2ZCBA

Crystal structure of ubiquitin p37a/p38a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIAADQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Crystal Structure of ubiquitin P37A/P38A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 74
sequence length 74
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zcbA00
2WDTB 2KVRA 4LDTD 1VD2A 4GDKB 3DDCB 4MGZE 2XEWA 1Z5SB 1SGHA 3L16A 3DOWA 2L7RA 2DZKA 2JXXA 4FBJB 2BWFA 4PYZA 1E7UA 3SU8X 3ENEA 4CHKA 4EKUA 1WGDA 3QQ8B 4EZKA 3QK0A 3TIXA 2KC1A 4BKGA 1Q0WB 3PRZA 2DAJA 1E8XA 1TZ1A 1WX7A 2MLBA 2O6VD 4MGKE 4HVBA 4WAAA 4WJOA 1YX6B 2PE6B 3IBEA 2G4DB 4EZJA 2FIFA 4HDOA 2N1WA 2WX1A 3O65B 4KSLC 1X1MA 2NCNA 2LGXA 2K6QA 2FCQA 2UWQA 2JY6A 5AEKB 3NZUA 3QARA 3A9KA 3KUDB 1WM2A 2MBQA 1WFYA 1XQQA 4HK2A 4K81A 5HKHA 1WF9A 4WJNA 1KM7A 2C9WB 4ZRIA 4W9IA 2N9XA 4B95A 2EMSA 4PS7A 2C5LC 1KLVA 2JPHA 4AJWA 2BYEA 2JZZA 3MTNB 4KDLB 5EDSA 1C1YB 4FHJA 3SHQA 4AWJA 2KZRA 2Z59B 2ZVNA 4IM2A 3D32A 4IC7B 2QHOA 2DENB 3ZNZB 3ZO5B 3B08A 3LJ3A 1P0RA 2NPTA 1V86A 3PPAA 1Y8RC 3VVWB 3U8ZA 3DVGX 5BO4B 1S3SG 1WI0A 4FHKA 4NY0A 2KO3A 1RFAA 1WXSA 2EMTA 1WE6A 3UIPB 2LXAA 1WM3A 2HE7A 1V9JA 2AEHA 2KLCA 2O2VA 4MGIE 2DYBA 3HHMA 1WZ3A 2GBKA 3Q3JA 4TKNA 4XX5A 4W9CA 4E3CA 2KJHB 4K7UA 2A5UA 3W1SA 3N3KB 4AOFA 2JF5A 2ZPYA 4OVVA 5J2RA 3WIMA 4ANUA 4NQKE 3QWZB 2MBHA 3OLMD 4HPMB 2KMCA 4DK5A 3RT3B 3RD2A 1IPGA 1RLFA 1V5TA 2JRIB 3QA8A 5TR5A 2KN5A 2ZNVB 1WGYA 4GIVA 5D2MB 2GBMA 3AI5A 3M63B 4P7IA 2AWTA 1KOTA 1Z2MA 4GN1A 4AJYB 3R7QA 3WAPA 2Z0DB 2OJRA 3TJPA 1M94A 1NDDA 4A3OA 3TL5A 2JVCA 3RUIB 2M17A 2KOXA 4LJOB 3VTUA 3PS6A 3VDZA 4FJVB 3T9LA 1U4AA 3VUXA 4BFRA 4BOSC 3QCAA 3ZKJC 3TMPB 1PQSA 2MP2A 2NR2A 2BYVE 1E8WA 5DPWA 2PE9A 4EFOA 4DWFA 4FJYA 1CMXB 2LWPA 2MWSB 2V1YA 1WMHB 2LZ6A 2Y5BB 3K9PB 2JWZA 3KW5B 1TBEA 4HCPB 4A3PA 2KMAA 2RSUA 1XD3B 2A4ZA 2MBOA 3R7RA 2OOBB 3M95A 1WE7A 3DBRI 3U7DA 2MX2A 2LD9A 2M0XA 3VFKA 5CHVC 3PLVA 2LUEA 1E8ZA 2FCMA 3VQIA 5KHOA 3KYDD 4FLHA 1RRBA 4ANVA 5G55A 1WJ4A 5C1ZA 4K7SA 5LXIB 3EECA 3N30A 2FNJB 3T8MA 4NQLB 1ZKHA 2LASA 2WWZA 3VUYA 4KSKC 1YIWA 2J0MA 4NJ7A 3H1UA 4DDGD 3ZRFA 3UINB 2AYOB 4HDQA 4KZ0A 3W1SC 2KTRB 2BPSA 1YQBA 1GG3A 3A1QB 4E74A 3I3TB 2M1MA 3EHVA 2PJHA 1VCBA 4GDLB 4ICVA 1QZEA 4MGYE 3OJ4B 4JQWC 3VXWA 1TTNA 2D07B 2IO2B 2K39A 4DHJB 1LM8B 2DZJA 4W9KA 4GSWA 1I35A 2KQ7A 4BBNC 2DX5B 4BKSA 1HE8A 2MCNB 1UBIA 3L13A 1H4RA 2UYZB 5JH5C 2KQSA 3A9JB 3DBHI 4LCDE 5AZGA 1RAXA 3QHTA 2IO0B 5JHBA 3DPDA 3A33B 4HJKA 2L8JA 4RM8A 3VH4B 4F1SA 1WZ0A 2KFKA 3PT2B 3R66C 2IO1B 4IUMB 2YVCA 4FA6A 4B6WA 2IO3B 4KIKB 4F8CB 3CSFA 3LDZE 2K25A 4MJSA 4KDIC 3NS8A 3ZDMC 4GXBA 5DPTA 3VTVA 1Q1OA 4JGHB 4JLCA 2LGDA 2KNBA 4HWIB 1WH3A 2ZEQA 1WY8A 1H8CA 2KX3A 4EZLA 1T0YA 3KYCD 2J0JA 3S2AA 2IYDB 2G4SA 2D2QA 2DHZA 2GMIC 3JSVB 3VAWA 4DHJD 3AU5A 2BYFA 4MELA 2HTHA 1NI2A 3HM6X 4NAWB 3OAWA 2BGFA 3A4RA 2XK5A 4CO7A 4NPNA 1OGWA 1V6EA 4JIOU 4WWNA 3NHEB 1IYFA 3JW0X 2ZJDA 4AUQC 2K1FA 5IA7A 1YD8U 1XT9B 3L54A 2LI5A 2Z0EB 2HD5B 4RM9A 3ZNGC 3NY5A 1WX9A 5E6NA 2GOWA 4MM3A 2DYOA 3WA0A 3UQBA 2C7HA 4ICUA 3PHWB 2FCSA 3ZUNA 5JHAA 3VH3B 1WIAA 1ZW7A 3V62A 3PRMB 2C7MB 4BKSD 4BOZB 1E5WA 3RULA 3OJ3A 3DBLI 2WX0A 2L00B 4ANWA 1GUAB 5AZFA 5J17A 2MQJA 2N9EB 3DBSA 2GBRA 3CF6E 2YLMA 2RPQA 2RR9A 2KC2A 3M3JA 5FR6A 4ASWC 3UGBB 1WJNA 3WANA 4WJQA 3RYTA 3X0WA 1WGRA 1KJTA 4RMAA 2KJ6A 3PZDA 4F7ZA 3PTFC 4I6LB 4I6PA 4IWQA 3PV1A 4W9JA 1WJ6A 3ZIMA 5CHWA 3DVGY 3ZRCA 4BKTA 3KH0A 2N9PC 3PVLA 5JZEB 4IM0A 1WRDB 2CHXA 2C7NB 5L95C 3PGEA 1G6JA 2L0TA 1E7VA 3PSEB 1OTRB 4IWOA 3RZWC 3V60A 5IAAC 1EF1A 5G2NA 2D10A 3ZTDA 3KUZA 3PLUA 4URKA 2HJ8A 1FXTB 2KWUB 3DCGA 4AP4C 2XBBC 5KHQA 2ZZPB 4LJPB 1Q5WB 5D7GA 3L0WB 4GDKA 3B1LX 2O2VB 2KXJA 1YX5B 4GDLA 3VHTC 1J19A 4MSQB 2BKRB 1P9DU 2KFJA 1R4MI 4XC2A 3IG3A 3Q3FA 1S1QB 3CMMB 2VRRB 3ML9A 2KHWB 4LDTB 2BF8B 2GBJA 2JRHA 2ZCCA 1V49A 2FUHB 3H7PB 2RD0A 3A9JA 3MJWA 1K8RB 1LQBA 1V5OA 1WR6E 4G11A 4GB9A 1I42A 3RCZA 4II2B 2DAFA 1WR1A 3TCAA 3WAOA 4W9DA 5DPRA 4HCNB 1WXMA 3IVFA 1F9JA 2MBBB 3ONSA 2V4LA 3QJZA 3DVNU 1E8YA 2D3GA 2IY1B 2CHZA 2O6VB 3PRPB 4KZCA 3MHSD 4KIKA 3R3MA 3QC8B 2LGYA 3ALBA 4II3B 1TGZB 2AL6A 4W9LA 3X23A 2NBUA 3CSTA 3GZNI 1WJUA 2MBEA 2CHWA 1LXDA 2CU1A 1V2YA 2DZMA 3DQVA 2MSED 2PEAA 1E90A 2CR5A 3AU4A 2IBIB 4TQ0A 2W9NA 2I1JA 1OEYJ 2C60A 3AXCA 1SIFA 3HM3A 3TBLD 2R2QA 2KTFA 2FAZA 3JSVA 1WGGA 4NAWA 2M8SA 5D6JB 3JVZX 4PS8A 2KLGA 3H7SA 2K6DB 2NVUI 2I1KA 2KDIA 1WX8A 5GMVA 1J0GA 2L05A 3SDLC 2L0FA 4HXDA 1UH6A 5CX3A 2CKHB 3BINA 4IG7B 3RZFA 3PHXB 3V6CB 3GOEA 2EKEC 2KWVB 3EFUA 3N32A 2KDFB 3A4SC 2FCNA 3ZDTA 4W9HA 3VUWA 4W9FA 4G0NB 3NOBA 2J7QB 2KANA 4X57B 3APDA 4MSMB 2M4NA 5E6OA 3ECIA 4G3XB 1UD7A 5DCNA 2KKCA 2IY0B 1LFDA 1OEYA 2PPHA 2NBWB 4IWPA 3KUCB 1EUVB 4GU2A 1C3TA 2MA9B 2WYQA 2D11A 3V61A 1MG8A 4ZDVA 2K8HA 2NBVB 3B0AA 3JYUA 2ZVOA 3QIJA 1GJZA 4N9F4 1EO6A 5AZHA 4DHZE 1J8CA 4TV3A 1JRUA 1UBQA 2G3QB 3ZTCA 2N1VA 3L10B 1IP9A 3ZLZA 4CYEA 1WXVA 2BWES 1ZGUB 2K8BA 3KVFB 5CTRC 2KFKB 2CS4A 3BY4B 2B3AA 3A9KB 4IW0A 1WYWB 1YJ1A 2FIDA 1A5RA 4MJSB 3ZW3A 4HLEA 2KK8A 3H6NA 3NZSA 3ZNID 4M8NA 3HIZA 1WMHA 2KJRA 4DXAB 1R4NI 2MW5A 4K1RB 4M8MA 4DBGA 4YL8A 2N7DA 4ZRJA 3UIOB 2L76A 1L2NA 3APCA 5C23A 3K9OB 2BKFA 4PS3A 1V80A 2N7EA 4MH0E 3C0RB 3P2BA 4J6IA 5L83A 4GMVA 4BVUC 3IHPC 5E6PA 4ZYNA 1NBFC 3DVNV 2JZ3B 4DHZB 2R2OA 2XK5B 3UQAA 4K7WA 4EEWA 3L17A 2KD0A 4EOYA 2KDBA 2LXCA 3H7PA 2NPTB 2DYMA 4JL9A 3ZNHB 1WGHA 2G45B 4W9EA 3APFA 2MRPA 3QAQA 3QX1A 2NS5A 3L08A 5CHFA 3VTWA 4GOCA 2J0KA 4FADA 1D3ZA 1V81A 2KTRA 4E71A 2L3ZA 1P98A 2IZVB 3A1QA 3AULA 4MDKE 4TUUA 4WWPA 4EUTA 2O6VA 4BBNF 1P3QU 3HK0A 2AL3A 1L7YA 2KDEB 1UELA 1GC7A 2JUOA 3IFWB 2ZNVC 4WJPA 2REXA 2LVPA 4M0WB 3PREA 3SD5A 1P1AA 3WALA 4DDID 2LJ5A 2LVQA 2ZCBA 2DZIA 3U30A 2KX0A 1BT0A 1UGMA 2KWCA 4FULA 4IM3A 5J18A 4FJZA 5D94A 2JT4B 4HPLB 2LRUA 4G50A 4KVGB 1OQYA 4TQ1A 4KV2A 1GC6A 1UZXB 4NJ6A 4I6NB 3M62B 4GGQA 4ANXA 4ZRKA 2V3SA 4WWOA 3W1YA 2ZPNA 4MEMA 4A20A 2ASQA 2LRWA 4FN2A 4NNJB 1EF5A 4B9KA 3ML8A 3ZVVA 2GBNA 3UF8A 3WAMA 2LVOA 1ISNA 2N4FA 4PYUA 3H9DA 5DPSA 1AARA 2MP2B 1GNUA 4WQOB 3EC8A 2K8CA 5LXHA 4XZ4A 5LLIA 4OVUA 2RGFA 1WXAA 3V6EB 4W9GA 1SE9A
chains in the Genus database with same CATH superfamily
