2ZC3A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (biapenem) from streptococcus pneumoniae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc3A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc3A01
1MWRA 4R23A 4CJNA 1MWSA 3EQUA 3UPPA 4N1XA 4MNRA 2ZC3A 5U47A 1QMFA 4R0QA 3EQVA 3UN7A 3UPOA 1K25A 4R1GA 3VSLA 1QMEA 1RP5A 4DKIA 4RA7A 3UE3A 3VSKA 1PYYA 5M1AA 5KSHA 1MWUA 2Z2LA 5M18A 3UPNA 4R3JA 3ZG0A 4BL2A 5M19A 4OVDA 3ZFZA 4JBFA 3LO7A 4QJGA 1MWTA 4CPKA 1VQQA 4BL3A 2Z2MA 3ZG5A 2ZC4A
chains in the Genus database with same CATH superfamily
1UEUA 1V3RA 4JI3J 1TV6B 2F65A 3PYFA 3PR5B 4P7TA 2HNYA 5GAGI 1REGX 1F3VA 1RTJA 3RB6A 3QLHB 4IR1A 5GAGU 1SJ1A 4LVNP 3PHTA 1T95A 4FN5A 1Y5NB 4DV2F 3OTBA 2R2SA 2EI5A 4K4SA 2IA0A 5AE1A 2GQQA 1SQFA 4U6PA 3A8KA 2JHEA 4ZCKA 2HAIA 2LEBA 4DL4A 2JEGA 5B0EA 4L73A 5LJ5Y 5KFBA 5KG2A 4UZBA 1F0XA 3OFEA 2VONA 3MMCA 2LYVA 2MQLA 1M1HA 4P6QA 5CXTA 3HFKA 3OR1B 3FQLA 1S57A 4ICLB 3KLFB 3MR5A 1CC8A 2DK2A 4DFPA 1QD1A 2QT7A 3KJNB 1PAUB 5D4OA 1SUQB 3ZFZA 2WSEC 5IT9Y 3EUNA 3QRPA 3CCMS 3C8YA 1RT2B 4DSFA 1ZTWA 4EK2A 2RQCA 1YJWS 4DU8A 2OEKA 1A9NB 2BUNA 2KXFA 2CQIA 1NZ8A 3DGVA 4X2BA 1KQKA 1D1UA 2DR5A 2P9CA 4OLOA 3U02A 1AUDA 1ZM2A 4F4XA 2PMWA 3I87A 2YKMB 4DPTA 2KT5A 3HKZD 2G0IA 4FBUA 4ES3A 2DH7A 3DLBA 3SEOA 1VQYA 4OYBA 2UXDJ 2P5VA 4M95A 7AT1B 5EN1A 4PWDA 3W2WA 3GJTB 1N56A 1YRTA 4X4TA 3ZFVA 1X9SA 3SBMA 1JJCB 3TA0A 2GFFA 3HHEA 2GHPA 1CLFA 3W64A 4KPYA 5J2QA 2FHMA 4R5PB 1R8BA 4Y2KA 1HWLA 3AXKA 1SPBP 4S0MA 1C2PA 3DM2A 2I2YA 3CXCR 1NK4A 4JUZA 1M5HA 4GVBB 3WX8A 2BANB 1L3UA 3C14A 4D3GA 3CSKA 2UVWA 1P9YA 4BWMA 5IM0B 3BQ0A 2QMXA 1XEZA 3DRPA 4CIOA 4L3KA 1R31A 4USJC 3IG1A 4IH6A 4WFAQ 1UAWA 2D3UA 2FDNA 3PFEA 4MTPA 1WTBA 3JSYA 1BY9A 4C8ZA 4DL2A 3CJTA 1WG4A 3IO1A 5HROA 5ETQA 2XM3A 4KHPF 3OR2A 5KSHA 2LFVA 4USKA 4AL6A 2OAUA 4LFCJ 2PDAA 4MKYA 4GO5X 4CQ1A 2YWHA 3G87A 2VASA 4RW8B 2FZCB 3KLEA 4NYZA 3ENVA 4C0HA 4F4WA 4ZVEA 1F3FA 1IKXB 1BWEA 1X9MA 3N6MA 3A1YG 4WKYA 4O44B 2ZHBA 3PACA 1XNRF 3BR8A 2W8LA 2HHUA 1HMVA 3C16A 3UDLA 2QLFB 5CYQA 5EX3A 3DCAA 5IOLA 4USVA 2OLUA 4DCJB 1SJRA 1N88A 2MB0B 2OMLA 1SKUB 3V4IA 2NR0A 1X5SA 4GRSA 3NLCA 2ZH4A 1FHTA 1QE1A 2WVDA 1IBLF 2DT9A 4YY3J 2NXEA 3M6WA 1TR0A 1R6VA 1VQMS 1S48A 2W2NP 4IFVB 1GH8A 2VJUA 1CJTA 1JLGA 1JXLA 4FF3A 4OX9F 1GTEA 2WONB 2EG1A 4DUYJ 2B4UA 5KT5A 4I7FB 1URNA 3HP6A 1IR1A 4ZMMA 1L3SA 1VIXA 1KN6A 2RH3A 5ETVA 3HVWA 3BPDA 1WD6A 2D9PA 3K8VA 4OMFG 4DMZA 5C5JA 1NPPA 3KLIB 3K5OA 3DRXA 3DU5A 3ZNUA 4M1KA 2YNHA 1WKJA 1F9EB 4V19X 2EWHA 3PCOB 2UVUA 1SIZA 5E3PA 1GMVA 3JAMU 2GMLA 4CM0A 4CRJA 1D9DA 4JYAF 2H9ZA 4Q2LA 4A8XA 3T1AA 4X4OA 3CDWA 1H3DA 5G4DA 4OJ1A 4ECTA 5GVQA 2W1BA 1WF0A 3N01A 4LFCF 5GAEI 3DRRA 1N5YA 5I3UA 1VS3A 4IOCQ 3OSPA 3X3UA 2VBYA 3NCRA 4DR2J 3CJ4A 2DITA 5HI7A 5GAEU 2V4RA 3PO4A 4A8MP 4C3MA 2OLVA 5HJYA 2R7SA 3GIIA 2EW9A 3OUYA 2YWWA 4WIIA 1DY3A 5H9EJ 1S6UA 4BS2A 1SJQA 2PEHA 4BL3A 2VG7B 2EFOA 3AAWB 4E0DA 2BM0A 1UJ6A 2AX0A 2VFVA 4DV0F 1KLNA 2VB6A 2CA9A 1V5IB 4J9VA 4X84A 2FPHX 2HS0A 3KLGB 1OY6A 4WPAA 2XWXA 3DOMB 4KKOB 3VALA 3SSRA 5IQQA 3CDBA 3TQEA 1QMFA 1VJQA 1G6BA 1RAAB 3TO8A 2UVVA 4DR5J 5LXRA 2KRRA 4KRWA 1C1BB 2QZ8A 2QYGA 1P9QC 2PN6A 5KFNA 1N4LA 2BW2A 2Y8YA 2PO4A 3TJ9A 1HNXF 1NDLA 2IYGA 1F60B 3VR1A 4UF4A 3A3NB 2OEJA 2YQ0A 3KLVA 2B9YA 2OD6A 2COLA 3NBPB 2KG1A 1RADB 1UWBB 3R1HA 2HGNA 3DLJA 2RQMA 3CJKA 1S1XB 3KJQB 3KJVA 2F8MA 2AEJA 1WOOA 2HK3A 3MZIA 4X4QA 5B0BA 3NMAA 4BL2A 3QIPB 1I94J 4U7CA 2RF2A 5T7LA 3UW1A 1VRTA 3QRQA 2V34A 2IVMA 1GNKA 2CRLA 4TKTA 5HO4A 4DR2F 2UUAJ 1F9HA 1QJHA 2GA7A 2IHR1 1S10A 2R2RA 1UWAA 4ZVRB 3NOCA 4DU7A 3DHWC 4PXEA 4ZKAA 2JOQA 4DV3F 1FT8A 4LF9J 1FRMA 3MMBA 5H1SV 5EGYA 4PPDA 3MMJA 4LSLB 1DBDA 1HHSA 2C2ZB 1HW8A 3C2PA 3EPIA 3LGHA 2QFJA 2IMWP 2XULA 1FCAA 2SXLA 3CDAA 2E7WA 2PT0A 1RKIA 1UKUA 3LW5C 3R5CA 1RABB 1FK9B 3R7NB 1HQEB 4L3NA 2R9LA 2ASLA 2E9RX 4ER8A 3BSAA 5CCLA 4YDXA 2BE2B 4K7QA 4ED2A 2A6MA 5D8HB 3QT5A 2MXYA 2YNIB 2WB1D 1LFWA 1WOSA 4WFXA 5F8NA 4QWEA 4CTAB 3THVA 1FERA 2XQCA 3KK1A 5DQIA 3MFHA 1JXVA 1DLOB 1B0TA 5J2NB 4HT5A 2HIQA 2RUSA 3ILLA 1AXQA 3NP5A 5KOWA 4FYXB 3V81A 4B9VA 3UPOA 4JI4J 5B0CA 3R2DJ 4A8WA 3BF4A 3FBEA 4M5NA 5DJBA 2NUHA 3OFFA 3BN7A 5EDWA 2C3MA 1SKWA 3FMWA 4OV1A 1B0VA 2XO6A 2UUAF 3K7RA 5B09A 3FGVA 5F9NA 3H5YA 4MH8A 5C24B 3MM8A 4HHUA 4DN0A 5J1PA 4B3RJ 3CJ5A 1M0SA 1U6ZA 4LF9F 1X9WA 1FX2A 3T1HJ 2CJQA 2DGUA 4LF7J 4U8YA 3BBFA 5G0RA 2K8GA 3EVWA 3M30B 1XQIA 4Q8EA 4ELUA 2IRUA 2LXFA 2HS4A 4QW9A 1R8PA 4JB8B 1RISA 5AXKA 1VRUB 2YX7A 3C3LA 3V6DB 1U2CA 1B99A 3NG8A 2CJYB 5CD4A 5A8WA 1S0NA 2VD3A 1DTTB 2FVSA 5C25B 1HYSA 2UXBJ 5HLFA 3ZTPA 2OPPB 3CCZA 3W2VB 2XS7A 4K4UA 2P8IA 5B0FA 5D77A 2N4DA 2EKNA 1CQMA 4OYXA 2GVZB 1RT5A 5AXNA 1HI1A 4RBVA 3EQUA 1NJXA 4IUFA 4P2FA 1YBTA 2MTLA 4Y00A 3V2UC 4AUKA 3RU0A 3EICA 1U48A 1SVDA 4NA1A 3JAMY 3MMAA 1V3ZA 3LOUA 2QFIA 1UTAA 2BZ2A 2JSXA 1YJRA 5LJ3Y 2QO3A 3BH6B 5LL6d 2Z0GA 4C98A 5KOXA 1FJCA 2WB4A 4MKAA 3W5ZA 4N41A 1HWKA 2RILA 4ZVGA 3TQ1A 1LQ9A 1XWLA 3AH6A 5DLGA 3US5A 3MUMP 2Y1LB 1V3SA 2FD2A 4C3LA 4B3RF 1TQLA 4RL1A 4QYZK 