2ZC3A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (biapenem) from streptococcus pneumoniae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
molecule keywords Penicillin-binding protein 2X
total genus 34
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc3A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc3A01
1QMEA 1K25A 4QJGA 3UPNA 4BL2A 1MWUA 4R0QA 3VSKA 3EQVA 3EQUA 4CPKA 3ZG5A 3LO7A 5U47A 3VSLA 1MWRA 4R3JA 1PYYA 3UPOA 4RA7A 2ZC4A 4DKIA 1RP5A 4OVDA 2ZC3A 1MWTA 5M19A 1QMFA 1VQQA 4R1GA 3UE3A 4BL3A 4MNRA 1MWSA 4JBFA 2Z2LA 3UPPA 3UN7A 2Z2MA 5M1AA 4CJNA 5M18A 3ZFZA 4N1XA 4R23A 3ZG0A 5KSHA
chains in the Genus database with same CATH superfamily
2KN4A 3UN5A 3QSYB 3KTQA 1TMJA 1WTFA 5MLCV 1VJQA 2EC2A 2DHXA 2HSEB 3SBMA 2RVJA 5LMNJ 1YJUA 4DSKA 4QWDA 3SI8A 3KKFA 3QSIA 2GA7A 2Z57B 5A2QY 3HF5A 4I0WA 4NEYA 4LQ3A 2KTQA 3IS9A 2BACA 2R3VA 4USMA 2VG6A 3RBZA 4WFYA 5DDQC 3C15A 1URNA 3HSZA 3J7YU 3H2VE 4RUBA 3RAXA 1IWGA 4LFCF 4DR6F 2EFQA 1KFSA 3UDEA 2HHHF 2CNLB 2JEJA 2UUCF 4DX5A 1KC8T 5E3CA 2XNRA 2E9TA 4OZ2A 1Z4UA 3BDEA 1YRTA 5DG8A 2FHJD 1R0CB 4YB1P 2D41A 4DG1B 3QJPA 4DF4A 5F3TA 1D1UA 2OTLS 4LT6A 3UE2A 1J5OB 4P72A 2L9DA 2D3OR 4KPCA 2OLWA 4DLGA 5CYQA 4GMKA 3D66A 2AKWB 4BL2A 3HMJG 2ROEA 4N56A 1IBMJ 4WE1B 1TAUA 3IA0A 2XSJB 1KR4A 4BCAA 2A18A 2XC9A 1ZM4A 4PG5A 5JMNA 1ZETA 1S49A 3NL0A 5GADU 4P7VA 1IWAA 5KT6A 1UEUA 3KLEB 2O5DA 4RUCA 2WTFA 1GXUA 2ALZA 3TP2A 1IBMF 2AGPA 5A6PA 1BQXA 3RAMA 3H4BA 4GVBB 2XWXA 3EZOA 3UFCX 3ZC4A 4B02A 2WZ1A 2ZVIA 3DI6A 5T14A 4X4TA 3U1NA 3CIMA 2ZM6F 3FZBA 1MMDA 1WC0A 2GVDB 4S0MA 1YBTA 1HNIB 4R25A 1YZ6A 3VGSA 4DX8H 4EK2A 2B7BB 4DV0J 1RAIB 1FKOA 3B54A 4P73A 1D0EA 1T7PA 3RZAA 3TW0A 3CCUS 2FJAB 4HI2A 4C11A 2MQPA 2XM3A 1S72S 3TA1A 2N7YA 4RNMA 1Q8KA 3G6YA 4CNYA 4TNOA 4URGA 2AU0A 4Q8EA 1IM6A 2BRKA 2AP6A 4JI1J 1UVKA 4ZVEA 2ZM6J 2WVCA 4YUDA 3BN7A 4DFPA 2BE2A 3DLKB 5IOLA 4H4MA 3A8EA 3CD5A 4LSLB 3M8PA 3JS9A 4OX6A 2NR0A 1S7IA 1NO8A 4M5DA 4DZ6A 2EI5A 2QLFB 1F0XA 2U2FA 4LR8A 4MK7A 4ZVFA 4R8UA 3W63A 2RKIA 5BR8F 1VYAA 1TV6A 3RB3A 1I94F 5J1PA 1YJWS 3ETMA 2F4VJ 1WI8A 3WX4A 5IWAJ 3TEHB 3ZNJ1 3BQ1A 1WTBA 4KAIA 1E6YB 2BV3A 2YVSA 3TVKA 3HSJA 4KR0B 5AXLA 3PV8A 5J2MB 3SYZA 4TU8A 3T1YJ 3MCOA 1NNDA 1Y10A 2PEBA 2UV8A 3O44A 2UZAA 5CHCB 2MZ1A 5CXTA 2LFVA 3E51A 4OZ1A 4QYRA 4ZCMA 5HJYA 1M5KC 1B4SA 5GAHU 4DR2J 3LPEA 2XG8A 4HI1A 3IG1A 3I6PA 2E9RX 4DKIA 5JXSA 2NSBA 5AJ3F 3OC2A 4J9KA 1N52B 1S1VB 4DV4F 2CZ4A 3J81j 3BM7A 4KGZB 2H48B 4JBCA 4A8SA 4NXMF 3D68A 4FYWB 2G2OA 3OLAA 3GIJA 3M1VA 3W65A 1RGVA 1HI0P 1X31C 1Q79A 2HHPA 3UQSA 1IQZA 4USIA 1X9SA 4JV5J 2HWHA 1M5HA 5HJXA 4PKDB 4YHHJ 1NPPA 3PR5B 4MK8A 2B3TB 1VMBA 4DV4J 3OVSA 2V94A 2QL5B 3GCXP 1RB0A 1T0TV 3NGSA 1T9WA 4LR9A 3FCHA 3DNCA 5DG9A 4XIUA 3L7PA 3W9JA 1O0PA 3EUNA 4O3QA 2HRYA 1WC3A 5HP1A 3TX8A 4M5KA 1KQFB 2L48A 3DGPA 3CSKA 3HLUA 4GKKJ 2DHAA 2GVZB 3T41A 3AXKA 4B17A 3KG4A 4ZIWA 2KYXA 2XGPA 4F4KA 3CJRA 4CJNA 1R27B 4ZP9A 4CO5A 1FD2A 2HS4A 3ZTRA 4ZLNA 1BY9A 1TL7A 1T9UA 3EMTA 5I42B 2MKJA 2BUNA 1TKZB 2QRRA 4ED1A 1S4EA 5L9NA 4F67A 3EICA 4YR2A 3CF5Q 1SH0A 2PDAA 3TZWA 1ELOA 3MMAA 1ZZFA 3IBCB 3VAKA 1K47A 4WKYA 4PWWA 1U1QA 2KU7A 2BMBA 7FD1A 3S8SA 4C3LA 1JJ2R 4WF9Q 3TJ9A 2BEFA 1IJEB 2H51B 5K9FA 1GTEA 1UA1A 2L9NA 1Q4RA 1YLXA 2XCAA 4NZ7A 3VHQA 2KB2A 5D77A 4P71A 1WKJA 1TL1B 2X1BA 4NLDA 5T7LB 2J0XA 3QRQA 5KFSA 4DUTA 1UAWA 3Q8UA 2B5JB 1W25A 1SB6A 3MEGA 2L08A 2VFVA 4N7TA 1U4BA 4UZBA 5E5NA 2B4UA 5AE1A 4X4VA 2YWHA 3R9LA 4M94A 1WELA 4DL2A 4C8MA 4Y2AA 3D54A 2XHWA 1O5JA 2YNIB 5D3GA 1C4CA 1QDUB 2IDLA 3PRVA 3O5TB 2PC6A 3W3SA 1YZ7A 1N56A 3ZTSA 2C3UA 5LXRA 1X4DA 3C15B 3DDNA 3MPUB 3TOQA 2DGVA 1IR1A 3E01B 3POTA 5EHHA 3D3BJ 3NBPA 3N79A 2CQGA 5GMEA 2DO0A 4QIWD 2WOMB 2J7KA 3A12A 3ZZUA 1HNWF 4K4SA 5DQHA 3QATA 3PEJA 5IM0A 1KQSR 3OSNA 3PW2A 4LRFA 4ZITA 1SCJB 1N4LA 4JI3J 3B4MA 4NLYA 1U49A 2YQ0A 3A13A 1JMTA 4K0KJ 2ADCA 2V63A 2BOAA 2KJWA 4BBYA 3K2YA 2WW4A 4P2SA 4K5RA 1HQEB 2MLZA 3MCNA 2CQ1A 2MQ8A 3M6UA 1DJ0A 3IP0A 5KFHA 2W9BA 3AJ2A 3U7JA 3FC9A 2P9EA 2C3YA 2MYFA 1SKWA 1HNXJ 3TA0A 1SUQB 3H0PA 3TUPA 4DX6A 1IKXB 4Q5VA 2QGFB 4LRAA 4FYYB 2YKQA 3BZQA 1LWCB 1KKHA 2VD3A 4ZPDA 3BSOA 4JV0A 1RWWB 2ZH2A 2DR5A 4Q2MA 4JV2A 1U1MA 4OI4A 2RRBA 3CCZA 4JOUA 4LSNB 1VK3A 3DXBA 4YOEA 3FMBA 2VQFJ 5KFIA 3NCPA 4DXLA 4QR0A 1XMOF 3V4MA 4YMEA 3GR1A 4K4WA 1CJKB 2A2DA 4ID5B 1NXIA 2V8PA 4MIAA 4RWWA 4B3TJ 1RWPB 3MM7B 4JI1F 2Y0BB 3PYFA 2A3JA 1K1QA 2EVZA 4RUAA 3MF5A 1TP7A 2EEYA 2F4FA 2MSSA 3LP1B 1RU2A 3HSGA 3R5JB 3KXDA 5A8KA 2WB1D 3QZ8A 3M8SA 3EYZA 1IR2A 1NK5A 2KT2A 1PYSB 3GLJA 4TYAA 4HVZA 1VC0A 3V4IA 1C1CB 5DRKA 2HNDA 4RW4A 3RRGA 2K3IA 2IHR1 2B56A 2DY1A 3KUHA 4O4GB 3W5XA 2BKOA 1LFWA 2J8AA 4JB8B 2W8KA 5IWAF 1YI2S 5DDOC 2UXCF 1JJCB 1CJKA 2AJ2A 3TYTA 4PG6A 5CYJA 4DPXA 3WQPA 3MM7A 1RU1A 1UP1A 1QSLA 1B3TA 2HAIA 2AZ3A 1ULRA 3HFZB 2AEMA 3PIOQ 2KXHA 1Q86T 2UUTA 2CVIA 4MMOA 2R7XA 2D3O1 3W5YA 2KJVA 2X1FA 3P4UB 2E44A 4GVLA 1VOMA 4HR2A 4NA3A 4U67Q 3DLGB 1SJ4P 4L76A 2K1RA 1VBZA 1IUJA 3NS7B 4GC6A 3OSPA 2CAJA 3QMQA 4FPRA 1XR6A 2I5JB 2VIHA 4K4TA 1FHTA 2Y0SD 2XI3A 