EQWA 1FEAA 1CJCA 4J56A 4E0VA 4APNA 2A87A 4K5SA 2WP6A 2JB2A 3RP8A 5IPYA 4U8JA 4YKGA 4FK1C 5GSNA 2WPFA 3AE6A 2R0GA 1PBCA 2GF3A 1GV4A 2VRMA 3AD7B 3BHFA 3ITJA 3NKSA 5C2TA 1ZMCA 4H4VA 2NVKX 1GRBA 1E39A 1XHCA 2F5ZA 3GRTA 4GR1A 4NNJA 4TM3A 3SZWA 3S5WA 5KMSA 1GRAA 1FEBA 3IF9A 1LTXR 4C5OA 1QO8A 2VQ7A 2YLZA 2IIDA 3L1RA 4I59A 2XYOA 4D03A 4U8PA 1JRYA 3AEDA 3QFAA 3UOVA 1ZP0A 1MOKA 2YLRA 4J36A 2J3NA 4Z2TA 5L46A 1ZMDA 3QVRA 4OCGA
chains in the Genus database with same CATH topology
3AE5A 4G9KA 2GB0A 4ECHA 1PJ6A 3BI2A 3GSIA 3GMCA 5GRTA 3GYIA 1B37A 1TRBA 3UTHA 2E4GA 2Y6QA 4CNKA 2BACA 1PDHA 3K30A 4RG4A 1LV0A 3KLJA 3H4KA 3Q6JA 4YWOA 3COXA 4K8DA 3EPTA 5EBKA 1O95A 2Q7VA 4N9XA 1NHRA 3BNUA 1TDNA 2BYBA 4TLZA 2IVDA 4A5LA 1COYA 3ADAB 1IUVA 1TDOA 4B64A 2BRYA 3G5QA 2XFNA 3Q9TA 3SFDA 4OPUA 1PBEA 3IHMA 3VRBA 4A6NB 4CBQA 1Z6LA 3DH9A 4J33A 4DSGA 2A8XA 3EF6A 4DGKA 1DOCA 4UP3A 3AEFA 3FBSA 1N4UA 3RNMA 4NTDA 1H7WA 1GNDA 4H4UA 1GOSA 3V3OA 1YQ4A 5IQ1A 4GAPA 2OLNA 5FS8A 1JRZA 1O94A 3LXDA 4CY6A 4GDPA 1RP0A 1YY5A 2B9WA 5KXJA 1Y56A 2O9ZA 5KMPA 3NTAA 1IUWA 5FS7A 5HYMA 1IUSA 1XANA 2Z5XA 3CPJG 4G74A 4YTMA 2I0ZA 2YM2A 3NTDA 3K7QX 4U2LA 1F8WA 1F8SA 1RSGA 2WP5A 4HB9A 3CTYA 3CGEA 4J57A 3FIMB 2WOWA 4ADWA 1GESA 4II2A 3CNSA 5FS9A 1EL7A 2YVGA 1S2QA 4Z25A 4YT0A 4YTNA 1ZX9A 2XFPA 3NHOX 4LIIA 1YQZA 4J31A 1L9DA 2EQ8A 1ELIA 2V3AA 2XLSA 3UOZA 2JB1A 3F8PA 1Q1WA 5IQ4A 2WHDA 3V3NA 4O5UA 5JCIA 2XLRA 1FL2A 3NYCA 2Z5YA 1S3BA 2XLUA 3OC4A 1Y56B 2WBAA 3NT6A 1W4XA 1ZOVA 2OLOA 3FG2P 1TYTA 2WEUA 3SX6A 4GUVA 2BCGG 4UDRA 1L9CA 1QLBA 4BK2A 4U8MA 1M6IA 2BABA 4OPGA 2GR1A 5FS6A 3S61A 3RP6A 4OPIA 3RHAA 1P2HA 2BK4A 4H4SA 5DBJA 5U1OA 2FBWA 2BXSA 1GPEA 1RYIA 2E1MA 1S3EA 2DKHA 3UKKA 1NHPA 4RSLA 3UOYA 3CNJA 1CF3A 1E1NA 1BZLA 3OZ2A 2X8CA 3ALJA 5TR3A 1LVLA 1OJ9A 1EL9A 4K5RA 4KPRA 4Y4LA 2BS2A 2C3DA 1ZDLA 3P9UA 2BA9A 1GRTA 3QFBA 1BWCA 2WPEA 3ICRA 2XLTA 3R9UA 2GAHB 1BKWA 2PYXA 2WS3A 2XVFA 1CHUA 3D1CA 4X9MA 4AOSA 2BK5A 4Y4MA 4A65A 3AE2A 2GV8A 4B68A 3ALMA 4U2SA 2C64A 4G6HA 2QA2A 3T2YA 4GF7A 5HHFA 4H4QA 3LJPA 1ONFA 4NEWA 3DJEA 1KDGA 5EB4A 1JNZA 3NK2X 3AEAA 4DSHA 2WDVA 4JDRA 4BK1A 3QJ4A 4AT0A 3DJJA 4JNQA 4C77A 2B76A 2C3CA 2B9XA 1JEHA 2B9YA 4LA1A 1N1PA 1FOHA 4REKA 2FJAA 1PXCA 1YKJA 3M0OA 1BGNA 3ICSA 2GMHA 2YQUA 3AE8A 3HYVA 5EB5A 4Z44A 1AOGA 2V60A 1F3PA 1JRXA 2BXRA 3T0KA 2GR0A 1GTEA 2H88A 2YVJA 2UZZA 3AYIA 3UTEA 1JU2A 3CGCA 5LV9A 1VG0A 2AAQA 2YG6A 2C67A 2C72A 3DMEA 3NLCA 4TM1A 1GERA 1NHSA 2CDUA 3AE1A 4Z26A 1BF3A 3LADA 2YLXA 4AP3A 2APGA 2YWLA 3HYWA 3CGBA 4X9NA 4XWRA 2XVEA 2ZZ0A 4EIPA 5KVHA 3ABVA 3CNPA 1TYPA 4C74A 2R45A 3P4RA 3KVEA 2CVJA 3QSSA 4EMIA 1GEUA 3ICTA 1PBBA 2C66A 3SGLA 1K0IA 5FMHA 3G5RA 3M13A 2XVIA 2HQMA 1OJTA 2DKIA 4JQ9A 2C76A 2C7GA 3DJGX 3LZXA 3H8LA 3NYEA 2Q6UA 2VZ2A 4NZHA 1NG3A 3C4NA 4OVIA 2EQ9A 2XVHA 5JCKA 1GALA 3C96A 2QA1A 4J34A 5KWFA 3P4QA 4YSZA 4B66A 1DXLA 3CGDA 4B69A 1BGJA 3DK4A 3RP7A 1E6EA 1VDCA 3GDNA 3P1WA 2WDQA 1JNRA 3GD3A 4FX9A 2C4CA 4B1BA 4IA6A 3PVCA 1ZK7A 4GRTA 1M64A 1X31B 2EQ7A 3UKAA 1NAAA 1CC2A 1KNPA 5CQFA 4B67A 3NN0X 2V3BA 1DOBA 1GETA 3NH3X 3B3RA 1OJCA 3GD4A 4ZN0A 3CMMA 4WCTA 4BJYA 3UKFA 4YKFA 1GSNA 3T37A 4BJZA 1ZKQA 2XCGA 5JCLA 5KOXA 2XDOA 2R4JA 3AEEA 4A7AA 2X50A 2C75A 2IVEA 3UKHA 1N4WA 1D7YA 5ER0A 3UCLA 3B6DA 1MO9A 3V76A 2AQJA 4UDQA 1H81A 5KNLA 2XLPA 2CFYA 3SXIA 1K4QA 1KSUA 4J2WA 1GRFA 3AE7A 1H6VA 3UKQA 1CC6A 3H8IA 3CIRA 3AE9A 1HYUA 1CL0A 1PXAA 4USQA 4CRTA 4EQRA 1NG4A 5HY5A 1EBDA 4BK3A 3BI4A 2VVLG 4YTPA 3EAOA 4PAAA 2Q0KA 4Z43A 1NHQA 3I3LA 1EL5A 2ZZBA 3UKPA 2C65A 2OALA 2OAMA 2GAGB 2BK3A 4CCRA 3AYLA 2B7RA 1K0JA 2OA1A 4K7ZA 3E1TA 1PS9A 1H86A 1S2YA 4H4TA 4II3A 1PJ7A 4K2XA 4H2NA 1TDFA 2YLTA 3FMWA 3KU9A 2GMJA 4EM4A 3LZWA 1E1LA 4HA6A 3UTGA 2H89A 4ZCCA 4G73A 1H7XA 1FECA 4TLXA 1GXFA 4TM0A 3BHKA 2X3NA 1YQ3A 2Y6RA 5KVIA 5BUKA 1FCDA 4H4RA 5KMRA 3GDPA 2ACZA 3I6DA 1XPQA 2XFQA 3GRSA 1L0VA 3VQRA 1LJ1A 2X8HA 2BS4A 2V6OA 2YG7A 2YLSA 4U8OA 4OPCA 1TDEA 2YVFA 4U2TA 1ZY8A 3SY4A 3NIXA 4P9SA 1E1MA 4CNJA 3GWDA 3DK9A 5KMQA 4XXGA 4UDPA 1F6MA 3HZLA 3PS9A 1KFYA 1XDIA 1NPXA 2CULA 2GR2A 2R46A 4H50A 3AB1A 2R0CA 3KPFA 5BVAA 2W0HA 3BNMA 4H4ZA 5CKUA 2VOUA 3VR8A 4CCQA 2WU5A 5BRTA 4IA5A 1N4VA 3QVPA 2V5ZA 4H2QA 4H4PA 5EOWA 1ZOYA 2YG3A 2WQYA 3UTFA 1NEKA 3CNTA 2ZZCA 1LQTA 1PJ5A 3VRAA 3UOXA 3KD9A 3HYXA 3QSEA 