3MCMA 2AMCB 3EJMA 2HWHA 1SL1A 3LP0B 2XGPA 3BDPA 4TU7A 3CJRA 2MZTA 1G4CA 1CG2A 1YQHA 3I56S 1TFWA 1W2BR 4KY3A 2P6TA 1VDHA 4PYAA 4Q44A 4FZVA 1HKAA 3TP2A 2CFXA 1WELA 1ULRA 1Q0NA 2CJKA 2E5HA 4GKJF 4N1XA 2M2BA 4OHXA 1RSCA 5KFSA 2OPQB 2WBMA 3K57A 2OJ3A 4NXMF 1R0CB 2ALYB 1CQNA 2V5HG 3DFEA 3OL8A 3MM9B 4R0JA 4CO5A 2QV6A 5EWFA 3C6UA 4KB7A 1QAXA 2DR9A 3SXLA 3GJQB 4GC7A 5DG9A 2J0WA 3PXGa 4NE9C 3HO1A 3A3OB 1FESA 5D4NA 4ITSA 2XC9A 4I2PA 4N8OA 3ELHA 3QFWA 1NHVA 1NKEA 4USIA 1HNZJ 1RDRA 2GVDA 3GU0A 4DV1J 1CULB 2QMWA 5LMUJ 3FK4A 3W8PA 3ENAA 3Q83A 2UVRA 4JI5J 3A8EA 4F0MA 2BOAA 2OPSB 1WSVA 3TUPA 2D74B 4LRDA 4OYZA 3RBDA 1S12A 4RW7A 1KDNA 3BV8A 4Z7CA 3QJLA 4HL9A 3RRKA 1VR6A 4DV7J 2CJ9A 1NJYA 3VVUA 3KDOA 3NNAA 2HWTA 3NGTA 2MKJA 2IMOA 3EVOA 1WTFA 1XMBA 1HL6A 2WOMB 4WBFA 3ENWA 8AT1B 2ABYA 1U47A 3H2VE 3JTOA 3CGIA 1TK8A 4RU9A 2L3MA 1T94A 3BGRB 2XMAA 4NYPA 4OI0A 2B51A 4F25A 1PGZA 4A48A 3CD7A 4B3SF 4B9MA 1FF2A 1OY9A 1RE1B 3GQCA 4PUOA 2KM8B 2MQPA 3BB5A 2IJNA 3PIPQ 2GX8A 4QWDA 3TA1A 3TA2A 4LQ9A 1U6BA 2EFQA 2E9ZA 2CZ9A 3I5BA 3FEYB 3CUNA 2POKA 3MR7A 3JYTB 2BJDA 2R42A 4XK8C 3JSMA 4CM2A 4K59A 5HBMB 2LVWA 3KNGA 2R7UA 1U09A 4JI2J 4ZHRB 3N5BA 4DV1F 4FPIA 3M9OB 1WORA 3ILOA 5ETSA 4F0KA 4HR2A 1L3KA 2DHGA 2C2NA 2YKOA 3OLAA 1JKHA 1TL3B 3M9MB 4P7VA 4Q43A 3DOKB 4PG5A 2HQDA 3MCSA 1IQZA 2GCFA 2N3LA 1VHIA 3LWLA 2GV1A 3BO2A 1RWXB 1S4FA 3SSSA 1S9GB 1RT3B 4WXWA 3LQVA 1NDCA 1ACMB 1G2EA 4DV7F 1KONA 1RKJA 1JLBA 1WJ9A 1NMEB 5A0YA 4ZPTR 1VQKS 2BX6A 2CQDA 2BABA 3JTNA 4KGMA 1MWYA 2JC0A 3NAHA 1FNMA 4Y34A 5IT0A 3BJYA 2A1BA 3S6EA 3VF0B 4CH0S 2DD8S 1NK5A 2PFDA 2HWIA 1F6TA 3BO4A 2OKQA 4O0IA 3CJQA 3I4PA 4LFAF 1FJEB 4OIXA 3GFYA 3UDVA 5GADI 2ADBA 1Q8KA 2I5JA 2M9KA 1ZM4A 1RBLA 3MEEB 4AXJA 3JB9k 4UY8T 1FWKA 1HBNA 2W4CA 5GADU 2R8KA 1Y10A 2VU5A 1N32J 1CVJA 3FUYA 5K20B 2CQCA 4HYKA 1VCTA 2IIHA 1EKSA 3BM7A 1LW0B 4EFAC 2R8HA 3ZG5A 4WWSA 2RNEA 4ED7A 1MROA 3L95X 3MTJA 5HSPA 4DF4A 3TUIC 4W92B 4QZVB 4WK3A 4NLRA 1S76D 2GHWA 2W2OP 3QATA 4MT1A 1XIQA 3MEGB 3M8YA 4HI1A 3KK2B 2R7TA 4RW9B 1N6QA 1QLNA 2E66A 1R27B 4G1QB 1HIYA 2DRDA 3HHKA 4RJVA 1R8AA 1S59A 1GQEA 1C4AA 1UW9A 2V94A 3QWUA 4HHJA 2H4YB 3TANA 4G65A 1ZM3A 2FVPA 1C1CA 3S01A 1N33J 4OYIA 3AJ1A 2Z2YB 3SCJE 3RJMB 1FJGJ 2AKWB 2FIUA 2FLLA 2XZDB 2ROEA 1JIHA 4WZQA 2OEMA 4TXSA 5DETA 3HSZA 3NS6A 2GZOA 3IAS9 1AFJA 1TL5A 2VBWA 4OZ2A 5D78A 4URGA 5AJ3F 3Q22A 2V63A 1EQ0A 5E3CA 2FJWA 4RPFA 4R1GA 2BKPA 3SDEB 2P9EA 5DM7Q 2VKRA 3CT9A 1LV5A 4MK7A 3LP1B 2HNZB 6FD1A 2ZBCA 3BO3A 5L9XA 3ZTQA 3M8ZA 4OI2A 4TQSA 1TTHB 5E2QA 4H4KC 1IBKF 1N34F 4AXIA 1H7WA 3M32A 2VH7A 1RWNB 1AROP 1U7LA 3MR2A 2LQ5A 2HEKA 4EBEA 2NZCA 3EGVA 2HK2A 2NYHA 4ED3A 4WIQA 2UU9F 2MEWA 3M2RA 2KZZA 1HWUA 3QJJA 2H4WB 4UZCA 4FKYA 2R4FA 4UOHA 3TVZA 3EDRB 4H4OA 2RRBA 3DLKA 2LQBA 1AW0A 1RWOB 3WC2A 1DQ8A 2BR0A 1JXEA 3TZYA 1EETB 3DU6A 1UVNA 1NNDA 3QMQA 3OL6A 3KYLA 2ILYA 4CH1A 2LECA 1FDDA 3IWLA 3KFWX 3PTWA 3G96A 3HF5A 3QT6A 4O3PA 3OW2R 2FJVA 2OD4A 4EGLA 3G2XA 2J8SA 1V9OA 4C8MA 3ETOA 2W7OA 4NLTA 3MFIA 5LSRA 1DRZA 1SJ3P 2RQ4A 2K3KA 2FGOA 1MN7A 4J37A 5K5MA 4KIAA 4ZS6A 2UV8G 4RO0A 3IS9B 4C8OA 4QJVA 4CZCA 1F5CA 1APSA 1BQMA 1EJ7L 3QT8A 4ECUA 1T9WA 3HPOA 3WDOA 2JNJA 1YI2S 1RU1A 4MK9A 3NS7B 4DQSA 2J6TA 4PABA 1RTZA 3MCOA 2BQUA 3ZG0A 2M4MA 4QWCA 1RAEB 2CDRB 3AT1B 2JEIA 2BKOA 3I0RB 1LXNA 2D7SA 3RAQA 3Q23A 1S0MA 1KOOA 4NXNJ 5BYQA 2JFKA 4RR5A 3H4DA 1RAIB 5BYRA 4NLOA 1WI8A 3N28A 4C0OC 2IBOA 3S7RA 4BC9A 1M1KT 2AJFE 2LQ9A 5BXIA 1GK8A 4Q8FA 1QTMA 3DLEA 1EP4A 3UCUP 3CJ0A 4A8YA 2HSEB 2QRRA 5H9EK 4USWA 4RW6A 2WSCC 3PYEA 3HHDA 1KS2A 2UUCF 3RB4A 3D5MA 2ZZNA 3AB2B 5T14A 2HHVA 3BYPA 2IDLA 2E29A 3A3PB 4I6AA 3MM7A 3CMAS 3O5TB 2HHHF 3LP2A 3RR8A 4MIWA 2J0QD 3M9NB 1RT4B 4PAAA 1IR0A 2PE8A 3QGGA 3UFCX 2YWGA 2CWXA 3CC2S 1TL1B 2EFGA 5D0RA 1BHNA 3HVAA 2DNNA 1REVA 4PCQA 5D4PA 3GLJA 3FCWA 4TVAB 1M5SA 3BH7B 2Y1RI 1N5TA 1N36J 2VQFF 5ETMA 2AHOB 3K5NA 1U6FA 4NZ6A 3MR3A 1E6VB 2C2OB 4DZ6A 1FVQA 1VMBA 3K59A 1TZ0A 5DQHA 1D9AA 1HFEL 3NWRA 3HHLB 5DGBA 6AT1B 2HBYB 3W9HA 5FDLB 1NXIA 4RBUA 4RW4B 4YMEA 3LAMA 3L09A 1S6QA 4C8YA 3GPAA 1DZ5A 3OFHA 2IM3A 3GCWP 1JNZB 2HNDB 3UQSA 1X5PA 2VICA 3MAHA 2ZH5A 5KG7A 4GKKF 3M1VB 3QZ8A 5B7WA 4XDCA 2B4OA 3A4TA 2DB1A 1PO6A 1SH3A 2B6AB 3VAFA 1ZZFA 4Y2IA 5MLCV 3Q8PB 1T0TV 1T05A 1AZSB 5AXLA 2MMYA 2V8GA 2FZKB 2DISA 4C9DA 1QMEA 2XYPB 3H2UB 3DGPB 3AA8A 5LSOA 1NSPA 3MECB 2XZWA 5DDQC 4DR4J 3B4DA 4DV5F 2ZNZA 3SQOP 1TV6A 2ZKUA 4P10A 2B3TB 4NLPA 1JJ2R 2DHAA 2MZJA 1T3NA 5SZTA 5KFKA 4Y0FA 3CCRS 3QLHA 4B3OB 3OLBA 2AEFA 1RHRB 2AT1B 4USMA 3CCVS 2MZQA 1U45A 4ID8A 1H98A 5DQGA 4DN9A 3VV2B 3P3DA 4NRUA 3TARA 1ZYQA 4UT4A 5KG3A 2CYYA 2NXCA 5E5NA 3THTA 2C2KB 4NI2B 2DIVA 3NGDA 4PXCA 1X60A 3M6VA 3BBBA 3UN5A 2KJWA 3D6MB 4RUAA 1XBWA 4TY9A 1DFDA 2FQQB 2NZ4A 2ZWPA 2KRBA 2AYBA 4X65F 1CJKB 3HK2A 2MLXA 4ICLA 3KLFA 1KQFB 4OHWA 3CJSA 5HQLA 4ELVA 3FFIB 3MXHP 5KT4A 2ZJRQ 1U2RA 1SUQA 5KFOA 4QJGA 2A2DA 4MYUA 1SV5B 1MSWD 2I6WA 1SH2A 5IV3A 2YH0A 4I6YA 3EGNA 1RT2A 2QG9B 1J5OB 2ZOMA 2DGWA 1KBRA 3RB0A 1Q1KA 4BLGA 2DYAA 4WE1B 5IWAJ 1U1OA 5M1AA 1U1RA 2GMJA 