4L6V3 3T9NA 5KFNA 3CPWR 4DSIA 4LSZB 3NKYA 5HI7A 3RG6A 5L9XA 5KFDA 4KRWA 3NAHA 2C2RA 1U2FA 3SSSA 3MURP 2QA4S 2DGTA 3EQVA 2F5GA 2BZ2A 4DR5F 2G0IA 1TKTA 1UETA 2RSQA 4ZJQA 2VB6A 3D1QA 4JYAF 2RQCA 1Y9OA 5DS7A 4ETZA 3J80U 3N0VA 3MR5A 5DJBA 1NSKL 3R7SB 4KT0C 2I6WA 4YHHF 4DV1J 3MOJB 2HHUA 4M63A 2ASYA 4OZ0A 1MWTA 1R43A 2X3DA 2DNNA 2F9DA 2MKHA 4JV1A 3LP0B 1AUDA 2RS2A 3UI3A 1QE1B 1PGZA 1VQ8S 1IXKA 1DBDA 3Q8PB 2HNZA 2FQQB 3ILIA 4NLOA 4ZLPA 4CLKA 2R8HA 3WDOA 1IM4A 5C24A 3I87A 3OQ2A 1Q7LB 4ZHRA 3K5LA 2J6SA 3LP2A 5EWEA 4I69A 3LAMA 4QW9A 4P10A 3G96A 2AYGA 1PJ7A 2AX0A 5KT4A 3RRHA 4WPAA 4RO0A 3QAEA 1FDNA 2DXFA 2ZJPQ 3G2XA 2B9XA 2QLWA 3HVTB 3JTPA 4DOZA 4ZCIA 2W8LA 1S0NA 1TKZA 1DHMA 1QE1A 4Y65A 5LXYA 4DUZF 2IFXA 2E5JA 3M7VA 4Q7AA 4RW6A 3W2WA 1J2VA 1HD0A 4YDXA 4F25A 4P2MA 3QAUA 1KD1T 2I38A 3TQ1A 2KG1A 1T03A 2J0SD 1AZSB 1HBUB 2OKQA 3OTEA 4GO7X 4KFBA 4OYBA 1A9NB 4RLEA 2P2CB 2WAFA 2FHKA 2PD1A 4UY8T 1WF0A 2E1AA 1JLGB 4O44B 1F2GA 3AOBA 2Q1LA 4CM0A 5AE3A 3H25A 1FA0A 2LA4A 4WU2A 2WONB 3BF4A 4V19J 2DR6A 4IG0A 1C0TA 1N0UA 4OZLA 4F2RA 4L75A 1XNQJ 5J2NA 1NSPA 1PJ5A 1T11A 2EFVA 1NM2A 1I51B 2AT1B 2JX2A 4RW6B 3W2WB 4CQ1A 5J2PA 3F41A 3FMWA 3MD1A 3BBCA 5E2QA 1VQ7S 4NCGB 2W2MP 3WIUA 3MMJA 2VDIA 3FEZA 2B8QA 5U47A 2RQMA 4PWUA 1WNEA 2XMKA 2FHJA 2QLJB 3QNWB 1S1VA 1GTHA 1KP6A 2RUSA 2ZH4A 1R0AA 4Y2MA 4OYOA 5BJRA 4X62J 4OZNA 1AT1B 2DHHA 4ZIVA 4EBEA 3W2VA 2C2EA 4B9NA 4FP9A 2ZZMA 1PIEA 1Y11A 4CT8A 4EU0A 4QWCA 5KAKA 1OSDA 1DRZA 3MEDB 3PG9A 3BDPA 5J2PB 2JJ4D 5GAEI 3UNGC 5D4PA 1C1BB 4PQUA 3KWMA 2R7QA 4Z7CA 1PG5B 4KGMA 2KM8B 2ASLA 4RU2A 4O3SA 3K5PA 4ANEA 4DV2F 1N33F 2XY5A 1HLWA 2DYAA 1FFGB 2GC8A 5IV3A 1FKAF 1SQFA 2V4RA 1FO1A 3HVRA 4B9TA 4LJMA 3EPGA 4OJ1A 3X3UA 4F04B 3MUTP 1UVLA 2ZVSA 2FVRA 2DKOB 3I96A 2V9WA 1VQKS 1RHMB 3OFFA 3JTOA 1ZS6A 4U7UK 3TQEA 2UU9F 3TNVA 2R4FA 3ISND 4WFNQ 1NPKA 3GZ7A 3HFVA 1TL7B 2KKHA 2YWWA 4K4XA 4NXNJ 4PQUB 2OPSA 3QO9A 2XMUA 5ETQA 1MN9A 1Y00A 2YPYA 1CLFA 4NMXA 1S1TA 1A0OB 2PE8A 3C16A 1FF2A 1FJCA 2I2YA 2ACYA 2AEJA 3EVWA 3H2LA 2ROPA 2YNFB 3SDEB 4EI2A 7AT1B 1D09B 1UJ6A 4OYPA 1DTTB 4DQSA 4N1XA 1X4GA 3US5A 3V6JA 1DARA 2OPRB 2QFIA 2V0NA 3X1LB 2YTCA 1JXEA 3IS9B 3M2RA 3GB0A 3MFIA 2NCKL 2VG6B 3GE9A 3GFYA 1EKRA 2F4VF 3N28A 2HFZA 1SV5A 2W2PP 3CJ4A 4QJVA 2BABA 3DU6A 1LW0B 4KC5A 4YS2A 2E5GA 2QA1A 1CJUB 2B51A 4Z7YA 1OIAA 1X9MA 2YX1A 4KSEB 3GONA 4X4QA 3TZXA 1VRUA 3FSXA 3MM5B 1UWBA 4ZVGA 2RMLA 4C8LA 3SDEA 1WHVA 4J7CA 2AX1A 2RHSB 3B78A 3OHBA 2RQ4A 2HQGA 3W62A 3RAQA 4ITSA 4FS2A 2HNDB 2OPQA 4A4JA 1CJTB 2DNYA 1YKWA 4W92B 5M18A 1ZTWA 3DWKA 4O4GA 1JKHA 4L3KA 5DGAA 1NJIT 2XY7A 1NKCA 1IR0A 1R3NA 3QIDA 5CYQB 5H9FJ 2HBZB 1RXOB 1G2EA 3E01A 3I0RB 2BA9A 3M8WA 3CD7A 5A8WA 4KQZA 3FEYB 4OYZA 3I82A 3K58A 4LF7F 4JI0F 3C6UA 4A47A 3BQ0A 2UXBJ 1WJ9A 1VI7A 5B09A 2GAHC 2AEFA 3BKFA 3DOLA 2C1EB 2RD5C 4Q2LA 4I6YA 3Q23A 4A8KA 1GMUA 3ZO7A 2H65B 5KFPA 1VLOA 3KG0A 2B6AB 3L3CA 1CC7A 2NXNA 2AF6A 3PYGA 3U1LA 3DLGA 1K25A 4ELTA 2H5JB 2OPQB 3UDCA 3G8SA 1VIOA 2R9LA 4LR7A 4Y0FA 3C6TA 4DJBA 4ECUA 5DLFA 2UXBF 3DOKA 2BM1A 5HMWA 2XLIA 3PM9A 4QCLA 1TUGB 3CMQA 1QJHA 4JBFA 2IAJB 1NJYA 1LWEA 4HYKA 1P9YA 1DURA 4DSJA 3GFZA 3MECA 3BBBA 3T19A 4UUWA 4YEAA 2FYXA 2IA6A 1IBKJ 5GVQA 2L41A 4F4ZA 1QLNA 1XNRJ 1PAUB 1RUSA 5KFMA 2EKNA 4CO4A 1URRA 2HZCA 3OR1B 4HACA 3BGRA 5CD4H 2GIQA 1UMJA 1JIHA 1OY8A 2RT3A 5E7OB 2FDNA 1WI6A 2EBEA 1V6HA 5BXIA 2VQEF 4N8NA 1P8GA 1NK8A 4MYTA 1GX5A 1WUUA 2CWKA 2ZHOA 4ZHRB 1FJGF 2RKIB 2XMJA 2B9YA 4DL0C 1IBKF 4P52A 1UZHA 2LXIA 1ITPA 1IBCB 1CG2A 4L72B 1XNRF 3CCES 4C8YA 3H59A 1FX4A 3Q8QB 4JI6J 1FTRA 4GKJF 1U02A 1YJRA 1FESA 4NLQA 1XMBA 3I56S 2GX8A 2ZNYA 4OZ5A 1RT3A 1VRTA 2HGMA 2M4MA 2XMAA 2W2QP 4ZP8A 4DS4A 1RKJA 4QU7A 1ZA1B 2XULA 2BJ9A 2IDEA 1HBNB 1JXLA 5KFOA 1M1KT 3IR7B 1WACA 3O2IA 3T5JA 4LQ9A 1JX4A 4ZA1A 2RILA 3VAIA 1QVGR 3AY0A 3LO7A 1DQ8A 2CQDA 1IKWA 8AT1B 4GKJJ 4IRCA 4C9DA 4KYZA 3IBWA 2HW3A 1VQ9S 3FQLA 1WG4A 5LT5A 2OFHX 1TAQA 5KFTA 3BO2A 2DIUA 3MTKA 4IG3B 4O3OA 4XAKA 3ISNC 2ZITA 3ZNUA 4LFBJ 1NAQA 3MM9B 3CD0A 1WHWA 3EGVA 3QFHA 4GO5X 1RWOB 4OZ3A 5A8RB 4Q8FA 2OFGX 1RAJA 4ED8A 4PPZA 1JLEB 3PX6A 4ZPTR 4ZK7M 1FWKA 4FZVA 2BVZA 1RBAA 3QIPA 3R97A 2YKNA 4P6QA 4AE5A 4ECXA 5LM7E 1PYOB 4NPOA 3MR6A 1U1PA 4I56A 4OL8A 3P8BB 2ZEJA 1R89A 4ILRA 3EDQB 1R0AB 3MR2A 2ZZNA 1JWWA 2K8GA 3TJ8A 3GJTB 3ZZYA 5FLXY 3CJSA 1RCOB 2GVZA 2G1DA 2WSCC 3AOAA 4J9VA 3O1LA 1SL2A 1RTIB 8ATCB 3A3OB 3EPIA 4DV3F 2C2NA 1LV5A 5FIIA 1WC1A 4K4YA 5EGYA 3A1YG 4RZRA 2AJQA 4A8MP 3CEDA 1KWMA 3IWXA 1RWNB 3DRRA 4DV2J 1N33J 1P1TA 2DXEA 2PN6A 3H7HB 2YKNB 4RU9A 1HNZF 2FPHX 2HMIA 1RA7A 2IVFB 4ES3A 2MJUA 1UA0A 2OEKA 2ZWPA 1X5OA 4FKYA 1P27B 2PO4A 4AXIA 2LEPA 2LQJA 2DO4A 2H4YB 4M8LA 4NOHA 4WP8A 3WX8A 4EUVA 1XMQF 1LK5A 1HWLA 2HFVA 4NASA 4OI3A 4RW9A 3NP5A 2BW7A 2AZ1A 4MKYA 1R8PA 4B3OB 2NXUA 1TL1A 2JVOA 5LL6d 2VICA 4FXWA 3Q8RB 4DUZJ 2OMLA 4ZMMA 1M1GA 4DR7J 1RSCA 1M5PC 1HW8A 2DNMA 3PHTA 2LEBA 1FNXH 4UZCA 1HFEL 4RX6A 5DDPC 3D0GE 5LMNF 3SCKE 2OJ3A 3K8VA 1SIWB 4DR3F 1SC6A 5LSRA 3MCSA 3C14B 3M2VA 4OYIA 1EARA 1SXLA 5FD1A 2EG2A 1RE1B 1JLCB 3ICLA 3MOZA 5HL7Q 