2B7SA 3AEBA 4USRA 3AXBA 3LOVA 4U8NA 4EIQA 2WOIA 1GRHA 3NYFA 4B65A 2RABA 1CJ4A 2YLWA 3AD8B 4H4XA 2VQBA 1CJ3A 4BURA 3ZYXA 3SZ0A 4EM3A 3KA7A 3GYJA 3NN6X 5HXIA 4G6GA 1Q1RA 2FJEA 2GQFA 2QCUA 2VVMA 4Z24A 3GYXA 3NG7X 4IVMB 3ZDNA 4JY3A 4I58A 5M0ZA 4NTEA 3AEGA 4JY2A 1KSSA 1PN0A 3REDA 1O5WA 2C70A 4OPDA 4U8KA 1H83A 3P4SA 2X99A 2JBVA 3CPIG 3K7MX 1P2EA 1VRQB 3AYJA 4A6NA 1E1KA 2JB3A 3GMBA 3P4PA 3O0HA 2TPRA 1KF6A 3K7TA 4RG3A 3NRNA 2GRTA 2PHHA 3AWIA 4YSYA 2YM1A 4YXDA 3DGZA 1IUXA 3ISHA 3GWFA 4A99A 2YAUA 1D4CA 2WOVA 3DGHA 2GQWA 3WE0A 4C3YA 3KKJA 3LB8A 3UKLA 4OPTA 4OPLA 4XWZA 2JAEA 4AT2A 3PO7A 3UP4A 4NTCA 2A89A 3T2KA 1GRGA 2GEWA 4YSHA 1OJAA 1D7LA 2WESA 2WETA 1REOA 1LPFA 2YG5A 3AE4A 3T2ZA 1D4EA 5JCNA 2WP9A 1Y0PA 3SZFA 2ZBWA 3D8XA 4D04A 2FJDA 4JNAA 1DOEA 2ARDA 5U63A 2NPXA 3T31A 2JK6A 4WX1A 2YR5A 2WU2A 4Z2UA 2XVJA 4KX6A 2BC1A 3DK8A 1V59A 1CJ2A 1PXBA 5U25A 2BC0A 4EQSA 3URHA 1CBOA 1VG9A 2YR6A 3T14A 4YSXA 1KNRA 1K0LA 2E5VA 3UP5A 3IHGA 1VQWA 3NK0X 2XFOA 1DODA 2AR8A 5J60A 3QSMA 3CPHG 1DNCA 1GREA 4EQXA 4B63A 1GT8A 1B8SA 2BCPA 4H4YA 1DJNA 2GVCA 2GH5A 3C4AA 5JCMA 3EANA 2QAEA 4A79A 2V61A 1L9EA 1H84A 3KPKA 3NGCX 4EMWA 4NEVA 3IC9A 1H82A 4H7UA 4ZCDA 4H2RA 3AE3A 3VR9A 1IUTA 1B5QA 1MXTA 2C73A 2JKCA 2WDRA 3DJDA 2RGJA 5KRQA 3ATQA 3SYIA 1GTHA 1CC4A 2RGHA 2VVLA 3CNDA 3NK1X 2FJBA 2R9ZA 4EMJA 4TM4A 2VRLA 1D4DA 1DJQA 4H4WA 4LU6A 3F8RA 2Q0LA 4GAVA 1B4VA 2WPCA 3DA1A 4AP1A 3SFEA 2R0PA 4GCMA 2X8GA 1D5TA 3BI5A 4CY8A 3FPZA 3NNEA 4H2PA 4X4JA 3AD9B 2BS3A 2EQ6A 4U8IA 1NENA 1IJHA 2XFUA 2TMDA 3SZCA 2BRAA 3CN8A 4Z2RA 1QJDA 5BULA 2YG4A 4IV9A 1NDAA 4DNAA 4NWZA 2GR3A 1F8RA 1OJDA 4GDEA 4JN9A 1EL8A 4Y4NA 5J7XA 5M10A 1JOAA 4U8LA 2R4EA 4A9WA 1SEZA 1IUUA 1TDKA 3JSKA 4K22A 4ICYA 4O5QA 3SM8A 4AOXA 3IWAA 1LQUA 3SQPA 2RGOA 3II4A 5C3JA 4FK1A 4FDCB 3F8DA 4IVOB 3ATRA 2YR4A 3G5SA 1PHHA 3M12A 4MJWA 4PABA 4BV6A 1E7PA 3AECA 1Q9IA 1PBFA 3L8KA 3VRDB 1UKVG 4C3XA 4M52A 5KOWA 3ALLA 1PBDA 4EQWA 1FEAA 1CJCA 4J56A 4E0VA 4APNA 2A87A 4K5SA 2WP6A 2JB2A 3RP8A 5IPYA 4U8JA 4YKGA 4FK1C 5GSNA 2WPFA 3AE6A 2R0GA 1PBCA 2GF3A 1GV4A 2VRMA 3AD7B 3BHFA 3ITJA 3NKSA 5C2TA 1ZMCA 4H4VA 2NVKX 1GRBA 1E39A 1XHCA 2F5ZA 3GRTA 4GR1A 4NNJA 4TM3A 3SZWA 3S5WA 5KMSA 1GRAA 1FEBA 3IF9A 1LTXR 4C5OA 1QO8A 2VQ7A 2YLZA 2IIDA 3L1RA 4I59A 2XYOA 4D03A 4U8PA 1JRYA 3AEDA 3QFAA 3UOVA 1ZP0A 1MOKA 2YLRA 4J36A 2J3NA 4Z2TA 5L46A 1ZMDA 3QVRA 4OCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 A;  2GB0 A;  4ECH A;  1PJ6 A;  3BI2 A;  3GSI A;  3GMC A;  5GRT A;  3GYI A;  1B37 A;  1TRB A;  3UTH A;  2E4G A;  2Y6Q A;  4CNK A;  2BAC A;  1PDH A;  3K30 A;  4RG4 A;  1LV0 A;  3KLJ A;  3H4K A;  3Q6J A;  4YWO A;  3COX A;  4K8D A;  3EPT A;  5EBK A;  1O95 A;  2Q7V A;  4N9X A;  1NHR A;  3BNU A;  1TDN A;  2BYB A;  4TLZ A;  2IVD A;  4A5L A;  1COY A;  3ADA B;  1IUV A;  1TDO A;  4B64 A;  3G5Q A;  2XFN A;  3Q9T A;  3SFD A;  4OPU A;  1PBE A;  3IHM A;  3VRB A;  4A6N B;  4CBQ A;  1Z6L A;  3DH9 A;  4J33 A;  4DSG A;  2A8X A;  3EF6 A;  4DGK A;  1DOC A;  4UP3 A;  3AEF A;  3FBS A;  1N4U A;  3RNM A;  4NTD A;  1H7W A;  1GND A;  4H4U A;  1GOS A;  3V3O A;  1YQ4 A;  5IQ1 A;  2OLN A;  5FS8 A;  1JRZ A;  1O94 A;  3LXD A;  4CY6 A;  4GDP A;  1RP0 A;  1YY5 A;  2B9W A;  5KXJ A;  1Y56 A;  2O9Z A;  3NTA A;  1IUW A;  5FS7 A;  5HYM A;  1IUS A;  1XAN A;  2Z5X A;  3CPJ G;  4YTM A;  2I0Z A;  2YM2 A;  3NTD A;  3K7Q X;  4U2L A;  1F8W A;  1F8S A;  1RSG A;  2WP5 A;  4HB9 A;  3CTY A;  3CGE A;  4J57 A;  3FIM B;  2WOW A;  4ADW A;  1GES A;  3CNS A;  5FS9 A;  1EL7 A;  2YVG A;  1S2Q A;  4Z25 A;  4YT0 A;  4YTN A;  1ZX9 A;  2XFP A;  3NHO X;  4LII A;  1YQZ A;  4J31 A;  1L9D A;  2EQ8 A;  1ELI A;  2V3A A;  2XLS A;  3UOZ A;  2JB1 A;  3F8P A;  1Q1W A;  5IQ4 A;  2WHD A;  3V3N A;  4O5U A;  5JCI A;  2XLR A;  1FL2 A;  3NYC A;  2Z5Y A;  1S3B A;  2XLU A;  3OC4 A;  1Y56 B;  2WBA A;  3NT6 A;  1W4X A;  1ZOV A;  2OLO A;  3FG2 P;  1TYT A;  2WEU A;  4GUV A;  2BCG G;  4UDR A;  1L9C A;  1QLB A;  4BK2 A;  4U8M A;  1M6I A;  2BAB A;  4OPG A;  2GR1 A;  5FS6 A;  3S61 A;  3RP6 A;  4OPI A;  3RHA A;  1P2H A;  2BK4 A;  4H4S A;  5DBJ A;  5U1O A;  2FBW A;  2BXS A;  1GPE A;  1RYI A;  2E1M A;  1S3E A;  2DKH A;  3UKK A;  1NHP A;  4RSL A;  3UOY A;  3CNJ A;  1CF3 A;  1E1N A;  1BZL A;  3OZ2 A;  2X8C A;  3ALJ A;  