2QC3A 3M4XA 3NY0A 1Q8IA 1OIAA 2IRYA 2MLYA 4DS5A 2JL9A 1X4GA 3S8SA 4QR2A 2M5YA 3MUVP 2YKMA 2XY5A 2AJ2A 3W62A 2VDHA 3OQ2A 2UUBF 3DWKA 3SSQA 2H51B 1L3TA 3VCDA 3R97A 1H6KX 1X4HA 2V0NA 3OT9A 1T3OA 1LWCB 2Y1IA 1SQGA 4Y2AA 2KI2A 2ZFHA 4WYLA 3PW2A 4QIEA 3M6UA 3NKYA 4OVDA 1YLXA 5J2MB 4Q7AA 4LREA 2BJ7A 4CO4A 3HHNB 5H9FJ 1YJUA 2R8IA 2BJ9A 2G1DA 3IGVA 2ZH3A 3PW5A 4GVBA 1M90T 2BANA 1YWXA 4LBHA 4OJ3A 2DGSA 4DR6J 2DNMA 4P72A 4ZP9A 4L75A 2HHSA 3FMBA 5IM0A 2D1CA 3NAIA 4F7VA 2VC1A 4N56A 1XTZA 5LMNJ 1FTCA 3LH2S 4OZNA 2BMBA 3VZHA 4DCOB 3CIZA 2YKAA 2OHDA 2P6SA 3TEGA 2CQPA 5IZHA 3G8SA 3M2VB 5FD1A 1WI6A 2HKEA 2V69A 2J7WA 3IM8A 2L9NA 2LMIA 3EVMA 1VQ9S 4WFBQ 1YJ7A 3FNNA 5KG6A 3GIMA 2Z4PA 2CKWA 4M5LA 4J9SA 1OO0B 5BR8J 3W60A 1S1WB 3D7SB 4RW8A 5IS2A 3M05A 2HFVA 1KQSR 1R0AB 4DSEA 4DKIA 2WADA 2B7CB 5BYSA 4K4VA 4FKXA 4MIAA 1B0PA 1IKXA 5KG0A 5ETKA 4O44A 4QIGA 1TK0A 2YX4A 2PMZD 2KB2A 4K5RA 2ZD1B 3H0PA 2CNLB 5KFJA 4J9KA 2FLOA 3QNWB 3U1LA 1IKVB 4U67Q 3M6XA 4JOUA 2W9AA 3QSIA 3IGNA 2VF3A 4ELTA 4PG6A 4TU9A 2NPIA 4IFVA 3T5KA 4ES2A 1FD8A 2W24A 2YKPA 3DLGA 4PWDB 4IOBA 2WONA 5MAOA 3MR6A 5F8GA 3DI6A 2FHKA 1BC6A 4I7FA 3AQOA 1SH0A 1MWZA 1X31C 2KL8A 2H5JB 1TU0B 2RT3A 1KWMA 2K06A 4I4BA 2CADA 2GJIA 5J2QB 2VZ9A 2CPDA 5JVGQ 1VQLS 4MFBB 4OHZA 4KO0A 2CQBA 5ETNA 1HNIB 3KLIA 3IRWP 4TYAA 4DUZF 4OYPA 3OXLA 2DCUB 2MZSA 3I9ZA 4ZP6A 4QWAA 4WFZA 3ENQA 2XYHB 4YFUA 4PR6A 4D3HA 5FLXY 4KH0B 1FI4A 4ECZA 1UVIA 2F4FA 2XMMA 2WBRA 4KFBB 3O6QA 1ITPA 3K5PA 4Y2CA 3L3CA 5HMYA 3W8GA 2JZ5A 1CJUB 2DJWA 2VODA 4JV1A 4N76A 4KHMA 4Q0BB 1Q4RA 5BR8F 5HP1B 4EO6A 1KOHA 4DR7F 1Q78A 2XY6A 1R6YA 1YVFA 4MAKA 4O23A 5KG5A 4CYUB 2CPJA 1U02A 4A8KA 4O3SA 4IG3B 1M1GA 4K50A 2MZ1A 1BD6A 1VK3A 4NMXA 1HLWA 1RP5A 2XMWA 3CD5A 1RBOB 2YTCA 2A0FB 4F2RA 3NL0A 2JRSA 2VG5A 1GX5A 2LA6A 2HMIB 2DVIA 2HG4A 2XNQA 3C16B 4DR1J 3N6LA 1EQMA 2H5IB 3KLGA 2FJXA 2ZOFA 4K0KJ 3PV8A 3DOMA 2X7IA 4KKOA 2QSFA 3UCZP 5DGAA 2A3JA 2VFTA 3R6GB 4TLRA 3H5UA 4WU2A 4W90B 2FY1A 4RX6A 5F8JA 4F67A 2HBRB 4QYRA 1CJTB 2RRAA 3PZPA 3V6JA 2O1PA 4DXLA 2LDYA 1IVZA 3L9ZA 4NOHA 2M8DB 2QLJB 4F4YA 2RJZA 5F8LA 2UV8A 3DOLB 4JV2A 3NBPA 5RUBA 1A7GE 4BBYA 1UWBA 3T6JA 1B7YB 4GC6A 1S1XA 3RTVA 3KTQA 2ADCA 4KGXB 2XTJP 2MQ8A 3R5AA 1WC6A 2N7YA 2YNHB 3CDUA 4NMLA 4ZVTB 3O2IA 3A13A 1TAQA 4RLEA 4JV5J 4DQRA 3GIJA 2CQGA 1O0PA 2W25A 5ADZA 2E1MC 4G1PA 5DO2A 2ZJQQ 5D15A 1D8ZA 4F4KA 5I3UB 1RAFB 2E5LJ 3LAKA 3CC4S 2FB0A 1MMLA 4IO1A 1PKUA 2E1AA 1HR0F 2I0XA 1IN0A 4LSLA 4ECSA 2QIFA 4HDHA 4B9NA 3I31A 1KFSA 4NLSA 3Q0AA 1IKWB 3QRRA 2YNFB 1CEZA 4M5KA 1U0HB 3QGPA 3VHQA 3PG9A 1HQUB 2EBGA 4DR1F 3GONA 1SJFA 9RUBA 2I8EA 4DQIA 3OHAA 4A8FA 3D54A 2BM1A 1LXJA 4DWIA 4EZ6A 5F3TA 3TW0A 1UVKA 4FS2A 4TYBA 3KHLA 1S49A 1HQEA 3F73A 1RQ0A 2BBEA 2LP4A 4U95A 2VPWB 1FXRA 3ZTSA 5IXUA 2BE2A 3GJRB 1Q95G 3CJ2A 4C2MA 1WG1A 3OTDA 2YNIA 2HLUA 2FVRA 2HHQA 3IRXA 1HBMB 4CTAA 4OLPA 1PYSB 2MKHA 3CCSS 2DR6A 2KT3A 1DLOA 1SQEA 5J2NA 1K1QA 3J7YI 2V8HA 4DL6A 4WZMA 2HHPA 4U8VA 3FQKA 2CQ2A 4YEAA 4DL5A 4YB5A 3L7UA 1NKCA 4WCEQ 3NGUA 3H7HB 2AGPA 2DNKA 2G9OA 4Y2MA 3IR6B 4NASA 2ZVIA 1N5VA 4DG1B 3WZ0A 1VIOA 3F56A 4RUHA 1ZAXA 3W7BA 2E9TA 1F2HA 4LRCA 3R7BB 2R7XA 5C24A 4HHHA 2HVHA 2JLEA 2KM8C 3NRBA 4J9NA 4M5IA 2QLWA 1VRTB 3IM9A 4EBCA 2CPFA 2DPJA 4LF6F 1YZ7A 3FJ2A 1K47A 2GIRA 2R2TA 4J9UE 5KFEA 1Y9OA 3PIOQ 1C0TA 3O44A 2K1RA 3MUTP 4KBIA 2EFVA 3M30A 4K4WA 5I42B 4R0QA 1XERA 2GS8A 3OTOF 4DPOA 1V5VA 3IBCB 4PWUA 4X4RA 2WCXA 4LSNB 3AD8C 1ZETA 1Q5YA 2FVQA 1OSCA 2FLNA 4CLZA 2B9WA 5M2PA 3V6DA 3T6BA 7FDRA 4R0EA 2ZM6F 1T8EA 1DTTA 5C25A 1MU2A 1CS4B 3W2VA 5IQ6A 3PDNA 1SIWB 1OWXA 1O5JA 2GVZA 1VQ8S 1YSJA 3TZZA 4DS4A 2DNOA 3EGWB 2R8JA 1FX4A 2GC8A 3HM9A 1MLAA 4X66J 1N5QA 2Q79A 5M18A 1Q8BA 1LWFA 4JP8A 2M0GB 3HVTA 3HX9A 1KHWA 2FJEB 4R8UB 4JI6J 4ZPWR 2RHSB 3PKMA 5CH7B 1NDKA 4PG8A 2WW4A 5HQ8A 5ETLA 2GAHC 2C3OA 4NA2A 2VPXB 2CPYA 4MIBA 1TVRB 5D6GA 1KSPA 5B0DA 3GIRA 3TZWA 2V9WA 1JNRB 4OYOA 3V81B 2MLZA 1TMJA 2WAFA 2DY1A 3PM9A 1ZZNA 1LWEB 2YVSA 4AE5A 1S7HA 2VBXA 5ETRA 3P45B 5KFZA 2KZMA 5C42A 5E41A 3LP0A 1QUPA 1URRA 3MOZA 4LF4F 4OYMA 1OQ6A 2G4BA 2XSJB 2D3ZA 4IQMA 1HBUB 4C8KA 1HA1A 4CI0B 2RRNA 4P75A 3JSBA 1RB0A 3DYAB 3FKBA 4M5DB 2Y1JA 3OL9A 5K8MA 3CCES 4O4GB 1PYOB 1O8BA 3K5MA 1FDBA 4WP8A 2WVCA 2VKZG 1T7PA 2MY7A 3VSLA 2OPQA 3BSCA 2CPXA 5L1LA 2DNZA 4M63A 3DRYA 5KG1A 3UNYA 1TELA 4LR9A 5A8WB 2E1CA 3IBWA 2VA2A 1PYTA 1HYSB 2DEJA 1WUUA 4B02A 3PR4A 1NAQA 2DTJA 4OYAA 1DARA 1FA0A 4HDGA 1X4DA 3B54A 4DR3F 3AXMA 2YWFA 2RS2A 5CYMB 4ED5A 5I3PA 1MWSA 3AODA 1QAJA 4ED6A 2DNHA 2FYXA 1J5EJ 1SL0A 3PJWA 1M5KC 2OPSA 1VQ6S 4HT7A 3KDNA 3TRGA 1FXDA 2EVZA 2R7QA 3T5HA 2KG0A 3MPWA 4BDPA 2EFNA 4L74A 3R5JB 1O51A 3D66A 2ZBQA 2M88A 1HW9A 5U47A 3NGKA 2ASYA 1SXLA 1OPIA 1VQSA 2DXDA 2Y0BB 4ZIVA 6FDRA 3HSJA 4ED8A 2H5EA 1IBMF 2WOMA 4JI3F 3CCUS 3NNHA 1OYDA 2ZH2A 1LK5A 1VJWA 2J9EA 3H20A 4DUTA 3CCTA 2LLZA 4ATNA 4URQU 2V68A 4KHRA 2HBZB 1WSRA 5KAKA 1SL2A 4PEOA 4DV4J 4J9RA 1R3NA 1UPPA 1RJJA 2MPUA 4A47A 2AX1A 3UR3C 2V6AA 2VQEJ 1RHQB 2G0JA 1S72S 4DDFA 1WKKA 1NB7A 1GAOA 4NZ7A 4C0BA 1J27A 1HNWJ 