1FE0A 3M2RB 4X4SA 3PIPQ 4DR7F 4FS1A 3PY8A 1TELA 2EK1A 2QV6A 2VPZB 3LALA 5C7PA 5D8HB 1TUWA 1BXNA 2CDRB 2KXNB 5J2NB 2YKMA 4PYAA 1GX6A 3C66A 4ELUA 1BC6A 2HGLA 1OY6A 1RT5A 3HXMA 4KY3A 4QIFA 4NCGA 1H7XA 3LOUA 5IM0B 3SSRA 1NDLA 3KUGA 2DT9A 2G0CA 1SH3A 2XMVA 1W26A 3NY0A 2UUBF 4OZJA 1YX2A 3IM9A 2VOOA 1N88A 4PXCA 4C8KA 5F3ZA 3M30B 1MMNA 2IJNA 1PCAA 1LQ9A 3T6BA 2V8HA 4Q0BB 3BEGB 2VKZG 1VC6A 5B7WA 1G3OA 2XO7A 5KG6A 3I0RA 2MKCA 4CTAB 4ZLLA 3GIMA 2RDJA 1FRHA 1WWHA 3EVMA 3L7UA 4UTGA 3W61A 3KLVA 3LW5C 2W9BB 2JEIA 1N32J 5I3QA 1N34F 4Q44A 1X4HA 4YY3F 1S59A 2MQOA 1RWKB 1IKXA 3UD4P 2HGNA 2PGCA 2DRDA 2ADBA 4WTOB 1KTQA 4OX8A 3MD3A 2PI4A 1YGYA 4JI4F 1N5VA 3NWGA 2HBRB 1H98A 2P6SA 3EXYA 3QGIA 5F0UA 1DTQB 4J9OA 4HDHA 3FCWA 5KFZA 1VRQC 3GIKA 1LWEB 1GT8A 3MPDA 2CJ9A 5IT0A 4ICLB 3SIPB 3O8WA 2N7CA 5M19A 2KVIA 3N9UC 3PW0A 1WC5A 4DMZA 5AXKA 3SV4A 1NKBA 1NUEA 3QO9B 2MTLA 5HATA 4EEYA 1LWFA 2ASDA 1CEZA 3KDNA 3QGHA 3KJVA 3E8OA 3CXCR 2E1CA 4KKOB 2VASA 3CJ5A 4U96A 8RUCA 4DV6J 1N6QA 2EFNA 3GP9A 3CULA 1GH8A 5I3PA 5A76A 3R1LA 1XK8A 4A8OA 3CD6S 4KO0B 3T6JA 1Q8BA 4WFBQ 4B3RJ 2J76E 4B9LA 1VFJA 3NCQA 1TMMA 1WORA 5HBMA 1XEZA 3G86A 4M5GA 1FKPB 2POKA 2Y8WA 1T9VA 4ES1A 1T95A 3RW6A 5IT9Y 1YHQS 3VGTA 1OO0B 3MAAB 2DEJA 4JI6F 4LF6F 1IQTA 2XZDB 4V19X 2J9DA 3CCVS 3NCRA 2W1BA 3LUYA 4I2QA 2O1PA 2OUGA 1U47A 1L3KA 2VPYB 4CZCA 3Q2TC 2HVHA 2N3LA 4MIBA 4I67A 4LSLA 4LF1A 2QJ3A 3QJLA 1HNVB 4AL6A 1CJTA 1UKUA 3THPA 5KT5A 1S1XB 4JI2F 1NK0A 4DWIA 3UPPA 4YR3A 4YFUA 3KHHA 3VZHA 4LF8J 3BGUA 2HNYB 3OFGA 2OEJA 2QMUB 3ET6B 3SFGA 1U6BA 2DITA 2HZVA 2RF2B 2Z30B 3PW4A 4KB7A 2M52A 4ANCA 1MLAA 3SCIE 3EZ5A 1HQUA 4F4YA 2HFUA 3CIZA 1WG1A 3UD3P 3M9OB 4R0JA 1B64A 2GGPB 2YKAA 2LCWA 3PRDA 1WEZA 2A6MA 4P74A 4C7QA 4ZLJA 2XBPA 3CNQP 3BSNA 1N5YB 1FDBA 4CM2A 2O3DA 3ITHA 4OHWA 4USWA 3PEHA 1EAYC 5K8PA 3EWGA 1HWUA 5B08A 3OUYB 3KLGB 3D6FB 2M2BA 5CYMB 4YR0A 4JI7F 2X1GA 1F5BA 3CMAS 2ROGA 1U8SA 2XTJP 1FRLA 2MMYA 4NCAA 2JNJA 2IAJA 4ED6A 1Q53A 4TN2A 1B0PA 4OV1A 4DPOA 2N3OA 2C2MB 1IVZA 1S9EB 2RAQA 3DOMA 4HH1A 4B9MA 4OJGA 3G6XA 3I32A 2W4CA 4R0EA 4V1Ak 4ZVHA 3V5RA 2GGPA 2DR7A 3VWSA 1OJ4A 2AW0A 2OSRA 2RJZA 4LRBA 4BHQA 2B9EA 2BJ8A 2A2CA 5F41A 1TL3A 3CUNA 1KFDA 1X7VA 3SQGB 4DEZA 1YJNS 1QVFR 1SC1B 2YH1A 5ETMA 1CJVA 2JDJA 4KV8B 2DY9A 2N4CA 2LKZA 2VBYA 3N01A 3KFWX 4G1QA 4X84A 2ERRA 4O3RA 1RBOB 4ED4A 1NK4A 1C0UA 2JZ5A 3OV7A 5AT1B 3KK3A 3L09A 1VISA 1RAFB 1S9EA 1VGYA 3DOMB 1LXNA 4DPWA 4F4WA 1VQ6S 1JJ4A 2BJEA 2OGUA 4J91A 3LWLA 3MM6B 1VQPS 3UCGA 3EX7B 3GV7B 2LU2A 1NCLA 3H5SA 4RBVA 1BGXT 3TEGA 1RBLA 1RLCL 3DN9A 2Z2LA 1SKRA 1CPZA 1U24A 2EPIA 1CQNA 2WVEA 4WKRA 1X4CA 2IYGA 2OD6A 4NLPA 1X60A 3EXCX 2Y1RI 2H5EA 1EJ7L 2GJ2A 4Y34A 1QAXA 1RAOA 3DYAB 3PNIA 1V5IB 4J9NA 2GO8A 3GWCA 1XERA 4CLFA 3H5UA 1ZAWA 1AXQA 2UXDJ 4B3TF 2G9OA 3OTBA 3R1HA 1GXTA 1JLCA 4JI8F 5B0BA 1LOUA 1REVA 5CZXA 1KS2A 1DLOB 2E5LJ 1S6QB 1FWPA 5CD4A 2YNGA 2C28A 3BQ2A 3V6DA 1MNEA 4PG8A 3J7A1 1JLFB 2Y1IA 4C8OA 4USJC 2XWYA 1RADB 3MEDA 4UOCA 2XLJA 1RT6B 4LRDA 3LGHA 5A8RA 3J81U 2HBQB 2GQQA 2QMWA 4XO0A 2ZH1A 4ID8A 2YY3A 3ZTOA 4HLBA 4P2XA 4NL5A 4DG1A 4I4BA 3H40A 4MJKA 1OQ6A 3AODA 3FRYA 3T5LA 3HT3A 4ZDNA 2AD9A 4WK1A 2HHHJ 1JXVA 1S6QA 3CCTA 1RISA 1BUXA 3G82B 5I3UB 2Z2ZA 2V5HG 2R7OA 4QPTA 4R5PB 3V6DB 3G9CA 3H8YA 3M6WA 4RBUA 3FZ2A 5KFLA 1BQNB 2FC8A 1UFKA 1RT6A 5K14A 3M8QB 1XC9A 5ETRA 2DBBA 3DRRB 4C48A 2LXUA 2NUUG 4TU7A 1KEKA 1PYTA 2BX6A 1S97A 1JLAA 1QAIA 3NGUA 1APSA 5CA5A 2BOPA 2WRMA 1TQLA 2ZWOA 3QWUA 5T41A 2RHQB 1U6ZA 3A8JA 2AJFE 4IFVA 4TQSA 2QFJA 2W01A 1DTTA 1FXDA 2DGXA 2DGQA 2OPRA 2BE9B 2PIIA 1E6VB 1KHVA 2R2TA 2FZGB 1R8CA 2W9AA 1X0PA 2FD2A 2YWGA 4HHUA 2ZKUA 4USVA 2FIUA 1ROFA 2GIFA 2M0GB 4Z37A 9ATCB 4HTJA 3MPYA 4DPYA 1TK8A 1HYSA 3SQOP 1KVJA 1JLAB 5F8GA 2R2RA 2Q6BA 3QZ7A 3D1HA 2M88A 3PZPA 4L74A 1GMVA 1UVNA 1G4CA 4LIRA 2BXJA 2YX4A 3DDKA 1F60B 4I2PA 1NJWA 3TAPA 1UJ4A 2RRAA 4LSNA 3CC2S 1L3SA 1YTYA 3IN5A 4ELVA 1JK9B 2AWZA 3KLIB 4C2MA 1ZH5A 3WC0A 3IAM9 4E8UA 2JEGA 4KPYA 2OTJS 1P9QC 2HRUA 1KRPA 4DR4J 4IRKA 4QYZK 1B70B 3ZTPA 5DETA 2RB7A 6FDRA 3J81Y 4ID5A 2K7JA 3CDWA 1FK9A 2V4JA 1K9MT 5K8MA 3D6TB 3LWMA 1RT5B 2U1AA 1Q82T 4B3MJ 2G1HA 1CULA 3ZZTA 1X5TA 5F8LA 1J5EJ 1X5PA 4PWDA 1N5QA 1Y3KA 3ULHA 3V4IB 4JI2J 1RT2B 4Y6IA 1W2IA 1ZOTA 2DNZA 4J5OA 1F1BB 1YJ9S 2GMHA 4FN5A 1U2RA 2HHVA 3OFEA 1H73A 2C3MA 4L73A 1FCAA 3KG1A 2DHSA 2WVFA 3KLHB 1S6OA 1MWSA 3MDFA 4ED3A 1O8BA 2CNOB 4DV7J 3PX0A 2ZH7A 1RYSA 4DZDA 1QSYA 2Q43A 4MH8A 4GC7A 2CKWA 1YG0A 1VQNS 4O4RA 2ZKTA 5HK4A 4DV1F 3KLEA 3OR2B 4GKKF 2DXDA 1SC4B 2W4DA 2YPZA 4QIGA 4DSFA 2PA8D 2CPEA 2HBYB 3L4BC 2DGSA 3BS9A 4IDKA 1HHTP 3G87A 3OTDA 4JI7J 2RH3A 4FVMA 2I5JA 4HACB 1IKYB 5GAEU 3D67A 2BW2A 1Q78A 2CUYA 4RA7A 2V50A 4K2XA 5C2GA 3FGVA 2FGCA 3PYDA 1TKTB 1BD6A 3HHEA 4QWBA 3FK4A 2VC1A 3VVUA 3UPFA 1S6PA 2RIJA 4C8NA 4M95A 2HLUA 2Y8YA 5KG1A 4CLZA 1K0TA 2D3ZA 1HHQA 2J9DE 5M2UA 2QL9B 4D3HA 5GMKa 5BYRA 1R8HA 1WHXA 2ZH9A 2KH9A 2VFTA 2HNZB 1R8BA 2XYHB 5J2QB 1TTHB 4WFXA 5C24B 4DR4F 1JLQA 1OY9A 1RACB 5EDWA 3B82A 2XO6A 5RUBA 1ZZNA 4NLWA 3ENQA 4O3PA 3SXLA 1EB0A 3MEEB 3JSMA 