4LDTD 1LO5D 4GDKB 4MGZE 3BK2A 2DZKA 2JXXA 2BWFA 4PYZA 3P4RB 3ENEA 4CHKA 4EKUA 1TKEA 4EZKA 3TIXA 1K53A 3LB8C 3Q14C 1VRAB 1E8XA 1TZ1A 4N6EB 3MJ5A 4WJOA 1CJEA 4HDOA 1X1MA 2JY6A 1FNUA 1WM2A 1WSPA 1WFYA 1XQQA 2MBQA 4K81A 2W3RA 4ZRIA 4W9IA 5IKCM 1ZUD2 3B9JA 1IBXA 3DHHC 3FKYA 5EDSA 4FHJA 4RGNA 2Z59B 4IM2A 3DHGC 3D32A 2HDEA 2DENB 1A70A 3PPAA 5BO4B 3Q8BA 4FHKA 1WXSA 2KWDA 2V4IB 1WE6A 4JX1C 5EE3A 2DYBA 3Q3JA 3J9CA 2MJDA 4AOFA 2JF5A 4M0WA 5J2RA 4ANUA 1K50A 4HPMB 3QA8A 2PLPA 2KN5A 5D2MB 1DOYA 2WXRA 1KOTA 5BMGA 2K9XA 4GN1A 4WIPA 2J52A 3TJPA 1BXTA 1YJJA 4A3OA 3RUIB 2M17A 2KOXA 4ACFA 2JZPA 1U4AA 3QCAA 3TMPB 2LUMA 1E8WA 4FJYA 2LWPA 2MWSB 2V1YA 1FCLA 4A3PA 2MBOA 2PVOD 2MX2A 3ZQ4A 1MHXA 2M0AA 3PLVA 1E6EB 4PK1A 3KYDD 5GXGB 1V97A 5G55A 4K7SA 3N30A 4NQLB 1ZKHA 2V3NA 1XCTL 5IN7A 4AQ7A 1MPEA 1L6VA 3R2IA 4KZ0A 5G5GA 2BPSA 1RM6C 1GG3A 2RDGA 1JQ4A 4MGYE 2I2YA 1LM8B 4W9KA 3TEWA 3I63C 2LJIA 1QOAA 5JH5C 2UYZB 1JCKB 1JALA 5AZGA 3QHTA 2GB1A 2IO0B 4WH4A 4NAMA 3Q8CA 1WZ0A 2KFKA 3PT2B 3PZ8A 3LDZE 2AQ2B 4MJSA 4O1NA 1L4ZB 1T0SC 3ZGZA 3DHIC 1WY8A 1T0YA 2IYDB 2DHZA 2GMIC 3AU5A 4MELA 1FM0D 1NI2A 4P1CC 1OGWA 2UU7A 1CQVA 1JRPA 2ZJDA 5FK9C 5IA7A 1C4PA 2JXTA 1XT9B 3L54A 2LI5A 1L0YB 2Z0EB 4JPSA 1MFWA 4OVZA 2FCSA 4BKSD 1I4GA 2BB5A 3DBLI 2WX0A 2L00B 4S0RA 5HG2A 2N9EB 1QILA 3LXFA 2RPQA 2RR9A 2KC2A 2CJNA 1AN8A 1WGRA 1WXQA 3PTFC 3PV1A 1YOVB 2QMTA 5CHWA 5FKAC 4A55A 4XDCA 5JZEB 5T8IA 2ZW1A 5L95C 2W82A 3RN9C 2OHFA 2D10A 3ZTDA 3KUZA 3PLUA 4URKA 1WRIA 3NZ3A 1VR9A 2XBBC 4OZBA 4LJPB 1Q5WB 3L0WB 1MVKA 5C2TB 4GDLA 4RGTA 4XE0A 4L1BA 1P9DU 2KFJA 1R4MI 1GB4A 3IG3A 3Q3FA 2KACA 1WWTA 2GBJA 2JRHA 2ZCCA 1V49A 3GP7A 3RMKC 4GB9A 1K8RB 4CQNA 4ZOHC 1MJDA 1WR1A 2AX5A 3AEBB 1CZPA 2L52A 3QJZA 1D5MC 4LLGM 4FXCA 2D3GA 2IY1B 2N9LA 2O6VB 2KT7A 1TGZB 1QOBA 2MBEA 1E9MA 3BYTB 2MSED 3AU4A 2CR5A 2IBIB 4TQ0A 2I1JA 3AXCA 1SIFA 3TBLD 2R2QA 2KTFA 4NAWA 2KLGA 3AE8B 4OW0A 2K6DB 3Q3MC 1YNTE 1FFVA 5CX3A 3KQ4A 2CKHB 2KWVB 3EFUA 3N32A 2FCNA 3ZDTA 3O13A 1F2RI 4ZHPA 2ACZB 3AE2B 4P1BC 1ZXHA 5DCNA 3HUIA 1LFDA 4KGRA 2QIEB 4IWPA 3AEFB 5EE9A 4GU2A 2D11A 1MG8A 4ZDVA 1EO6A 2DLBA 2G3QB 3ZTCA 1V1PA 3L10B 1IP9A 1QQRA 1WXVA 1ZGUB 2K8BA 3EFCA 4IW0A 2SEBD 1RYJA 2ICIA 2WQYB 5H8YE 4DXAB 1UGJA 2H89B 4M8MA 4YL8A 4ZRJA 1L2NA 4LNOA 1MI0A 1SE4A 4J6IA 3P42A 4GMVA 3I5JC 5E6PA 4DHZB 1TT5B 5D3DA 2IJ0A 3L17A 2KD0A 3FILA 3Q6BA 3RPFC 4JL9A 2FUG1 1WGHA 3APFA 2KYWA 1EU3A 5CHFA 4E71A 1TYGB 2L3ZA 1P98A 4MDKE 4TUUA 4EUTA 3KLSX 3HK0A 2AL3A 1L7YA 2EKIA 1I4RA 3SD5A 2DZIA 1BMLC 3U30A 1BT0A 2IPKD 4HPLB 1AYFA 1B9RA 4GLSC 1V1OA 4OZAA 4ANXA 2V3SA 1SE3A 4WWOA 4NNJB 4JWSC 4WWMA 1OQQA 3ZVVA 4M02A 3UF8A 1TKGA 2MHJA 3H9DA 1AARA 1XF5L 4B0MA 2J42A 5LXHA 1WXAA 4LNFA 4ZRPA 2XEWA 1SGHA 2PW9A 4K3CA 1EM7A 4FBJB 1E7UA 1WGDA 3ZXRA 2KC1A 3VR8B 1FRRA 3GE8C 1GOZA 1KFYB 3PO0A 2L83A 1WX7A 2O6VD 1F52A 3IBEA 4KSLC 1R7SA 2LGXA 2K6QA 2FCQA 5AEKB 3NZUA 3KWLA 3RFZB 2EMSA 2BBCA 2K3UA 2JZZA 4KDLB 5AUKA 3SHQA 1FFUA 1ESFA 2WXNA 1E10A 2NPTA 1L5PA 2RMMA 1S3SG 1RFAA 2JU6X 2HE7A 1V9JA 2AEHA 3AH7A 2KLCA 3AE4B 4IDIA 2GBKA 4XX5A 1SE2A 2ZW0A 3RNFC 4E3CA 4XWTA 3FC4A 4IOIE 1MG4A 3W1SA 3N3KB 4OVVA 1NYRA 3QWZB 1KRHA 3RD2A 3RT3B 1V5TA 2JX5A 2K0PA 2AWTA 4ZHOA 3RNAC 3R7QA 2NTSA 1F77A 3RNEC 2MJ3A 2Z0DB 3T3OA 3W9CB 1FXIA 2QC8A 3UI3A 1V8CA 2JVCA 3PS6A 2D3CA 3ZKJC 2NR2A 4C7YA 2PE9A 2Y5BB 2LZ6A 1KF6B 2KMAA 2K5PA 3U7DA 3Q3NC 2M0XA 2WXKA 3VRAB 2LGSA 4MACA 2LUEA 3VQIA 5KHOA 4ANVA 2BS4B 5C1ZA 2LASA 2V3PA 3VUYA 1STEA 1YIWA 4KSKC 2J0MA 4C56C 3P4QB 2V0GA 2LFIA 2AYOB 1YQ4B 2KTRB 3AEEB 4RNAA 4ICVA 4QAYA 1XLNA 3VXWA 2D07B 2DZJA 4YTPB 2KQ7A 1N5XA 2INNE 4BBNC 4ZRQA 4BKSA 3L13A 3RNGC 2LHEA 4C00A 2PIAA 3MHZA 1ZP0B 4HJKA 2L8JA 2WDQB 2WU2B 3R66C 4IUMB 4B6WA 2IO3B 2GRIA 5HFYA 1FNVA 3VTVA 4JGHB 1XLPA 4HWIB 2KX3A 4EZLA 1CK1A 1JWSD 5BYSA 2D2QA 3N1YC 3VAWA 4RH6A 3Q8FA 1DOIA 2QSDA 4YSYB 3AMZA 3OAWA 2XN9C 2XK5A 4NPNA 1FCCC 3JW0X 2K1FA 3FAHA 2D5GA 2WXMA 1JW9D 2E3TA 3UQBA 2C7HA 1M4VA 4ICUA 3BYYB 1C79A 1WIAA 3V62A 1OQRA 4XWWA 2C7MB 4BOZB 2WS3B 3OJ3A 1XLOA 4ANWA 3RI7C 1TIFA 4LNIA 2G9HD 3R2TA 2YLMA 2GLSA 1D6EC 3UGBB 1WJNA 3WANA 4M00A 1KJTA 1FO4A 1IBXB 3IXSA 4A90A 4IWQA 3NVZA 3ZIMA 1AWDA 3DVGY 2N9PC 1PYWD 1XXGA 3V60A 5IAAC 5G2NA 3IAS1 1QF6A 2HJ8A 3Q8AA 2FBWB 2WDRB 1J19A 2N7JA 3N1XC 4R3DA 1VDVA 2VRRB 3ML9A 2BF8B 4RGOS 3H7PB 1WR6E 3TCAA 4C4VB 2KDMA 3IVFA 3WCQA 2MBBB 4TMAB 2V4LA 4P16A 2DNFA 2CHZA 3MHSD 3QC8B 3U4EG 2WHIA 3AV8A 2CHWA 2CU1A 1V2YA 3MC8A 3DQVA 4Q2JA 1QLBB 1GPXA 1N60A 2C60A 2BS3B 1FMAD 1C76A 3HM3A 4P6VF 2FAZA 2VH1A 1WGGA 1TZOA 3JVZX 4PS8A 3H7SA 1NVID 4ARCA 4OHJA 1WX8A 5TSSA 2L05A 3SDLC 3BINA 1C9FA 3PHXB 3GOEA 4HEA1 3EGRA 5HHDG 2KDFB 3A4SC 2R61A 4W9FA 2KMMA 5I4DA 2JYEA 3E56A 1IUEA 2M4NA 3ECIA 4RF1A 4KKIA 2KQ4X 2NBWB 3KUCB 1EUVB 3L4PA 2K22A 1IGCA 3B0AA 3QIJA 1JWBD 4N9F4 1N63A 2N1VA 2NTTA 1HQRD 3ZLZA 4CYEA 2BWES 3MC9A 3KVFB 1UWXA 2N0SB 1EWCA 2KFKB 2CS4A 2J4XA 3EA6A 2B3AA 3A9KB 2I38A 1YJ1A 4EE2A 4MJSB 3ZNID 4M8NA 2LGIA 3HIZA 1WMHA 2JWUA 4XDDA 3I57A 2MW5A 3UIOB 2L76A 5C23A 3K9OB 5BYRA 3P2BA 2N9KA 5L83A 5H92C 2LEKA 4BVUC 1DGJA 3DVNV 4ZYNA 2BTEA 2JZ3B 2R2OA 4HROA 4REZA 4K7WA 3UQAA 2Y3AA 2KDBA 2LXCA 2GI9A 2G45B 3QAQA 4A6QA 2NS5A 2BYTA 1L6UA 4FADA 4LNNA 2IZVB 3A1QA 2O6VA 4BBNF 4MH8A 3P4PB 2JUOA 1HEZE 2ZNVC 2LVPA 1YQ3B 3E9SA 2PKOA 2KX0A 5J18A 2JT4B 4G50A 2SAKA 2BQQA 1C4CA 2OEDA 4D2KA 1ENFA 3TUOA 4ZRKA 3W1YA 2ZPNA 1ET9A 3N9YC 3AN1A 2LVOA 2N4FA 4DQOC 4PYUA 5DPSA 2MP2B 4WQOB 4NZLB 3EC8A 4XZ4A 5LLIA 4OVUA 2RGFA 1SE9A 1NENB 2KVRA 1Z5SB 3L16A 3DOWA 2L7RA 3W2DA 3SU8X 4NJCA 3QK0A 1Q0WB 2DAJA 3ZXVA 3HRDD 3BVZA 3ZJUA 2MLBA 4MGKE 4HVBA 3HVZA 2BT6A 3R8BA 2PE6B 2G4DB 4L2YA 4EZJA 2FIFA 2QDFA 2UWQA 3QARA 3KUDB 5HKHA 4HK2A 1WF9A 3AB5A 1KM7A 4B95A 4PS7A 2C5LC 3RNBC 3DWGC 4USAA 2JPHA 4AJWA 2BYEA 2IGHA 3MTNB 1NI3A 2KZRA 4LK0M 2WXHA 2W3SA 4IC7B 2W54A 2KAJA 4YSZB 2QHOA 3LJ3A 2V9HA 1P0RA 1Y8RC 3VVWB 3U8ZA 3DVGX 4NY0A 2KO3A 3NJTA 2QEJC 3ZJTA 2O2VA 2WXOA 2B76B 1WZ3A 4TKNA 4W9CA 2RPVA 2TSSA 3URYA 4K7UA 2ZPYA 3C8YA 3WIMA 1GB1A 1J7BA 4DK5A 1RLFA 5TR5A 2ZNVB 1WGYA 2RDBC 4GIVA 1C4AA 4ITKA 1D5ZC 2WU5B 4YWGG 1KH0A 4MM3B 3MP9A 3NVYA 3CIRB 3VDZA 4FJVB 3T9LA 3VUXA 4BFRA 2QJLA 1FD6A 1PQSA 2BYVE 5DPWA 1SEBD 1I4HA 1CMXB 3OG5A 3KW5B 3K9PB 2JWZA 3MC0B 4HCPB 3EUB2 2RSUA 3NVVA 3R7RA 2VZKD 3M95A 1VZ6A 2LD9A 3AM9A 1E8ZA 1PGBA 4FLHA 1WJ4A 4RGMA 1ZOYB 5LXIB 1YJIA 3AE7B 1PFDA 4NJ7A 3H1UA 2IGGA 3ZRFA 3UINB 1EWYC 4HDQA 3W1SC 1YQBA 4E74A 1QZEA 4JQWC 1TTNA 2JSVX 1N61A 5G5HA 1I35A 2DX5B 2MCNB 2KQSA 3A9JB 4LCDE 1RAXA 1HZ5A 5JHBA 3DPDA 4LTUA 3VH4B 2WXGA 1DYQA 4KIKB 1T0QC 1MHHE 4KDIC 3ZDMC 3RNCC 1E7PB 2WP9B 3IT4B 3TEZA 2LGDA 2KNBA 1H8CA 1C78A 2RDHA 3KYCD 4DXFA 2J0JA 3S2AA 1XO3A 1FXAA 2G4SA 3JSVB 4DHJD 2WXJA 2VH2A 3HM6X 2DBYA 1K52A 2BGFA 2LHDA 4CO7A 4JIOU 4WWNA 3NHEB 3GB1A 3BVGA 1P7EA 4AUQC 1QOFA 4RFBA 4KGSA 3NY5A 3BIID 2GOWA 3WA0A 3U7ZA 1FEHA 4C80A 3ZUNA 3PHWB 3P4SB 5JHAA 1GAQB 3PRMB 5JXVA 2PTLA 2J53A 1GUAB 5AZFA 5J17A 2MQJA 3DBSA 2GBRA 2Y5CA 3CF6E 1ACCA 3M3JA 4ASWC 4WJQA 3RYTA 3AEAB 4RMAA 4F7ZA 3PZDA 4WQMA 2IGDA 4I6LB 2AQ1B 4I6PA 2ONQA 1WJ6A 1ZDXA 2L1AA 1TS2A 4IM0A 1XLQA 1G6JA 1RWSA 1E7VA 2L0TA 4IWOA 2WGSA 1EF1A 1JROA 2KWUB 3DCGA 3C19A 4GDKA 2KXJA 1YX5B 3VHTC 2BKRB 1HA5A 1K51A 1QOGA 3CMMB 2KHWB 2D3BA 2FUHB 4YTMB 2RD0A 3MJWA 1OFFA 3RCZA 4II2B 2DAFA 3SFEB 2WDVB 3WAOA 1J7CA 5DPRA 4HCNB 4TSSA 1WXMA 1F9JA 3ONSA 1UUPA 3DVNU 2AQ3B 1N62A 3PRPB 3NVWA 4KZCA 3R3MA 4W9LA 4BAXA 3TEYA 2AL6A 2NBUA 1WJUA 1FRDA 3DBRB 1LXDA 4WAFA 2DZMA 2WXPA 1E90A 1UF0A 2WLBA 2W9NA 1I4QA 1C77A 1HTOA 1ZXIA 2INPE 2PVGC 2NVUI 2I1KA 2KDIA 5GMVA 3ZNHB 2L0FA 4HXDA 2X38A 3RZFA 3V6CB 2EKEC 1SJHD 4IKGA 4C7ZA 4W9HA 1N6ZA 2H88B 4KX6B 2KANA 3DWMA 3APDA 3DBHB 5E6OA 1TS3A 1OEYA 1PUTA 3NRZA 1FPYA 2MA9B 2YEPB 2K8HA 1B1ZA 3Q3OC 1KTKA 2ZVOA 3JYUA 1GJZA 3B2FA 1PDXA 4BZAA 4DHZE 4TV3A 1JRUA 1UBQA 4DXGA 2WXQA 5LNK1 2W55A 3NG0A 2FIDA 4HLEA 2KK8A 3H6NA 1V80A 2N7EA 3C0RB 3ETRA 1ROEA 3N20C 2M19A 2XK5B 3H7PA 3IAM1 2DYMA 2Z8LA 3BVMA 4W9EA 3QX1A 4C4VA 2L32A 3VTWA 4GOCA 4L23A 1D3ZA 4HJGE 3KWVA 3AULA 1P3QU 3HVDA 1UELA 2KDEB 3IFWB 2REXA 1ZPSA 4M0WB 3WALA 3VRBB 1UGMA 4FULA 2LRUA 4KVGB 4TQ1A 1T0RC 