3JYTA 4ED0A 5CQGA 4DJBA 1RBAA 2LQJA 5HBMA 1DQAA 2Y8WA 4ZHRA 4OI1A 3DDKA 4I2PB 2OMOA 1L5UA 2N7CA 4PXBA 5DS7A 4GMKA 2C3UA 4MK8A 2GGPB 2DPIA 3CD6S 5HVGA 3TZXA 2M7SA 1TL3A 2VFUA 4ZJOA 2BQRA 2OUGA 4IOAQ 2HZAA 2ZNYA 3DOKA 1RWMB 3U27A 1N5SA 4USHA 1NKBA 2O3DA 5JJBA 5EWEA 4ID5A 1S9GA 1RT3A 4F4AA 4X62J 1PIEA 3HSDA 3O8WA 5C2CA 2UXDF 3OXFA 1B3TA 3ICLA 1EHWA 1KFDA 3KK3B 2D69A 5LSLA 4JI8J 1R89A 4IH5A 1P6TA 3OJUA 3QYYA 1LKZA 2H3EB 2JX2A 5KFLA 1FRJA 5DDOC 2DGOA 4K4TA 1PJ7A 3N0VA 1X7VA 3MTKA 1FEHA 2BW7A 2DNPA 1RT7B 1Y5IB 3MEEA 3QO9B 2XSFA 3PHEA 2XS5A 8ATCB 2ZH6A 4OJGA 4AT1B 4QR1A 1NB2A 5E33A 1MWQA 4MNRA 1H2TZ 1UA1A 3C15B 1HD0A 1U2FA 3G8QA 4PUOB 4IQXA 3SCLE 1LW0A 2HFUA 2XB2D 1QDUB 3D67A 1RTDB 2PC6A 3TAMB 1O6XA 4C11B 3MEGA 3GCXP 2A10A 3KK2A 1X4FA 2DR8A 4RW9A 4NCGB 3U1MA 1WF1A 4G1QA 4ZVSB 3HFVA 3K0JA 2DRBA 5CYJA 4EUVA 2O67A 2J7UA 5FIIA 1JJHA 4KT0C 3UR0A 4X64J 5DLFA 1TK5A 5KFMA 3ILIA 3FCVA 3I6PA 3HT0A 2J6SA 4CJNA 1W26A 3DHXA 3HHLC 1HPZA 2DKOB 1U8SA 4LIRA 3NWGA 1D0EA 2ERRA 4PKDB 3G82B 1EKRA 4P73A 1D9FA 5L9NA 2WVFA 2BDPA 4YY3F 2M3DA 4K8RA 3SIPB 1S79A 5H9FK 3GE9A 1N48A 3DXSX 4KJIA 2JLFA 1S1UB 4DUYF 2YKNB 4OHVA 1WDDA 3NEKA 1Y4ZB 4C48A 3QWPA 2DHXA 1JLCB 3I55S 1XMQJ 1AFIA 4N47A 4OX7A 3GFXA 4IRCA 4RNHA 2HNZA 3Q8RB 2AD9A 4IO9Q 3CCWA 1PILA 1HWJA 3BSNA 4L76A 2W4PA 4JV0A 5KT2A 3CO9A 1BUXA 3R27A 3I9V9 2VPZB 4M8LA 3D6TB 2LU2A 3DMJB 4DPXA 3QT7A 2RS8A 5IC6B 4WJBA 2DRAA 3DLLQ 1VC6A 2F4VJ 2YH1A 4N77A 2V2ZA 3IR5B 2NYIA 2RDDA 2NUUG 5F0WA 2P9GA 2OIHA 1B7FA 1FD2A 1KVKA 1MROB 1SBRA 4HI2A 3VQSA 2BXJA 4I1TA 3FBBA 3PEHA 3N79A 3EE3A 3QFHA 3P6YC 5HQMA 1RAJA 3O1LA 2ZITA 4X4NA 1WC5A 3OTCA 1WACA 4ED4A 1DURA 5KFUA 1SC3B 3HFZB 5HATA 2LXIA 4ANCA 3KHHA 2MQOA 1ZAWA 1KVJA 5A2QU 3UE2A 2R2UA 3KG4A 4DPWA 2KDOA 3AHPA 2Y3YA 4LF8J 5AE3A 5HK4A 5M2RA 4L6V3 1IWGA 4YUDA 1N0UA 1RCXB 3TYTA 1SKRA 2HVIA 4DR5F 2DNYA 1JMTA 3IS9A 2MQNA 3T5LA 1XR5A 2HPUA 1Z1ZA 1RT6B 4QIVA 4DFKA 2H54B 2AGOA 4QIWD 1QY7A 3GG1A 3KXDA 3UCGA 3VQTA 2QL5B 2HRYA 3LGMA 3UD5A 3VAJA 2MGZB 1FNXH 1YZ6A 5DDRC 4FBTA 4USUA 4X4SA 4JBCA 2AW0A 1TL4A 2HHXA 1KTVA 3RB3A 1I94F 2IC3B 2V8VA 1LWXA 2QJ3A 3JQKA 4KE5A 3MHYA 3R5DA 4X4PA 5C2GA 1ZM9A 4OYWA 5K14B 4FYDA 5IT4A 2X1AA 3E8OA 3J81U 1YKWA 4UQTA 2Q43A 1IKYB 3VGVA 5J1EA 2HZCA 1ZA2B 3CJ3A 1RTIB 3E01B 4EEYA 4TLQA 3F0NA 4X4UA 1RWVB 4YR2A 1YJTA 1FDAA 4NLDA 2E5IA 1GMWA 2BA9A 3Q86A 3R5GA 2JVRA 3MEDB 4CNZA 4H4OB 1RT4A 3Q8SB 4B3MJ 4ZPBA 4WTOB 4QYZJ 4ZP8A 2W9BB 1FJ7A 1TL1A 1IQTA 3UN2A 5DG8A 4HACB 4CNYA 4OI4A 1YITS 3CCQS 1M5PC 5HL7Q 1VOMA 2R8GA 2EC0A 1CPZA 4KAIA 3EZ5A 4ECRA 3RAMA 3GWCA 1J2VA 2OPRB 4DZDA 2CZVC 4KGZB 1RTHB 1XNQJ 1E6VA 1JB0C 1EX8A 3TR5A 1NJIT 4KTQA 3C66A 2NCKL 5FDLA 2IJFA 3THPA 4RW4A 1ZPVA 1ZS6A 2RDJA 3GYXB 3TJAA 1UEKA 4KR0B 2HIYA 2HNDA 3HT3A 2KYXA 3AB4B 1YDLA 3LALA 5L39A 3FRZA 3M1VA 4OJHA 4JI4F 2HVZA 3H40A 2B6AA 3ET6B 4I2QB 2IJRA 3G71S 3FBFA 5KFDA 1IBCB 3FEXB 3VZIA 5D0HA 4ZK7M 5CAAA 1XMOJ 2WW8A 3KUHA 2Z56B 1T9VA 4ZLPA 4CLYA 1AZSA 3AJDA 1F5BA 1N52B 1WHYA 1GT8A 1FNOA 4IG0B 5M19A 3DGPA 2VBZA 2MJUA 3MECA 2R7VA 3UI3A 3NMRA 1WF2A 2PEBA 2ATCB 1PAEX 4LUBA 5I3QA 2Y9HA 2MKCA 2AF6A 4ZLLA 3UPFA 2JWNA 3RRGA 3T1HF 4HEA9 2IM0A 1D3WA 3J7ZT 1NHKL 2QX0A 4LF7F 1MW7A 1YHQS 4HTIA 4B3OA 3RGIA 3U7JA 4ZCLA 2RIJA 2IAJB 1BQNB 4B3MF 4I56A 4WYWA 1G7CB 4WFYA 4F04B 1UETA 4QIFA 1S1TB 2JEJA 5KFQA 2B56A 4NEZA 2PSZA 3LUYA 4DEZA 4AD6A 1QM9A 4CLUA 3C6TB 2K7JA 5L1JA 4NI2A 4DV2J 1I6JA 5AE2A 7FD1A 2UXBF 4DFMA 1BWVA 4J7CA 2ZE2B 5IC4B 2OSQA 1XNQF 3P5TL 2WVEA 2YQ3A 1CJKA 4HH1A 3PRVA 2G1HA 2VG6B 1JLFA 4LMZA 3GR0A 3M8SA 1FFGB 1DTQA 3G86A 3G6VA 2N82B 3J80U 2ZHAA 1ZAVA 3MGJA 3FFIA 4LFBJ 1NPRA 2RVJA 3HVRA 1TL7B 4FYVB 2H1YA 1SV5A 1TMMA 2RHQB 1GXTA 2CJAA 3UDEA 1P8GA 1J5OA 3GZ7A 3MPUB 2PFFB 3KLHB 2IM2A 1D8YA 3D0HE 3TI0A 2X3DA 3PX0A 4OZJA 4PRFA 4AL7A 2Q1LA 1AB8A 3HJFA 3TUJC 5F9LA 2YNGB 3TOQA 2FHJA 1U0SA 4LRBA 2D9OA 3CE8A 1LWCA 2BYCA 2XZTB 3H5SA 3BKUA 1IM6A 2AIRB 3MM5B 4Z37A 2LQ8A 4ZDNA 5J2MA 5HMWA 2VFSA 5A2QY 3RRHA 2P2CB 4ZOSA 1HHTP 2F8HA 5F3ZA 3MPVA 2GIQA 3B8HA 5K8OA 5C7PA 2YY3A 1LFPA 4IDKB 4FP9A 2HBQB 4RNNA 2V2VA 4U7UK 4BWJA 3K17A 3B4MA 4Y3CA 1NO8A 5HMXA 1E6YB 3ZZRA 5HAOA 1PC5A 3M8WA 2HFNA 1VC5A 1YX2A 2GW8A 3M2VA 3D6HB 2DHHA 5KTQA 2ZJPQ 1SI9A 5AT1B 1SC1B 4LFBF 5D4LA 5EHHA 2B4VA 2YPZA 2JVOA 5DRKA 5THWA 4YR3A 4FF4A 1HNZF 2K3IA 1S1WA 4KSEB 5KT7A 2Z2ZA 1R0AA 3ZO7A 4KHPJ 1PCAA 2NSBA 5LMUF 4RNFA 1X0PA 2NPFA 1WWHA 3E3XA 1XK8A 4JI5F 1Y5LB 2MQQA 4K5SA 3CPWR 3ISZA 4KH1B 2VDIA 3J81Y 1K73T 2XGQA 5A8RB 2QGFB 5DZ7A 2V8DA 4G3IA 4YS2A 4DSJA 3EZOA 4F26A 1RI7A 1PG5B 2ZD1A 2JC1A 3KUGA 2UP1A 3NOGA 4K4XA 2IDEA 1TKXB 3GP9A 4DBQA 4NLVA 1IKVA 2XLIA 4CWBA 1XNRJ 3F44A 3RAXA 4WXOA 4ILLA 2KVQE 4EBDA 2FUG9 2X1FA 3NCQA 2CNKB 2E1RA 2V4JB 3RG6A 2YWKA 1F5AA 3ISNC 3LGNA 4HTJA 1TAUA 4BHQA 3AOCA 4ETZA 2QTWA 4FNIA 2AGQA 3W5XA 1C0UB 2J0SD 1JQGA 3LPYA 3L7OA 4EYHB 4Z7YA 4CP5A 1IBLJ 5D0GA 1RHMB 2B0GA 3BQ1A 2CIMA 4NLGA 4OX9J 3GSDA 3MCNA 4BC7A 2XCPA 2NLWA 2XMTA 2OELA 1KD1T 2EFPA 4MFBA 1RU2A 3KJFB 4RBTA 3ZZYA 2QL9B 4ALZA 1HNIA 1ICEB 1GMUA 3MAAB 