5TR3 A;  1LVL A;  1OJ9 A;  1EL9 A;  4K5R A;  4KPR A;  4Y4L A;  2BS2 A;  2C3D A;  1ZDL A;  3P9U A;  2BA9 A;  1GRT A;  3QFB A;  1BWC A;  2WPE A;  3ICR A;  2XLT A;  3R9U A;  2GAH B;  1BKW A;  2PYX A;  2WS3 A;  2XVF A;  1CHU A;  3D1C A;  4X9M A;  4AOS A;  2BK5 A;  4Y4M A;  4A65 A;  3AE2 A;  2GV8 A;  4B68 A;  3ALM A;  4U2S A;  2C64 A;  2QA2 A;  4GF7 A;  5HHF A;  4H4Q A;  3LJP A;  1ONF A;  4NEW A;  3DJE A;  1KDG A;  5EB4 A;  1JNZ A;  3NK2 X;  3AEA A;  4DSH A;  2WDV A;  4JDR A;  4BK1 A;  3QJ4 A;  4AT0 A;  3DJJ A;  4JNQ A;  4C77 A;  2B76 A;  2C3C A;  2B9X A;  1JEH A;  2B9Y A;  4LA1 A;  1N1P A;  1FOH A;  4REK A;  2FJA A;  1PXC A;  1YKJ A;  3M0O A;  1BGN A;  3ICS A;  2GMH A;  2YQU A;  3AE8 A;  5EB5 A;  4Z44 A;  1AOG A;  2V60 A;  1F3P A;  1JRX A;  2BXR A;  2GR0 A;  1GTE A;  2H88 A;  2YVJ A;  2UZZ A;  3AYI A;  3UTE A;  1JU2 A;  3CGC A;  5LV9 A;  1VG0 A;  2AAQ A;  2YG6 A;  2C67 A;  2C72 A;  3DME A;  3NLC A;  4TM1 A;  1GER A;  1NHS A;  2CDU A;  3AE1 A;  4Z26 A;  1BF3 A;  3LAD A;  2YLX A;  4AP3 A;  2APG A;  2YWL A;  3CGB A;  4X9N A;  4XWR A;  2XVE A;  2ZZ0 A;  4EIP A;  5KVH A;  3ABV A;  3CNP A;  1TYP A;  4C74 A;  2R45 A;  3P4R A;  3KVE A;  2CVJ A;  3QSS A;  4EMI A;  1GEU A;  3ICT A;  1PBB A;  2C66 A;  3SGL A;  1K0I A;  5FMH A;  3G5R A;  3M13 A;  2XVI A;  2HQM A;  1OJT A;  2DKI A;  4JQ9 A;  2C76 A;  2C7G A;  3DJG X;  3LZX A;  3H8L A;  3NYE A;  2Q6U A;  2VZ2 A;  4NZH A;  1NG3 A;  3C4N A;  4OVI A;  2EQ9 A;  2XVH A;  5JCK A;  1GAL A;  3C96 A;  2QA1 A;  4J34 A;  5KWF A;  3P4Q A;  4YSZ A;  4B66 A;  1DXL A;  3CGD A;  4B69 A;  1BGJ A;  3DK4 A;  3RP7 A;  1E6E A;  1VDC A;  3GDN A;  3P1W A;  2WDQ A;  1JNR A;  3GD3 A;  4FX9 A;  4B1B A;  4IA6 A;  3PVC A;  1ZK7 A;  4GRT A;  1M64 A;  1X31 B;  2EQ7 A;  3UKA A;  1NAA A;  1CC2 A;  1KNP A;  5CQF A;  4B67 A;  3NN0 X;  2V3B A;  1DOB A;  1GET A;  3NH3 X;  3B3R A;  1OJC A;  3GD4 A;  4ZN0 A;  4WCT A;  4BJY A;  3UKF A;  4YKF A;  1GSN A;  3T37 A;  4BJZ A;  1ZKQ A;  2XCG A;  5JCL A;  5KOX A;  2XDO A;  2R4J A;  3AEE A;  4A7A A;  2X50 A;  2C75 A;  2IVE A;  3UKH A;  1N4W A;  1D7Y A;  5ER0 A;  3UCL A;  3B6D A;  1MO9 A;  3V76 A;  2AQJ A;  4UDQ A;  1H81 A;  2XLP A;  2CFY A;  1K4Q A;  1KSU A;  4J2W A;  1GRF A;  3AE7 A;  1H6V A;  3UKQ A;  1CC6 A;  3H8I A;  3CIR A;  3AE9 A;  1HYU A;  1CL0 A;  1PXA A;  4USQ A;  4CRT A;  4EQR A;  1NG4 A;  5HY5 A;  1EBD A;  4BK3 A;  3BI4 A;  2VVL G;  4YTP A;  3EAO A;  4PAA A;  2Q0K A;  4Z43 A;  1NHQ A;  3I3L A;  1EL5 A;  2ZZB A;  3UKP A;  2C65 A;  2OAL A;  2OAM A;  2GAG B;  2BK3 A;  4CCR A;  3AYL A;  2B7R A;  1K0J A;  2OA1 A;  4K7Z A;  3E1T A;  1PS9 A;  1H86 A;  1S2Y A;  4H4T A;  1PJ7 A;  4K2X A;  4H2N A;  1TDF A;  2YLT A;  3FMW A;  3KU9 A;  2GMJ A;  4EM4 A;  3LZW A;  1E1L A;  4HA6 A;  3UTG A;  2H89 A;  4ZCC A;  1H7X A;  1FEC A;  4TLX A;  1GXF A;  4TM0 A;  3BHK A;  2X3N A;  1YQ3 A;  2Y6R A;  5KVI A;  5BUK A;  1FCD A;  4H4R A;  3GDP A;  2ACZ A;  3I6D A;  1XPQ A;  2XFQ A;  3GRS A;  1L0V A;  3VQR A;  1LJ1 A;  2X8H A;  2BS4 A;  2V6O A;  2YG7 A;  2YLS A;  4U8O A;  4OPC A;  1TDE A;  2YVF A;  4U2T A;  1ZY8 A;  3NIX A;  4P9S A;  1E1M A;  4CNJ A;  3GWD A;  3DK9 A;  4XXG A;  4UDP A;  1F6M A;  3HZL A;  3PS9 A;  1KFY A;  1XDI A;  1NPX A;  2CUL A;  2GR2 A;  2R46 A;  4H50 A;  3AB1 A;  2R0C A;  3KPF A;  5BVA A;  2W0H A;  3BNM A;  4H4Z A;  5CKU A;  2VOU A;  3VR8 A;  4CCQ A;  2WU5 A;  5BRT A;  4IA5 A;  1N4V A;  3QVP A;  2V5Z A;  4H2Q A;  4H4P A;  5EOW A;  1ZOY A;  2YG3 A;  2WQY A;  3UTF A;  1NEK A;  3CNT A;  2ZZC A;  1LQT A;  1PJ5 A;  3VRA A;  3UOX A;  3KD9 A;  3QSE A;  2B7S A;  3AEB A;  4USR A;  3AXB A;  3LOV A;  4U8N A;  4EIQ A;  2WOI A;  1GRH A;  3NYF A;  4B65 A;  2RAB A;  1CJ4 A;  2YLW A;  3AD8 B;  4H4X A;  2VQB A;  1CJ3 A;  4BUR A;  3ZYX A;  4EM3 A;  3KA7 A;  3GYJ A;  3NN6 X;  5HXI A;  1Q1R A;  2FJE A;  2GQF A;  2QCU A;  2VVM A;  4Z24 A;  3NG7 X;  4IVM B;  3ZDN A;  4JY3 A;  4I58 A;  5M0Z A;  4NTE A;  3AEG A;  4JY2 A;  1KSS A;  1PN0 A;  3RED A;  1O5W A;  2C70 A;  4OPD A;  4U8K A;  1H83 A;  3P4S A;  2X99 A;  2JBV A;  3CPI G;  3K7M X;  1P2E A;  1VRQ B;  3AYJ A;  4A6N A;  1E1K A;  2JB3 A;  3GMB A;  3P4P A;  3O0H A;  2TPR A;  1KF6 A;  3K7T A;  4RG3 A;  3NRN A;  2GRT A;  2PHH A;  3AWI A;  