1KLUD 1GC6A 4NJ6A 4I6NB 1TS4A 1FIQA 4ARIA 2ASQA 2LRWA 4FN2A 1T6BX 4B9KA 1VZ8A 2GBNA 4YT0B 3AECB 2KVZA 4A9AA 2QILA 1L0XB 2X8XX 4JE3B 2HTME 4K3BA 1L0VB 4W9GA 2WDTB 4B0EA 1T3QA 1VD2A 3DDCB 3W5VB 3AE1B 4ZYSA 4AS1A 3PZ7A 3OWEB 4US8A 3QQ8B 3Q69A 4YSXB 4BKGA 3PRZA 4PT5A 3GZNB 1JWAD 4WAAA 2YEPF 1YX6B 1HXYD 1SF0A 4HKQA 1AW7A 2N1WA 2WX1A 3O65B 1FNWA 2NCNA 3BZDB 3A9KA 1F0ZA 4WJNA 1WGKA 2C9WB 2N9XA 1KLVA 4M01A 2E6XA 1F1HA 5MPOA 1C1YB 2CU3A 4AWJA 3ZJVA 2ZVNA 3U2SC 1SBBB 3ZNZB 3ZO5B 3B08A 2NMQA 1JWUD 1V86A 1WI0A 2EMTA 3UIPB 3NUHB 1JWMD 2LXAA 1WM3A 3P63A 4MGIE 1YMHE 3HHMA 1KLGD 3AE3B 1L4DB 2KJHB 1XCQL 5HI1A 2A5UA 1TY2A 1SXTA 4NQKE 2MBHA 3OLMD 2KMCA 2VZKB 1IPGA 2JRIB 2GBMA 3AI5A 3M63B 1JMLA 2MH7A 2MJEA 4P7IA 3MFGA 1Z2MA 4AJYB 2Y5PA 3T3NA 3WAPA 2IDYA 2OJRA 1M94A 1R4NB 1NDDA 1I7HA 3TL5A 4LJOB 4YTNB 3VTUA 4HKZE 4BOSC 3BWUD 5EE0A 2MP2A 1SIJA 4EFOA 1PGAA 4DWFA 3ABVB 1YN4A 3GS2A 1WMHB 1TBEA 1XD3B 2A4ZA 2OOBB 1WE7A 3DBRI 5BMHA 1Q10A 3VFKA 4RCOA 5CHVC 2JYTA 2FCMA 1RRBA 2WNMA 2BVCA 2XNAC 4RF0A 3EECA 2FNJB 3T8MA 3ZYYX 2WWZA 3BK1A 4DDGD 1SB3C 5D3IB 3B2GA 3A1QB 3I3TB 2M1MA 3EHVA 2PJHA 1VCBA 4GDLB 3OJ4B 4LNKA 2IO2B 2K39A 4DHJB 4GSWA 4N58A 4HRSA 1HE8A 1UBIA 3SEBA 1H4RA 4JWUC 1EU4A 2G1EA 3DBHI 3VR9B 2BW2A 2INDC 1BUIC 2KN4A 3A33B 4RM8A 3SR6A 1SSNA 4F1SA 2IO1B 2YVCA 4FA6A 1NEKB 3CSFA 4F8CB 2K25A 3NS8A 4GXBA 5DPTA 3CWIA 1Q1OA 1TKYA 4JLCA 3IT6B 1WH3A 2ZEQA 2HJ1A 1LGRA 4XYCA 2QCZA 1UNSA 2BYFA 2HTHA 2FE8A 4NAWB 5BYQA 3A4RA 1V6EA 3AEGB 3AEDB 1IYFA 2D3AA 5EE1A 1YD8U 2HD5B 4RM9A 3ZNGC 1J7AA 1WX9A 5E6NA 4MM3A 2DYOA 4OZCA 2M56B 3Q2AC 3VH3B 1ZW7A 1E5WA 3RULA 1YN3A 2WXIA 3NS1A 2EELA 5FR6A 3X0WA 1N5WA 2KJ6A 4KGTA 1V1PB 1ZDVA 1HTQA 1HZ6A 1D4BA 4W9JA 3ZRCA 4BKTA 3KH0A 3PVLA 1ET6A 2PMVA 1SJED 1WRDB 2CHXA 2C7NB 3PGEA 4UDUC 3PSEB 1OTRB 2BB6A 3RZWC 1TY0A 3GE3C 1FXTB 4AP4C 5KHQA 3N1ZC 2ZZPB 4N59A 5D7GA 3B1LX 1WYGA 2O2VB 3V3XA 4MSQB 4H2AA 2DWQA 4XC2A 1S1QB 4LDTB 3FILB 3TEXA 3A9JA 4G11A 1V5OA 1LQBA 1XEEA 1I42A 3AE6B 4W9DA 1TJEA 1I4XA 1VJKA 2MEKA 1E8YA 4S17A 2WXFA 1UWMA 4KIKA 4II3B 2LGYA 3ALBA 3X23A 1ZE3D 3GZNI 3CSTA 2ON8A 4YXDB 2PEAA 2JQRB 4XGAB 1OEYJ 4WURA 3JSVA 1I4PA 2Q5WD 5FR3A 2M8SA 5D6JB 1J0GA 1UH6A 4IG7B 4KKJA 3VUWA 4G0NB 5BMIA 3NOBA 2J7QB 5AUIA 4X57B 4MSMB 1NYQA 4G3XB 1UD7A 2KKCA 2IY0B 2CJOA 2PPHA 1IGDA 1T5XD 1C3TA 2WYQA 3V61A 2NBVB 5AZHA 1J8CA 5E6JA 1VZ7A 2BS2B 1D5XC 2LMCA 5CTRC 1DOXA 3BY4B 1YN5A 1WYWB 1A5RA 3ZW3A 3NZSA 3H8HA 2KJRA 1R4NI 4K1RB 1Y56A 4DBGA 3V05A 2N7DA 3W5UB 3APCA 2BKFA 1F2RC 4US9A 4PS3A 4MH0E 1VLBA 1P7FA 1QKZA 5IOIA 3TSSA 3IHPC 1NBFC 3AE5B 1PGXA 3Q8EA 4EEWA 4EOYA 3AE9B 3P1MA 2NPTB 2MRPA 3L08A 3DBLB 4MT5A 4J3OD 5IO9A 2J0KA 1V81A 2KTRA 4WWPA 3LYYA 2OJWA 5IP4D 1RFKA 1GC7A 4WJPA 3PREA 4DDID 1P1AA 2LJ5A 2LVQA 2ZCBA 4A8XC 2KWCA 4IM3A 4FJZA 5D94A 3I9V1 1QT9A 2INCC 1OQYA 2WXLA 4KV2A 3U52E 1UZXB 3M62B 4GGQA 5C3JB 4MEMA 4A20A 1EF5A 3ML8A 4HPPA 3SFDB 1E0ZA 3WAMA 1ISNA 1R4MB 1GNUA 2K8CA 1TS5A 3V6EB
chains in the Genus database with same CATH topology
2WDTB 2KVRA 4LDTD 1VD2A 4GDKB 3DDCB 4MGZE 2XEWA 1Z5SB 1SGHA 3L16A 3DOWA 2L7RA 2DZKA 2JXXA 4FBJB 2BWFA 4PYZA 1E7UA 3SU8X 3ENEA 4CHKA 4EKUA 1WGDA 3QQ8B 4EZKA 3QK0A 3TIXA 2KC1A 4BKGA 1Q0WB 3PRZA 2DAJA 1E8XA 1TZ1A 1WX7A 2MLBA 2O6VD 4MGKE 4HVBA 4WAAA 4WJOA 1YX6B 2PE6B 3IBEA 2G4DB 4EZJA 2FIFA 4HDOA 2N1WA 2WX1A 3O65B 4KSLC 1X1MA 2NCNA 2LGXA 2K6QA 2FCQA 2UWQA 2JY6A 5AEKB 3NZUA 3QARA 3A9KA 3KUDB 1WM2A 2MBQA 1WFYA 1XQQA 4HK2A 4K81A 5HKHA 1WF9A 4WJNA 1KM7A 2C9WB 4ZRIA 4W9IA 2N9XA 4B95A 2EMSA 4PS7A 2C5LC 1KLVA 2JPHA 4AJWA 2BYEA 2JZZA 3MTNB 4KDLB 5EDSA 1C1YB 4FHJA 3SHQA 4AWJA 2KZRA 2Z59B 2ZVNA 4IM2A 3D32A 4IC7B 2QHOA 2DENB 3ZNZB 3ZO5B 3B08A 3LJ3A 1P0RA 2NPTA 1V86A 3PPAA 1Y8RC 3VVWB 3U8ZA 3DVGX 5BO4B 1S3SG 1WI0A 4FHKA 4NY0A 2KO3A 1RFAA 1WXSA 2EMTA 1WE6A 3UIPB 2LXAA 1WM3A 2HE7A 1V9JA 2AEHA 2KLCA 2O2VA 4MGIE 2DYBA 3HHMA 1WZ3A 2GBKA 3Q3JA 4TKNA 4XX5A 4W9CA 4E3CA 2KJHB 4K7UA 2A5UA 3W1SA 3N3KB 4AOFA 2JF5A 2ZPYA 4OVVA 5J2RA 3WIMA 4ANUA 4NQKE 3QWZB 2MBHA 3OLMD 4HPMB 2KMCA 4DK5A 3RT3B 3RD2A 1IPGA 1RLFA 1V5TA 2JRIB 3QA8A 5TR5A 2KN5A 2ZNVB 1WGYA 4GIVA 5D2MB 2GBMA 3AI5A 3M63B 4P7IA 2AWTA 1KOTA 1Z2MA 4GN1A 4AJYB 3R7QA 3WAPA 2Z0DB 2OJRA 3TJPA 1M94A 1NDDA 4A3OA 3TL5A 2JVCA 3RUIB 2M17A 2KOXA 4LJOB 3VTUA 3PS6A 3VDZA 4FJVB 3T9LA 1U4AA 3VUXA 4BFRA 4BOSC 3QCAA 3ZKJC 3TMPB 1PQSA 2MP2A 2NR2A 2BYVE 1E8WA 5DPWA 2PE9A 4EFOA 4DWFA 4FJYA 1CMXB 2LWPA 2MWSB 2V1YA 1WMHB 2LZ6A 2Y5BB 3K9PB 2JWZA 3KW5B 1TBEA 4HCPB 4A3PA 2KMAA 2RSUA 1XD3B 2A4ZA 2MBOA 3R7RA 2OOBB 3M95A 1WE7A 3DBRI 3U7DA 2MX2A 2LD9A 2M0XA 3VFKA 5CHVC 3PLVA 2LUEA 1E8ZA 2FCMA 3VQIA 5KHOA 3KYDD 4FLHA 1RRBA 4ANVA 5G55A 1WJ4A 5C1ZA 4K7SA 5LXIB 3EECA 3N30A 2FNJB 3T8MA 4NQLB 1ZKHA 2LASA 2WWZA 3VUYA 4KSKC 1YIWA 2J0MA 4NJ7A 3H1UA 4DDGD 3ZRFA 3UINB 2AYOB 4HDQA 4KZ0A 3W1SC 2KTRB 2BPSA 1YQBA 1GG3A 3A1QB 4E74A 3I3TB 2M1MA 3EHVA 2PJHA 1VCBA 4GDLB 4ICVA 1QZEA 4MGYE 3OJ4B 4JQWC 3VXWA 1TTNA 2D07B 2IO2B 2K39A 4DHJB 1LM8B 2DZJA 4W9KA 4GSWA 1I35A 2KQ7A 4BBNC 2DX5B 4BKSA 1HE8A 2MCNB 1UBIA 3L13A 1H4RA 2UYZB 5JH5C 2KQSA 3A9JB 3DBHI 4LCDE 5AZGA 1RAXA 3QHTA 2IO0B 5JHBA 3DPDA 3A33B 4HJKA 2L8JA 4RM8A 3VH4B 4F1SA 1WZ0A 2KFKA 3PT2B 3R66C 2IO1B 4IUMB 2YVCA 4FA6A 4B6WA 2IO3B 4KIKB 4F8CB 3CSFA 3LDZE 2K25A 4MJSA 4KDIC 3NS8A 3ZDMC 4GXBA 5DPTA 3VTVA 1Q1OA 4JGHB 4JLCA 2LGDA 2KNBA 4HWIB 1WH3A 2ZEQA 1WY8A 1H8CA 2KX3A 4EZLA 1T0YA 3KYCD 2J0JA 3S2AA 2IYDB 2G4SA 2D2QA 2DHZA 2GMIC 3JSVB 3VAWA 4DHJD 3AU5A 2BYFA 4MELA 2HTHA 1NI2A 3HM6X 4NAWB 3OAWA 2BGFA 3A4RA 2XK5A 4CO7A 4NPNA 1OGWA 1V6EA 4JIOU 4WWNA 3NHEB 1IYFA 3JW0X 2ZJDA 4AUQC 2K1FA 5IA7A 1YD8U 1XT9B 3L54A 2LI5A 2Z0EB 2HD5B 4RM9A 3ZNGC 3NY5A 1WX9A 5E6NA 2GOWA 4MM3A 2DYOA 3WA0A 3UQBA 2C7HA 4ICUA 3PHWB 2FCSA 3ZUNA 5JHAA 3VH3B 1WIAA 1ZW7A 3V62A 3PRMB 2C7MB 4BKSD 4BOZB 1E5WA 3RULA 3OJ3A 3DBLI 2WX0A 2L00B 4ANWA 1GUAB 5AZFA 5J17A 2MQJA 2N9EB 3DBSA 2GBRA 3CF6E 2YLMA 2RPQA 2RR9A 2KC2A 3M3JA 5FR6A 4ASWC 3UGBB 1WJNA 3WANA 4WJQA 3RYTA 3X0WA 1WGRA 1KJTA 4RMAA 2KJ6A 3PZDA 4F7ZA 3PTFC 4I6LB 4I6PA 4IWQA 3PV1A 4W9JA 1WJ6A 3ZIMA 5CHWA 3DVGY 3ZRCA 4BKTA 3KH0A 2N9PC 3PVLA 5JZEB 4IM0A 1WRDB 2CHXA 2C7NB 5L95C 3PGEA 1G6JA 2L0TA 1E7VA 3PSEB 1OTRB 4IWOA 3RZWC 3V60A 5IAAC 1EF1A 5G2NA 2D10A 3ZTDA 3KUZA 3PLUA 4URKA 2HJ8A 1FXTB 2KWUB 3DCGA 4AP4C 2XBBC 5KHQA 2ZZPB 4LJPB 1Q5WB 5D7GA 3L0WB 4GDKA 3B1LX 2O2VB 2KXJA 1YX5B 4GDLA 3VHTC 1J19A 4MSQB 2BKRB 1P9DU 2KFJA 1R4MI 4XC2A 3IG3A 3Q3FA 1S1QB 3CMMB 2VRRB 3ML9A 2KHWB 4LDTB 2BF8B 2GBJA 2JRHA 2ZCCA 1V49A 2FUHB 3H7PB 2RD0A 3A9JA 3MJWA 1K8RB 1LQBA 1V5OA 1WR6E 4G11A 4GB9A 1I42A 3RCZA 4II2B 2DAFA 1WR1A 3TCAA 3WAOA 4W9DA 5DPRA 4HCNB 1WXMA 3IVFA 1F9JA 2MBBB 3ONSA 2V4LA 3QJZA 3DVNU 1E8YA 2D3GA 2IY1B 2CHZA 2O6VB 3PRPB 4KZCA 3MHSD 4KIKA 3R3MA 3QC8B 2LGYA 3ALBA 4II3B 1TGZB 2AL6A 4W9LA 3X23A 2NBUA 3CSTA 3GZNI 1WJUA 2MBEA 2CHWA 1LXDA 2CU1A 1V2YA 2DZMA 3DQVA 2MSED 2PEAA 1E90A 2CR5A 3AU4A 2IBIB 4TQ0A 2W9NA 2I1JA 1OEYJ 2C60A 3AXCA 1SIFA 3HM3A 3TBLD 2R2QA 2KTFA 2FAZA 3JSVA 1WGGA 4NAWA 2M8SA 5D6JB 3JVZX 4PS8A 2KLGA 3H7SA 2K6DB 2NVUI 2I1KA 2KDIA 1WX8A 5GMVA 1J0GA 2L05A 3SDLC 2L0FA 4HXDA 1UH6A 5CX3A 2CKHB 3BINA 4IG7B 3RZFA 