3BPSP 1Q16B 3BZQA 5ETPA 5K9FA 3CO0P 3MM6B 2WVBA 3KOAA 2HQGA 3G8TA 4KFBA 3B6BA 3EYZA 5E3QA 5L8RC 2XHWA 2GMHA 1S99A 3B82A 2FY8A 1CJUA 1RYRA 1S6PA 2IY5B 4Q0BA 4QPTA 3PW7A 4JYAJ 5HP1A 2EPIA 1N8RT 1KR4A 2KO1A 3UE3A 1Q53A 3O3LA 2C28A 4JI2F 3T3FA 1RLDA 1FRXA 2QLXA 3ETMA 1K1SA 3MD1A 4NWBA 4CYUA 4F4ZA 3H25A 4IG3A 1NSQA 2KKHA 1VGYA 2AJ4A 1TUWA 5E0OA 3CULA 3HI9A 4YHHJ 1ZTTA 4B9LA 3HJVA 1EB0A 1IJEB 4V19J 4ZIWA 3GV5B 2CQHA 4CO1A 4CLSA 3PNIA 5LT5A 1NDPA 2NS1B 4B17A 2HMIA 3MAQA 2OI2A 3OC2A 3HMJG 2OP5A 1S1VB 2E5GA 2RD5C 2XI2A 3AJ2A 2IRXA 3BYRA 4DV0J 4A8SA 3LPEA 2CUYA 2BJ1A 2B9EA 3M2UB 4PZVA 3SQGB 3LANA 2QN6B 1JJ4A 1JLQB 3DLGB 3DI6B 5EWGA 5L1IA 3DRSB 2O66A 3UWTA 2OSRA 4EI2A 3K89A 2AYMA 1YBUA 3DOLA 1S5ZA 1VBXA 3R9LA 2FJAB 1NJWA 2ZEJA 1NK7A 5BJRA 1Q8LA 4CT8A 3QZ7A 1TKTB 1HNXJ 3JQJA 3M8PB 1XJWB 4KO0B 3J80Y 4OZ5A 5CABA 1N32F 3DNCA 1Y0HA 2AQ4A 2FJDB 1B64A 1R0BG 2B7BB 4PQAA 2BRKA 1BGXT 4JI7J 2G2OA 2G2YA 3QBCA 5J2PB 3DKDA 1VQQA 2W2MP 2GJ2A 4K2XA 1RAGB 2XMJA 2ZBIA 5HJXA 2W7PA 4UTGA 2BVZA 4W98A 4XIUA 4YHHF 2RKIB 3VGUA 3BSOA 2PD1A 3K5LA 2PA3A 4OV6A 4I67A 1Q5VA 4DV3J 4E98A 1N33F 2CWKA 1IKWA 5DDPC 2BACA 4I0WA 2YNFA 3AY0A 1FFWB 1U0HA 1FJGF 4P2XA 1HQUA 4YB6A 4QW8A 1P1LA 2A6OA 4JBFA 3TAPA 4FS1A 1NPKA 4RWWA 5SUHA 3HDSA 2B5JB 3ZZUA 4YDDB 2ZH8A 2VG5B 3I32A 3G4SS 3UO0A 3PRDA 1FKOB 1UVMA 2L9DA 2RQKA 4ZVOB 4IFYB 1HBMA 1RWKB 2IVFB 3N4WA 2CVEA 3W65A 1S7IA 2LCWA 3M8QB 3Q24A 4ZVQB 5LXYA 3AD9C 2N4CA 1Z2LA 2QLBB 3IAM9 3AOAA 3IWXA 4ERDA 3TNVA 1HBOB 1LEOA 4W4MA 2I9SA 4KGKA 4Y65A 1QAIA 2NXNA 3IR7B 1YRUA 3D3BJ 4NZ0A 5KFXA 4DF8A 1T11A 3ZZ0A 3E2EA 4G6VB 4DG1A 2G0CA 1HNVB 3Q8YA 3EXYA 1S0OA 2DO0A 2AU0A 4JI7F 2MKIA 1LW2B 2XMUA 1U49A 4LF5J 4I69A 2IFXA 2BE7D 1T03B 1F2GA 1ELOA 4PQUB 3AD7C 2AJ0A 2IA6A 2VHGA 4TY8B 4RZRA 4ZVHA 2DNLA 3POTB 3G6ES 2DXEA 3V4MA 2DGXA 1RGVA 5I42A 3MDFA 3QIDA 3FZ2A 4LSNA 3UPNA 2H65B 5L38A 2XI3A 1VK8A 4O4RA 5CZVA 3UVJB 3Q89A 2NXUA 1CS4A 3A12A 2AV5A 1RYSA 2C3YA 3OFGA 1N0VC 1DHMA 3MF5A 4IH7A 1X4BA 2ATLA 2MDAA 1T9UA 3HKWA 4ANEA 1UMJA 3HSGA 2CVIA 3ITHA 1VQNS 4TU8A 1JLAB 4IKAA 1RWPB 2CG4A 2EC2A 1NK9A 2KFYA 4EO8A 1S0VA 2NXJA 4R8UA 5FLXU 2W9CB 1TKZB 2DNGA 3IRXB 1HI8A 3SCIE 3MI7X 4P71A 1KC8T 1NH7A 1TVRA 1QUVA 2QL7B 2K2PA 2HAFA 2ZH7A 1Q82T 4LBPA 2L48A 2ZBPA 2VFRA 1KTQA 4NXNF 3FSXA 1SCJB 5LM7E 4J9QA 2LEPA 3LWMA 1LWEA 4WK1A 2PGCA 1S9EA 3KUEA 1PBUA 3CDEA 1I1GA 4CLKA 4N8NA 4LF5F 1KNZA 5A8KB 1Q7YT 3TVYA 2B8QA 3EXCX 1S9FA 3Q2SC 4OX6A 3OJSA 3Q2TC 3I0SA 5A6PA 2V67A 2XSJA 2BJ8A 5KFCA 3CNQP 1HBUA 5KFAA 4OZ1A 4ZCIA 2MYFA 4H4KA 2BJ3A 2RU3A 3DYAA 4M5DA 1ZBTA 1QTNB 1H7XA 2HFSA 4O4GA 5JXSA 4N5SA 3N5FA 3RZAA 2EXUA 3MD3A 1C0TB 2XCAA 2K1RB 2QA4S 2HZVA 1JLEB 2LEAA 3TJ8A 3BBCA 4C8NA 2KYZA 3I5AA 3J7A1 3J7Z5 3GFHA 2XEXA 3Q8VA 4ZVFA 2XBPA 3TWZA 1N36F 4FVCA 3H42A 4GKJJ 2AZ1A 4EU0A 2A18A 1MU2B 2E5JA 2DIUA 3EPGA 4NXMJ 1KLMB 1CJVB 3KWMA 3OR1A 1TP7A 1VQ7S 4M5GA 4OHYA 5CYMA 1HQ2A 1VBYA 3KMSA 4OZ0A 3T41A 2VA3A 5A76A 2EK6A 3AQPA 1RK8A 4FYYB 1KP6A 4F02A 1LWFB 1NUEA 1FE0A 2C2MB 3HVTB 4KC5A 4ZPAA 4GO7X 5D3GB 4ECVA 2KU7A 3G6YA 1WKLA 1FKPB 3EWGA 5B0GA 4H4MB 4CO3A 4URSA 3WX4A 4YN3B 4F0HA 3H4BA 3CCJS 2DBBA 3IA0A 3EZUA 5F8MA 3VAGA 3CJ8A 4DV6J 4DQPA 1RWUA 1TUGB 1T02A 4DFJA 4DR4F 1ZPWX 1X5OA 4F8RA 1RT1B 2FGCA 5C42B 3FSIA 3HZGA 1BLUA 4KV8B 1A0OB 3S1TA 1KRPA 4A8OA 3KMQA 3ZZPA 2DHSA 2Z58B 2DGQA 3BN4A 4OI6A 3IC1A 4R5PA 2I38A 4K2JA 1H73A 1KQGB 5DZ6A 1WEXA 3ULHA 2HNYB 3I96A 4RUCA 3NNCA 2AJ1A 5KFIA 2C2EA 1RTJB 2E44A 2UUWA 3KKFA 4B3SJ 4YB7A 1DQ9A 3SV3A 3SV4A 5K8PA 3D0IE 3W66A 1FWLA 2MHNA 5JMNA 1FE4A 2OFGX 2CJBA 4I6WA 3Q8UA 2GIFA 5HN0A 2VV5A 2RSQA 4UUWA 3ILJA 3GR1A 4EWTA 2V9KA 1FEEA 3UN7A 4DL7A 1IWAA 2ZDOA 4K4ZA 3JXOA 4R3JA 1TUVA 3MMCB 3SCKE 3LO7A 3H90A 4B9UA 2HRTA 2M8HA 1NU4A 2GGPA 1YGYA 4DX6A 2FTRA 1OSDA 5IWAF 3R7SB 1YTYA 4F2SA 4AYBD 5EX0A 2EEYA 2RDIA 5T41A 4DLGA 1K8AT 4ECQA 2KFNA 5CD4H 1M5VC 4DX8H 1R7IA 2NREA 5CCMA 4PPZA 1M5OC 3T1YJ 2BRLA 3CF5Q 4DV6F 3W3SA 4QU6A 2AP6A 2VUGA 1DJ0A 4QWBA 1YRXA 4U7UD 5KFYA 3KK3A 1VBKA 3ADAC 5F8IA 1YJNS 3H5XA 3X1LB 2OO4A 4NLWA 3NGSA 3W2WB 4ILRA 1YJ9S 5JVHQ 4NLYA 3RBXA 4RU2A 1RT7A 2WK4A 1WHXA 3QO9A 2CQ1A 2X1BA 4HKQA 4ZN1A 4LFAJ 1U1MA 4DR6F 4PWWA 4XDDA 3DM2B 2J9DA 5KFFA 3GG0A 3C15A 1UA0A 1CC7A 5FJ4A 2KTQA 1XR6A 3ZTRA 5LMNF 3LTOA 1V6HA 2MSTA 2YX1A 3C14B 4IRKA 2J76E 4DSIA 4WU3A 1VQ5S 2ZZMA 1YIJS 4DLEA 1NSKL 2J9DE 2HQFA 4RA7A 1Y00A 3R5BA 2QEXS 3DRPB 2RUGA 4RWXA 1RTDA 3EDQB 3IG1B 1FRIA 3TAMA 1FVSA 4C11A 2CNNB 1FDNA 3D68A 3VAMA 1HD1A 4NCGA 1P27B 2V50A 3ZZTA 4RUBA 4C97A 5HROB 3SFUA 4OI3A 2GQ2A 1NRKA 3OR2B 4PXDA 5KG4A 3DDNA 1WNEA 1ZH5A 1VQPS 2D41A 2D3OR 4XTTA 4QBUA 4P52A 3H98A 3L4BC 3D3CJ 3D1HA 3KLEB 3GIKA 3FRYA 2QA4G 4O3RA 1ROFA 3T1YF 3UDCA 2BEFA 2EG2A 1TFYA 3G82A 4CPKA 5ETOA 2WRMA 2VG7A 4ID5B 4P74A 4R23A 3GV7B 4E2FB 1LK7A 1HMVB 1MG7A 3PYDA 5CYQB 2XWYA 3PKYA 1S1UA 2YPYA 3V4IB 2ALZA 2KH9A 2YKNA 4OFZA 1QE1B 3VWSA 1X5TA 4G1IA 1JLCA 2W7AA 2QA2A 4ZLJA 4DPUA 2BQ3A 1WC1A 1C1BA 1JLGB 5GMDA 4E8UA 4XAKA 3C19A 3WHIA 5AJ3J 3EGZA 4RNMA 1VQOS 2GO8A 5B08A 4ED1A 4C3KA 3OBIA 