1X4FA 5IS2A 3CO9A 4AFFA 1N54B 2MHNA 4MKAA 2NQPA 4XTTA 3H4DA 4WK3A 5CQGA 2HYIB 3NGRA 4ERDA 1V3SA 5F9LA 3MM9A 2PEHA 3NOGA 3ENWA 5E3RA 2ZHBA 1RT7A 3VTIA 2VA2A 3HJFA 4URSA 3P5TL 5IC4B 1JLEA 4AQYF 1FVQA 2RNEA 1AUSL 5HQLA 2FVPA 4FF2A 1JNZB 1R6VA 3AQOA 5KFBA 2MKKA 1M90T 3IM8A 3W66A 4IQXA 3M05A 1QTMA 2VV5A 4JI8J 5DGBA 3DRYA 5HANA 5HVFA 4IR1A 2IC3B 1RKIA 1Y7PA 4DUYF 1FNOA 2CJQA 4EYIB 1Y4ZB 4J9QA 4IH6A 2RS8A 2B4VA 4KHMA 1Q1KA 4K0KF 4LUBA 2F63A 2LECA 1C4AA 1YDLA 2BM0A 3KK2B 3HO1A 5M2RA 3FBBA 3RBDA 3I4PA 2MZRA 4CWBA 4TY8A 4X66J 1LW2A 3TZZA 1BQMB 2UXCJ 2PI5A 2C3OA 4O0IA 4DUYJ 4F4AA 1EETB 1UL3A 3WIVA 3P6YC 2DB1A 2IM2A 2CQIA 1QY7A 4NCBA 1UVIA 4YB5A 1I6JA 1RK8A 1OYEA 4ZPCA 2BDPA 4FNIA 2JL9A 4QOTA 1UCNA 2WHOA 3R6LB 4W4MA 4ZN3A 2B0GA 1TFWA 2KFNA 1VC5A 5GAHI 3JQMA 3R8YA 1RDRA 1LXJA 2W2NP 4PXEA 4RW9B 2UP1A 1P6TA 1SUQA 2HWIA 1HBMB 2C3PA 2KHCA 5AXMA 3KJFB 1FWLA 3QRPA 3D5MA 1NDKA 3SCLE 1EETA 1RWVB 4RJVA 2MQMA 2VG5B 2GNKA 5K20B 5KFQA 4YP3A 1MN7A 3BKUA 3KK3B 3D0HE 4FYXB 2QTWA 4IFVB 2LA6A 3RBXA 4MKBA 5E33A 5GAGI 2F65A 3HDSA 1U6FA 3MZIA 4FF3A 2A0FB 2F7VA 4LIWA 2FJEB 3GYXB 3UDLA 1UFLA 2F8HA 4RBTA 4CLWA 1U0HA 3DLJA 3TWZA 3I4HX 2NLWA 2LQ9A 2MGZA 2Y9HA 5T7LA 2F3JA 2JHEA 1HI1A 3T1HF 5K5MA 2ZHAA 4OI1A 5LJ3Y 2DIVA 3IRXB 4OYMA 3MAQA 2AQ4A 2YKMB 4C0OC 3DLBA 3ZXWA 1PBUA 5A2QU 1S99A 5BYSA 2VQFF 4LFAF 3DYAA 1ZPWX 2E5HA 3KLFA 3TUIC 1PBAA 1O6XA 4J9LA 3I0SB 2R42A 4Y2CA 3DRXA 1AFJA 3IXQA 5HROB 3FCVA 3ZZOA 2HHTA 1QD1A 2HIYA 4H4KA 4KGKA 3KHGA 3P96A 1LEOA 1XR7A 1S1UB 4OMFG 4WZMA 1M5VC 4RNHA 3NEKA 3S6EA 2G2YA 4HT5A 1HPZB 1U25A 2DNHA 2K3KA 2XZTB 4CTAA 4JI3F 1IJFB 4EMDA 1JLFA 2IY5B 4IO1A 2OO4A 4U8VA 2HVIA 2WOMA 3HT0A 4CRJA 4AL7A 2FTRA 3ENVA 3IR6B 5E3QA 2J6TA 1RAAB 4J9MA 4DFMA 2N82B 3CCMS 1HA1A 1VQMS 3QJJA 3N5FA 2FLLA 4JYAJ 2GCFA 1WEXA 1HMVA 2K1RB 5IZHA 3ZG0A 1MMLA 2UVRA 1LNQA 4TYBA 2OP5A 2DH7A 3O3LA 4YDDB 1D8YA 5SUHA 4TLQA 3H5YA 1IBLF 4IUFA 4WYWA 4BWMA 2EKYA 4R5PA 2XS5A 1SIZA 1HNIA 1S0OA 4OLPA 2P8IA 4C0BA 4JV5F 1YITS 2HAFA 3PRBA 3UW1A 2EXUA 2ZE2B 3FBEA 1HL6A 4WJBA 5B0AA 4CLUA 2XGQA 4IOCQ 3V6KA 3UN2A 1FNMA 3BO4A 4G65A 1SJRA 2KT5A 3BPSP 2CPYA 1TK0A 2DNOA 5KG5A 2XB2D 4AL5A 4IDKB 1RWXB 4KKOA 1GEHA 3OL6A 3VVTA 1VQOS 1U8WA 2BKPA 1UPPA 2W7PA 5F8JA 2HK3A 3DOKB 4MK9A 3OL9A 3AA8A 1H6KX 2J8SA 4WE1A 2FJXA 4LF2A 1RYRA 3LH2S 5HBMB 4ZPAA 5IT4A 1FT8A 4CT9A 2XQCA 3V81B 2OI2A 1WOOA 5HO4A 3EGNA 1S6PB 2X7IA 1HNZJ 3BH6B 3DLLQ 1E6YA 5CZVA 4DL3A 1F5CA 4KGXB 2F8EX 3AB4B 4LF5J 1HYSB 4DCPB 2IBOA 4UT4A 1LFPA 5L1LA 3CC7S 1LK7A 1UFWA 3OXFA 3HHLB 3UNYA 1HR0J 2DVIA 2FJVA 4JI4J 1NHKL 1S0MA 2HK2A 1ZTTA 3JQKA 4X65F 5FJ4A 4LMZA 3TANA 4M5HA 2XYGB 2OH2A 4USTA 4RW4B 5J2QA 2H9ZA 2J0QD 4EZ6A 2ATLA 1VBXA 4ZVQB 2HURA 2LP4A 3OPKA 4NMLA 4NLVA 1VQ5S 3FSYA 2F9JA 5D4OA 4EBDA 4BS2A 1RHJB 3W64A 4AXJA 3OJUA 3GQCA 2AMCB 1X9WA 3CCQS 4P2FA 2NZCA 1T94A 3LQVA 3CWJA 2NSCA 4X62F 3M1VB 3GV5B 2ZJRQ 1K8AT 4DV5F 3Q8VA 4LFBF 1CC8A 1WD6A 1CULB 4G1PA 1WC6A 2IRXA 4X4OA 4K4UA 1DY3A 2RRNA 1S57A 1NH8A 2FJBB 2E66A 3RBEA 5H9EJ 1ICEB 2J6UA 2JOQA 3OXGA 2I9SA 4R8UB 3H5XA 2DK2A 3M8ZA 4HL9A 2XMWA 3LGNA 4X2BA 1U48A 2VL1A 2QLBB 4BC7A 2GZOA 2VFSA 4USHA 3IO1A 5C42B 4IG3A 1WKKA 2VA3A 2EK6A 2JLFA 2B4OA 1TL5A 2MQLA 3DRSA 4DDFA 5HLFB 1SBRA 2R7RA 2LLZA 3AJDA 2HVZA 1KSPA 4A8YA 3QFWA 1HNWJ 5D0HA 3HSDA 5A6WA 2IVMA 1KQGB 5F8IA 3JYTB 2KRBA 2A1BA 1EX8A 2M3DA 3K5OA 4U9RA 4UW2A 4D3GA 5I42A 4I7FA 2IM0A 3WHIA 3TX0A 5KT3A 1T05B 1QMEA 2VG7A 1UPMB 3SEOA 3KK1A 2WW8A 3B4DA 1L3UA 1C0UB 3DFEA 1MWUA 1B99A 2ATCB 4OYWA 4WBFA 1ZA2B 2WBMA 4OX9J 4O23A 4Q43A 4NLTA 4CO0A 2CRLA 5ETOA 3DRSB 4MAKA 5ADZA 4ENOA 1RTIA 2UUWA 4ANDA 3GIIA 2OSQA 1Q5VA 1U1LA 1H2TZ 2GAGC 2P9CA 3W5ZA 1QMFA 1VCTA 2LYVA 2CZVC 2MZQA 4OYAA 3A3NB 4FNHA 5G0RA 2MDAA 1JB0C 3UWTA 4BC9A 3VALA 3Q22A 3SZ2A 2HHWA 3GCWP 2DNKA 1QTNB 1H74A 1XBWA 3UD5A 4F0MA 4DR1J 2CG8A 2CJYB 4P9SA 1U7LA 3CJ0A 3LAKA 2LQ5A 2H1YA 2RU3A 3AD9C 4IH7A 3UR3C 3HD1A 4MKVA 3T5KA 1KNZA 1CQMA 1Y5IB 3ILLA 1M0SA 3M32A 2V2VA 1JLQB 2V69A 2WK4A 3I9V9 5H1SV 1XMOJ 1T03B 1X5SA 5K8OA 1VLYA 1BLUA 3L9ZA 1TVRB 3MM8A 3BB5A 2G4BA 2ZBPA 2YNIA 5D3GB 1RJJA 1BWVA 4UY85 2SXLA 1ZAXA 1SPBP 4HT7A 3J80Y 2I0XA 1DLOA 2D3UA 3ELHA 3HJVA 3TVZA 2MGZB 3POTB 3BBFA 3BKTA 4G6VB 1C0TB 1Q8IA 4TLRA 4A8XA 2GS8A 5HMZA 2CZ9A 3AJ1A 1QAYA 4WXWA 3OJSA 4F3QA 2OAUA 4U7CA 1M1HA 2FY8A 4C3KA 3TZYA 4B3SF 4PUOB 4MNRA 3S7RA 4MTPA 3W8PA 1WF2A 4PXDA 1J5EF 2ZOGA 3D7SB 4NE9C 1V9OA 3KOAA 3MMBA 5ETPA 3IGVA 3G8TA 3NWRA 3R6GB 1JLBB 1JQGA 2ZH3A 3Q8YA 4LF6J 2RDIA 3PDNA 2QO3A 3PKMA 1D9FA 4ILLA 2V6AA 3BN4A 4ALZA 3QBCA 1BE4A 7FDRA 1VIXA 2YKOA 1S76D 3G6ES 2JRSA 5F8HA 1BQNA 3GU0A 1NLKL 2B5JA 2GHPA 2YWFA 2AHOB 1U1NA 2FZCB 2E9ZA 3V6HA 3W1YC 1RQ0A 5IXUA 2CPJA 4CIOA 4RNNA 3UN7A 2C2KB 1GQEA 4HH0A 5LSLA 4XPEA 2AJ1A 1Y3JA 3HKZD 3PCOB 1JLBA 5HAOA 1IBLJ 3BPDA 3VZIA 1S1WB 2XZWA 4ES2A 2VHGA 2HQ3A 1R6YA 4DHVA 3BSCA 4QR1A 3HHLD 2E7VA 3K0JA 4EGLA 2VBWA 2WVBA 2XSJA 1MG7A 4KE5A 1X0FA 3SFUA 4K4ZA 4ZVRB 3PKYA 4USKA 3NGTA 3T3FA 3CJKA 2AV5A 1KLNA 1XQIA 5C25A 3UCZP 4N41A 1CS4A 4DL6A 2ZDOA 2GIRA 2KO1A 3EM1A 1L3TA 1QUPA 