4YSY A;  2YM1 A;  4YXD A;  3DGZ A;  1IUX A;  3ISH A;  3GWF A;  4A99 A;  2YAU A;  1D4C A;  2WOV A;  3DGH A;  2GQW A;  3WE0 A;  4C3Y A;  3KKJ A;  3LB8 A;  3UKL A;  4OPT A;  4OPL A;  4XWZ A;  2JAE A;  4AT2 A;  3PO7 A;  3UP4 A;  4NTC A;  2A89 A;  1GRG A;  2GEW A;  4YSH A;  1OJA A;  1D7L A;  2WES A;  2WET A;  1REO A;  1LPF A;  2YG5 A;  3AE4 A;  5JCN A;  1D4E A;  2WP9 A;  1Y0P A;  2ZBW A;  3D8X A;  4D04 A;  2FJD A;  4JNA A;  1DOE A;  2ARD A;  5U63 A;  2NPX A;  2JK6 A;  4WX1 A;  2YR5 A;  2WU2 A;  4Z2U A;  2XVJ A;  4KX6 A;  2BC1 A;  3DK8 A;  1V59 A;  1CJ2 A;  1PXB A;  5U25 A;  2BC0 A;  4EQS A;  3URH A;  1CBO A;  1VG9 A;  2YR6 A;  4YSX A;  1KNR A;  1K0L A;  2E5V A;  3UP5 A;  3IHG A;  1VQW A;  3NK0 X;  2XFO A;  1DOD A;  2AR8 A;  5J60 A;  3QSM A;  3CPH G;  1DNC A;  1GRE A;  4EQX A;  4B63 A;  1GT8 A;  1B8S A;  2BCP A;  4H4Y A;  1DJN A;  2GVC A;  2GH5 A;  3C4A A;  5JCM A;  3EAN A;  2QAE A;  4A79 A;  2V61 A;  1L9E A;  1H84 A;  3NGC X;  4EMW A;  4NEV A;  3IC9 A;  1H82 A;  4H7U A;  4ZCD A;  4H2R A;  3AE3 A;  3VR9 A;  1IUT A;  1B5Q A;  1MXT A;  2C73 A;  2JKC A;  2WDR A;  3DJD A;  2RGJ A;  5KRQ A;  3ATQ A;  1GTH A;  1CC4 A;  2RGH A;  2VVL A;  3CND A;  3NK1 X;  2FJB A;  2R9Z A;  4EMJ A;  4TM4 A;  2VRL A;  1D4D A;  1DJQ A;  4H4W A;  4LU6 A;  3F8R A;  2Q0L A;  4AP1 A;  1B4V A;  2WPC A;  3DA1 A;  3SFE A;  2R0P A;  4GCM A;  2X8G A;  1D5T A;  3BI5 A;  4CY8 A;  3FPZ A;  3NNE A;  4H2P A;  4X4J A;  3AD9 B;  2BS3 A;  2EQ6 A;  4U8I A;  1NEN A;  1IJH A;  2XFU A;  2TMD A;  3CN8 A;  4Z2R A;  1QJD A;  5BUL A;  2YG4 A;  4IV9 A;  1NDA A;  4DNA A;  2GR3 A;  1F8R A;  1OJD A;  4GDE A;  4JN9 A;  1EL8 A;  4Y4N A;  5J7X A;  5M10 A;  1JOA A;  4U8L A;  2R4E A;  4A9W A;  1SEZ A;  1IUU A;  1TDK A;  3JSK A;  4K22 A;  4ICY A;  4O5Q A;  3SM8 A;  4AOX A;  3IWA A;  1LQU A;  3SQP A;  2RGO A;  3II4 A;  5C3J A;  4FK1 A;  4FDC B;  3F8D A;  4IVO B;  3ATR A;  2YR4 A;  3G5S A;  1PHH A;  3M12 A;  4MJW A;  4PAB A;  4BV6 A;  1E7P A;  3AEC A;  1Q9I A;  1PBF A;  3L8K A;  3VRD B;  1UKV G;  4C3X A;  4M52 A;  5KOW A;  3ALL A;  1PBD A;  4EQW A;  1FEA A;  1CJC A;  4J56 A;  4E0V A;  4APN A;  2A87 A;  4K5S A;  2WP6 A;  2JB2 A;  3RP8 A;  5IPY A;  4U8J A;  4YKG A;  4FK1 C;  5GSN A;  2WPF A;  3AE6 A;  2R0G A;  1PBC A;  2GF3 A;  1GV4 A;  2VRM A;  3AD7 B;  3BHF A;  3ITJ A;  3NKS A;  5C2T A;  1ZMC A;  4H4V A;  2NVK X;  1GRB A;  1E39 A;  1XHC A;  2F5Z A;  3GRT A;  4GR1 A;  4TM3 A;  3S5W A;  1GRA A;  1FEB A;  3IF9 A;  1LTX R;  4C5O A;  1QO8 A;  2VQ7 A;  2YLZ A;  2IID A;  3L1R A;  4I59 A;  2XYO A;  4D03 A;  4U8P A;  1JRY A;  3AED A;  3QFA A;  3UOV A;  1ZP0 A;  1MOK A;  2YLR A;  4J36 A;  2J3N A;  4Z2T A;  5L46 A;  1ZMD A;  3QVR A;  4OCG A; 
#chains in the Genus database with same CATH topology
 3AE5 A;  4G9K A;  2GB0 A;  4ECH A;  1PJ6 A;  3BI2 A;  3GSI A;  3GMC A;  5GRT A;  3GYI A;  1B37 A;  1TRB A;  3UTH A;  2E4G A;  2Y6Q A;  4CNK A;  2BAC A;  1PDH A;  3K30 A;  4RG4 A;  1LV0 A;  3KLJ A;  3H4K A;  3Q6J A;  4YWO A;  3COX A;  4K8D A;  3EPT A;  5EBK A;  1O95 A;  2Q7V A;  4N9X A;  1NHR A;  3BNU A;  1TDN A;  2BYB A;  4TLZ A;  2IVD A;  4A5L A;  1COY A;  3ADA B;  1IUV A;  1TDO A;  4B64 A;  2BRY A;  3G5Q A;  2XFN A;  3Q9T A;  3SFD A;  4OPU A;  1PBE A;  3IHM A;  3VRB A;  4A6N B;  4CBQ A;  1Z6L A;  3DH9 A;  4J33 A;  4DSG A;  2A8X A;  3EF6 A;  4DGK A;  1DOC A;  4UP3 A;  3AEF A;  3FBS A;  1N4U A;  3RNM A;  4NTD A;  1H7W A;  1GND A;  4H4U A;  1GOS A;  3V3O A;  1YQ4 A;  5IQ1 A;  4GAP A;  2OLN A;  5FS8 A;  1JRZ A;  1O94 A;  3LXD A;  4CY6 A;  4GDP A;  1RP0 A;  1YY5 A;  2B9W A;  5KXJ A;  1Y56 A;  2O9Z A;  5KMP A;  3NTA A;  1IUW A;  5FS7 A;  5HYM A;  1IUS A;  1XAN A;  2Z5X A;  3CPJ G;  4G74 A;  4YTM A;  2I0Z A;  2YM2 A;  3NTD A;  3K7Q X;  4U2L A;  1F8W A;  1F8S A;  1RSG A;  2WP5 A;  4HB9 A;  3CTY A;  3CGE A;  4J57 A;  3FIM B;  2WOW A;  4ADW A;  1GES A;  4II2 A;  3CNS A;  5FS9 A;  1EL7 A;  2YVG A;  1S2Q A;  4Z25 A;  4YT0 A;  4YTN A;  1ZX9 A;  2XFP A;  3NHO X;  4LII A;  1YQZ A;  4J31 A;  1L9D A;  2EQ8 A;  1ELI A;  2V3A A;  2XLS A;  3UOZ A;  2JB1 A;  3F8P A;  1Q1W A;  5IQ4 A;  2WHD A;  3V3N A;  4O5U A;  5JCI A;  2XLR A;  1FL2 A;  3NYC A;  2Z5Y A;  1S3B A;  2XLU A;  3OC4 A;  1Y56 B;  2WBA A;  3NT6 