3PHXB 3V6CB 3GOEA 2EKEC 2KWVB 3EFUA 3N32A 2KDFB 3A4SC 2FCNA 3ZDTA 4W9HA 3VUWA 4W9FA 4G0NB 3NOBA 2J7QB 2KANA 4X57B 3APDA 4MSMB 2M4NA 5E6OA 3ECIA 4G3XB 1UD7A 5DCNA 2KKCA 2IY0B 1LFDA 1OEYA 2PPHA 2NBWB 4IWPA 3KUCB 1EUVB 4GU2A 1C3TA 2MA9B 2WYQA 2D11A 3V61A 1MG8A 4ZDVA 2K8HA 2NBVB 3B0AA 3JYUA 2ZVOA 3QIJA 1GJZA 4N9F4 1EO6A 5AZHA 4DHZE 1J8CA 4TV3A 1JRUA 1UBQA 2G3QB 3ZTCA 2N1VA 3L10B 1IP9A 3ZLZA 4CYEA 1WXVA 2BWES 1ZGUB 2K8BA 3KVFB 5CTRC 2KFKB 2CS4A 3BY4B 2B3AA 3A9KB 4IW0A 1WYWB 1YJ1A 2FIDA 1A5RA 4MJSB 3ZW3A 4HLEA 2KK8A 3H6NA 3NZSA 3ZNID 4M8NA 3HIZA 1WMHA 2KJRA 4DXAB 1R4NI 2MW5A 4K1RB 4M8MA 4DBGA 4YL8A 2N7DA 4ZRJA 3UIOB 2L76A 1L2NA 3APCA 5C23A 3K9OB 2BKFA 4PS3A 1V80A 2N7EA 4MH0E 3C0RB 3P2BA 4J6IA 5L83A 4GMVA 4BVUC 3IHPC 5E6PA 4ZYNA 1NBFC 3DVNV 2JZ3B 4DHZB 2R2OA 2XK5B 3UQAA 4K7WA 4EEWA 3L17A 2KD0A 4EOYA 2KDBA 2LXCA 3H7PA 2NPTB 2DYMA 4JL9A 3ZNHB 1WGHA 2G45B 4W9EA 3APFA 2MRPA 3QAQA 3QX1A 2NS5A 3L08A 5CHFA 3VTWA 4GOCA 2J0KA 4FADA 1D3ZA 1V81A 2KTRA 4E71A 2L3ZA 1P98A 2IZVB 3A1QA 3AULA 4MDKE 4TUUA 4WWPA 4EUTA 2O6VA 4BBNF 1P3QU 3HK0A 2AL3A 1L7YA 2KDEB 1UELA 1GC7A 2JUOA 3IFWB 2ZNVC 4WJPA 2REXA 2LVPA 4M0WB 3PREA 3SD5A 1P1AA 3WALA 4DDID 2LJ5A 2LVQA 2ZCBA 2DZIA 3U30A 2KX0A 1BT0A 1UGMA 2KWCA 4FULA 4IM3A 5J18A 4FJZA 5D94A 2JT4B 4HPLB 2LRUA 4G50A 4KVGB 1OQYA 4TQ1A 4KV2A 1GC6A 1UZXB 4NJ6A 4I6NB 3M62B 4GGQA 4ANXA 4ZRKA 2V3SA 4WWOA 3W1YA 2ZPNA 4MEMA 4A20A 2ASQA 2LRWA 4FN2A 4NNJB 1EF5A 4B9KA 3ML8A 3ZVVA 2GBNA 3UF8A 3WAMA 2LVOA 1ISNA 2N4FA 4PYUA 3H9DA 5DPSA 1AARA 2MP2B 1GNUA 4WQOB 3EC8A 2K8CA 5LXHA 4XZ4A 5LLIA 4OVUA 2RGFA 1WXAA 3V6EB 4W9GA 1SE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDT B;  2KVR A;  4LDT D;  1VD2 A;  4GDK B;  3DDC B;  4MGZ E;  2XEW A;  1Z5S B;  1SGH A;  3L16 A;  3DOW A;  2L7R A;  2DZK A;  2JXX A;  4FBJ B;  2BWF A;  4PYZ A;  1E7U A;  3SU8 X;  3ENE A;  4CHK A;  4EKU A;  1WGD A;  3QQ8 B;  4EZK A;  3QK0 A;  3TIX A;  2KC1 A;  4BKG A;  1Q0W B;  3PRZ A;  2DAJ A;  1E8X A;  1TZ1 A;  1WX7 A;  2MLB A;  2O6V D;  4MGK E;  4HVB A;  4WAA A;  4WJO A;  1YX6 B;  2PE6 B;  3IBE A;  2G4D B;  4EZJ A;  2FIF A;  4HDO A;  2N1W A;  2WX1 A;  3O65 B;  4KSL C;  1X1M A;  2NCN A;  2LGX A;  2K6Q A;  2FCQ A;  2UWQ A;  2JY6 A;  5AEK B;  3NZU A;  3QAR A;  3A9K A;  3KUD B;  1WM2 A;  2MBQ A;  1WFY A;  1XQQ A;  4HK2 A;  4K81 A;  5HKH A;  1WF9 A;  4WJN A;  1KM7 A;  2C9W B;  4ZRI A;  4W9I A;  2N9X A;  4B95 A;  2EMS A;  4PS7 A;  2C5L C;  1KLV A;  2JPH A;  4AJW A;  2BYE A;  2JZZ A;  3MTN B;  4KDL B;  5EDS A;  1C1Y B;  4FHJ A;  3SHQ A;  4AWJ A;  2KZR A;  2Z59 B;  2ZVN A;  4IM2 A;  3D32 A;  4IC7 B;  2QHO A;  2DEN B;  3ZNZ B;  3ZO5 B;  3B08 A;  3LJ3 A;  1P0R A;  2NPT A;  1V86 A;  3PPA A;  1Y8R C;  3VVW B;  3U8Z A;  3DVG X;  5BO4 B;  1S3S G;  1WI0 A;  4FHK A;  4NY0 A;  2KO3 A;  1RFA A;  1WXS A;  2EMT A;  1WE6 A;  3UIP B;  2LXA A;  1WM3 A;  2HE7 A;  1V9J A;  2AEH A;  2KLC A;  2O2V A;  4MGI E;  2DYB A;  3HHM A;  1WZ3 A;  2GBK A;  3Q3J A;  4TKN A;  4XX5 A;  4W9C A;  4E3C A;  2KJH B;  4K7U A;  2A5U A;  3W1S A;  3N3K B;  4AOF A;  2JF5 A;  2ZPY A;  4OVV A;  5J2R A;  3WIM A;  4ANU A;  4NQK E;  3QWZ B;  2MBH A;  3OLM D;  4HPM B;  2KMC A;  4DK5 A;  3RT3 B;  3RD2 A;  1IPG A;  1RLF A;  1V5T A;  2JRI B;  3QA8 A;  5TR5 A;  2KN5 A;  2ZNV B;  1WGY A;  4GIV A;  5D2M B;  2GBM A;  3AI5 A;  3M63 B;  4P7I A;  2AWT A;  1KOT A;  1Z2M A;  4GN1 A;  4AJY B;  3R7Q A;  3WAP A;  2Z0D B;  2OJR A;  3TJP A;  1M94 A;  1NDD A;  4A3O A;  3TL5 A;  2JVC A;  3RUI B;  2M17 A;  2KOX A;  4LJO B;  3VTU A;  3PS6 A;  3VDZ A;  4FJV B;  3T9L A;  1U4A A;  3VUX A;  4BFR A;  4BOS C;  3QCA A;  3ZKJ C;  3TMP B;  1PQS A;  2MP2 A;  2NR2 A;  2BYV E;  1E8W A;  5DPW A;  2PE9 A;  4EFO A;  4DWF A;  4FJY A;  1CMX B;  2LWP A;  2MWS B;  2V1Y A;  1WMH B;  2LZ6 A;  2Y5B B;  3K9P B;  2JWZ A;  3KW5 B;  1TBE A;  4HCP B;  4A3P A;  2KMA A;  2RSU A;  1XD3 B;  2A4Z A;  2MBO A;  3R7R A;  2OOB B;  3M95 A;  1WE7 A;  3DBR I;  3U7D A;  2MX2 A;  2LD9 A;  2M0X A;  3VFK A;  5CHV C;  3PLV A;  2LUE A;  1E8Z A;  2FCM A;  3VQI A;  5KHO A;  3KYD D;  4FLH A;  1RRB A;  4ANV A;  5G55 A;  1WJ4 A;  5C1Z A;  4K7S A;  5LXI B;  3EEC A;  3N30 A;  2FNJ B;  3T8M A;  4NQL B;  1ZKH A;  2LAS A;  2WWZ A;  3VUY A;  4KSK C;  1YIW A;  2J0M A;  4NJ7 A;  3H1U A;  4DDG D;  3ZRF A;  3UIN B;  2AYO B;  4HDQ A;  4KZ0 A;  3W1S C;  2KTR B;  2BPS A;  1YQB A;  1GG3 A;  3A1Q B;  4E74 A;  3I3T B;  2M1M A;  3EHV A;  2PJH A;  1VCB A;  4GDL B;  4ICV A;  1QZE A;  4MGY E;  3OJ4 B;  4JQW C;  3VXW A;  1TTN A;  2D07 B;  2IO2 B;  2K39 A;  4DHJ B;  1LM8 B;  2DZJ A;  4W9K A;  4GSW A;  1I35 A;  2KQ7 A;  4BBN C;  2DX5 B;  4BKS A;  1HE8 A;  2MCN B;  1UBI A;  3L13 A;  1H4R A;  2UYZ B;  5JH5 C;  2KQS A;  3A9J B;  3DBH I;  4LCD E;  5AZG A;  1RAX A;  3QHT A;  2IO0 B;  5JHB A;  3DPD A;  3A33 B;  4HJK A;  2L8J A;  4RM8 A;  3VH4 B;  4F1S A;  1WZ0 A;  2KFK A;  3PT2 B;  3R66 C;  2IO1 B;  4IUM B;  2YVC A;  4FA6 A;  4B6W A;  2IO3 B;  4KIK B;  4F8C B;  3CSF A;  3LDZ E;  2K25 A;  4MJS A;  4KDI C;  3NS8 A;  3ZDM C;  4GXB A;  5DPT A;  3VTV A;  1Q1O A;  4JGH B;  4JLC A;  2LGD A;  2KNB A;  4HWI B;  1WH3 A;  2ZEQ A;  1WY8 A;  1H8C A;  2KX3 A;  4EZL A;  1T0Y A;  3KYC D;  2J0J A;  3S2A A;  2IYD B;  2G4S A;  2D2Q A;  2DHZ A;  2GMI C;  3JSV B;  3VAW A;  4DHJ D;  3AU5 A;  2BYF A;  4MEL A;  2HTH A;  1NI2 A;  3HM6 X;  4NAW B;  3OAW A;  2BGF A;  3A4R A;  2XK5 A;  4CO7 A;  4NPN A;  1OGW A;  1V6E A;  4JIO U;  4WWN A;  3NHE B;  1IYF A;  3JW0 X;  2ZJD A;  4AUQ C;  2K1F A;  5IA7 A;  1YD8 U;  1XT9 B;  3L54 A;  2LI5 A;  2Z0E B;  2HD5 B;  4RM9 A;  3ZNG C;  3NY5 A;  1WX9 A;  5E6N A;  2GOW A;  4MM3 A;  2DYO A;  3WA0 A;  3UQB A;  2C7H A;  4ICU A;  3PHW B;  2FCS A;  3ZUN A;  5JHA A;  3VH3 B;  1WIA A;  1ZW7 A;  3V62 A;  3PRM B;  2C7M B;  4BKS D;  4BOZ B;  1E5W A;  3RUL A;  3OJ3 A;  3DBL I;  2WX0 A;  2L00 B;  4ANW A;  1GUA B;  5AZF A;  5J17 A;  2MQJ A;  2N9E B;  3DBS A;  2GBR A;  3CF6 E;  2YLM A;  2RPQ A;  2RR9 A;  2KC2 A;  3M3J A;  5FR6 A;  4ASW C;  3UGB B;  1WJN A;  3WAN A;  4WJQ A;  3RYT A;  3X0W A;  1WGR A;  1KJT A;  4RMA A;  2KJ6 A;  3PZD A;  4F7Z A;  3PTF C;  4I6L B;  4I6P A;  4IWQ A;  3PV1 A;  4W9J A;  1WJ6 A;  3ZIM A;  5CHW A;  3DVG Y;  3ZRC A;  4BKT A;  3KH0 A;  2N9P C;  3PVL A;  5JZE B;  4IM0 A;  1WRD B;  2CHX A;  2C7N B;  5L95 C;  3PGE A;  1G6J A;  2L0T A;  1E7V A;  3PSE B;  1OTR B;  4IWO A;  3RZW C;  3V60 A;  5IAA C;  1EF1 A;  5G2N A;  2D10 A;  3ZTD A;  3KUZ A;  3PLU A;  4URK A;  2HJ8 A;  1FXT B;  2KWU B;  3DCG A;  4AP4 C;  2XBB C;  5KHQ A;  2ZZP B;  4LJP B;  1Q5W B;  5D7G A;  3L0W B;  4GDK A;  3B1L X;  2O2V B;  2KXJ A;  1YX5 B;  4GDL A;  3VHT C;  1J19 A;  4MSQ B;  2BKR B;  1P9D U;  2KFJ A;  1R4M I;  4XC2 A;  3IG3 A;  3Q3F A;  1S1Q B;  3CMM B;  2VRR B;  3ML9 A;  2KHW B;  4LDT B;  2BF8 B;  2GBJ A;  2JRH A;  2ZCC A;  1V49 A;  2FUH B;  3H7P B;  2RD0 A;  3A9J A;  3MJW A;  1K8R B;  1LQB A;  1V5O A;  1WR6 E;  4G11 A;  4GB9 A;  1I42 A;  3RCZ A;  4II2 B;  2DAF A;  1WR1 A;  3TCA A;  3WAO A;  4W9D A;  5DPR A;  4HCN B;  1WXM A;  3IVF A;  1F9J A;  2MBB B;  3ONS A;  