3SI8A 1U1NA 3DMJA 2ZUGA 2QMUB 1CSJA 1Q7LB 4WP3A 4I68A 5A6WA 2KVIA 1WOPA 3QIPA 3PEJA 5GAHI 1IBKJ 3D28A 2CPEA 2KN4A 2ASJA 1N34J 3AA9A 3PVXA 2VOOA 4DSKA 3IP0A 1RAHB 4DSLA 3CW2C 4UUXA 5GAHU 2F7VA 3T5JA 4ZPDA 2CZ4A 1WC3A 3K58A 4FXWA 3DRRB 1N5YB 2V2QA 4OX8A 2UU9J 4LR8A 1OPZA 3KNAA 3VAIA 3BREA 1YJVA 2VJVA 2WZ1A 1TKDA 3MWBA 3EMTA 1CBKA 2MZRA 5JUMA 2HFOA 1R8CA 1Y3JA 3T19A 1VI7A 1H72C 3P5BP 3OUYB 3MURP 4J9LA 2JJ4D 4FF1A 1HPZB 2F8EX 2Z57B 4K0KF 2GAGC 3G9CA 2YWEA 1FK9A 2XLJA 2ROGA 2ZC3A 2GJFA 1PJ6A 3TEHB 1LNQA 1UEVA 4J9MA 3DDIA 4NL5A 2MSSA 4B9TA 3OL7A 1MNEA 2ZH9A 3BR9A 1RT6A 3W9JA 1MWRA 4C4WA 2QA1A 2DO4A 4CLTA 4C6AA 1NZAA 1UW4A 1I5OB 1NBEB 1VHFA 4Q5VA 4R25A 1K0VA 5M2UA 4A8QA 2MGZA 3I4HX 1GXUA 2MKKA 3J7YU 4DL3A 1NK8A 2HS3A 1GFWB 4FYWB 3FSYA 1H38A 4YQWA 2IC3A 1JK9B 1B70B 2AJQA 4JV5F 3AOBA 3CJKB 3KJVB 2V8PA 5F0UA 5K14A 1Q79A 1SB6A 1IXKA 4P2MA 4DX7A 2RMLA 4F36A 1VLOA 4FVMA 4LBIA 1IKYA 4CLLA 2RF2B 5T7LB 4JI1J 1Y3KA 1DAXA 4WP9A 1WHWA 4TQRA 3H2LA 1N54B 1AA1B 1BMQB 2VOPA 1RTIA 3BGUA 2ZOGA 3E01A 2E5LF 3BGFA 3GILA 3EQVA 4MJKA 5KFVA 4LQ3A 3H59A 3MEDA 5AXMA 3N6NA 3TAQA 2RU9A 1U4BA 4CDIA 3CC7S 2J5AA 1BQXA 2G13A 2UUCJ 2W9BA 2HGLA 3MMBB 1T9YA 4HACA 3JQMA 2HHHJ 1UL3A 1VRUA 4Y28C 4J91A 4ECYA 1MMDA 3GFZA 1RA6A 4Z2XA 2OPPA 3KHRA 3DN9A 2KXNB 2OPRA 2ZKTA 3UD4P 1RTHA 2ZDPA 3EX7B 4ENOA 2J6UA 2VQFJ 2LDIA 1EARA 3GV8B 5CA5A 3P8BB 2MY8A 2E1PA 1X0FA 2YQ1A 2Z2LA 3RUBL 3CCLS 3D1QA 1MMNA 4J5OA 3U1NA 3V5RA 4NLXA 4P2SA 2DH8A 2Q6BA 3UPPA 3KK1B 5ETTA 2CQ0A 3ET6A 4I2QA 4Q45A 3D9BA 5E7OB 2CNOB 4ZP7A 4GKKJ 1H2UX 1EZZB 1WEZA 2QYCA 1X8DA 2C2DA 2CJXB 1U25A 4KYZA 4IG0A 9ATCB 4AQYJ 4JI1F 1QVFR 1UJ5A 2BE9B 4NLQA 3GMGA 3TX8A 2JFDA 5KFPA 2DNRA 2ASDA 2ZHOA 3PO5A 4UOCA 3MM8B 3LO3A 4QQBA 5J1EB 2PI5A 1IUJA 2DNQA 2FZGB 2IAJA 1BQNA 1H2VZ 4DV5J 4WF9Q 5DM6Q 2ILZA 1PJ5A 3QSYB 3SFGA 2UXCJ 1S1TA 2G2ZA 3QJPA 3WQPA 1SC4B 4UW2A 5G0RB 2WSFC 3C6TA 3PFOA 3GJSB 2ACMA 4PG4A 3PY8A 2KXHA 2APOA 3C46A 3WIVA 1QSLA 1GMWD 2X3GA 2ZE2A 1FRLA 5I4MA 1PC4A 4K4YA 3R6LB 2U1AA 1BXNA 3MM9A 4F3QA 4TN2A 5KFGA 4LF2A 3PX4A 1XC9A 5HLFB 1SKSA 2VG6A 1MN9A 4WFNQ 4X66F 1OS5A 3VVTA 2V2KA 3D0GE 3AFGA 2NSCA 1KHVA 4X65J 1S4EA 1TL7A 1RT5B 1UPMB 4ECXA 4JI6F 2ZZTA 4IR9A 1U24A 3W63A 4HH0A 1CULA 5KFHA 1GXLA 2VPYB 4OZLA 1FXLA 4MKVA 3CB4A 4FF2A 3KLHA 3GTYX 3MMAB 3WIUA 5J1NA 3HHLD 2F1FA 2YKQA 2FVCA 4IYQA 3EM1A 4ECWA 4NCAA 1AT1B 4AQYF 2RAQA 2J0XA 2YNGA 3ONQA 4GVLA 4O0NA 2OTLS 1EAYC 1GX6A 2W2QP 4PG7A 2BKNA 1UVLA 2Q3PA 3RYLA 2XY7A 4MKBA 2RB7A 2UUBJ 2OTJS 3MM5A 3R2CJ 1L3VA 3OXGA 1F1BB 3NXZA 1U1KA 4O3NA 3BGRA 2UXCF 3I5CA 2ACYA 4ZVUB 2HQCA 3CMQA 3IWNC 3D4JA 3BEGB 4EYIB 3ZTOA 3R1LA 3PYGA 2HGMA 1NM2A 4IDKA 4ZVPB 1HHQA 2V4QA 4Y6IA 4ZITA 3OPKA 1UVJA 1E6YA 3QGHA 1G3OA 4ETXA 1YG0A 2AEMA 1X4CA 2YXLA 1NHUA 2CQ4A 4A4JA 2GNKA 3FDSA 1UP1A 4YP3A 4AL5A 4OZ3A 4LJMA 1RHKB 4DOZA 2FLPA 2HVDA 4KGVB 3C6UB 2KHDA 2F3JA 5E3RA 2HHTA 1JLFB 1DTQB 3V6KA 3FEZA 3KHGA 4NEYA 3GYGA 2IM1A 2C2RA 3GSIA 3CMES 1J5EF 1GTHA 4L72B 2CG8A 4I64A 2XS2A 1F9FA 2XLKA 5A8RA 5HVFA 1S77D 2GVDB 4LRFA 2BJEA 3QPIA 4HLBA 1NK0A 3RW7A 1QVGR 1TKXA 3IXQA 1U26A 3JS9A 2DCLA 1W2IA 1WDTA 2CPZA 4H54A 3RR7A 2N3OA 1UZDA 2HRUA 4FXVA 2X1GA 4RW7B 2V4JA 2PIIA 3DXBA 4DCPB 1C0UA 4F50A 2ROPA 4FDFA 2L41A 2MQMA 2Q66A 3GYNA 1YK9A 3RW6A 2FHJD 4F3OA 1HARA 3T9ZA 4M5MA 1T9TA 3JSRA 4XPCA 3PJXA 4DV4F 1JWWA 3MOJB 3MAAA 2W01A 1QSSA 4LIWA 4JI0J 2XO7A 3MM6A 2PA8D 2VQEF 2VL1A 3IFEA 4KPCA 3PW0A 1WC4A 4DUZJ 2EK1A 5KFRA 5KFWA 1RCOB 2LKZA 3IN5A 4A46A 2IPOB 1HNWF 4YR0A 2HHWA 3SZ2A 3VGSA 3NCPA 2JH3A 3VGTA 1RAOA 1T9XA 3HZEA 1QSYA 4YB1P 2HQIA 3KG0A 3JSMB 2ZWOA 2HVEA 2A2CA 3QAUA 2CXEA 1NCLA 4DR7J 1S6OA 4WKRA 1KEKA 3P4UB 2EKYA 3ZC4A 1QAYA 3M8RA 1X4EA 4X4VA 5E3AA 1K44A 3W1YC 1LOUA 2E7XA 3JTPA 1FWPA 4CH7A 3QGIA 3I82A 3BS9A 4CO0A 2E7VA 4WTYA 4X62F 1JKHB 3SYZA 3P96A 2R7OA 1U8WA 3D2WA 4ILMA 1S1VA 1FRHA 2FC9A 1Y11A 1FKAF 2W4DA 4DHVA 2AYEA 4C7QA 1JLBB 2DEIA 3M2UA 3L7PA 3OTEA 4JI8F 5A0YB 2JLGA 3SQGA 3CEDA 4EZ9A 3IMQJ 3BGLA 3ZZOA 1PBAA 2CPHA 1JLQA 2B43A 3TVKA 3PX6A 2HQ3A 1KKHA 3TUZC 4Q2MA 3DRSA 4CO2A 3SDEA 4YOEA 1NSAA 2Y0SD 2KFZA 2XNRA 4ZA1A 3OVAA 1U1PA 1MWUA 2GO9A 2F9JA 4CLFA 3OVBA 1EIYB 4NYOA 1K9MT 3LP1A 3BQ2A 1NLKL 4UOFA 2HFZA 4NX9A 4JI0F 2C3PA 2L08A 1TKTA 3M8PA 3VAKA 2I5JB 4ZJQA 4EMDA 1K25A 4AFFA 3BGOP 1WHVA 3GB0A 2ZVSA 3CVKA 5L1KA 4HVZA 1HBNB 1OQ3A 2F63A 2J9CA 2O5DA 2HLTA 4F3MA 1UJ4A 1B4SA 2Q6CA 4UY85 2QSWA 2D3O1 4CT9A 3W9IA 2IYIA 5J2PA 1S6PB 3FC9A 4QU7A 4DQQA 2LXUA 3KG1A 2H48B 4XO0A 3W61A 2XHCA 2RKIA 2FJBB 4X64F 1UFWA 4O3QA 1AYEA 1N6QB 4USTA 2C1EB 5KT6A 2B9XA 3QQCD 3P49B 3J81j 2MHEA 2IBKA 1EETA 3H8YA 4DPYA 1HR0J 1Q81T 3RBEA 1IR2A 2B5JA 2F40A 1C1CB 5ITHA 4ZCMA 1HI0P 2OFHX 1FKOA 3K2YA 1YBAA 1UFLA 2WHOA 5K8NA 4U96A 4CCHA 3IBFB 1IM4A 2HYIB 1VBZA 4IFYA 3UD3P 1KVIA 1IJFB 2LU1A 1W25A 2VC0A 3LA0A 1Z2ZA 1A6LA 1XMQF 2EBEA 3M8QA 3D1OA 3PJ9A 5HMZA 1I3OB 4MMOA 1FRKA 4LVOP 2AYGA 2NQPA 2U2FA 1HBOA 3OVSA 2DGVA 2R7WA 2DXFA 2XMKA 3VAHA 8RUCA 3FZBA 1RACB 3I0RA 1AUSL 1FTRA 1NH8A 2RE1A 2DH9A 2OLWA 4LRAA 1HNVA 4UQGA 2Z30B 2F4VF 