3BV8A 2W7AA 4WWSA 4R3JA 5LOQA 1S9GA 4NLXA 4RNFA 1YWXA 2DR8A 4NXMJ 5EUHA 1OQ3A 3FVYA 1QUVA 3HX9A 1WHYA 3KLIA 2X1AA 3OW2R 2HHQA 2BR0A 1RHQB 3SCJE 3ENAA 1RCXB 5CCMA 4C11B 5HN0A 2LQBA 2OIHA 3JSYA 5DQIA 3SSQA 4ECYA 3FKBA 2EWHA 1FK9B 2V4JB 1CS4B 3C19A 3DXSX 3FQKA 3TRGA 5KOXA 3VV2B 1HR0F 1FX2A 2DNRA 4CLLA 1VRTB 1XTZA 2OD4A 4H4MB 4DSEA 5F9NA 4QW8A 3CE8A 4A46A 3UPNA 3BGLA 5KFUA 3PYEA 2QN6B 3BREA 3OT9A 5FDLA 3IRWP 4J9RA 2FJWA 1Z1ZA 1I1GA 1TV6B 2HZAA 1EP4B 1PILA 3RB0A 1S9FA 4EFAC 4M5IA 3Q89A 2UUAF 4HHJA 3ILOA 3QGGA 3MR7A 3C6UB 4ECTA 3A4TA 1X4BA 2XEXA 2VC0A 2QL7B 2BQ3A 5KFRA 2R7VA 2B6AA 3UVJA 2KXFA 2XY6A 1RTJA 3M4XA 5ETSA 3BR9A 3CC4S 3R7NB 4LF4F 2FUG9 2BANB 3TUZC 5ETKA 4C6AA 1D8ZA 4MT1A 3SV3A 4NRTA 2JVRA 1SJQA 2H54B 4ZVSB 3CMES 4LVNP 3HZGA 3MECB 1DZ5A 2CQ4A 1SI9A 2HWTA 5KFJA 5KFEA 1UJ5A 2D9OA 3TI0A 1Y0HA 2BE7D 2HFOA 1F3VA 3AXMA 3HHLC 2Z4PA 3OLBA 1SKSA 2QMXA 5B0GA 4FYDA 4OVDA 2JC1A 2YX7A 3NS6A 1VQQA 2VZ9A 4OIXA 1NSQA 3TVYA 1WSRA 2ZH6A 1U45A 1T05A 3K59A 2CQ2A 3B6BA 3OD2A 3KLGA 3OR1A 1GNKA 2VG7B 5DM6Q 4FF4A 2J7WA 3BGRB 3FFIA 3QT6A 1T9XA 3BGFA 3PW5A 2ILZA 4H4OA 1G6BA 3EE3A 3AH6A 3LA0A 1UWAA 2DJWA 1XN9A 2X51A 4C97A 1PJ6A 1TU0B 1UW4A 1B0VA 1FKOB 1VK8A 4FKXA 2CWXA 4KFBB 4RW8A 5G4DA 4IOAQ 2ZFHA 3WZ0A 1OWXA 3CVKA 3OTCA 2G2ZA 5DZ7A 1BMQB 4N77A 3T1AA 1FVSA 4EZ9A 4KTQA 1VJWA 3LP0A 2F1FA 4UOHA 4X64F 3OL8A 2WVDA 3CT9A 3GILA 1I3OB 3R5CA 2GMLA 1RT7B 1RP5A 1HBNA 2MKYA 1D9AA 2I8EA 3R5AA 1NZAA 4Y2KA 3T1YF 4FBTA 2DCUB 2FY1A 1TUVA 3N5BA 1YIJS 2FLOA 3RB6A 2IJFA 4LBHA 4UF4A 2C2ZB 3IR5B 4IOBA 2UUBJ 5L1JA 4FBUA 2HIQA 4TQRA 3NGKA 2PFFB 5J2MA 5KFGA 4KHPF 3NMRA 2QEXS 4ECSA 2UV8G 3A3PB 4ETXA 3RU0A 5BYQA 1AA1B 1C1BA 1OPIA 2R8KA 5F0WA 3QPIA 3RRKA 2R2SA 1UZDA 4ECWA 2CVEA 3UPOA 3GPAA 3D3CJ 3NAIA 2D74B 4DU7A 4TY9A 2IMOA 3OBIA 4USUA 5L39A 5THWA 2E5IA 2HKEA 1RWUA 2OPPA 4PG4A 4ILMA 1FXLA 5IC6B 2DRBA 2W2OP 2XS7A 2M8DB 2DH8A 2NUHA 2XYPB 4JI0J 4Q0BA 3MMCB 2CQBA 2WONA 3ISZA 4QBUA 3C46A 3KNGA 5KFYA 3PFEA 2C2OB 3MTJA 4IFYA 5KFFA 1RT1B 2ZBQA 4DR5J 4FXDA 1HBOA 4JUZA 5L46A 4DR2F 2UXDF 2XI2A 3FUYA 4XK8C 4CO1A 2MB0B 2IJRA 3GYGA 2FZKB 4ZPWR 1KVKA 3DM2B 1H0HB 4PQAA 2HMIB 1VBYA 1HWIA 1VHIA 4QJGA 2MSTA 3TAQA 2KM8C 2HQCA 5HP1B 2CPZA 5IFMA 1T9YA 4K7QA 3EQUA 1D3WA 2KVQE 2DEIA 2YNFA 2JFKA 3DGPB 3QLHA 3G4SS 1XIQA 1QM9A 1HQEA 1XWLA 2GQ2A 3G82A 2ZC4A 4A48A 1U1OA 1S10A 3NS5A 2AYBA 1S0VA 2E7WA 4A8WA 1AFIA 2ZNZA 3H2UB 4PR6A 3QT5A 2KDOA 4KIAA 2MXYA 3QRRA 1SV5B 2J9CA 2VKRA 2V2QA 3H20A 5C25B 3IRXA 3DM2A 5I4MA 4LF5F 4RPFA 1CVJA 5E3PA 1CJUA 2VFUA 2FHOB 2ZDPA 3GYNA 4NYZA 1KVIA 4B9SA 3JTNA 2QZ8A 5L8RC 1UWBB 4DU8A 1RTZA 4HTIA 4OFZA 4LBIA 2VQEJ 2MKSA 1X4AA 2K06A 2ZOMA 1FJGJ 3A8IA 4KO0A 2EBGA 3G8QA 3BSAA 2C2DA 1MWRA 5D6GA 4C8ZA 4RR5A 1AW0A 5KTQA 3BO3A 3VSKA 1FRIA 2IM1A 3IC1A 4WIQA 4IR9A 4CLPA 1SKUB 4X4RA 2MHEA 3UR0A 1N34J 4ED0A 1N36F 1VQSA 2O01C 3EDRB 3KJNB 3MEGB 1P1LA 3DOLB 4C3MA 4B3RF 4J90A 4I2QB 3J7YI 2O67A 3EZUA 4M5LA 3JAMU 2BJ3A 5LSOA 4ECRA 4NI2B 1RWMB 2KFZA 2H3EB 2YQ3A 4QZVB 3NMAA 1R0BG 2CQPA 1HMVB 3UN3A 3HPOA 2HEKA 2PMHA 1NKEA 4F3OA 2ACMA 2CYYA 3M6VA 4OHVA 2DISA 1S1XA 4QQBA 2O66A 2VBZA 3GR0A 2QYGA 5FDLB 2OLUA 4UOFA 2UUAJ 1U09A 3PR4A 4DPTA 3ET6A 4LFCJ 3MI7X 4U7UD 2IPOB 2GV1A 2RF2A 4OQJA 6FD1A 2UUCJ 2CDQA 4C0HA 3O6QA 2FGOA 5EX3A 3K5MA 2NXEA 4DR6J 3AD8C 2B9WA 4Z2XA 1TKXB 1YJ7A 3UVJB 5JVHQ 1R31A 1RTJB 4PUOA 4LF4J 3I5CA 1WF1A 5CABA 1K44A 5H9EK 1HNXF 2VOPA 2Z8QA 3GFHA 3Q86A 4O3NA 5KT7A 1JKHB 1DTQA 3RB4A 3WC2A 3WBZA 1QSSA 2YH0A 5D78A 4BWJA 2VBXA 1RTDB 2IBKA 4QIVA 4OHZA 2Q3PA 4XPCA 2HHSA 2PSZA 2E1MC 3W9HA 4CLSA 3ZZ0A 1SC3B 1NZ8A 3I5AA 3JSBA 3TAMB 4F4XA 4X4NA 2H5IB 1KOHA 4ED2A 3R2CJ 1KLMA 3FEXB 5LMUJ 5SZTA 3HHLA 4K4VA 4G1QB 4CO3A 1GFWB 2MEWA 2W4PA 2NS1B 2K2PA 1DAXA 1RLDA 2AYMA 2BBEA 4NYPA 2LEAA 1T3OA 3E2EA 4M5DB 1EQMA 3HCXA 4DV0F 2L3MA 2AJ4A 4J9UE 3OHAA 1U1KA 2HFSA 3LP2B 5DO2A 1WDTA 3CW2C 3K17A 2VF3A 1FXRA 3THVA 1BHNA 3VQSA 1GMWA 1RTHA 1EZZB 1AYEA 2B43A 3BGOP 3BYPA 2KL8A 4F26A 2ZH5A 3ZFZA 3BYRA 5B0FA 5JJBA 5ETNA 1NDPA 3DC2A 4E0DA 5L1IA 2FLPA 4RUHA 1K0VA 4PAAA 2H4WB 1C1CA 1FRJA 4DQPA 2DPJA 4OJ3A 1H2UX 1FJEB 3HI9A 2PFDA 2VDHA 4CP5A 2UVWA 1L3VA 4DF8A 3D1OA 3K89A 3CO0P 1NK6A 4X4UA 4FF1A 3W7BA 3T1HJ 4QU6A 2QA2A 3DHWC 3SMZA 2QA4G 2EFPA 3P5BP 2ZJQQ 4W98A 2RQKA 1U1RA 2DRAA 3RUBL 5C42A 1HQUB 4NYOA 4LFAJ 4F0KA 3DLEA 2ASJA 4KHPJ 5EWFA 1RHKB 2YNGB 2KFYA 3AAWB 3NNHA 1RT3B 1S48A 1W7WA 4FVCA 5DG7A 2WADA 2HS3A 5EX0A 2HRTA 2Z56B 3R3TA 3VAHA 1J27A 3ITHB 4ZVTB 3I9ZA 4OV6A 3I55S 1Y5NB 5HQ8A 5F8NA 3CCWA 4QPXA 5J1EB 1MWZA 2CFXA 3CGIA 5L38A 2V2ZA 1Q81T 3ZG5A 1UTAA 3F44A 3KK1B 4I6WA 3HFKA 3BR8A 1Z2LA 5B0DA 3W9IA 2VU5A 4O0NA 4CH1A 4FPIA 2LVWA 2MZTA 2OELA 2QIFA 3N4WA 1F5AA 2NPIA 4WFAQ 4QWEA 4YN3B 1UEKA 2UVVA 3RR8A 4R0QA 2QG9B 4I64A 2QSFA 3U27A 4E98A 3GG1A 1SL1A 4YY3J 3JSRA 1RAEB 3TARA 1F9FA 1IKVA 1RT1A 1S12A 1WOPA 3MEKA 4MFBB 1R7IA 3HHKA 3R5GA 3GJSB 3M8RA 2GO9A 3KUEA 2ZC3A 2MLYA 4URQU 4DBQA 4F7VA 4LVOP 4DQQA 1Q7YT 3C3LA 4DFKA 4DSLA 2NREA 2BYCA 4OJHA 1NEEA 2BJ1A 4ZN1A 3KJQB 2DNGA 4KH0B 4U95A 1N5SA 2VH7A 2YWEA 2W24A 5KFAA 