A;  1W4X A;  1ZOV A;  2OLO A;  3FG2 P;  1TYT A;  2WEU A;  3SX6 A;  4GUV A;  2BCG G;  4UDR A;  1L9C A;  1QLB A;  4BK2 A;  4U8M A;  1M6I A;  2BAB A;  4OPG A;  2GR1 A;  5FS6 A;  3S61 A;  3RP6 A;  4OPI A;  3RHA A;  1P2H A;  2BK4 A;  4H4S A;  5DBJ A;  5U1O A;  2FBW A;  2BXS A;  1GPE A;  1RYI A;  2E1M A;  1S3E A;  2DKH A;  3UKK A;  1NHP A;  4RSL A;  3UOY A;  3CNJ A;  1CF3 A;  1E1N A;  1BZL A;  3OZ2 A;  2X8C A;  3ALJ A;  5TR3 A;  1LVL A;  1OJ9 A;  1EL9 A;  4K5R A;  4KPR A;  4Y4L A;  2BS2 A;  2C3D A;  1ZDL A;  3P9U A;  2BA9 A;  1GRT A;  3QFB A;  1BWC A;  2WPE A;  3ICR A;  2XLT A;  3R9U A;  2GAH B;  1BKW A;  2PYX A;  2WS3 A;  2XVF A;  1CHU A;  3D1C A;  4X9M A;  4AOS A;  2BK5 A;  4Y4M A;  4A65 A;  3AE2 A;  2GV8 A;  4B68 A;  3ALM A;  4U2S A;  2C64 A;  4G6H A;  2QA2 A;  3T2Y A;  4GF7 A;  5HHF A;  4H4Q A;  3LJP A;  1ONF A;  4NEW A;  3DJE A;  1KDG A;  5EB4 A;  1JNZ A;  3NK2 X;  3AEA A;  4DSH A;  2WDV A;  4JDR A;  4BK1 A;  3QJ4 A;  4AT0 A;  3DJJ A;  4JNQ A;  4C77 A;  2B76 A;  2C3C A;  2B9X A;  1JEH A;  2B9Y A;  4LA1 A;  1N1P A;  1FOH A;  4REK A;  2FJA A;  1PXC A;  1YKJ A;  3M0O A;  1BGN A;  3ICS A;  2GMH A;  2YQU A;  3AE8 A;  3HYV A;  5EB5 A;  4Z44 A;  1AOG A;  2V60 A;  1F3P A;  1JRX A;  2BXR A;  3T0K A;  2GR0 A;  1GTE A;  2H88 A;  2YVJ A;  2UZZ A;  3AYI A;  3UTE A;  1JU2 A;  3CGC A;  5LV9 A;  1VG0 A;  2AAQ A;  2YG6 A;  2C67 A;  2C72 A;  3DME A;  3NLC A;  4TM1 A;  1GER A;  1NHS A;  2CDU A;  3AE1 A;  4Z26 A;  1BF3 A;  3LAD A;  2YLX A;  4AP3 A;  2APG A;  2YWL A;  3HYW A;  3CGB A;  4X9N A;  4XWR A;  2XVE A;  2ZZ0 A;  4EIP A;  5KVH A;  3ABV A;  3CNP A;  1TYP A;  4C74 A;  2R45 A;  3P4R A;  3KVE A;  2CVJ A;  3QSS A;  4EMI A;  1GEU A;  3ICT A;  1PBB A;  2C66 A;  3SGL A;  1K0I A;  5FMH A;  3G5R A;  3M13 A;  2XVI A;  2HQM A;  1OJT A;  2DKI A;  4JQ9 A;  2C76 A;  2C7G A;  3DJG X;  3LZX A;  3H8L A;  3NYE A;  2Q6U A;  2VZ2 A;  4NZH A;  1NG3 A;  3C4N A;  4OVI A;  2EQ9 A;  2XVH A;  5JCK A;  1GAL A;  3C96 A;  2QA1 A;  4J34 A;  5KWF A;  3P4Q A;  4YSZ A;  4B66 A;  1DXL A;  3CGD A;  4B69 A;  1BGJ A;  3DK4 A;  3RP7 A;  1E6E A;  1VDC A;  3GDN A;  3P1W A;  2WDQ A;  1JNR A;  3GD3 A;  4FX9 A;  2C4C A;  4B1B A;  4IA6 A;  3PVC A;  1ZK7 A;  4GRT A;  1M64 A;  1X31 B;  2EQ7 A;  3UKA A;  1NAA A;  1CC2 A;  1KNP A;  5CQF A;  4B67 A;  3NN0 X;  2V3B A;  1DOB A;  1GET A;  3NH3 X;  3B3R A;  1OJC A;  3GD4 A;  4ZN0 A;  3CMM A;  4WCT A;  4BJY A;  3UKF A;  4YKF A;  1GSN A;  3T37 A;  4BJZ A;  1ZKQ A;  2XCG A;  5JCL A;  5KOX A;  2XDO A;  2R4J A;  3AEE A;  4A7A A;  2X50 A;  2C75 A;  2IVE A;  3UKH A;  1N4W A;  1D7Y A;  5ER0 A;  3UCL A;  3B6D A;  1MO9 A;  3V76 A;  2AQJ A;  4UDQ A;  1H81 A;  5KNL A;  2XLP A;  2CFY A;  3SXI A;  1K4Q A;  1KSU A;  4J2W A;  1GRF A;  3AE7 A;  1H6V A;  3UKQ A;  1CC6 A;  3H8I A;  3CIR A;  3AE9 A;  1HYU A;  1CL0 A;  1PXA A;  4USQ A;  4CRT A;  4EQR A;  1NG4 A;  5HY5 A;  1EBD A;  4BK3 A;  3BI4 A;  2VVL G;  4YTP A;  3EAO A;  4PAA A;  2Q0K A;  4Z43 A;  1NHQ A;  3I3L A;  1EL5 A;  2ZZB A;  3UKP A;  2C65 A;  2OAL A;  2OAM A;  2GAG B;  2BK3 A;  4CCR A;  3AYL A;  2B7R A;  1K0J A;  2OA1 A;  4K7Z A;  3E1T A;  1PS9 A;  1H86 A;  1S2Y A;  4H4T A;  4II3 A;  1PJ7 A;  4K2X A;  4H2N A;  1TDF A;  2YLT A;  3FMW A;  3KU9 A;  2GMJ A;  4EM4 A;  3LZW A;  1E1L A;  4HA6 A;  3UTG A;  2H89 A;  4ZCC A;  4G73 A;  1H7X A;  1FEC A;  4TLX A;  1GXF A;  4TM0 A;  3BHK A;  2X3N A;  1YQ3 A;  2Y6R A;  5KVI A;  5BUK A;  1FCD A;  4H4R A;  5KMR A;  3GDP A;  2ACZ A;  3I6D A;  1XPQ A;  2XFQ A;  3GRS A;  1L0V A;  3VQR A;  1LJ1 A;  2X8H A;  2BS4 A;  2V6O A;  2YG7 A;  2YLS A;  4U8O A;  4OPC A;  1TDE A;  2YVF A;  4U2T A;  1ZY8 A;  3SY4 A;  3NIX A;  4P9S A;  1E1M A;  4CNJ A;  3GWD A;  3DK9 A;  5KMQ A;  4XXG A;  4UDP A;  1F6M A;  3HZL A;  3PS9 A;  1KFY A;  1XDI A;  1NPX A;  2CUL A;  2GR2 A;  2R46 A;  4H50 A;  3AB1 A;  2R0C A;  3KPF A;  5BVA A;  2W0H A;  3BNM A;  4H4Z A;  5CKU A;  2VOU A;  3VR8 A;  4CCQ A;  2WU5 A;  5BRT A;  4IA5 A;  1N4V A;  3QVP A;  2V5Z A;  4H2Q A;  4H4P A;  5EOW A;  1ZOY A;  2YG3 A;  2WQY A;  3UTF A;  1NEK A;  3CNT A;  2ZZC A;  1LQT A;  1PJ5 A;  3VRA A;  3UOX A;  3KD9 A;  3HYX A;  3QSE A;  2B7S A;  3AEB A;  4USR A;  3AXB A;  3LOV A;  4U8N A;  4EIQ A;  2WOI A;  1GRH