3T9NA 1VRQC 2C42A 1D09B 4P9SA 1W7WA 1RA7A 2Z8QA 3J7AN 1LW2A 3V6HA 5IT9U 1RZMA 1VYAA 3M32B 3ZNJ1 4RKUC 1T03A 1R8HA 2UUTA 3HD2A 5B0AA 4PQUA 2R7RA 3CWJA 4TY8A 4M5JA 3HXMA 2JDJA 5CHCB 3DLHA 4LT6A 3POTA 2FC8A 4DX5A 3M2RB 4B9SA 2XYGB 4LF6J 1WEYA 4ZJLA 5IFMA 3WBZA 2LA4A 2KT2A 5D0EA 1PSDA 1OMSA 1ZA1B 1Z4UA 4NA3A 2XG8A 2WAEA 3DLKB 4V1Ak 4FXDA 4QPXA 3UVJA 2AZ3A 1I51B 1RHUB 3OTOJ 2R3VA 5KT3A 4DL0C 1OJ4A 3FBCA 5F8HA 1VQ4S 4KQZA 4J9OA 4LF8F 2C22A 1OY8A 3OV7A 5GMKa 5IV4A 3DC2A 3MPYA 2ZM6J 3R8YA 2K7KA 3HLUA 5DG7A 1RUSA 1JLAA 1S97A 4B3TJ 1MWTA 1NEEA 2GQCA 2WTFA 2ZC4A 3UNGC 3HHLA 3W5YA 3NGRA 4ZPCA 1FO1A 2W9CA 1TKZA 1Y7PA 2MKSA 2X51A 4N7TA 4QOTA 2B8PA 2HW3A 1BQMB 2M70A 1GEHA 3ZXWA 1SC6A 5KFTA 2W8KA 2JEFA 3LF0A 4B08A 2F9DA 2OGUA 2ZH1A 1BE4A 2ZUAA 5GMEA 2O01C 2BV3A 5HANA 1RLCL 1NJZA 3MPDA 2DGTA 2OH2A 5EUHA 3FVYA 2QE5A 1UFKA 2AWZA 2CQ3A 2Z2MA 1RHJB 2B4PA 3FCHA 5A8KA 4DI6A 4ES1A 3SMZA 4NRTA 3ISND 1PYYA 3Q8QB 4XPEA 1U1QA 1H0HB 1C4CA 1K0TA 3OHBA 4M94A 3VTIA 1SJ4P 4PYDA 3HD1A 3A8JA 1XR7A 2FHOB 1ZOTA 3DLEB 4LF4J 1EP4B 3BKFA 2YBVA 4J9PA 3R3TA 3NS5A 2BOPA 2ZBRA 3WC0A 2MJNA 4ZN3A 4RW6B 4MYTA 3CIMA 4ANDA 4LR7A 1JLEA 4CLPA 1U1LA 3VSKA 4IRDA 4LF1A 2MKYA 3MM7B 3PRBA 1VLYA 3LP2B 4C8LA 2KJVA 4QR0A 3B78A 3D6FB 1WC0A 2M52A 1R43A 1VFJA 4OL8A 1NK6A 4ZPVR 2WAQD 1REVB 2GHVC 3UN3A 4NCBA 1KLMA 2I1RA 3TX0A 4LSZB 5LOQA 2DY9A 1CJVA 1UZHA 4B3TF 3HULA 3K8WA 2HURA 3G6XA 2CAJA 1RXOB 1RWWB 1WG5A 2IVYA 3ITHB 1JX4A 2CDQA 1FFSB 3MEKA 4U9RA 4UOGA 2DR7A 3F41A 2J8AA 2PMHA 3M7VA 2UZAA 4DR3J 5D3GA 3N9UC 2PI4A 1G1XA 3CTRA 4WE1A 4CLWA 5L46A 1X4AA 3PW4A 1S6QB 1FKPA 5HVHA 1Q86T 4OQJA 4ZLNA 3HCXA 4BCAA 2KHCA 3OD2A 1P1TA 4H4MA 4FNHA 1XN9A 1XMOF 5CZXA 3CD0A 2L9WA 2W2PP 3E51A 4RNOA 1VC0A 4FPRA 5F41A 1HWIA 4NPOA 1S9EB 3OSNA 3BDEA 4TNOA 4J90A 4NLUA 1H74A 2J7KA 2XMVA 1VISA 1T05B 3ZZZA 2F5GA 1RT1A 1UCNA 2CPIA 3A8IA 4M5HA 4KV8A 3BKTA 4QCLA 4O3OA 3RBZA 3I0SB 1OYEA 1IBMJ 2VIHA 3QAEA
chains in the Genus database with same CATH topology
1UEUA 4BC9A 1V3RA 1U1MA 2LU2A 3DMJB 4DR6F 1TV6B 2RS8A 3PR5B 4WJBA 2DRAA 3DLLQ 4XDDA 1M1KT 1VC6A 4P7TA 2HNYA 2AJFE 2J9DA 3DM2B 2LQ9A 5GAGI 2YH1A 5KFFA 3GG0A 4Q8FA 4N77A 1UA0A 1QTMA 1CC7A 5FJ4A 3DLEA 2KTQA 1EP4A 1RTJA 3RB6A 3UCUP 1XR6A 3IR5B 3CJ0A 3QLHB 5LMNF 4A8YA 2NYIA 2NUUG 1V6HA 2QRRA 2MSTA 2P9GA 5F0WA 2YX1A 4IRKA 2J76E 4IR1A 5GAGU 2OIHA 1B7FA 1FD2A 1SJ1A 4DSIA 4LVNP 4WU3A 1VQ5S 2ZZMA 4RW6A 2WSCC 1T95A 1YIJS 1MROB 1SBRA 3HHDA 1KS2A 1Y5NB 4FN5A 4HI2A 4DLEA 2UUCF 3RB4A 3D5MA 4DV2F 3OTBA 3VQSA 2R2SA 2ZZNA 2BXJA 2EI5A 3AB2B 5T14A 4I1TA 4K4SA 2HHVA 2IA0A 5AE1A 2J9DE 2GQQA 4RA7A 3PEHA 3N79A 2E29A 4U6PA 1Y00A 3R5BA 4I6AA 2QEXS 3DRPB 3MM7A 3CMAS 3O5TB 2JHEA 2RUGA 3LP2A 2HHHF 4RWXA 4ZCKA 1RTDA 3RR8A 2HAIA 3P6YC 4MIWA 2LEBA 3IG1B 4DL4A 1FRIA 1RAJA 3TAMA 2JEGA 5B0EA 1FVSA 4C11A 3M9NB 2J0QD 3O1LA 1RT4B 1FDNA 1IR0A 2ZITA 2PE8A 3QGGA 3UFCX 3VAMA 1HD1A 2YWGA 4NCGA 1P27B 3CC2S 3ZZTA 1TL1B 2EFGA 4C97A 4X4NA 5HROB 5LJ5Y 3SFUA 3HVAA 2DNNA 5KG2A 5KFBA 1REVA 4PCQA 4OI3A 2GQ2A 1NRKA 3OR2B 5D4PA 4PXDA 1F0XA 3OTCA 1WACA 3OFEA 5KG4A 1DURA 5KFUA 3DDNA 1WNEA 1ZH5A 2VONA 3MMCA 1VQPS 2LYVA 2MQLA 2D41A 2D3OR 4P6QA 4QBUA 1M5SA 5CXTA 3HFKA 3H98A 2Y1RI 3OR1B 3FQLA 1N5TA 4ICLB 3D1HA 2VQFF 3KLFB 3KLEB 3MR5A 3GIKA 2LXIA 1CC8A 3FRYA 3KHHA 2QA4G 2DK2A 2MQOA 4O3RA 4DFPA 1ZAWA 1KVJA 3K5NA 1ROFA 1U6FA 3T1YF 2QT7A 3UE2A 3UDCA 2R2UA 3KG4A 4NZ6A 5D4OA 3MR3A 2KDOA 1E6VB 3AHPA 1FVQA 1SUQB 2EG2A 1VMBA 1TFYA 3ZFZA 3K59A 5AE3A 2WSEC 1TZ0A 5M2RA 5IT9Y 3EUNA 4CPKA 5DQHA 2WRMA 2VG7A 4L6V3 3CCMS 4ID5B 4YUDA 3C8YA 1D9AA 1HFEL 1RT2B 4DSFA 1ZTWA 2RQCA 4R23A 1N0UA 3HHLB 5DGBA 3GV7B 3TYTA 1SKRA 1YJWS 5FDLB 1A9NB 1LK7A 4RBUA 4RW4B 4YMEA 2HVIA 1HMVB 3LAMA 4DR5F 2BUNA 2KXFA 2DNYA 2CQIA 1JMTA 3L09A 5CYQB 1S6QA 4C8YA 2XWYA 3IS9A 4X2BA 2MQNA 3PKYA 3T5LA 1KQKA 1DZ5A 1XR5A 2P9CA 1D1UA 4OLOA 2DR5A 3OFHA 3U02A 2HPUA 2IM3A 1S1UA 1Z1ZA 1AUDA 1RT6B 1JNZB 2HNDB 3UQSA 1ZM2A 3V4IB 2ALZA 1X5PA 2KH9A 3MAHA 4F4XA 2YKNA 5KG7A 4OFZA 2ZH5A 4GKKF 3I87A 3M1VB 2YKMB 3QZ8A 1QE1B 5B7WA 2KT5A 3HKZD 1X5TA 4QIVA 3VWSA 4FBUA 4XDCA 2B4OA 2DB1A 4G1IA 1JLCA 2DH7A 4ES3A 4DFKA 2W7AA 1PO6A 3DLBA 1SH3A 2B6AB 3SEOA 3VAFA 1ZZFA 2QA2A 4Y2IA 1VQYA 2BQ3A 2AGOA 5MLCV 2P5VA 1C1BA 1JLGB 4QIWD 4M95A 1QY7A 5EN1A 4E8UA 4PWDA 3GG1A 4XAKA 3Q8PB 3UCGA 3VQTA 3EGZA 2HRYA 3LGMA 3W2WA 3VAJA 2MGZB 4RNMA 1FNXH 1N56A 1YRTA 1T05A 1VQOS 5DDRC 4X4TA 4FBTA 2GO8A 5AXLA 4X4SA 5B08A 2MMYA 4JBCA 4ED1A 2AW0A 2V8GA 3ZFVA 1TL4A 2DISA 1X9SA 4C9DA 2HHXA 1QMEA 1KTVA 3RB3A 3TA0A 2GFFA 3HHEA 3H2UB 4C3KA 2GHPA 1I94F 2IC3B 2V8VA 3AA8A 4KPYA 5LSOA 1CLFA 3MECB 3OBIA 3SI8A 1U1NA 5J2QA 4KE5A 3MHYA 2XZWA 3R5DA 5DDQC 4X4PA 2FHMA 4R5PB 3B4DA 1R8BA 4Y2KA 4DV5F 2ZNZA 1HWLA 1ZM9A 3DMJA 5K14B 1TV6A 4FYDA 2ZUGA 5IT4A 2X1AA 1CSJA 2ZKUA 3E8OA 1C2PA 2B3TB 1Q7LB 3DM2A 4NLPA 4I68A 4UQTA 2Q43A 1JJ2R 5A6WA 2I2YA 1IKYB 2KVIA 3CXCR 2DHAA 1NK4A 2MZJA 3QIPA 4JUZA 5SZTA 5KFKA 1M5HA 1T3NA 3PEJA 5GAHI 2BANB 5J1EA 2HZCA 3D28A 4Y0FA 2CPEA 2KN4A 3QLHA 3CCRS 2ASJA 4B3OB 3AA9A 3PVXA 3OLBA 1L3UA 2VOOA 