5HVGA 2LXFA 3PO4A 3MMAB 2HVDA 2KHDA 4HDGA 3D2WA 2KRRA 3R5BA 1KOOA 3VF0B 3DMJB 3DRPB 4CCHA 3CB4A 1TKDA 1T02A 3CDAA 3HD2A 2BQRA 1TVRA 2CPFA 3CJTA 3MM8B 3OFHA 2ZD1B 2GW8A 1IKVB 4MFBA 2LDYA 2M8HA 3OVAA 5JVGQ 5BR8J 4Y2IA 3MUVP 1HKAA 3GV8B 4ZCLA 3FJ2A 4ZKAA 3QT8A 2JSXA 5HVHA 2M7SA 2ZUAA 3HZEA 3QYYA 4HHHA 2W9CA 3UCUP 2FVQA 1TFYA 3J7AN 4C4WA 4K59A 3NG8A 4WFZA 1YJTA 1R8AA 1U2CA 3P45B 1RZMA 4U6PA 2G13A 2V4QA 3V81A 2D1CA 1SL0A 2R7WA 1T3NA 2R8GA 1JJHA 2XLKA 3JXOA 2ZD1A 4ZP6A 1HI8A 2E1RA 3M6XA 4P75A 2NZ4A 1U0HB 1HIYA 3MPVA 1OMSA 2VPWB 4ZVUB 1RHRB 2GMJA 3CJQA 1D9DA 4B9VA 2Z2YB 4IG0B 2KT3A 2YWKA 3F0NA 3NBPB 2CJBA 1LW0A 2MZSA 3ZZPA 3EVOA 4KJIA 4Y28C 1PO6A 5D0EA 2ZOFA 3M9NB 2YXLA 4DL7A 4PG7A 1Q95G 2I1RA 1KQKA 3S01A 3DGVA 2YBVA 2LMIA 4RWXA 3IWNC 2EFOA 1YBAA 4YB7A 3FBFA 3MWBA 3OL7A 1S1WA 4ECQA 3CJ2A 3D6HB 3W2VB 3JAMY 4IO9Q 1XNQF 1RI7A 2VJUA 1HWKA 1HPZA 2V68A 4UUXA 4IFYB 2P9GA 3HVWA 1HD1A 3DHXA 1M5OC 5K14B 4WCEQ 1HW9A 1HWJA 2W25A 4M1KA 4YQWA 1RAGB 2DHGA 2KZMA 2FC9A 1MU2B 1A7GE 1TKXA 3ZZZA 4AD6A 1XR5A 1LWCA 3D6MB 3AB2B 3JQJA 5HQMA 5E41A 1S77D 1ZBTA 3EJMA 4EO6A 1V3RA 2CJAA 3M30A 4PXBA 2HHXA 3NOCA 1YQHA 4PZVA 1REGX 2EC0A 3D4JA 1FI4A 2DNQA 5ETLA 4E2FB 5B0EA 3M9MB 2APOA 4NZ6A 1RAHB 5IT9U 3PFOA 3OXLA 1ZM2A 5DDRC 2BRLA 4OLOA 2P6TA 2DPIA 3MPWA 4DX7A 2ZE2A 3CCJS 1AB8A 2P5VA 3R5DA 2CNNB 4NLUA 1VQLS 4BLGA 3MAAA 5LMUF 2OMOA 3VGVA 2CADA 3NRBA 3GSIA 1S1TB 4NZ0A 3TO8A 3ZFVA 2IYIA 3D9BA 3I5BA 3C16B 5KFKA 5KFXA 5A8KB 5EWGA 1GAOA 3GMGA 1NK7A 4CO2A 2R7UA 2FLNA 1S5ZA 1DQ9A 2F40A 2HS0A 3QQCD 3MHYA 4DFJA 2DNPA 2CPXA 1H7WA 5ETVA 4M5JA 4MYUA 2HG4A 2NYHA 3LF0A 2CNKB 2HQIA 6AT1B 2DNLA 4ICLA 2WB4A 2DD8S 5D0GA 4ZP7A 1EP4A 2HNYA 4N8OA 2ILYA 2CPDA 2IVYA 2MPUA 3CDUA 1FEHA 5ETTA 1LKZA 3TA2A 3MEEA 2LU1A 4XDDA 1RTHB 1Q8LA 3K57A 4F8RA 3HK2A 4MIWA 2HVEA 3T9ZA 1UVMA 5C2CA 5D0RA 1FEEA 2ZZTA 4TKTA 4CYUA 1WKLA 2BKNA 2QC3A 3TUJC 1T9TA 3UE3A 4NI2A 4BL3A 3PJWA 4NEZA 2YNHB 4PWDB 2A6OA 4K2JA 4IKAA 3TJAA 4PRFA 4HEA9 4M5NA 3OUYA 4EYHB 2GJIA 4X66F 2JWNA 4QIEA 4NWBA 2MLXA 4FDFA 1IKWB 4TXSA 3KHLA 4IRDA 1SJ1A 5E0OA 2XMMA 1NPRA 3AFGA 1SVDA 4WYLA 3DLEB 3KMSA 4PABA 5DQGA 4N5SA 2CJXB 3EGZA 2V8VA 4CYUB 4CPKA 3RGIA 1FE4A 1HQ2A 1OPZA 3KNAA 3OR2A 1NB2A 2E7XA 1NRKA 2WSFC 1HNVA 1VHFA 3PTWA 4DV6F 1B7YB 4N76A 2HPUA 3GSDA 1Q5YA 4DL4A 4WIIA 3QIPB 3RYLA 3C6TB 2CQHA 5L1KA 1YBUA 1IKYA 4JP8A 3THTA 4B08A 3S1TA 4R1GA 1ACMB 1KTVA 1UW9A 2D7SA 2G0JA 4DQRA 2C42A 1YRUA 3D0IE 4J9SA 1RTDA 2KYZA 4JI5F 3CDEA 2KG0A 1DQAA 2Z2MA 3NXZA 4TVAB 1ZM9A 4ZS6A 1FERA 4WTYA 3E3XA 3T5HA 5HLFA 3TR5A 1OSCA 1BWEA 4U8YA 3N6LA 1B0TA 4DCJB 2CPHA 1SQGA 5J1NA 2A10A 2FHMA 4B9UA 1EHWA 1N0VC 5CYMA 4C98A 1NHVA 3DDIA 1TK5A 4H54A 2X3GA 2VG5A 1YSJA 3LPYA 2E1PA 4CH7A 1MWYA 3HVAA 1X8DA 3FBCA 4H4KC 5HMYA 2VPXB 4NLGA 1AZSA 1HBUA 3BH7B 2BJDA 1S4FA 4QYZJ 1S79A 4K8RA 1GK8A 2V2KA 4GRSA 4NA1A 1HHSA 4F0HA 3Q0AA 3VAMA 4O44A 2CXEA 4EO8A 1OS5A 1V3ZA 3JSMB 3CCSS 1KN6A 2JLGA 3CDBA 4B3OA 4W90B 2R7TA 2LDIA 3PJXA 2R8IA 1O51A 4DL5A 4CLTA 1S6UA 1Z2ZA 3IAS9 2DTJA 3M8YA 2OHDA 3MCMA 2B7CB 3LANA 3ZTQA 3L95X 1ZM3A 1K73T 4A8QA 2MQQA 4QWAA 2DGOA 3H98A 2JC0A 4PPDA 4B3SJ 1OYDA 3KLFB 1TR0A 2EG1A 3M32B 5KG2A 3Q83A 4ED7A 1FRMA 1QAJA 3AD7C 3UDVA 2QX0A 1MW7A 2PMWA 3ADAC 3C14A 3IBFB 3M2VB 4IQMA 4XDCA 4DN0A 1B7FA 4J9PA 2R8JA 4WU3A 3W8GA 4UOGA 1TZ0A 3MMCA 2GHVC 2W7OA 2CQ3A 5IQQA 5K8NA 4LRCA 3NGDA 1ZAVA 1DFDA 1VBKA 1RHUB 2M5YA 5IQ6A 3H42A 2M9KA 3M8QA 1F6TA 1FDAA 1GXLA 2Z58B 4KBIA 3RTVA 4AT1B 5M1AA 3VQTA 4NLSA 1NB7A 3RJMB 1F2HA 2DGWA 3MMBB 1YRXA 2MKIA 5GMDA 2IRYA 1J5OA 1RT4A 1WDDA 1NHUA 1VDHA 4NA2A 4L3NA 4CH0S 1REVB 1Q0NA 2HQDA 3J7Z5 4ZPVR 1IN0A 1U0SA 1MROA 2JFDA 1ZYQA 2V9KA 3QLHB 4OI6A 4OHXA 5CCLA 5H9FK 3AOCA 4DV7F 4DLEA 2HFNA 1T8EA 4G1IA 1RABB 4ECZA 2DGUA 1H2VZ 3FDSA 3D28A 4EWTA 4F02A 4ATNA 1K1SA 2V34A 1HBMA 3C8YA 2PMZD 2DR9A 2RU9A 4OX7A 4Q45A 1AROP 2CJKA 3KDOA 2FVSA 2UVUA 4RNOA 5KG3A 5KT2A 3GJQB 1NSAA 2Q79A 2K7KA 2RDDA 4GVBA 3VCDA 4PYDA 3MXHP 3DI6B 1MROB 2AGQA 3HHNB 3DRPA 4LBPA 4DV3J 4RW7A 3G71S 4R23A 2GVDA 3GIRA 3Q2SC 3RW7A 5I3UA 3R2DJ 5AE2A 1NMEB 5D15A 2QE5A 2V8GA 2XNQA 3CTRA 3PJ9A 4UQTA 4RL1A 4NXNF 3H90A 3ONQA 4AUKA 4X4PA 2IMWP 2J5AA 1PAEX 1YJVA 3CJKB 3UO0A 3C2PA 2MY8A 2XS2A 2IA0A 4ECVA 4WZQA 3KJVB 2L9WA 2FB0A 3U1MA 3NNAA 2VFRA 5KG7A 3U02A 1NBEB 1VRUB 1FRXA 1HARA 3MM5A 4F36A 3ZZRA 1WSVA 3I0SA 3K7RA 3NLCA 5M2PA 3HP6A 3PX4A 3M8PB 4RW7B 2AIRB 4ZCKA 1XMQJ 4G3IA 3CJ8A 5F8MA 1RT2A 3J7ZT 4HKQA 4N47A 4A8FA 3VGUA 4RKUC 5DLGA 5CAAA 1FTCA 1S1UA 3FRZA 4LREA 4LF9F 1FKPA 2N4DA 1LWXA 1PSDA 4QR2A 2YKPA 4J37A 4AYBD 4IYQA 5A8WB 3CCLS 1SJ3P 3KLHA 2E5LF 4F2SA 4X65J 2JLEA 1H72C 4ER8A 3LP1A 4ZVPB 4DR3J 4I2PB 2Y1JA 1FRKA 1PKUA 2AGOA 4AQYJ 2RUGA 2JH3A 4UQGA 4LF9J 1G7CB 2RE1A 3HKWA 4YB6A 4ZOSA 3P49B 1FFWB 1WEYA 2CA9A 2Y1LB 5JUMA 1CSJA 4KGVB 1PC4A 2Z0GA 2ZH8A 2WAEA 1F9HA 2VJVA 1TL4A 2XSFA 5DZ6A 4DV5J 4LF7J 1EQ0A 1C2PA 1KONA 2V67A 3EGWB 3F56A 3PHEA 5HMXA 5A0YB 5E3AA 1KDNA 2WCXA 4I6AA 3TAMA 3HM9A 1N8RT 5KFVA 1MU2A 3KYLA 3QGPA 2FVCA 3W60A 1N5YA 2VODA 1KLMB 3IGNA 1VQ4S 2UU9J 2GHWA 1SJFA 3PO5A 