A;  3NYF A;  4B65 A;  2RAB A;  1CJ4 A;  2YLW A;  3AD8 B;  4H4X A;  2VQB A;  1CJ3 A;  4BUR A;  3ZYX A;  3SZ0 A;  4EM3 A;  3KA7 A;  3GYJ A;  3NN6 X;  5HXI A;  4G6G A;  1Q1R A;  2FJE A;  2GQF A;  2QCU A;  2VVM A;  4Z24 A;  3GYX A;  3NG7 X;  4IVM B;  3ZDN A;  4JY3 A;  4I58 A;  5M0Z A;  4NTE A;  3AEG A;  4JY2 A;  1KSS A;  1PN0 A;  3RED A;  1O5W A;  2C70 A;  4OPD A;  4U8K A;  1H83 A;  3P4S A;  2X99 A;  2JBV A;  3CPI G;  3K7M X;  1P2E A;  1VRQ B;  3AYJ A;  4A6N A;  1E1K A;  2JB3 A;  3GMB A;  3P4P A;  3O0H A;  2TPR A;  1KF6 A;  3K7T A;  4RG3 A;  3NRN A;  2GRT A;  2PHH A;  3AWI A;  4YSY A;  2YM1 A;  4YXD A;  3DGZ A;  1IUX A;  3ISH A;  3GWF A;  4A99 A;  2YAU A;  1D4C A;  2WOV A;  3DGH A;  2GQW A;  3WE0 A;  4C3Y A;  3KKJ A;  3LB8 A;  3UKL A;  4OPT A;  4OPL A;  4XWZ A;  2JAE A;  4AT2 A;  3PO7 A;  3UP4 A;  4NTC A;  2A89 A;  3T2K A;  1GRG A;  2GEW A;  4YSH A;  1OJA A;  1D7L A;  2WES A;  2WET A;  1REO A;  1LPF A;  2YG5 A;  3AE4 A;  3T2Z A;  1D4E A;  5JCN A;  2WP9 A;  1Y0P A;  3SZF A;  2ZBW A;  3D8X A;  4D04 A;  2FJD A;  4JNA A;  1DOE A;  2ARD A;  5U63 A;  2NPX A;  3T31 A;  2JK6 A;  4WX1 A;  2YR5 A;  2WU2 A;  4Z2U A;  2XVJ A;  4KX6 A;  2BC1 A;  3DK8 A;  1V59 A;  1CJ2 A;  1PXB A;  5U25 A;  2BC0 A;  4EQS A;  3URH A;  1CBO A;  1VG9 A;  2YR6 A;  3T14 A;  4YSX A;  1KNR A;  1K0L A;  2E5V A;  3UP5 A;  3IHG A;  1VQW A;  3NK0 X;  2XFO A;  1DOD A;  2AR8 A;  5J60 A;  3QSM A;  3CPH G;  1DNC A;  1GRE A;  4EQX A;  4B63 A;  1GT8 A;  1B8S A;  2BCP A;  4H4Y A;  1DJN A;  2GVC A;  2GH5 A;  3C4A A;  5JCM A;  3EAN A;  2QAE A;  4A79 A;  2V61 A;  1L9E A;  1H84 A;  3KPK A;  3NGC X;  4EMW A;  4NEV A;  3IC9 A;  1H82 A;  4H7U A;  4ZCD A;  4H2R A;  3AE3 A;  3VR9 A;  1IUT A;  1B5Q A;  1MXT A;  2C73 A;  2JKC A;  2WDR A;  3DJD A;  2RGJ A;  5KRQ A;  3ATQ A;  3SYI A;  1GTH A;  1CC4 A;  2RGH A;  2VVL A;  3CND A;  3NK1 X;  2FJB A;  2R9Z A;  4EMJ A;  4TM4 A;  2VRL A;  1D4D A;  1DJQ A;  4H4W A;  4LU6 A;  3F8R A;  2Q0L A;  4GAV A;  1B4V A;  2WPC A;  3DA1 A;  4AP1 A;  3SFE A;  2R0P A;  4GCM A;  2X8G A;  1D5T A;  3BI5 A;  4CY8 A;  3FPZ A;  3NNE A;  4H2P A;  4X4J A;  3AD9 B;  2BS3 A;  2EQ6 A;  4U8I A;  1NEN A;  1IJH A;  2XFU A;  2TMD A;  3SZC A;  2BRA A;  3CN8 A;  4Z2R A;  1QJD A;  5BUL A;  2YG4 A;  4IV9 A;  1NDA A;  4DNA A;  4NWZ A;  2GR3 A;  1F8R A;  1OJD A;  4GDE A;  4JN9 A;  1EL8 A;  4Y4N A;  5J7X A;  5M10 A;  1JOA A;  4U8L A;  2R4E A;  4A9W A;  1SEZ A;  1IUU A;  1TDK A;  3JSK A;  4K22 A;  4ICY A;  4O5Q A;  3SM8 A;  4AOX A;  3IWA A;  1LQU A;  3SQP A;  2RGO A;  3II4 A;  5C3J A;  4FK1 A;  4FDC B;  3F8D A;  4IVO B;  3ATR A;  2YR4 A;  3G5S A;  1PHH A;  3M12 A;  4MJW A;  4PAB A;  4BV6 A;  1E7P A;  3AEC A;  1Q9I A;  1PBF A;  3L8K A;  3VRD B;  1UKV G;  4C3X A;  4M52 A;  5KOW A;  3ALL A;  1PBD A;  4EQW A;  1FEA A;  1CJC A;  4J56 A;  4E0V A;  4APN A;  2A87 A;  4K5S A;  2WP6 A;  2JB2 A;  3RP8 A;  5IPY A;  4U8J A;  4YKG A;  4FK1 C;  5GSN A;  2WPF A;  3AE6 A;  2R0G A;  1PBC A;  2GF3 A;  1GV4 A;  2VRM A;  3AD7 B;  3BHF A;  3ITJ A;  3NKS A;  5C2T A;  1ZMC A;  4H4V A;  2NVK X;  1GRB A;  1E39 A;  1XHC A;  2F5Z A;  3GRT A;  4GR1 A;  4NNJ A;  4TM3 A;  3SZW A;  3S5W A;  5KMS A;  1GRA A;  1FEB A;  3IF9 A;  1LTX R;  4C5O A;  1QO8 A;  2VQ7 A;  2YLZ A;  2IID A;  3L1R A;  4I59 A;  2XYO A;  4D03 A;  4U8P A;  1JRY A;  3AED A;  3QFA A;  3UOV A;  1ZP0 A;  1MOK A;  2YLR A;  4J36 A;  2J3N A;  4Z2T A;  5L46 A;  1ZMD A;  3QVR A;  4OCG A; 
#chains in the Genus database with same CATH homology
 3AE5 A;  4G9K A;  2GB0 A;  4ECH A;  1PJ6 A;  3BI2 A;  3GSI A;  3GMC A;  5GRT A;  3GYI A;  1B37 A;  1TRB A;  3UTH A;  2E4G A;  2Y6Q A;  4CNK A;  2BAC A;  1PDH A;  3K30 A;  4RG4 A;  1LV0 A;  3KLJ A;  3H4K A;  3Q6J A;  4YWO A;  3COX A;  4K8D A;  3EPT A;  5EBK A;  1O95 A;  2Q7V A;  4N9X A;  1NHR A;  3BNU A;  1TDN A;  2BYB A;  4TLZ A;  2IVD A;  4A5L A;  1COY A;  3ADA B;  1IUV A;  1TDO A;  4B64 A;  2BRY A;  3G5Q A;  2XFN A;  3Q9T A;  3SFD A;  4OPU A;  1PBE A;  3IHM A;  3VRB A;  4A6N B;  4CBQ A;  1Z6L A;  3DH9 A;  4J33 A;  4DSG A;  2A8X A;  3EF6 A;  4DGK A;  1DOC A;  4UP3 A;  3AEF A;  3FBS A;  1N4U A;  3RNM A;  4NTD A;  1H7W A;  1GND A;  4H4U A;  1GOS A;  3V3O A;  1YQ4 A;  5IQ1 A;  4GAP A;  2OLN A;  