2V4L A;  3QJZ A;  3DVN U;  1E8Y A;  2D3G A;  2IY1 B;  2CHZ A;  2O6V B;  3PRP B;  4KZC A;  3MHS D;  4KIK A;  3R3M A;  3QC8 B;  2LGY A;  3ALB A;  4II3 B;  1TGZ B;  2AL6 A;  4W9L A;  3X23 A;  2NBU A;  3CST A;  3GZN I;  1WJU A;  2MBE A;  2CHW A;  1LXD A;  2CU1 A;  1V2Y A;  2DZM A;  3DQV A;  2MSE D;  2PEA A;  1E90 A;  2CR5 A;  3AU4 A;  2IBI B;  4TQ0 A;  2W9N A;  2I1J A;  1OEY J;  2C60 A;  3AXC A;  1SIF A;  3HM3 A;  3TBL D;  2R2Q A;  2KTF A;  2FAZ A;  3JSV A;  1WGG A;  4NAW A;  2M8S A;  5D6J B;  3JVZ X;  4PS8 A;  2KLG A;  3H7S A;  2K6D B;  2NVU I;  2I1K A;  2KDI A;  1WX8 A;  5GMV A;  1J0G A;  2L05 A;  3SDL C;  2L0F A;  4HXD A;  1UH6 A;  5CX3 A;  2CKH B;  3BIN A;  4IG7 B;  3RZF A;  3PHX B;  3V6C B;  3GOE A;  2EKE C;  2KWV B;  3EFU A;  3N32 A;  2KDF B;  3A4S C;  2FCN A;  3ZDT A;  4W9H A;  3VUW A;  4W9F A;  4G0N B;  3NOB A;  2J7Q B;  2KAN A;  4X57 B;  3APD A;  4MSM B;  2M4N A;  5E6O A;  3ECI A;  4G3X B;  1UD7 A;  5DCN A;  2KKC A;  2IY0 B;  1LFD A;  1OEY A;  2PPH A;  2NBW B;  4IWP A;  3KUC B;  1EUV B;  4GU2 A;  1C3T A;  2MA9 B;  2WYQ A;  2D11 A;  3V61 A;  1MG8 A;  4ZDV A;  2K8H A;  2NBV B;  3B0A A;  3JYU A;  2ZVO A;  3QIJ A;  1GJZ A;  4N9F 4;  1EO6 A;  5AZH A;  4DHZ E;  1J8C A;  4TV3 A;  1JRU A;  1UBQ A;  2G3Q B;  3ZTC A;  2N1V A;  3L10 B;  1IP9 A;  3ZLZ A;  4CYE A;  1WXV A;  2BWE S;  1ZGU B;  2K8B A;  3KVF B;  5CTR C;  2KFK B;  2CS4 A;  3BY4 B;  2B3A A;  3A9K B;  4IW0 A;  1WYW B;  1YJ1 A;  2FID A;  1A5R A;  4MJS B;  3ZW3 A;  4HLE A;  2KK8 A;  3H6N A;  3NZS A;  3ZNI D;  4M8N A;  3HIZ A;  1WMH A;  2KJR A;  4DXA B;  1R4N I;  2MW5 A;  4K1R B;  4M8M A;  4DBG A;  4YL8 A;  2N7D A;  4ZRJ A;  3UIO B;  2L76 A;  1L2N A;  3APC A;  5C23 A;  3K9O B;  2BKF A;  4PS3 A;  1V80 A;  2N7E A;  4MH0 E;  3C0R B;  3P2B A;  4J6I A;  5L83 A;  4GMV A;  4BVU C;  3IHP C;  5E6P A;  4ZYN A;  1NBF C;  3DVN V;  2JZ3 B;  4DHZ B;  2R2O A;  2XK5 B;  3UQA A;  4K7W A;  4EEW A;  3L17 A;  2KD0 A;  4EOY A;  2KDB A;  2LXC A;  3H7P A;  2NPT B;  2DYM A;  4JL9 A;  3ZNH B;  1WGH A;  2G45 B;  4W9E A;  3APF A;  2MRP A;  3QAQ A;  3QX1 A;  2NS5 A;  3L08 A;  5CHF A;  3VTW A;  4GOC A;  2J0K A;  4FAD A;  1D3Z A;  1V81 A;  2KTR A;  4E71 A;  2L3Z A;  1P98 A;  2IZV B;  3A1Q A;  3AUL A;  4MDK E;  4TUU A;  4WWP A;  4EUT A;  2O6V A;  4BBN F;  1P3Q U;  3HK0 A;  2AL3 A;  1L7Y A;  2KDE B;  1UEL A;  1GC7 A;  2JUO A;  3IFW B;  2ZNV C;  4WJP A;  2REX A;  2LVP A;  4M0W B;  3PRE A;  3SD5 A;  1P1A A;  3WAL A;  4DDI D;  2LJ5 A;  2LVQ A;  2ZCB A;  2DZI A;  3U30 A;  2KX0 A;  1BT0 A;  1UGM A;  2KWC A;  4FUL A;  4IM3 A;  5J18 A;  4FJZ A;  5D94 A;  2JT4 B;  4HPL B;  2LRU A;  4G50 A;  4KVG B;  1OQY A;  4TQ1 A;  4KV2 A;  1GC6 A;  1UZX B;  4NJ6 A;  4I6N B;  3M62 B;  4GGQ A;  4ANX A;  4ZRK A;  2V3S A;  4WWO A;  3W1Y A;  2ZPN A;  4MEM A;  4A20 A;  2ASQ A;  2LRW A;  4FN2 A;  4NNJ B;  1EF5 A;  4B9K A;  3ML8 A;  3ZVV A;  2GBN A;  3UF8 A;  3WAM A;  2LVO A;  1ISN A;  2N4F A;  4PYU A;  3H9D A;  5DPS A;  1AAR A;  2MP2 B;  1GNU A;  4WQO B;  3EC8 A;  2K8C A;  5LXH A;  4XZ4 A;  5LLI A;  4OVU A;  2RGF A;  1WXA A;  3V6E B;  4W9G A;  1SE9 A; 
#chains in the Genus database with same CATH topology
 4LDT D;  1LO5 D;  4GDK B;  4MGZ E;  3BK2 A;  2DZK A;  2JXX A;  2BWF A;  4PYZ A;  3P4R B;  3ENE A;  4CHK A;  4EKU A;  1TKE A;  4EZK A;  3TIX A;  1K53 A;  3LB8 C;  3Q14 C;  1VRA B;  1E8X A;  1TZ1 A;  4N6E B;  3MJ5 A;  4WJO A;  1CJE A;  4HDO A;  1X1M A;  2JY6 A;  1FNU A;  1WM2 A;  1WSP A;  1WFY A;  1XQQ A;  2MBQ A;  4K81 A;  2W3R A;  4ZRI A;  4W9I A;  5IKC M;  1ZUD 2;  3B9J A;  1IBX A;  3DHH C;  3FKY A;  5EDS A;  4FHJ A;  4RGN A;  2Z59 B;  4IM2 A;  3DHG C;  3D32 A;  2HDE A;  2DEN B;  1A70 A;  3PPA A;  5BO4 B;  3Q8B A;  4FHK A;  1WXS A;  2KWD A;  2V4I B;  1WE6 A;  4JX1 C;  5EE3 A;  2DYB A;  3Q3J A;  3J9C A;  2MJD A;  4AOF A;  2JF5 A;  4M0W A;  5J2R A;  4ANU A;  1K50 A;  4HPM B;  3QA8 A;  2PLP A;  2KN5 A;  5D2M B;  1DOY A;  2WXR A;  1KOT A;  5BMG A;  2K9X A;  4GN1 A;  4WIP A;  2J52 A;  3TJP A;  1BXT A;  1YJJ A;  4A3O A;  3RUI B;  2M17 A;  2KOX A;  4ACF A;  2JZP A;  1U4A A;  3QCA A;  3TMP B;  2LUM A;  1E8W A;  4FJY A;  2LWP A;  2MWS B;  2V1Y A;  1FCL A;  4A3P A;  2MBO A;  2PVO D;  2MX2 A;  3ZQ4 A;  1MHX A;  2M0A A;  3PLV A;  1E6E B;  4PK1 A;  3KYD D;  5GXG B;  1V97 A;  5G55 A;  4K7S A;  3N30 A;  4NQL B;  1ZKH A;  2V3N A;  1XCT L;  5IN7 A;  4AQ7 A;  1MPE A;  1L6V A;  3R2I A;  4KZ0 A;  5G5G A;  2BPS A;  1RM6 C;  1GG3 A;  2RDG A;  1JQ4 A;  4MGY E;  2I2Y A;  1LM8 B;  4W9K A;  3TEW A;  3I63 C;  2LJI A;  1QOA A;  5JH5 C;  2UYZ B;  1JCK B;  1JAL A;  5AZG A;  3QHT A;  2GB1 A;  2IO0 B;  4WH4 A;  4NAM A;  3Q8C A;  1WZ0 A;  2KFK A;  3PT2 B;  3PZ8 A;  3LDZ E;  2AQ2 B;  4MJS A;  4O1N A;  1L4Z B;  1T0S C;  3ZGZ A;  3DHI C;  1WY8 A;  1T0Y A;  2IYD B;  2DHZ A;  2GMI C;  3AU5 A;  4MEL A;  1FM0 D;  1NI2 A;  4P1C C;  1OGW A;  2UU7 A;  1CQV A;  1JRP A;  2ZJD A;  5FK9 C;  5IA7 A;  1C4P A;  2JXT A;  1XT9 B;  3L54 A;  2LI5 A;  1L0Y B;  2Z0E B;  4JPS A;  1MFW A;  4OVZ A;  2FCS A;  4BKS D;  1I4G A;  2BB5 A;  3DBL I;  2WX0 A;  2L00 B;  4S0R A;  5HG2 A;  2N9E B;  1QIL A;  3LXF A;  2RPQ A;  2RR9 A;  2KC2 A;  2CJN A;  1AN8 A;  1WGR A;  1WXQ A;  3PTF C;  3PV1 A;  1YOV B;  2QMT A;  5CHW A;  5FKA C;  4A55 A;  4XDC A;  5JZE B;  5T8I A;  2ZW1 A;  5L95 C;  2W82 A;  3RN9 C;  2OHF A;  2D10 A;  3ZTD A;  3KUZ A;  3PLU A;  4URK A;  1WRI A;  3NZ3 A;  1VR9 A;  2XBB C;  4OZB A;  4LJP B;  1Q5W B;  3L0W B;  1MVK A;  5C2T B;  4GDL A;  4RGT A;  4XE0 A;  4L1B A;  1P9D U;  2KFJ A;  1R4M I;  1GB4 A;  3IG3 A;  3Q3F A;  2KAC A;  1WWT A;  2GBJ A;  2JRH A;  2ZCC A;  1V49 A;  3GP7 A;  3RMK C;  4GB9 A;  1K8R B;  4CQN A;  4ZOH C;  1MJD A;  1WR1 A;  2AX5 A;  3AEB B;  1CZP A;  2L52 A;  3QJZ A;  1D5M C;  4LLG M;  4FXC A;  2D3G A;  2IY1 B;  2N9L A;  2O6V B;  2KT7 A;  1TGZ B;  1QOB A;  2MBE A;  1E9M A;  3BYT B;  2MSE D;  3AU4 A;  2CR5 A;  2IBI B;  4TQ0 A;  2I1J A;  3AXC A;  1SIF A;  3TBL D;  2R2Q A;  2KTF A;  4NAW A;  2KLG A;  3AE8 B;  4OW0 A;  2K6D B;  3Q3M C;  1YNT E;  1FFV A;  5CX3 A;  3KQ4 A;  2CKH B;  2KWV B;  3EFU A;  3N32 A;  2FCN A;  3ZDT A;  3O13 A;  1F2R I;  4ZHP A;  2ACZ B;  3AE2 B;  4P1B C;  1ZXH A;  5DCN A;  3HUI A;  1LFD A;  4KGR A;  2QIE B;  4IWP A;  3AEF B;  5EE9 A;  4GU2 A;  2D11 A;  1MG8 A;  4ZDV A;  1EO6 A;  2DLB A;  2G3Q B;  3ZTC A;  1V1P A;  3L10 B;  1IP9 A;  1QQR A;  1WXV A;  1ZGU B;  2K8B A;  3EFC A;  4IW0 A;  2SEB D;  1RYJ A;  2ICI A;  2WQY B;  5H8Y E;  4DXA B;  1UGJ A;  2H89 B;  4M8M A;  4YL8 A;  4ZRJ A;  1L2N A;  4LNO A;  1MI0 A;  1SE4 A;  4J6I A;  3P42 A;  4GMV A;  3I5J C;  5E6P A;  4DHZ B;  1TT5 B;  5D3D A;  2IJ0 A;  3L17 A;  2KD0 A;  3FIL A;  3Q6B A;  3RPF C;  4JL9 A;  2FUG 1;  1WGH A;  3APF A;  2KYW A;  1EU3 A;  5CHF A;  4E71 A;  1TYG B;  2L3Z A;  1P98 A;  4MDK E;  4TUU A;  4EUT A;  3KLS X;  3HK0 A;  2AL3 A;  1L7Y A;  2EKI A;  1I4R A;  3SD5 A;  2DZI A;  1BML C;  3U30 A;  1BT0 A;  2IPK D;  4HPL B;  1AYF A;  1B9R A;  4GLS C;  1V1O A;  4OZA A;  4ANX A;  2V3S A;  1SE3 A;  4WWO A;  4NNJ B;  4JWS C;  4WWM A;  1OQQ A;  3ZVV A;  4M02 A;  3UF8 A;  1TKG A;  2MHJ A;  3H9D A;  1AAR A;  1XF5 L;  4B0M A;  2J42 A;  5LXH A;  1WXA A;  4LNF A;  4ZRP A;  2XEW A;  1SGH A;  2PW9 A;  4K3C A;  1EM7 A;  4FBJ B;  1E7U A;  1WGD A;  3ZXR A;  2KC1 A;  3VR8 B;  1FRR A;  3GE8 C;  1GOZ A;  1KFY B;  3PO0 A;  2L83 A;  1WX7 A;  2O6V D;  1F52 A;  3IBE A;  4KSL C;  1R7S A;  2LGX A;  2K6Q A;  2FCQ A;  5AEK B;  3NZU A;  3KWL A;  3RFZ B;  2EMS A;  2BBC A;  2K3U A;  2JZZ A;  4KDL B;  5AUK A;  3SHQ A;  1FFU A;  1ESF A;  2WXN A;  1E10 A;  2NPT A;  1L5P A;  2RMM A;  1S3S G;  1RFA A;  2JU6 X;  2HE7 A;  1V9J A;  2AEH A;  3AH7 A;  2KLC A;  3AE4 B;  4IDI A;  2GBK A;  4XX5 A;  1SE2 A;  2ZW0 A;  3RNF C;  4E3C A;  4XWT A;  3FC4 A;  4IOI E;  1MG4 A;  3W1S A;  3N3K B;  4OVV A;  1NYR A;  3QWZ B;  1KRH A;  3RD2 A;  3RT3 B;  1V5T A;  2JX5 A;  2K0P A;  2AWT A;  4ZHO A;  3RNA C;  3R7Q A;  2NTS A;  1F77 A;  3RNE C;  2MJ3 A;  2Z0D B;  3T3O A;  3W9C B;  1FXI A;  2QC8 A;  3UI3 A;  1V8C A;  2JVC A;  3PS6 A;  2D3C A;  3ZKJ C;  2NR2 A;  4C7Y A;  2PE9 A;  2Y5B B;  2LZ6 A;  1KF6 B;  2KMA A;  2K5P A;  3U7D A;  3Q3N C;  2M0X A;  2WXK A;  3VRA B;  2LGS A;  4MAC A;  2LUE A;  3VQI A;  5KHO A;  4ANV A;  2BS4 B;  5C1Z A;  2LAS A;  2V3P A;  3VUY A;  1STE A;  1YIW A;  4KSK C;  2J0M A;  4C56 C;  3P4Q B;  2V0G A;  2LFI A;  2AYO B;  1YQ4 B;  2KTR B;  3AEE B;  4RNA A;  4ICV A;  4QAY A;  1XLN A;  3VXW A;  2D07 B;  2DZJ A;  4YTP B;  2KQ7 A;  1N5X A;  2INN E;  4BBN C;  4ZRQ A;  4BKS A;  3L13 A;  3RNG C;  2LHE A;  4C00 A;  2PIA A;  3MHZ A;  1ZP0 B;  4HJK A;  2L8J A;  2WDQ B;  2WU2 B;  3R66 C;  4IUM B;  4B6W A;  2IO3 B;  2GRI A;  5HFY A;  1FNV A;  3VTV A;  4JGH B;  1XLP A;  4HWI B;  2KX3 A;  4EZL A;  1CK1 A;  1JWS D;  5BYS A;  2D2Q A;  3N1Y C;  3VAW A;  4RH6 A;  3Q8F A;  1DOI A;  2QSD A;  4YSY B;  3AMZ A;  3OAW A;  2XN9 C;  2XK5 A;  4NPN A;  1FCC C;  3JW0 X;  2K1F A;  3FAH A;  2D5G A;  2WXM A;  1JW9 D;  2E3T A;  3UQB A;  2C7H A;  1M4V A;  4ICU A;  3BYY B;  1C79 A;  1WIA A;  3V62 A;  1OQR A;  4XWW A;  2C7M B;  4BOZ B;  2WS3 B;  3OJ3 A;  1XLO A;  4ANW A;  3RI7 C;  1TIF A;  4LNI A;  2G9H D;  3R2T A;  2YLM A;  2GLS A;  1D6E C;  3UGB B;  1WJN A;  3WAN A;  4M00 A;  1KJT A;  1FO4 A;  1IBX B;  3IXS A;  4A90 A;  4IWQ A;  3NVZ A;  3ZIM A;  1AWD A;  3DVG Y;  2N9P C;  1PYW D;  1XXG A;  3V60 A;  5IAA C;  5G2N A;  3IAS 1;  1QF6 A;  2HJ8 A;  3Q8A A;  2FBW B;  2WDR B;  1J19 A;  2N7J A;  3N1X C;  4R3D A;  1VDV A;  2VRR B;  3ML9 A;  2BF8 B;  4RGO S;  3H7P B;  1WR6 E;  3TCA A;  4C4V B;  2KDM A;  3IVF A;  3WCQ A;  2MBB B;  4TMA B;  2V4L A;  4P16 A;  2DNF A;  2CHZ A;  3MHS D;  3QC8 B;  3U4E G;  2WHI A;  3AV8 A;  2CHW A;  2CU1 A;  1V2Y A;  3MC8 A;  3DQV A;  4Q2J A;  1QLB B;  1GPX A;  1N60 A;  2C60 A;  2BS3 B;  1FMA D;  1C76 A;  3HM3 A;  4P6V F;  2FAZ A;  2VH1 A;  1WGG A;  1TZO A;  3JVZ X;  4PS8 A;  3H7S A;  1NVI D;  4ARC A;  4OHJ A;  1WX8 A;  5TSS A;  2L05 A;  3SDL C;  3BIN A;  1C9F A;  3PHX B;  3GOE A;  4HEA 1;  3EGR A;  5HHD G;  2KDF B;  3A4S C;  2R61 A;  4W9F A;  2KMM A;  5I4D A;  2JYE A;  3E56 A;  1IUE A;  2M4N A;  3ECI A;  4RF1 A;  4KKI A;  2KQ4 X;  2NBW B;  3KUC B;  1EUV B;  3L4P A;  2K22 A;  1IGC A;  3B0A A;  3QIJ A;  1JWB D;  4N9F 4;  1N63 A;  2N1V A;  2NTT A;  1HQR D;  3ZLZ A;  4CYE A;  2BWE S;  3MC9 A;  3KVF B;  1UWX A;  2N0S B;  1EWC A;  2KFK B;  2CS4 A;  2J4X A;  3EA6 A;  2B3A A;  3A9K B;  2I38 A;  1YJ1 A;  4EE2 A;  4MJS B;  3ZNI D;  4M8N A;  2LGI A;  3HIZ A;  1WMH A;  2JWU A;  4XDD A;  3I57 A;  2MW5 A;  3UIO B;  2L76 A;  5C23 A;  3K9O B;  5BYR A;  3P2B A;  2N9K A;  5L83 A;  5H92 C;  2LEK A;  4BVU C;  1DGJ A;  3DVN V;  4ZYN A;  2BTE A;  2JZ3 B;  2R2O A;  4HRO A;  4REZ A;  4K7W A;  3UQA A;  2Y3A A;  2KDB A;  2LXC A;  2GI9 A;  2G45 B;  3QAQ A;  4A6Q A;  2NS5 A;  2BYT A;  1L6U A;  4FAD A;  4LNN A;  2IZV B;  3A1Q A;  2O6V A;  4BBN F;  4MH8 A;  3P4P B;  2JUO A;  1HEZ E;  2ZNV C;  2LVP A;  1YQ3 B;  3E9S A;  2PKO A;  2KX0 A;  5J18 A;  2JT4 B;  4G50 A;  2SAK A;  2BQQ A;  1C4C A;  2OED A;  4D2K A;  1ENF A;  3TUO A;  4ZRK A;  3W1Y A;  2ZPN A;  1ET9 A;  3N9Y C;  3AN1 A;  2LVO A;  2N4F A;  4DQO C;  4PYU A;  5DPS A;  2MP2 B;  4WQO B;  4NZL B;  3EC8 A;  4XZ4 A;  5LLI A;  4OVU A;  2RGF A;  1SE9 A;  1NEN B;  2KVR A;  1Z5S B;  3L16 A;  3DOW A;  2L7R A;  3W2D A;  3SU8 X;  4NJC A;  3QK0 A;  1Q0W B;  2DAJ A;  3ZXV A;  3HRD D;  3BVZ A;  3ZJU A;  2MLB A;  4MGK E;  4HVB A;  3HVZ A;  2BT6 A;  3R8B A;  2PE6 B;  2G4D B;  4L2Y A;  4EZJ A;  2FIF A;  2QDF A;  2UWQ A;  3QAR A;  3KUD B;  5HKH A;  4HK2 A;  1WF9 A;  3AB5 A;  1KM7 A;  4B95 A;  4PS7 A;  2C5L C;  3RNB C;  3DWG C;  4USA A;  2JPH A;  4AJW A;  2BYE A;  2IGH A;  3MTN B;  1NI3 A;  2KZR A;  4LK0 M;  2WXH A;  2W3S A;  4IC7 B;  2W54 A;  2KAJ A;  4YSZ B;  2QHO A;  3LJ3 A;  2V9H A;  1P0R A;  1Y8R C;  3VVW B;  3U8Z A;  3DVG X;  4NY0 A;  2KO3 A;  3NJT A;  2QEJ C;  3ZJT A;  2O2V A;  2WXO A;  2B76 B;  1WZ3 A;  4TKN A;  4W9C A;  2RPV A;  2TSS A;  3URY A;  4K7U A;  2ZPY A;  3C8Y A;  3WIM A;  1GB1 A;  1J7B A;  4DK5 A;  1RLF A;  5TR5 A;  2ZNV B;  1WGY A;  2RDB C;  4GIV A;  1C4A A;  4ITK A;  1D5Z C;  2WU5 B;  4YWG G;  1KH0 A;  4MM3 B;  3MP9 A;  3NVY A;  3CIR B;  3VDZ A;  4FJV B;  3T9L A;  3VUX A;  4BFR A;  2QJL A;  1FD6 A;  1PQS A;  2BYV E;  5DPW A;  1SEB D;  1I4H A;  1CMX B;  3OG5 A;  3KW5 B;  3K9P B;  2JWZ A;  3MC0 B;  4HCP B;  3EUB 2;  2RSU A;  3NVV A;  3R7R A;  2VZK D;  3M95 A;  1VZ6 A;  2LD9 A;  3AM9 A;  1E8Z A;  1PGB A;  4FLH A;  1WJ4 A;  4RGM A;  1ZOY B;  5LXI B;  1YJI A;  3AE7 B;  1PFD A;  4NJ7 A;  3H1U A;  2IGG A;  3ZRF A;  3UIN B;  1EWY C;  4HDQ A;  3W1S C;  1YQB A;  4E74 A;  1QZE A;  4JQW C;  1TTN A;  2JSV X;  1N61 A;  5G5H A;  1I35 A;  2DX5 B;  2MCN B;  2KQS A;  3A9J B;  4LCD E;  1RAX A;  1HZ5 A;  5JHB A;  3DPD A;  4LTU A;  3VH4 B;  2WXG A;  1DYQ A;  4KIK B;  1T0Q C;  1MHH E;  4KDI C;  3ZDM C;  3RNC C;  1E7P B;  2WP9 B;  3IT4 B;  3TEZ A;  2LGD A;  2KNB A;  1H8C A;  1C78 A;  2RDH A;  3KYC D;  4DXF A;  2J0J A;  3S2A A;  1XO3 A;  1FXA A;  2G4S A;  3JSV B;  4DHJ D;  2WXJ A;  2VH2 A;  3HM6 X;  2DBY A;  1K52 A;  2BGF A;  2LHD A;  4CO7 A;  4JIO U;  4WWN A;  3NHE B;  3GB1 A;  3BVG A;  1P7E A;  4AUQ C;  1QOF A;  4RFB A;  4KGS A;  3NY5 A;  3BII D;  2GOW A;  3WA0 A;  3U7Z A;  1FEH A;  4C80 A;  3ZUN A;  3PHW B;  3P4S B;  5JHA A;  1GAQ B;  3PRM B;  5JXV A;  2PTL A;  2J53 A;  1GUA B;  5AZF A;  5J17 A;  2MQJ A;  3DBS A;  2GBR A;  2Y5C A;  3CF6 E;  1ACC A;  3M3J A;  4ASW C;  4WJQ A;  3RYT A;  3AEA B;  4RMA A;  4F7Z A;  3PZD A;  4WQM A;  2IGD A;  4I6L B;  2AQ1 B;  4I6P A;  2ONQ A;  1WJ6 A;  1ZDX A;  2L1A A;  1TS2 A;  4IM0 A;  1XLQ A;  1G6J A;  1RWS A;  1E7V A;  2L0T A;  4IWO A;  2WGS A;  1EF1 A;  1JRO A;  2KWU B;  3DCG A;  3C19 A;  4GDK A;  2KXJ A;  1YX5 B;  3VHT C;  2BKR B;  1HA5 A;  1K51 A;  1QOG A;  3CMM B;  2KHW B;  2D3B A;  2FUH B;  4YTM B;  2RD0 A;  3MJW A;  1OFF A;  3RCZ A;  4II2 B;  2DAF A;  3SFE B;  2WDV B;  3WAO A;  1J7C A;  5DPR A;  4HCN B;  4TSS A;  1WXM A;  1F9J A;  3ONS A;  1UUP A;  3DVN U;  2AQ3 B;  1N62 A;  3PRP B;  3NVW