2XCPA 3MFHA 4I7FB 4FYVB 5KFCA 2KI2A 2BANA 2WSEC 3VAFA 2OLVA 5GAGU 4WP3A 1NU4A 2NXCA 2J7UA 3IFEA 2GQCA 4JI5J 4KHRA 4DR1F 4KH1B 2E29A 2EW9A 2XHCA 4OI2A 1PC5A 2HLTA 1N32F 1FJ7A 2MJNA 1V5VA 3AQPA 3PVXA 5A0YA 2CG4A 3R27A 4CLYA 2QYCA 1NH7A 4DCOB 2DH9A 3PACA 2R7SA 1LWFB 1Y5LB 2VUGA 2IRUA 5G0RB 5C5JA 3SQGA 4FXVA 1NK9A 2XMTA 4OX9F 2BE2B 3DLKA 1EKSA 2KZZA 1N6QB 2YQ1A 3GJRB 1KHWA 2CQCA 3FFIB 4X64J 2GFFA 3GTYX 4I68A 4CI0B 4H4OB 1VQYA 3LO3A 2Y3YA 3JB9k 2J0WA 3DU5A 5KG4A 1WOSA 5LJ5Y 3R7BB 3F73A 3AT1B 3MGJA 2HQFA 3LGMA 4RW8B 5AXNA 3I31A 2JEFA 4BDPA 2QSWA 3VR1A 2IM3A 3A8KA 1KBRA 4M5MA 1I94J 2C22A 1XJWB 3HULA 5KG0A 1FD8A 1Q16B 2FJDB 2QLXA 3GG0A 3HVTA 1MWQA 4NRUA 3K5NA 2WAQD 5HSPA 9RUBA 3P3DA 2B4PA 4NX9A 3KK2A 3DKDA 2MY7A 1L5UA 1UVJA 3M2UB 5MAOA 1S7HA 3MAHA 3HHDA 5IV4A 2J9EA 2YNHA 4B3MF 4TY8B 5KOWA 4ZVOB 3B8HA 3PXGa 1N5TA 3AA9A 4CNZA 1SH2A 5J1EA 1BQMA 3MUMP 2ZBIA 1EIYB 3OVBA 3IG1B 3LTOA 4PCQA 3VAJA 1VR6A 3GFXA 3L7OA 5EN1A 2QT7A 1F9EB 2WBRA 2ZBRA 3FNNA 1N48A 3OTOJ 4DQIA 1WG5A 2NYIA 2DCLA 1N36J 5KSHA 1JLGA 5AJ3J 3VAGA 4OHYA 3PW7A 1U26A 1WC4A 1H3DA 2PA3A 2R2UA 1FFSB 3K8WA 4Y3CA 4ZPBA 1JNRB 5GADI 4EBCA 1YK9A 3M2UA 1GMWD 3BJYA 3G6VA 3VSLA 4Y00A 3MR3A 3JYTA 1H38A 3KMQA 4LF8F 1MSWD 3QWPA 3Q8SB 4PEOA 3OTOF 5B0CA 3CCRS 5DM7Q 1W2BR 2B8PA 2M70A 2EFGA 1SQEA 3N6NA 2CPIA 1RT4B 2IC3A 2OPPB 3ETOA 3IWLA 1ZPVA 2VONA 1G1XA 2ALYB 2PT0A 2ZUGA 3DMJA 1VS3A 5D4LA 3V2UC 1F3FA 2MQNA 3AHPA 3DCAA 4ZJLA 3CJ3A 4DN9A 2F8MA 3QT7A 2OEMA 4F3MA 2IIHA 1TL3B 1HBOB 3N6MA 1NJXA 1A6LA 2D9PA 1LW2B 2GJFA 3IMQJ 1CJVB 4KV8A 1X4EA 1RA6A 3DLHA 4WXOA 2BQUA 2Q66A 2D69A 4K5SA 3Q24A 4OYXA 2W9CB 4CDIA 2ABYA 4K50A 1NJZA 4NLRA 2V8DA 4WP9A 1PYYA 5D4NA 1S9GB 2AYEA 4DPUA 5KFWA 1M5SA 3NNCA 4P7TA 4ZJOA 2BJ7A 5HROA 3MM6A 1I5OB 2NXJA 2MZJA 4DS5A 1E6VA 4ED5A 2ZBCA 2CIMA 4TU9A 3FSIA 1NDCA 4F50A 3ILJA 4I1TA 5ITHA 2AJ0A 1FDDA 1UEVA 2OPSB 2Q6CA 2LQ8A 4DI6A 4OI0A 3KHRA 5FLXU 2CQ0A 2NPFA 1CBKA 3RR7A 5CH7B 1YVFA 2COLA 4IH5A
chains in the Genus database with same CATH topology
2KN4A 3KTQA 1WTFA 5MLCV 2DHXA 2RVJA 1YJUA 4DSKA 4QWDA 3SI8A 3KKFA 2GA7A 5A2QY 3HF5A 4I0WA 4LQ3A 2KTQA 3IS9A 2BACA 2VG6A 5DDQC 4WFYA 1URNA 3J7YU 3H2VE 3RAXA 4LFCF 2EFQA 1KFSA 2HHHF 2JEJA 2UUCF 1KC8T 5E3CA 2XNRA 2E9TA 1Z4UA 3BDEA 1YRTA 5DG8A 2FHJD 4YB1P 2D41A 4DG1B 3QJPA 4DF4A 5F3TA 1D1UA 2OTLS 4LT6A 3UE2A 1J5OB 2L9DA 2D3OR 2OLWA 4DLGA 5CYQA 4GMKA 4BL2A 3HMJG 2ROEA 4N56A 1TAUA 4WE1B 3IA0A 2XSJB 1KR4A 4BCAA 2A18A 2XC9A 1ZM4A 4PG5A 1ZETA 1S49A 3NL0A 5GADU 4P7VA 5KT6A 1UEUA 3KLEB 2O5DA 4RUCA 2WTFA 1GXUA 2ALZA 3TP2A 1IBMF 2AGPA 5A6PA 1BQXA 3RAMA 3H4BA 2XWXA 1N6QB 3UFCX 3ZC4A 4B02A 3DI6A 5T14A 4X4TA 3U1NA 3CIMA 2ZM6F 3FZBA 1MMDA 1HNIB 4R25A 4DX8H 2B7BB 1FKOA 1D0EA 1T7PA 3RZAA 3TW0A 3CCUS 2FJAB 4HI2A 4C11A 2MQPA 1S72S 3TA1A 2N7YA 3G6YA 4CNYA 4TNOA 4URGA 2AU0A 4Q8EA 2BRKA 2AP6A 1UVKA 4ZVEA 4YUDA 3BN7A 4DFPA 2BE2A 3DLKB 4H4MA 3A8EA 3CD5A 4LSLB 3M8PA 4OX6A 2NR0A 1NO8A 4M5DA 2EI5A 1F0XA 2U2FA 5BR8F 4MK7A 4ZVFA 4R8UA 2RKIA 1TV6A 3RB3A 1I94F 5J1PA 1YJWS 1WI8A 3WX4A 1WTBA 3BQ1A 4KAIA 1E6YB 2BV3A 2YVSA 3TVKA 4KR0B 5AXLA 3PV8A 5J2MB 3SYZA 4TU8A 1NNDA 2UV8A 3O44A 2UZAA 5CHCB 2MZ1A 5CXTA 4OZ1A 3E51A 4QYRA 4ZCMA 1M5KC 5GAHU 2XG8A 4HI1A 3IG1A 3I6PA 2E9RX 4DKIA 5JXSA 2NSBA 5AJ3F 3OC2A 4J9KA 1N52B 1S1VB 4DV4F 2CZ4A 3BM7A 4A8SA 4JBCA 4NXMF 3OLAA 3GIJA 1HI0P 3M1VA 1RGVA 1Q79A 2HHPA 3UQSA 1IQZA 4USIA 1X9SA 2HWHA 1M5HA 4PKDB 3PR5B 4MK8A 2B3TB 1VMBA 3OVSA 2V94A 5DG9A 3FCHA 3DNCA 4XIUA 3L7PA 1O0PA 3EUNA 4O3QA 2HRYA 5HP1A 3TX8A 1KQFB 2L48A 3DGPA 3CSKA 3HLUA 2DHAA 4B17A 3KG4A 2KYXA 2XGPA 4F4KA 1R27B 4ZP9A 4CO5A 1FD2A 2HS4A 5I42B 1BY9A 2MKJA 2BUNA 1TKZB 2QRRA 4ED1A 5L9NA 4F67A 4YR2A 3CF5Q 1SH0A 2PDAA 1ELOA 3MMAA 1ZZFA 3VAKA 4WKYA 2KU7A 7FD1A 3S8SA 4C3LA 1JJ2R 4WF9Q 1IJEB 5K9FA 1UA1A 1GTEA 2L9NA 1Q4RA 2XCAA 4NZ7A 2KB2A 5D77A 5T7LB 2X1BA 1TL1B 4NLDA 2J0XA 5KFSA 1UAWA 2B5JB 1W25A 1SB6A 3MEGA 2L08A 2VFVA 1U4BA 5E5NA 2B4UA 5AE1A 4X4VA 2YWHA 4M94A 1WELA 4DL2A 4C8MA 4Y2AA 3D54A 2XHWA 1O5JA 2YNIB 5D3GA 1C4CA 3O5TB 2PC6A 3W3SA 1N56A 5LXRA 2C3UA 4RNNA 1X4DA 3DDNA 5EHHA 4JI3F 3TOQA 2DGVA 3E01B 3POTA 3NBPA 3N79A 2CQGA 2DO0A 4QIWD 2WOMB 2J7KA 3ZZUA 1HNWF 4K4SA 3PEJA 5IM0A 1KQSR 3OSNA 3PW2A 1N4LA 3B4MA 4NLYA 1U49A 1JMTA 2ADCA 2KJWA 4BBYA 3K2YA 4P2SA 4K5RA 1HQEB 2CQ1A 3M6UA 1DJ0A 5KFHA 2W9BA 3AJ2A 3U7JA 2P9EA 2C3YA 2MYFA 1SKWA 3TA0A 1SUQB 1IKXB 4Q5VA 2YKQA 3BZQA 1LWCB 2VD3A 4ZPDA 3BSOA 4JV0A 2ZH2A 2DR5A 4Q2MA 4JV2A 1U1MA 4OI4A 2RRBA 3CCZA 4JOUA 4LSNB 1VK3A 3DXBA 4YOEA 3FMBA 5KFIA 3NCPA 1XMOF 4QR0A 3V4MA 4YMEA 3GR1A 4K4WA 2A2DA 4ID5B 4MIAA 4JI1F 4RWWA 3MM7B 2A3JA 1K1QA 2EVZA 3MF5A 1TP7A 2MSSA 3LP1B 5A8KA 3M8SA 3EYZA 3QZ8A 2WB1D 1NK5A 2KT2A 4TYAA 4HVZA 1VC0A 3V4IA 1C1CB 5DRKA 2HNDA 4RW4A 3RRGA 2K3IA 2IHR1 2B56A 4O4GB 2W8KA 4FF2A 2UXCF 1LFWA 2J8AA 1YI2S 5IWAF 5DDOC 3TYTA 4PG6A 5CYJA 3MM7A 1UP1A 1QSLA 2HAIA 3PIOQ 1ULRA 1Q86T 2KXHA 2UUTA 2CVIA 4MMOA 2R7XA 2KJVA 2X1FA 2E44A 1VOMA 4NA3A 4U67Q 3DLGB 1SJ4P 1VBZA 2K1RA 4CJNA 1IUJA 4GC6A 3OSPA 3QMQA 4FPRA 1XR6A 2I5JB 4K4TA 1FHTA 