5FS8 A;  1JRZ A;  1O94 A;  3LXD A;  4CY6 A;  4GDP A;  1RP0 A;  1YY5 A;  2B9W A;  5KXJ A;  1Y56 A;  2O9Z A;  5KMP A;  3NTA A;  1IUW A;  5FS7 A;  5HYM A;  1IUS A;  1XAN A;  2Z5X A;  3CPJ G;  4G74 A;  4YTM A;  2I0Z A;  2YM2 A;  3NTD A;  3K7Q X;  4U2L A;  1F8W A;  1F8S A;  1RSG A;  2WP5 A;  4HB9 A;  3CTY A;  3CGE A;  4J57 A;  3FIM B;  2WOW A;  4ADW A;  1GES A;  4II2 A;  3CNS A;  5FS9 A;  1EL7 A;  2YVG A;  1S2Q A;  4Z25 A;  4YT0 A;  4YTN A;  1ZX9 A;  2XFP A;  3NHO X;  4LII A;  1YQZ A;  4J31 A;  1L9D A;  2EQ8 A;  1ELI A;  2V3A A;  2XLS A;  3UOZ A;  2JB1 A;  3F8P A;  1Q1W A;  5IQ4 A;  2WHD A;  3V3N A;  4O5U A;  5JCI A;  2XLR A;  1FL2 A;  3NYC A;  2Z5Y A;  1S3B A;  2XLU A;  3OC4 A;  1Y56 B;  2WBA A;  3NT6 A;  1W4X A;  1ZOV A;  2OLO A;  3FG2 P;  1TYT A;  2WEU A;  3SX6 A;  4GUV A;  2BCG G;  4UDR A;  1L9C A;  1QLB A;  4BK2 A;  4U8M A;  1M6I A;  2BAB A;  4OPG A;  2GR1 A;  5FS6 A;  3S61 A;  3RP6 A;  4OPI A;  3RHA A;  1P2H A;  2BK4 A;  4H4S A;  5DBJ A;  5U1O A;  2FBW A;  2BXS A;  1GPE A;  1RYI A;  2E1M A;  1S3E A;  2DKH A;  3UKK A;  1NHP A;  4RSL A;  3UOY A;  3CNJ A;  1CF3 A;  1E1N A;  1BZL A;  3OZ2 A;  2X8C A;  3ALJ A;  5TR3 A;  1LVL A;  1OJ9 A;  1EL9 A;  4K5R A;  4KPR A;  4Y4L A;  2BS2 A;  2C3D A;  1ZDL A;  3P9U A;  2BA9 A;  1GRT A;  3QFB A;  1BWC A;  2WPE A;  3ICR A;  2XLT A;  3R9U A;  2GAH B;  1BKW A;  2PYX A;  2WS3 A;  2XVF A;  1CHU A;  3D1C A;  4X9M A;  4AOS A;  2BK5 A;  4Y4M A;  4A65 A;  3AE2 A;  2GV8 A;  4B68 A;  3ALM A;  4U2S A;  2C64 A;  4G6H A;  2QA2 A;  3T2Y A;  4GF7 A;  5HHF A;  4H4Q A;  3LJP A;  1ONF A;  4NEW A;  3DJE A;  1KDG A;  5EB4 A;  1JNZ A;  3NK2 X;  3AEA A;  4DSH A;  2WDV A;  4JDR A;  4BK1 A;  3QJ4 A;  4AT0 A;  3DJJ A;  4JNQ A;  4C77 A;  2B76 A;  2C3C A;  2B9X A;  1JEH A;  2B9Y A;  4LA1 A;  1N1P A;  1FOH A;  4REK A;  2FJA A;  1PXC A;  1YKJ A;  3M0O A;  1BGN A;  3ICS A;  2GMH A;  2YQU A;  3AE8 A;  3HYV A;  5EB5 A;  4Z44 A;  1AOG A;  2V60 A;  1F3P A;  1JRX A;  2BXR A;  3T0K A;  2GR0 A;  1GTE A;  2H88 A;  2YVJ A;  2UZZ A;  3AYI A;  3UTE A;  1JU2 A;  3CGC A;  5LV9 A;  1VG0 A;  2AAQ A;  2YG6 A;  2C67 A;  2C72 A;  3DME A;  3NLC A;  4TM1 A;  1GER A;  1NHS A;  2CDU A;  3AE1 A;  4Z26 A;  1BF3 A;  3LAD A;  2YLX A;  4AP3 A;  2APG A;  2YWL A;  3HYW A;  3CGB A;  4X9N A;  4XWR A;  2XVE A;  2ZZ0 A;  4EIP A;  5KVH A;  3ABV A;  3CNP A;  1TYP A;  4C74 A;  2R45 A;  3P4R A;  3KVE A;  2CVJ A;  3QSS A;  4EMI A;  1GEU A;  3ICT A;  1PBB A;  2C66 A;  3SGL A;  1K0I A;  5FMH A;  3G5R A;  3M13 A;  2XVI A;  2HQM A;  1OJT A;  2DKI A;  4JQ9 A;  2C76 A;  2C7G A;  3DJG X;  3LZX A;  3H8L A;  3NYE A;  2Q6U A;  2VZ2 A;  4NZH A;  1NG3 A;  3C4N A;  4OVI A;  2EQ9 A;  2XVH A;  5JCK A;  1GAL A;  3C96 A;  2QA1 A;  4J34 A;  5KWF A;  3P4Q A;  4YSZ A;  4B66 A;  1DXL A;  3CGD A;  4B69 A;  1BGJ A;  3DK4 A;  3RP7 A;  1E6E A;  1VDC A;  3GDN A;  3P1W A;  2WDQ A;  1JNR A;  3GD3 A;  4FX9 A;  2C4C A;  4B1B A;  4IA6 A;  3PVC A;  1ZK7 A;  4GRT A;  1M64 A;  1X31 B;  2EQ7 A;  3UKA A;  1NAA A;  1CC2 A;  1KNP A;  5CQF A;  4B67 A;  3NN0 X;  2V3B A;  1DOB A;  1GET A;  3NH3 X;  3B3R A;  1OJC A;  3GD4 A;  4ZN0 A;  3CMM A;  4WCT A;  4BJY A;  3UKF A;  4YKF A;  1GSN A;  3T37 A;  4BJZ A;  1ZKQ A;  2XCG A;  5JCL A;  5KOX A;  2XDO A;  2R4J A;  3AEE A;  4A7A A;  2X50 A;  2C75 A;  2IVE A;  3UKH A;  1N4W A;  1D7Y A;  5ER0 A;  3UCL A;  3B6D A;  1MO9 A;  3V76 A;  2AQJ A;  4UDQ A;  1H81 A;  5KNL A;  2XLP A;  2CFY A;  3SXI A;  1K4Q A;  1KSU A;  4J2W A;  1GRF A;  3AE7 A;  1H6V A;  3UKQ A;  1CC6 A;  3H8I A;  3CIR A;  3AE9 A;  1HYU A;  1CL0 A;  1PXA A;  4USQ A;  4CRT A;  4EQR A;  1NG4 A;  5HY5 A;  1EBD A;  4BK3 A;  3BI4 A;  2VVL G;  4YTP A;  3EAO A;  4PAA A;  2Q0K A;  4Z43 A;  1NHQ A;  3I3L A;  1EL5 A;  2ZZB A;  3UKP A;  2C65 A;  2OAL A;  2OAM A;  2GAG B;  2BK3 A;  4CCR A;  3AYL A;  2B7R A;  1K0J A;  2OA1 A;  4K7Z A;  3E1T A;  1PS9 A;  1H86 A;  1S2Y A;  4H4T A;  4II3 A;  1PJ7 A;  4K2X A;  4H2N A;  1TDF A;  2YLT A;  3FMW A;  3KU9 A;  2GMJ A;  4EM4 A;  3LZW A;  1E1L A;  4HA6 A;  3UTG A;  2H89 A;  4ZCC A;  4G73 A;  1H7X A;  1FEC A;  4TLX A;  1GXF A;  4TM0 A;  3BHK A;  2X3N A;  1YQ3 A;  2Y6R A;  5KVI A;  5BUK A;  1FCD A;  4H4R A;  5KMR A;  3GDP A;  2ACZ A;  3I6D A;  1XPQ A;  2XFQ A;  3GRS A;  1L0V A;  3VQR A;  1LJ1 A;  2X8H A;  2BS4 A;  2V6O A;  2YG7 A;  2YLS A;  4U8O A;  4OPC A;  1TDE A;  2YVF A;  4U2T A;  1ZY8 A;  3SY4 A;  3NIX A;  4P9S A;  1E1M A;  4CNJ A;  3GWD A;  3DK9 A;  5KMQ A;  4XXG A;  4UDP A;  1F6M A;  3HZL A;  3PS9 A;  1KFY A;  1XDI A;  1NPX A;  2CUL A;  2GR2 A;  2R46 A;  4H50 A;  3AB1 A;  2R0C A;  3KPF A;  5BVA A;  2W0H A;  3BNM A;  4H4Z A;  5CKU A;  2VOU A;  3VR8 A;  4CCQ A;  2WU5 A;  5BRT A;  4IA5 A;  1N4V A;  3QVP A;  2V5Z A;  4H2Q A;  4H4P A;  5EOW A;  1ZOY A;  2YG3 A;  2WQY A;  3UTF A;  1NEK A;  3CNT A;  2ZZC A;  1LQT A;  1PJ5 A;  3VRA A;  3UOX A;  3KD9 A;  3HYX A;  3QSE A;  2B7S A;  3AEB A;  4USR A;  3AXB A;  3LOV A;  4U8N A;  4EIQ A;  2WOI A;  1GRH A;  3NYF A;  4B65 A;  2RAB A;  1CJ4 A;  2YLW A;  3AD8 B;  4H4X A;  2VQB A;  1CJ3 A;  4BUR A;  3ZYX A;  3SZ0 A;  4EM3 A;  3KA7 A;  3GYJ A;  3NN6 X;  5HXI A;  4G6G A;  1Q1R A;  2FJE A;  2GQF A;  2QCU A;  2VVM A;  4Z24 A;  3GYX A;  3NG7 X;  4IVM B;  3ZDN A;  4JY3 A;  4I58 A;  5M0Z A;  4NTE A;  3AEG A;  4JY2 A;  1KSS A;  1PN0 A;  3RED A;  1O5W A;  2C70 A;  4OPD A;  4U8K A;  1H83 A;  3P4S A;  2X99 A;  2JBV A;  3CPI G;  3K7M X;  1P2E A;  1VRQ B;  3AYJ A;  4A6N A;  1E1K A;  2JB3 A;  3GMB A;  3P4P A;  3O0H A;  2TPR A;  1KF6 A;  3K7T A;  4RG3 A;  3NRN A;  2GRT A;  2PHH A;  3AWI A;  4YSY A;  2YM1 A;  4YXD A;  3DGZ A;  1IUX A;  3ISH A;  3GWF A;  4A99 A;  2YAU A;  1D4C A;  2WOV A;  3DGH A;  2GQW A;  3WE0 A;  4C3Y A;  3KKJ A;  3LB8 A;  3UKL A;  4OPT A;  4OPL A;  4XWZ A;  2JAE A;  4AT2 A;  3PO7 A;  3UP4 A;  4NTC A;  2A89 A;  3T2K A;  1GRG A;  2GEW A;  4YSH A;  1OJA A;  1D7L A;  2WES A;  2WET A;  1REO A;  1LPF A;  2YG5 A;  3AE4 A;  3T2Z A;  1D4E A;  5JCN A;  2WP9 A;  1Y0P A;  3SZF A;  2ZBW A;  3D8X A;  4D04 A;  2FJD A;  4JNA A;  1DOE A;  2ARD A;  5U63 A;  2NPX A;  3T31 A;  2JK6 A;  4WX1 A;  2YR5 A;  2WU2 A;  4Z2U A;  2XVJ A;  4KX6 A;  2BC1 A;  3DK8 A;  1V59 A;  1CJ2 A;  1PXB A;  5U25 A;  2BC0 A;  4EQS A;  3URH A;  1CBO A;  1VG9 A;  2YR6 A;  3T14 A;  4YSX A;  1KNR A;  1K0L A;  2E5V A;  3UP5 A;  3IHG A;  1VQW A;  3NK0 X;  2XFO A;  1DOD A;  2AR8 A;  5J60 A;  3QSM A;  3CPH G;  1DNC A;  1GRE A;  4EQX A;  4B63 A;  1GT8 A;  1B8S A;  2BCP A;  4H4Y A;  1DJN A;  2GVC A;  2GH5 A;  3C4A A;  5JCM A;  3EAN A;  2QAE A;  4A79 A;  2V61 A;  1L9E A;  1H84 A;  3KPK A;  3NGC X;  4EMW A;  4NEV A;  3IC9 A;  1H82 A;  4H7U A;  4ZCD A;  4H2R A;  3AE3 A;  3VR9 A;  1IUT A;  1B5Q A;  1MXT A;  2C73 A;  2JKC A;  2WDR A;  3DJD A;  2RGJ A;  5KRQ A;  3ATQ A;  3SYI A;  1GTH A;  1CC4 A;  2RGH A;  2VVL A;  3CND A;  3NK1 X;  2FJB A;  2R9Z A;  4EMJ A;  4TM4 A;  2VRL A;  1D4D A;  1DJQ A;  4H4W A;  4LU6 A;  3F8R A;  2Q0L A;  4GAV A;  1B4V A;  2WPC A;  3DA1 A;  4AP1 A;  3SFE A;  2R0P A;  4GCM A;  2X8G A;  1D5T A;  3BI5 A;  4CY8 A;  3FPZ A;  3NNE A;  4H2P A;  4X4J A;  3AD9 B;  2BS3 A;  2EQ6 A;  4U8I A;  1NEN A;  1IJH A;  2XFU A;  2TMD A;  3SZC A;  2BRA A;  3CN8 A;  4Z2R A;  1QJD A;  5BUL A;  2YG4 A;  4IV9 A;  1NDA A;  4DNA A;  4NWZ A;  2GR3 A;  1F8R A;  1OJD A;  4GDE A;  4JN9 A;  1EL8 A;  4Y4N A;  5J7X A;  5M10 A;  1JOA A;  4U8L A;  2R4E A;  4A9W A;  1SEZ A;  1IUU A;  1TDK A;  3JSK A;  4K22 A;  4ICY A;  4O5Q A;  3SM8 A;  4AOX A;  3IWA A;  1LQU A;  3SQP A;  2RGO A;  3II4 A;  5C3J A;  4FK1 A;  4FDC B;  3F8D A;  4IVO B;  3ATR A;  2YR4 A;  3G5S A;  1PHH A;  3M12 A;  4MJW A;  4PAB A;  4BV6 A;  1E7P A;  3AEC A;  1Q9I A;  1PBF A;  3L8K A;  3VRD B;  1UKV G;  4C3X A;  4M52 A;  5KOW A;  3ALL A;  1PBD A;  4EQW A;  1FEA A;  1CJC A;  4J56 A;  4E0V A;  4APN A;  2A87 A;  4K5S A;  2WP6 A;  2JB2 A;  3RP8 A;  5IPY A;  4U8J A;  4YKG A;  4FK1 C;  5GSN A;  2WPF A;  3AE6 A;  2R0G A;  1PBC A;  2GF3 A;  1GV4 A;  2VRM A;  3AD7 B;  3BHF A;  3ITJ A;  3NKS A;  5C2T A;  1ZMC A;  4H4V A;  2NVK X;  1GRB A;  1E39 A;  1XHC A;  2F5Z A;  3GRT A;  4GR1 A;  4NNJ A;  4TM3 A;  3SZW A;  3S5W A;  5KMS A;  1GRA A;  1FEB A;  3IF9 A;  1LTX R;  4C5O A;  1QO8 A;  2VQ7 A;  2YLZ A;  2IID A;  3L1R A;  4I59 A;  2XYO A;  4D03 A;  4U8P A;  1JRY A;  3AED A;  3QFA A;  3UOV A;  1ZP0 A;  1MOK A;  2YLR A;  4J36 A;  2J3N A;  4Z2T A;  5L46 A;  1ZMD A;  3QVR A;  4OCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...