A;  4KZC A;  3R3M A;  4W9L A;  4BAX A;  3TEY A;  2AL6 A;  2NBU A;  1WJU A;  1FRD A;  3DBR B;  1LXD A;  4WAF A;  2DZM A;  2WXP A;  1E90 A;  1UF0 A;  2WLB A;  2W9N A;  1I4Q A;  1C77 A;  1HTO A;  1ZXI A;  2INP E;  2PVG C;  2NVU I;  2I1K A;  2KDI A;  5GMV A;  3ZNH B;  2L0F A;  4HXD A;  2X38 A;  3RZF A;  3V6C B;  2EKE C;  1SJH D;  4IKG A;  4C7Z A;  4W9H A;  1N6Z A;  2H88 B;  4KX6 B;  2KAN A;  3DWM A;  3APD A;  3DBH B;  5E6O A;  1TS3 A;  1OEY A;  1PUT A;  3NRZ A;  1FPY A;  2MA9 B;  2YEP B;  2K8H A;  1B1Z A;  3Q3O C;  1KTK A;  2ZVO A;  3JYU A;  1GJZ A;  3B2F A;  1PDX A;  4BZA A;  4DHZ E;  4TV3 A;  1JRU A;  1UBQ A;  4DXG A;  2WXQ A;  5LNK 1;  2W55 A;  3NG0 A;  2FID A;  4HLE A;  2KK8 A;  3H6N A;  1V80 A;  2N7E A;  3C0R B;  3ETR A;  1ROE A;  3N20 C;  2M19 A;  2XK5 B;  3H7P A;  3IAM 1;  2DYM A;  2Z8L A;  3BVM A;  4W9E A;  3QX1 A;  4C4V A;  2L32 A;  3VTW A;  4GOC A;  4L23 A;  1D3Z A;  4HJG E;  3KWV A;  3AUL A;  1P3Q U;  3HVD A;  1UEL A;  2KDE B;  3IFW B;  2REX A;  1ZPS A;  4M0W B;  3WAL A;  3VRB B;  1UGM A;  4FUL A;  2LRU A;  4KVG B;  4TQ1 A;  1T0R C;  1KLU D;  1GC6 A;  4NJ6 A;  4I6N B;  1TS4 A;  1FIQ A;  4ARI A;  2ASQ A;  2LRW A;  4FN2 A;  1T6B X;  4B9K A;  1VZ8 A;  2GBN A;  4YT0 B;  3AEC B;  2KVZ A;  4A9A A;  2QIL A;  1L0X B;  2X8X X;  4JE3 B;  2HTM E;  4K3B A;  1L0V B;  4W9G A;  2WDT B;  4B0E A;  1T3Q A;  1VD2 A;  3DDC B;  3W5V B;  3AE1 B;  4ZYS A;  4AS1 A;  3PZ7 A;  3OWE B;  4US8 A;  3QQ8 B;  3Q69 A;  4YSX B;  4BKG A;  3PRZ A;  4PT5 A;  3GZN B;  1JWA D;  4WAA A;  2YEP F;  1YX6 B;  1HXY D;  1SF0 A;  4HKQ A;  1AW7 A;  2N1W A;  2WX1 A;  3O65 B;  1FNW A;  2NCN A;  3BZD B;  3A9K A;  1F0Z A;  4WJN A;  1WGK A;  2C9W B;  2N9X A;  1KLV A;  4M01 A;  2E6X A;  1F1H A;  5MPO A;  1C1Y B;  2CU3 A;  4AWJ A;  3ZJV A;  2ZVN A;  3U2S C;  1SBB B;  3ZNZ B;  3ZO5 B;  3B08 A;  2NMQ A;  1JWU D;  1V86 A;  1WI0 A;  2EMT A;  3UIP B;  3NUH B;  1JWM D;  2LXA A;  1WM3 A;  3P63 A;  4MGI E;  1YMH E;  3HHM A;  1KLG D;  3AE3 B;  1L4D B;  2KJH B;  1XCQ L;  5HI1 A;  2A5U A;  1TY2 A;  1SXT A;  4NQK E;  2MBH A;  3OLM D;  2KMC A;  2VZK B;  1IPG A;  2JRI B;  2GBM A;  3AI5 A;  3M63 B;  1JML A;  2MH7 A;  2MJE A;  4P7I A;  3MFG A;  1Z2M A;  4AJY B;  2Y5P A;  3T3N A;  3WAP A;  2IDY A;  2OJR A;  1M94 A;  1R4N B;  1NDD A;  1I7H A;  3TL5 A;  4LJO B;  4YTN B;  3VTU A;  4HKZ E;  4BOS C;  3BWU D;  5EE0 A;  2MP2 A;  1SIJ A;  4EFO A;  1PGA A;  4DWF A;  3ABV B;  1YN4 A;  3GS2 A;  1WMH B;  1TBE A;  1XD3 B;  2A4Z A;  2OOB B;  1WE7 A;  3DBR I;  5BMH A;  1Q10 A;  3VFK A;  4RCO A;  5CHV C;  2JYT A;  2FCM A;  1RRB A;  2WNM A;  2BVC A;  2XNA C;  4RF0 A;  3EEC A;  2FNJ B;  3T8M A;  3ZYY X;  2WWZ A;  3BK1 A;  4DDG D;  1SB3 C;  5D3I B;  3B2G A;  3A1Q B;  3I3T B;  2M1M A;  3EHV A;  2PJH A;  1VCB A;  4GDL B;  3OJ4 B;  4LNK A;  2IO2 B;  2K39 A;  4DHJ B;  4GSW A;  4N58 A;  4HRS A;  1HE8 A;  1UBI A;  3SEB A;  1H4R A;  4JWU C;  1EU4 A;  2G1E A;  3DBH I;  3VR9 B;  2BW2 A;  2IND C;  1BUI C;  2KN4 A;  3A33 B;  4RM8 A;  3SR6 A;  1SSN A;  4F1S A;  2IO1 B;  2YVC A;  4FA6 A;  1NEK B;  3CSF A;  4F8C B;  2K25 A;  3NS8 A;  4GXB A;  5DPT A;  3CWI A;  1Q1O A;  1TKY A;  4JLC A;  3IT6 B;  1WH3 A;  2ZEQ A;  2HJ1 A;  1LGR A;  4XYC A;  2QCZ A;  1UNS A;  2BYF A;  2HTH A;  2FE8 A;  4NAW B;  5BYQ A;  3A4R A;  1V6E A;  3AEG B;  3AED B;  1IYF A;  2D3A A;  5EE1 A;  1YD8 U;  2HD5 B;  4RM9 A;  3ZNG C;  1J7A A;  1WX9 A;  5E6N A;  4MM3 A;  2DYO A;  4OZC A;  2M56 B;  3Q2A C;  3VH3 B;  1ZW7 A;  1E5W A;  3RUL A;  1YN3 A;  2WXI A;  3NS1 A;  2EEL A;  5FR6 A;  3X0W A;  1N5W A;  2KJ6 A;  4KGT A;  1V1P B;  1ZDV A;  1HTQ A;  1HZ6 A;  1D4B A;  4W9J A;  3ZRC A;  4BKT A;  3KH0 A;  3PVL A;  1ET6 A;  2PMV A;  1SJE D;  1WRD B;  2CHX A;  2C7N B;  3PGE A;  4UDU C;  3PSE B;  1OTR B;  2BB6 A;  3RZW C;  1TY0 A;  3GE3 C;  1FXT B;  4AP4 C;  5KHQ A;  3N1Z C;  2ZZP B;  4N59 A;  5D7G A;  3B1L X;  1WYG A;  2O2V B;  3V3X A;  4MSQ B;  4H2A A;  2DWQ A;  4XC2 A;  1S1Q B;  4LDT B;  3FIL B;  3TEX A;  3A9J A;  4G11 A;  1V5O A;  1LQB A;  1XEE A;  1I42 A;  3AE6 B;  4W9D A;  1TJE A;  1I4X A;  1VJK A;  2MEK A;  1E8Y A;  4S17 A;  2WXF A;  1UWM A;  4KIK A;  4II3 B;  2LGY A;  3ALB A;  3X23 A;  1ZE3 D;  3GZN I;  3CST A;  2ON8 A;  4YXD B;  2PEA A;  2JQR B;  4XGA B;  1OEY J;  4WUR A;  3JSV A;  1I4P A;  2Q5W D;  5FR3 A;  2M8S A;  5D6J B;  1J0G A;  1UH6 A;  4IG7 B;  4KKJ A;  3VUW A;  4G0N B;  5BMI A;  3NOB A;  2J7Q B;  5AUI A;  4X57 B;  4MSM B;  1NYQ A;  4G3X B;  1UD7 A;  2KKC A;  2IY0 B;  2CJO A;  2PPH A;  1IGD A;  1T5X D;  1C3T A;  2WYQ A;  3V61 A;  2NBV B;  5AZH A;  1J8C A;  5E6J A;  1VZ7 A;  2BS2 B;  1D5X C;  2LMC A;  5CTR C;  1DOX A;  3BY4 B;  1YN5 A;  1WYW B;  1A5R A;  3ZW3 A;  3NZS A;  3H8H A;  2KJR A;  1R4N I;  4K1R B;  1Y56 A;  4DBG A;  3V05 A;  2N7D A;  3W5U B;  3APC A;  2BKF A;  1F2R C;  4US9 A;  4PS3 A;  4MH0 E;  1VLB A;  1P7F A;  1QKZ A;  5IOI A;  3TSS A;  3IHP C;  1NBF C;  3AE5 B;  1PGX A;  3Q8E A;  4EEW A;  4EOY A;  3AE9 B;  3P1M A;  2NPT B;  2MRP A;  3L08 A;  3DBL B;  4MT5 A;  4J3O D;  5IO9 A;  2J0K A;  1V81 A;  2KTR A;  4WWP A;  3LYY A;  2OJW A;  5IP4 D;  1RFK A;  1GC7 A;  4WJP A;  3PRE A;  4DDI D;  1P1A A;  2LJ5 A;  2LVQ A;  2ZCB A;  4A8X C;  2KWC A;  4IM3 A;  4FJZ A;  5D94 A;  3I9V 1;  1QT9 A;  2INC C;  1OQY A;  2WXL A;  4KV2 A;  3U52 E;  1UZX B;  3M62 B;  4GGQ A;  5C3J B;  4MEM A;  4A20 A;  1EF5 A;  3ML8 A;  4HPP A;  3SFD B;  1E0Z A;  3WAM A;  1ISN A;  1R4M B;  1GNU A;  2K8C A;  1TS5 A;  3V6E B; 
#chains in the Genus database with same CATH homology
 2WDT B;  2KVR A;  4LDT D;  1VD2 A;  4GDK B;  3DDC B;  4MGZ E;  2XEW A;  1Z5S B;  1SGH A;  3L16 A;  3DOW A;  2L7R A;  2DZK A;  2JXX A;  4FBJ B;  2BWF A;  4PYZ A;  1E7U A;  3SU8 X;  3ENE A;  4CHK A;  4EKU A;  1WGD A;  3QQ8 B;  4EZK A;  3QK0 A;  3TIX A;  2KC1 A;  4BKG A;  1Q0W B;  3PRZ A;  2DAJ A;  1E8X A;  1TZ1 A;  1WX7 A;  2MLB A;  2O6V D;  4MGK E;  4HVB A;  4WAA A;  4WJO A;  1YX6 B;  2PE6 B;  3IBE A;  2G4D B;  4EZJ A;  2FIF A;  4HDO A;  2N1W A;  2WX1 A;  3O65 B;  4KSL C;  1X1M A;  2NCN A;  2LGX A;  2K6Q A;  2FCQ A;  2UWQ A;  2JY6 A;  5AEK B;  3NZU A;  3QAR A;  3A9K A;  3KUD B;  1WM2 A;  2MBQ A;  1WFY A;  1XQQ A;  4HK2 A;  4K81 A;  5HKH A;  1WF9 A;  4WJN A;  1KM7 A;  2C9W B;  4ZRI A;  4W9I A;  2N9X A;  4B95 A;  2EMS A;  4PS7 A;  2C5L C;  1KLV A;  2JPH A;  4AJW A;  2BYE A;  2JZZ A;  3MTN B;  4KDL B;  5EDS A;  1C1Y B;  4FHJ A;  3SHQ A;  4AWJ A;  2KZR A;  2Z59 B;  2ZVN A;  4IM2 A;  3D32 A;  4IC7 B;  2QHO A;  2DEN B;  3ZNZ B;  3ZO5 B;  3B08 A;  3LJ3 A;  1P0R A;  2NPT A;  1V86 A;  3PPA A;  1Y8R C;  3VVW B;  3U8Z A;  3DVG X;  5BO4 B;  1S3S G;  1WI0 A;  4FHK A;  4NY0 A;  2KO3 A;  1RFA A;  1WXS A;  2EMT A;  1WE6 A;  3UIP B;  2LXA A;  1WM3 A;  2HE7 A;  1V9J A;  2AEH A;  2KLC A;  2O2V A;  4MGI E;  2DYB A;  3HHM A;  1WZ3 A;  2GBK A;  3Q3J A;  4TKN A;  4XX5 A;  4W9C A;  4E3C A;  2KJH B;  4K7U A;  2A5U A;  3W1S A;  3N3K B;  4AOF A;  2JF5 A;  2ZPY A;  4OVV A;  5J2R A;  3WIM A;  4ANU A;  4NQK E;  3QWZ B;  2MBH A;  3OLM D;  4HPM B;  2KMC A;  4DK5 A;  