2Y0SD 2XI3A 4L6V3 3T9NA 5KFNA 3CPWR 4DSIA 3NKYA 5HI7A 5L9XA 5KFDA 4KRWA 3NAHA 2C2RA 1U2FA 3SSSA 3MURP 2QA4S 2DGTA 3EQVA 2BZ2A 4DR5F 1TKTA 1UETA 2RSQA 2VB6A 3D1QA 4JYAF 2RQCA 1Y9OA 5DS7A 4ETZA 3N0VA 3MR5A 5DJBA 4YHHF 2HHUA 4KT0C 3MOJB 4M63A 2ASYA 4OZ0A 1MWTA 1R43A 2DNNA 2F9DA 2MKHA 4JV1A 3LP0B 1AUDA 2RS2A 3UI3A 1QE1B 1PGZA 1VQ8S 1IXKA 1DBDA 3Q8PB 2HNZA 4NLOA 4ZLPA 2R8HA 3WDOA 1IM4A 5C24A 3I87A 3OQ2A 1Q7LB 4ZHRA 3K5LA 2J6SA 3LP2A 5EWEA 4I69A 3LAMA 4QW9A 3G96A 2AYGA 2AX0A 5KT4A 3RRHA 3QAEA 1FDNA 2ZJPQ 2B9XA 2QLWA 3HVTB 3JTPA 4DOZA 4ZCIA 2W8LA 1S0NA 1TKZA 1DHMA 1QE1A 4Y65A 5LXYA 4DUZF 2IFXA 2E5JA 4Q7AA 4RW6A 3W2WA 1J2VA 1HD0A 4YDXA 4F25A 1KD1T 3QAUA 2I38A 3TQ1A 2KG1A 1T03A 2J0SD 1HBUB 2OKQA 3OTEA 4GO7X 4KFBA 1A9NB 4RLEA 2WAFA 2FHKA 2PD1A 4UY8T 1WF0A 2E1AA 1JLGB 4O44B 1F2GA 2Q1LA 5AE3A 3H25A 1FA0A 2LA4A 4WU2A 2WONB 3BF4A 4V19J 4IG0A 1N0UA 1C0TA 4OZLA 4F2RA 5J2NA 4CQ1A 5J2PA 2EFVA 2JX2A 4RW6B 3W2WB 4PUOA 3F41A 3FMWA 3MD1A 5E2QA 1VQ7S 4NCGB 3MMJA 5U47A 3FEZA 2RQMA 4PWUA 1WNEA 2XMKA 2FHJA 1S1VA 1GTHA 2ZH4A 1R0AA 4Y2MA 5BJRA 4OZNA 4EBEA 2C2EA 3W2VA 4B9NA 2ZZMA 4FP9A 4CT8A 4EU0A 4QWCA 5KAKA 1OSDA 1DRZA 3MEDB 3BDPA 5J2PB 2JJ4D 5GAEI 3UNGC 5D4PA 1C1BB 4PQUA 3KWMA 2R7QA 2KM8B 2ASLA 4KGMA 4RU2A 4O3SA 3K5PA 4DV2F 1N33F 2XY5A 2GC8A 1FKAF 2V4RA 1FO1A 3HVRA 4B9TA 4LJMA 3EPGA 4OJ1A 3X3UA 3MUTP 1UVLA 2ZVSA 2FVRA 3I96A 2V9WA 1VQKS 3OFFA 3JTOA 4U7UK 2UU9F 3TNVA 2R4FA 3ISND 4WFNQ 4PQUB 3GZ7A 4K4XA 2KKHA 2OPSA 3QO9A 2XMUA 1Y00A 1CLFA 1S1TA 2PE8A 1FF2A 1FJCA 2I2YA 2ACYA 3H2LA 2ROPA 2YNFB 3SDEB 1UJ6A 4DQSA 1DTTB 1X4GA 3US5A 3V6JA 1DARA 2OPRB 3X1LB 2V0NA 2YTCA 1JXEA 3IS9B 3M2RA 3GB0A 3MFIA 2VG6B 3GE9A 3GFYA 2F4VF 3N28A 2HFZA 1SV5A 3CJ4A 4QJVA 2BABA 3DU6A 1LW0B 4KC5A 2E5GA 2QA1A 2B51A 1OIAA 1X9MA 2YX1A 4KSEB 4X4QA 1VRUA 3FSXA 3MM5B 1UWBA 4ZVGA 2RMLA 4C8LA 3SDEA 1WHVA 3B78A 2AX1A 3OHBA 3RAQA 2RQ4A 4ITSA 4FS2A 2HNDB 2OPQA 4A4JA 2DNYA 5M18A 4W92B 1ZTWA 3DWKA 4O4GA 1JKHA 5DGAA 1NJIT 2XY7A 1NKCA 1IR0A 1R3NA 3QIDA 5CYQB 5H9FJ 1G2EA 3E01A 3I0RB 2BA9A 3CD7A 5A8WA 4KQZA 3FEYB 4LF7F 3I82A 3K58A 4JI0F 3C6UA 4A47A 3BQ0A 5B09A 1VI7A 4A8KA 4Q2LA 3DOLA 2RD5C 4I6YA 3Q23A 5KFPA 3L3CA 3KG0A 2B6AB 1CC7A 2AF6A 3U1LA 3DLGA 4ELTA 2OPQB 3UDCA 3G8SA 1VIOA 2R9LA 4ECUA 4Y0FA 3C6TA 4DJBA 5DLFA 2UXBF 3DOKA 2BM1A 5HMWA 2XLIA 3PM9A 4QCLA 1QJHA 4JBFA 2IAJB 1NJYA 1LWEA 4HYKA 1DURA 4DSJA 3GFZA 3MECA 3T19A 4UUWA 4YEAA 2IA6A 5GVQA 2L41A 4F4ZA 1QLNA 5KFMA 4CO4A 1URRA 2HZCA 3OR1B 3BGRA 5CD4H 2GIQA 1UMJA 2RT3A 1JIHA 5E7OB 1WI6A 2FDNA 2EBEA 1V6HA 2VQEF 4N8NA 1P8GA 1NK8A 4MYTA 1GX5A 2ZHOA 4ZHRB 1FJGF 2RKIB 2XMJA 2B9YA 4DL0C 1IBKF 2LXIA 1CG2A 4L72B 1XNRF 3CCES 4C8YA 3H59A 3Q8QB 1FTRA 4GKJF 1YJRA 4JI4F 1FESA 4NLQA 1XMBA 3I56S 2ZNYA 2GX8A 4OZ5A 1RT3A 2M4MA 2HGMA 1VRTA 4ZP8A 4DS4A 1RKJA 4QU7A 2XULA 1HBNB 1JXLA 5KFOA 1M1KT 3IR7B 1WACA 3O2IA 3T5JA 4LQ9A 1JX4A 4ZA1A 2RILA 3VAIA 1QVGR 3AY0A 3LO7A 1DQ8A 2CQDA 1IKWA 4IRCA 4C9DA 3IBWA 2HW3A 1VQ9S 3FQLA 1WG4A 5LT5A 2OFHX 1TAQA 5KFTA 3BO2A 2DIUA 3MTKA 4IG3B 4O3OA 4XAKA 3ISNC 2ZITA 1NAQA 3MM9B 3CD0A 1WHWA 4GO5X 4Q8FA 5A8RB 2OFGX 1RAJA 4ED8A 4PPZA 1JLEB 3PX6A 4ZPTR 4ZK7M 4AE5A 4FZVA 2BVZA 1S0OA 3QIPA 4N1XA 2YKNA 4P6QA 4ECXA 4NPOA 3MR6A 1U1PA 4I56A 4OL8A 1R89A 4ILRA 1R0AB 3MR2A 2ZZNA 1JWWA 2K8GA 3ZZYA 5FLXY 2G1DA 2WSCC 1SL2A 3O1LA 1RTIB 3EPIA 4DV3F 1LV5A 2AJQA 5FIIA 4K4YA 5EGYA 3A1YG 4RZRA 4A8MP 3CEDA 3IWXA 3DRRA 1P1TA 2PN6A 4RU9A 2YKNB 1HNZF 2FPHX 2HMIA 1RA7A 2IVFB 4ES3A 2MJUA 1UA0A 1X5OA 1P27B 2PO4A 4AXIA 2LEPA 2LQJA 2DO4A 4M8LA 4NOHA 4EUVA 1XMQF 1LK5A 1HWLA 4OI3A 4RW9A 3NP5A 4MKYA 1R8PA 4B3OB 2NXUA 1TL1A 2JVOA 5LL6d 3PW5A 4FXWA 3Q8RB 2OMLA 4ZMMA 1M5PC 1HW8A 2DNMA 2LEBA 1FNXH 1HFEL 4RX6A 5DDPC 3D0GE 5LMNF 3SCKE 2OJ3A 3K8VA 1SIWB 4DR3F 1SC6A 5LSRA 3MCSA 3M2VA 4RNMA 2EC0A 1SXLA 5FD1A 2EG2A 3MOZA 1JLCB 3ICLA 5HL7Q 4X4SA 1FE0A 3M2RB 3PIPQ 4DR7F 4FS1A 3PY8A 2EK1A 2QV6A 2VPZB 3LALA 5D8HB 2KXNB 5J2NB 2YKMA 1GX6A 3C66A 4ELUA 2HGLA 1RT5A 3HXMA 4QIFA 4NCGA 1H7XA 3LOUA 5IM0B 3SSRA 2DT9A 2G0CA 1SH3A 2XMVA 2UUBF 4OZJA 2VOOA 1N88A 4PXCA 4C8KA 5F3ZA 3M30B 1MMNA 2IJNA 1LQ9A 3T6BA 2V8HA 4Q0BB 3BEGB 2VKZG 1VC6A 5B7WA 1G3OA 2XO7A 5KG6A 3I0RA 2MKCA 4CTAB 2RDJA 3GIMA 1FRHA 1WWHA 3KLVA 2W9BB 2JEIA 3LW5C 5I3QA 1N34F 4Q44A 1X4HA 4YY3F 2MQOA 1IKXA 3UD4P 2PGCA 2HGNA 2ADBA 1KTQA 4OX8A 3MD3A 2PI4A 1YGYA 1N5VA 3NWGA 1H98A 2P6SA 3EXYA 3QGIA 5F0UA 1DTQB 4J9OA 4HDHA 5KFZA 3GIKA 1LWEB 1GT8A 2CJ9A 5IT0A 4ICLB 2N7CA 3O8WA 5M19A 2KVIA 3N9UC 3PW0A 3SV4A 4DMZA 5AXKA 1NKBA 3QO9B 4EEYA 1LWFA 2ASDA 1CEZA 3QGHA 3KJVA 3E8OA 3CXCR 2E1CA 4KKOB 2VASA 3CJ5A 1N6QA 2EFNA 3CULA 1GH8A 5I3PA 3R1LA 1XK8A 4A8OA 3CD6S 4KO0B 3T6JA 1Q8BA 4WFBQ 2J76E 4B9LA 1VFJA 3NCQA 5HBMA 1XEZA 3G86A 1FKPB 2POKA 4ES1A 3RW6A 1T95A 5IT9Y 1YHQS 1OO0B 4JI6F 4LF6F 1IQTA 4V19X 2J9DA 3CCVS 3NCRA 4I2QA 3LUYA 2O1PA 1U47A 1L3KA 2VPYB 4CZCA 2HVHA 2N3LA 4MIBA 4I67A 4LSLA 3QJLA 1HNVB 4AL6A 1UKUA 5KT5A 3THPA 1NK0A 1S1XB 4JI2F 4DWIA 3UPPA 4YR3A 4YFUA 3KHHA 3VZHA 3BGUA 2HNYB 3OFGA 3SFGA 1U6BA 2DITA 2RF2B 3PW4A 4KB7A 2M52A 3EZ5A