4DSKA 3CJ3A 4D3GA 3CCVS 2MZQA 1U45A 3CSKA 1RTIB 3E01B 4ID8A 4EEYA 4TLQA 4DSLA 1H98A 2UVWA 4UUXA 4X4UA 5GAHU 2F7VA 3T5JA 5DQGA 4YR2A 1YJTA 4DN9A 1FDAA 4BWMA 4NLDA 5IM0B 3P3DA 4NRUA 2E5IA 4ZPDA 3TARA 3BQ0A 1ZYQA 2BA9A 2QMXA 1XEZA 2CZ4A 2JVRA 3DRPA 5KG3A 4CIOA 2CYYA 3MEDB 1R31A 4USJC 3K58A 4FXWA 3IG1A 4CNZA 5E5NA 4H4OB 3DRRB 1RT4A 4IH6A 4WFAQ 1UAWA 4OX8A 3Q8SB 1N5YB 4ZPBA 3THTA 2D3UA 1OPZA 4QYZJ 4ZP8A 2FDNA 3PFEA 2DIVA 3NGDA 4MTPA 1WTBA 3JSYA 2W9BB 1BY9A 4PXCA 4DL2A 1TL1A 3KNAA 4C8ZA 3VAIA 1IQTA 3BREA 1FJ7A 1WG4A 3IO1A 5DG8A 5HROA 3M6VA 4CNYA 2KJWA 1YJVA 4KHPF 3OR2A 4OI4A 4RUAA 1YITS 5KSHA 1XBWA 3CCQS 1M5PC 1TKDA 5HL7Q 1VOMA 4TY9A 1DFDA 2NZ4A 2KRBA 4AL6A 2AYBA 3MWBA 4X65F 2OAUA 2R8GA 2VOPA 2EC0A 2PDAA 2MZRA 3HK2A 5JUMA 2HFOA 4MKYA 4GO5X 1CPZA 4KAIA 4ICLA 4CQ1A 3EZ5A 2YWHA 4RW8B 2VASA 3KLFA 1KQFB 3KLEA 4NYZA 4ECRA 1R8CA 1Y3JA 3ENVA 3T19A 1VI7A 4OHWA 4C0HA 3RAMA 3OUYB 4F4WA 4ZVEA 3MURP 4J9LA 2JJ4D 3GWCA 1J2VA 2OPRB 4FF1A 1HPZB 2CZVC 1RTHB 4ELVA 3FFIB 3MXHP 1IKXB 1E6VA 2F8EX 5KT4A 2ZJRQ 1BWEA 1X9MA 1U2RA 3N6MA 1JB0C 1SUQA 5KFOA 3A1YG 2A2DA 4K0KF 4QJGA 4WKYA 4MYUA 1SV5B 1MSWD 3TR5A 4O44B 1SH2A 2YH0A 1NJIT 4I6YA 3EGNA 2ZHBA 3G9CA 2YWEA 3PACA 1FK9A 1RT2A 2XLJA 1J5OB 2ROGA 4KTQA 2ZOMA 2ZC3A 3C66A 1XNRF 2DGWA 3BR8A 2W8LA 3RB0A 1Q1KA 5FDLA 2HHUA 2IJFA 4WE1B 3THPA 4RW4A 1ZPVA 1U1OA 1HMVA 1UEVA 3UDLA 4J9MA 5M1AA 4NL5A 2RDJA 1U1RA 2MSSA 3GYXB 2GMJA 5CYQA 4B9TA 5EX3A 3DCAA 2OLUA 3OL7A 3M4XA 4KR0B 1Q8IA 1OIAA 2IRYA 1MNEA 2ZH9A 1SJRA 4DS5A 1N88A 3BR9A 2MB0B 1RT6A 2HNDA 3HT3A 2OMLA 2JL9A 1X4GA 2KYXA 3V4IA 2NR0A 3AB4B 1MWRA 3LALA 3S8SA 5L39A 4QR2A 1X5SA 3FRZA 4C4WA 3M1VA 2M5YA 3NLCA 2ZH4A 1FHTA 3MUVP 2QA1A 2YKMA 2XY5A 4OJHA 1QE1A 2DO4A 4JI4F 2HVZA 3H40A 2DT9A 1IBLF 3M6WA 1TR0A 1VQMS 2B6AA 1NZAA 1S48A 1UW4A 4I2QB 1GH8A 1VHFA 4IFVB 4Q5VA 4R25A 3OQ2A 1JLGA 1JXLA 2UUBF 3DWKA 1K0VA 3G71S 4FF3A 4OX9F 1GTEA 3SSQA 5M2UA 5KFDA 2WONB 2EG1A 1L3TA 3VCDA 3FEXB 3VZIA 2B4UA 5KT5A 4ZK7M 4A8QA 2MGZA 1H6KX 1X4HA 2V0NA 2WW8A 3I4HX 1T3OA 1GXUA 4I7FB 4ZLPA 1URNA 1LWCB 3HP6A 2MKKA 2Y1IA 3J7YU 1F5BA 1N52B 4Y2AA 4ZMMA 4DL3A 2KI2A 1NK8A 2ZFHA 4WYLA 2HS3A 3PW2A 1L3SA 1VIXA 1KN6A 1WHYA 2RH3A 4QIEA 3FSYA 1GT8A 3M6UA 1FNOA 3NKYA 4IG0B 4YQWA 3DGPA 1H38A 5M19A 2VBZA 4OVDA 3HVWA 2IC3A 1JK9B 2AJQA 2MJUA 3MECA 2R7VA 1WD6A 2D9PA 3UI3A 1WF2A 3NMRA 4JV5F 5J2MB 3K8VA 4OMFG 4LUBA 4Q7AA 4DMZA 4CO4A 5I3QA 3CJKB 2MKCA 3KJVB 5F0UA 5K14A 1Q79A 1SB6A 1IXKA 5C5JA 2AF6A 3HHNB 3UPFA 2JWNA 3KLIB 3K5OA 2RMLA 3DRXA 3RRGA 3DU5A 5H9FJ 3T1HF 1YJUA 4FVMA 4HEA9 4M1KA 1IKYA 2YNHA 2IM0A 2R8IA 2G1DA 3IGVA 1D3WA 2ZH3A 3PW5A 3J7ZT 4V19X 1M90T 2BANA 2EWHA 1YWXA 2RF2B 5T7LB 4LF7F 1MW7A 1Y3KA 1YHQS 4HTIA 4OJ3A 1DAXA 2UVUA 4B3OA 1WHWA 4ZCLA 3U7JA 4TQRA 2DGSA 3H2LA 1N54B 2RIJA 1SIZA 2IAJB 1BQNB 5E3PA 4B3MF 1RTIA 2DNMA 2GMLA 2ZOGA 3BGUA 3E01A 4I56A 4WYWA 2E5LF 3BGFA 1D9DA 3GILA 4JYAF 3EQVA 1G7CB 4WFYA 2H9ZA 4Q2LA 1UETA 4QIFA 4A8XA 3T1AA 4ZP9A 2HHSA 4X4OA 3CDWA 3FMBA 1S1TB 5IM0A 4MJKA 1H3DA 5KFVA 2JEJA 4LQ3A 2D1CA 5KFQA 2B56A 3NAIA 2VC1A 3H59A 5G4DA 4OJ1A 1XTZA 4N56A 4ECTA 2PSZA 3MEDA 1FTCA 5GVQA 3LUYA 3LH2S 3N6NA 4OZNA 5AXMA 3VZHA 4DEZA 1WF0A 3N01A 3TAQA 2RU9A 3CIZA 5GAEI 1U4BA 2YKAA 3DRRA 1QM9A 1N5YA 5I3UA 4LFCF 3C6TB 1VS3A 4IOCQ 2K7JA 3OSPA 2P6SA 3CC7S 2J5AA 1BQXA 2CQPA 2G13A 5IZHA 3X3UA 5L1JA 3G8SA 2VBYA 3M2VB 3NCRA 1I6JA 5FD1A 5AE2A 1WI6A 7FD1A 2W9BA 2UXBF 2HGLA 3MMBB 3CJ4A 4DFMA 2DITA 2J7WA 5HI7A 2L9NA 2LMIA 2ZE2B 1VQ9S 5GAEU 2V4RA 4WFBQ 3PO4A 1UL3A 2OSQA 4A8MP 1XNQF 3FNNA 3P5TL 5KG6A 3GIMA 4C3MA 1VRUA 4Y28C 2OLVA 2Z4PA 2CKWA 2YQ3A 4HH1A 2R7SA 4ECYA 4J9SA 1MMDA 3GFZA 1OO0B 3GIIA 2EW9A 1S1WB 4RW8A 5IS2A 3M05A 1RA6A 1KQSR 1R0AB 4DSEA 2VG6B 1JLFA 4Z2XA 3GR0A 3M8SA 4LMZA 3OUYA 2OPPA 3KHRA 4DKIA 2WADA 2B7CB 1DTQA 3DN9A 3G86A 5BYSA 2KXNB 2N82B 2OPRA 3G6VA 4K4VA 4WIIA 2ZHAA 2ZKTA 1ZAVA 3UD4P 4MIAA 1RTHA 1B0PA 3MGJA 3FFIA 5H9EJ 1IKXA 1S6UA 2RVJA 2ZDPA 4BS2A 1SJQA 3HVRA 5KG0A 2PEHA 3EX7B 1SV5A 4BL3A 4O44A 4QIGA 2VG7B 2EFOA 3AAWB 4E0DA 2BM0A 1GXTA 2J6UA 1UJ6A 1TK0A 2YX4A 2AX0A 2LDIA 2CJAA 2VFVA 4DV0F 1P8GA 3GV8B 3GZ7A 2PMZD 5CA5A 1J5OA 1KLNA 2VB6A 2MY8A 2KB2A 4X84A 4K5RA 2FPHX 1X0FA 2Z2LA 2HS0A 2PFFB 2ZD1B 5KFJA 3CCLS 4J9KA 3KLGB 2FLOA 3KLHB 2XWXA 3D1QA 1MMNA 2IM2A 4J5OA 4KKOB 1D8YA 3VALA 3D0HE 3U1NA 3V5RA 3TI0A 3U1LA 3SSRA 1IKVB 5IQQA 3PX0A 4NLXA 4P2SA 3CDBA 2DH8A 2Q6BA 3M6XA 4U67Q 3UPPA 1QMFA 4JOUA 2W9AA 1G6BA 4OZJA 3TO8A 3KK1B 2UVVA 3IGNA 4PRFA 2CQ0A 4AL7A 2Q1LA 5LXRA 2KRRA 4ELTA 4KRWA 4PG6A 4TU9A 2NPIA 4I2QA 4Q45A 3HJFA 4IFVA 3TUJC 1C1BB 3T5KA 2QZ8A 5F9LA 4ES2A 1FD8A 1P9QC 2W24A 2YKPA 2FHJA 2YNGB 3DLGA 5E7OB 3TOQA 4IOBA 4PWDB 2WONA 2PN6A 5MAOA 5KFNA 1N4LA 2BW2A 5F8GA 3MR6A 4ZP7A 3DI6A 2FHKA 2D9OA 1BC6A 2PO4A 1H2UX 1HNXF 4I7FA 3AQOA 3CE8A 1LWCA 2IYGA 1SH0A 1MWZA 2BYCA 1F60B 1WEZA 3VR1A 3H5SA 2QYCA 1X8DA 2C2DA 3KLVA 1U25A 2B9YA 2OD6A 2RT3A 2COLA 4IG0A 4I4BA 3NBPB 2KG1A 1UWBB 3MM5B 3R1HA 2GJIA 4JI1F 1QVFR 1UJ5A 4Z37A 5J2QB 4ZDNA 2VZ9A 2HGNA 2CPDA 5JVGQ 5J2MA 3DLJA 4NLQA 1VQLS 2RQMA