3RT3 B;  3RD2 A;  1IPG A;  1RLF A;  1V5T A;  2JRI B;  3QA8 A;  5TR5 A;  2KN5 A;  2ZNV B;  1WGY A;  4GIV A;  5D2M B;  2GBM A;  3AI5 A;  3M63 B;  4P7I A;  2AWT A;  1KOT A;  1Z2M A;  4GN1 A;  4AJY B;  3R7Q A;  3WAP A;  2Z0D B;  2OJR A;  3TJP A;  1M94 A;  1NDD A;  4A3O A;  3TL5 A;  2JVC A;  3RUI B;  2M17 A;  2KOX A;  4LJO B;  3VTU A;  3PS6 A;  3VDZ A;  4FJV B;  3T9L A;  1U4A A;  3VUX A;  4BFR A;  4BOS C;  3QCA A;  3ZKJ C;  3TMP B;  1PQS A;  2MP2 A;  2NR2 A;  2BYV E;  1E8W A;  5DPW A;  2PE9 A;  4EFO A;  4DWF A;  4FJY A;  1CMX B;  2LWP A;  2MWS B;  2V1Y A;  1WMH B;  2LZ6 A;  2Y5B B;  3K9P B;  2JWZ A;  3KW5 B;  1TBE A;  4HCP B;  4A3P A;  2KMA A;  2RSU A;  1XD3 B;  2A4Z A;  2MBO A;  3R7R A;  2OOB B;  3M95 A;  1WE7 A;  3DBR I;  3U7D A;  2MX2 A;  2LD9 A;  2M0X A;  3VFK A;  5CHV C;  3PLV A;  2LUE A;  1E8Z A;  2FCM A;  3VQI A;  5KHO A;  3KYD D;  4FLH A;  1RRB A;  4ANV A;  5G55 A;  1WJ4 A;  5C1Z A;  4K7S A;  5LXI B;  3EEC A;  3N30 A;  2FNJ B;  3T8M A;  4NQL B;  1ZKH A;  2LAS A;  2WWZ A;  3VUY A;  4KSK C;  1YIW A;  2J0M A;  4NJ7 A;  3H1U A;  4DDG D;  3ZRF A;  3UIN B;  2AYO B;  4HDQ A;  4KZ0 A;  3W1S C;  2KTR B;  2BPS A;  1YQB A;  1GG3 A;  3A1Q B;  4E74 A;  3I3T B;  2M1M A;  3EHV A;  2PJH A;  1VCB A;  4GDL B;  4ICV A;  1QZE A;  4MGY E;  3OJ4 B;  4JQW C;  3VXW A;  1TTN A;  2D07 B;  2IO2 B;  2K39 A;  4DHJ B;  1LM8 B;  2DZJ A;  4W9K A;  4GSW A;  1I35 A;  2KQ7 A;  4BBN C;  2DX5 B;  4BKS A;  1HE8 A;  2MCN B;  1UBI A;  3L13 A;  1H4R A;  2UYZ B;  5JH5 C;  2KQS A;  3A9J B;  3DBH I;  4LCD E;  5AZG A;  1RAX A;  3QHT A;  2IO0 B;  5JHB A;  3DPD A;  3A33 B;  4HJK A;  2L8J A;  4RM8 A;  3VH4 B;  4F1S A;  1WZ0 A;  2KFK A;  3PT2 B;  3R66 C;  2IO1 B;  4IUM B;  2YVC A;  4FA6 A;  4B6W A;  2IO3 B;  4KIK B;  4F8C B;  3CSF A;  3LDZ E;  2K25 A;  4MJS A;  4KDI C;  3NS8 A;  3ZDM C;  4GXB A;  5DPT A;  3VTV A;  1Q1O A;  4JGH B;  4JLC A;  2LGD A;  2KNB A;  4HWI B;  1WH3 A;  2ZEQ A;  1WY8 A;  1H8C A;  2KX3 A;  4EZL A;  1T0Y A;  3KYC D;  2J0J A;  3S2A A;  2IYD B;  2G4S A;  2D2Q A;  2DHZ A;  2GMI C;  3JSV B;  3VAW A;  4DHJ D;  3AU5 A;  2BYF A;  4MEL A;  2HTH A;  1NI2 A;  3HM6 X;  4NAW B;  3OAW A;  2BGF A;  3A4R A;  2XK5 A;  4CO7 A;  4NPN A;  1OGW A;  1V6E A;  4JIO U;  4WWN A;  3NHE B;  1IYF A;  3JW0 X;  2ZJD A;  4AUQ C;  2K1F A;  5IA7 A;  1YD8 U;  1XT9 B;  3L54 A;  2LI5 A;  2Z0E B;  2HD5 B;  4RM9 A;  3ZNG C;  3NY5 A;  1WX9 A;  5E6N A;  2GOW A;  4MM3 A;  2DYO A;  3WA0 A;  3UQB A;  2C7H A;  4ICU A;  3PHW B;  2FCS A;  3ZUN A;  5JHA A;  3VH3 B;  1WIA A;  1ZW7 A;  3V62 A;  3PRM B;  2C7M B;  4BKS D;  4BOZ B;  1E5W A;  3RUL A;  3OJ3 A;  3DBL I;  2WX0 A;  2L00 B;  4ANW A;  1GUA B;  5AZF A;  5J17 A;  2MQJ A;  2N9E B;  3DBS A;  2GBR A;  3CF6 E;  2YLM A;  2RPQ A;  2RR9 A;  2KC2 A;  3M3J A;  5FR6 A;  4ASW C;  3UGB B;  1WJN A;  3WAN A;  4WJQ A;  3RYT A;  3X0W A;  1WGR A;  1KJT A;  4RMA A;  2KJ6 A;  3PZD A;  4F7Z A;  3PTF C;  4I6L B;  4I6P A;  4IWQ A;  3PV1 A;  4W9J A;  1WJ6 A;  3ZIM A;  5CHW A;  3DVG Y;  3ZRC A;  4BKT A;  3KH0 A;  2N9P C;  3PVL A;  5JZE B;  4IM0 A;  1WRD B;  2CHX A;  2C7N B;  5L95 C;  3PGE A;  1G6J A;  2L0T A;  1E7V A;  3PSE B;  1OTR B;  4IWO A;  3RZW C;  3V60 A;  5IAA C;  1EF1 A;  5G2N A;  2D10 A;  3ZTD A;  3KUZ A;  3PLU A;  4URK A;  2HJ8 A;  1FXT B;  2KWU B;  3DCG A;  4AP4 C;  2XBB C;  5KHQ A;  2ZZP B;  4LJP B;  1Q5W B;  5D7G A;  3L0W B;  4GDK A;  3B1L X;  2O2V B;  2KXJ A;  1YX5 B;  4GDL A;  3VHT C;  1J19 A;  4MSQ B;  2BKR B;  1P9D U;  2KFJ A;  1R4M I;  4XC2 A;  3IG3 A;  3Q3F A;  1S1Q B;  3CMM B;  2VRR B;  3ML9 A;  2KHW B;  4LDT B;  2BF8 B;  2GBJ A;  2JRH A;  2ZCC A;  1V49 A;  2FUH B;  3H7P B;  2RD0 A;  3A9J A;  3MJW A;  1K8R B;  1LQB A;  1V5O A;  1WR6 E;  4G11 A;  4GB9 A;  1I42 A;  3RCZ A;  4II2 B;  2DAF A;  1WR1 A;  3TCA A;  3WAO A;  4W9D A;  5DPR A;  4HCN B;  1WXM A;  3IVF A;  1F9J A;  2MBB B;  3ONS A;  2V4L A;  3QJZ A;  3DVN U;  1E8Y A;  2D3G A;  2IY1 B;  2CHZ A;  2O6V B;  3PRP B;  4KZC A;  3MHS D;  4KIK A;  3R3M A;  3QC8 B;  2LGY A;  3ALB A;  4II3 B;  1TGZ B;  2AL6 A;  4W9L A;  3X23 A;  2NBU A;  3CST A;  3GZN I;  1WJU A;  2MBE A;  2CHW A;  1LXD A;  2CU1 A;  1V2Y A;  2DZM A;  3DQV A;  2MSE D;  2PEA A;  1E90 A;  2CR5 A;  3AU4 A;  2IBI B;  4TQ0 A;  2W9N A;  2I1J A;  1OEY J;  2C60 A;  3AXC A;  1SIF A;  3HM3 A;  3TBL D;  2R2Q A;  2KTF A;  2FAZ A;  3JSV A;  1WGG A;  4NAW A;  2M8S A;  5D6J B;  3JVZ X;  4PS8 A;  2KLG A;  3H7S A;  2K6D B;  2NVU I;  2I1K A;  2KDI A;  1WX8 A;  5GMV A;  1J0G A;  2L05 A;  3SDL C;  2L0F A;  4HXD A;  1UH6 A;  5CX3 A;  2CKH B;  3BIN A;  4IG7 B;  3RZF A;  3PHX B;  3V6C B;  3GOE A;  2EKE C;  2KWV B;  3EFU A;  3N32 A;  2KDF B;  3A4S C;  2FCN A;  3ZDT A;  4W9H A;  3VUW A;  4W9F A;  4G0N B;  3NOB A;  2J7Q B;  2KAN A;  4X57 B;  3APD A;  4MSM B;  2M4N A;  5E6O A;  3ECI A;  4G3X B;  1UD7 A;  5DCN A;  2KKC A;  2IY0 B;  1LFD A;  1OEY A;  2PPH A;  2NBW B;  4IWP A;  3KUC B;  1EUV B;  4GU2 A;  1C3T A;  2MA9 B;  2WYQ A;  2D11 A;  3V61 A;  1MG8 A;  4ZDV A;  2K8H A;  2NBV B;  3B0A A;  3JYU A;  2ZVO A;  3QIJ A;  1GJZ A;  4N9F 4;  1EO6 A;  5AZH A;  4DHZ E;  1J8C A;  4TV3 A;  1JRU A;  1UBQ A;  2G3Q B;  3ZTC A;  2N1V A;  3L10 B;  1IP9 A;  3ZLZ A;  4CYE A;  1WXV A;  2BWE S;  1ZGU B;  2K8B A;  3KVF B;  5CTR C;  2KFK B;  2CS4 A;  3BY4 B;  2B3A A;  3A9K B;  4IW0 A;  1WYW B;  1YJ1 A;  2FID A;  1A5R A;  4MJS B;  3ZW3 A;  4HLE A;  2KK8 A;  3H6N A;  3NZS A;  3ZNI D;  4M8N A;  3HIZ A;  1WMH A;  2KJR A;  4DXA B;  1R4N I;  2MW5 A;  4K1R B;  4M8M A;  4DBG A;  4YL8 A;  2N7D A;  4ZRJ A;  3UIO B;  2L76 A;  1L2N A;  3APC A;  5C23 A;  3K9O B;  2BKF A;  4PS3 A;  1V80 A;  2N7E A;  4MH0 E;  3C0R B;  3P2B A;  4J6I A;  5L83 A;  4GMV A;  4BVU C;  3IHP C;  5E6P A;  4ZYN A;  1NBF C;  3DVN V;  2JZ3 B;  4DHZ B;  2R2O A;  2XK5 B;  3UQA A;  4K7W A;  4EEW A;  3L17 A;  2KD0 A;  4EOY A;  2KDB A;  2LXC A;  3H7P A;  2NPT B;  2DYM A;  4JL9 A;  3ZNH B;  1WGH A;  2G45 B;  4W9E A;  3APF A;  2MRP A;  3QAQ A;  3QX1 A;  2NS5 A;  3L08 A;  5CHF A;  3VTW A;  4GOC A;  2J0K A;  4FAD A;  1D3Z A;  1V81 A;  2KTR A;  4E71 A;  2L3Z A;  1P98 A;  2IZV B;  3A1Q A;  3AUL A;  4MDK E;  4TUU A;  4WWP A;  4EUT A;  2O6V A;  4BBN F;  1P3Q U;  3HK0 A;  2AL3 A;  1L7Y A;  2KDE B;  1UEL A;  1GC7 A;  2JUO A;  3IFW B;  2ZNV C;  4WJP A;  2REX A;  2LVP A;  4M0W B;  3PRE A;  3SD5 A;  1P1A A;  3WAL A;  4DDI D;  2LJ5 A;  2LVQ A;  2ZCB A;  2DZI A;  3U30 A;  2KX0 A;  1BT0 A;  1UGM A;  2KWC A;  4FUL A;  4IM3 A;  5J18 A;  4FJZ A;  5D94 A;  2JT4 B;  4HPL B;  2LRU A;  4G50 A;  4KVG B;  1OQY A;  4TQ1 A;  4KV2 A;  1GC6 A;  1UZX B;  4NJ6 A;  4I6N B;  3M62 B;  4GGQ A;  4ANX A;  4ZRK A;  2V3S A;  4WWO A;  3W1Y A;  2ZPN A;  4MEM A;  4A20 A;  2ASQ A;  2LRW A;  4FN2 A;  4NNJ B;  1EF5 A;  4B9K A;  3ML8 A;  3ZVV A;  2GBN A;  3UF8 A;  3WAM A;  2LVO A;  1ISN A;  2N4F A;  4PYU A;  3H9D A;  5DPS A;  1AAR A;  2MP2 B;  1GNU A;  4WQO B;  3EC8 A;  2K8C A;  5LXH A;  4XZ4 A;  5LLI A;  4OVU A;  2RGF A;  1WXA A;  3V6E B;  4W9G A;  1SE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...