2ZCBA

Crystal structure of ubiquitin p37a/p38a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIAADQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ubiquitin P37A/P38A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ubiquitin
total genus 20
structure length 74
sequence length 74
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zcbA00
2PJHA 4JLCA 1C3TA 2R2OA 1WGGA 5E6PA 2MBEA 3PGEA 5LLIA 2LJ5A 2L7RA 1TBEA 1T0YA 2NPTA 3V6EB 1GC7A 2L05A 1Q5WB 2XEWA 5DPWA 3A1QB 1OTRB 4BOSC 3B08A 4G11A 4MJSB 2DZIA 3DVGX 3H7SA 4W9FA 2IY0B 2KDFB 2KHWB 4WJPA 3DVGY 1SGHA 4ANVA 1WE7A 2AWTA 3ZRCA 5LXHA 4IM3A 3EECA 4PYUA 1EF5A 2IO1B 4WJQA 1E8YA 4M0WB 1M94A 2DZMA 3ZTCA 5TR5A 3RYTA 3KVFB 1LM8B 2KWUB 4WWPA 3OLMD 2RD0A 4FLHA 1NDDA 3NHEB 4LCDE 1V81A 2M4NA 2KMCA 3OAWA 3PSEB 4DXAB 3QARA 1WJNA 2N9EB 4NNJB 3GOEA 2I1KA 5AZHA 4KDIC 4JIOU 2CR5A 2ZPYA 3QK0A 2CHXA 3NZUA 1P1AA 1E8ZA 1EF1A 3TIXA 3PV1A 5E6NA 2O6VB 1E8WA 4XX5A 1RAXA 3QHTA 4FJZA 3UF8A 3KUZA 3WANA 1KLVA 2BF8B 2K25A 3D32A 2PEAA 3H7PB 4EZJA 2GMIC 1WGYA 3RZWC 1SIFA 2ZEQA 3RCZA 3A9KB 1WJ4A 2IO3B 2Z0EB 2K6QA 4K7SA 3VUWA 3HM6X 2Z59B 3H7PA 2EKEC 2KTFA 3NOBA 4GDKA 4W9HA 4ZYNA 1WY8A 1WIAA 4TV3A 3M63B 2N9PC 3ENEA 4F1SA 3RULA 3JVZX 2KTRA 4FADA 2JWZA 3APDA 5CHWA 3V60A 2JT4B 3ZVVA 3R3MA 1OQYA 2J0MA 2MQJA 3AULA 1Q0WB 2BYVE 3OJ4B 4MELA 4LJPB 3ZDTA 3ML9A 4I6NB 2XK5A 1WR1A 2REXA 3L0WB 2D3GA 1K8RB 1WFYA 4HWIB 2KJHB 2ZVOA 3DVNV 3ZO5B 2IBIB 3UQAA 4W9DA 2MBBB 2CS4A 2MA9B 2Z0DB 1WM3A 1WZ3A 2N7DA 3ZTDA 4CHKA 4GOCA 4RMAA 5D7GA 1S1QB 2KANA 3V62A 2PE6B 5KHOA 3WALA 2DZKA 3TL5A 2ZCBA 3CMMB 2KWVB 5G2NA 3A33B 3KH0A 1YX6B 4WQOB 1R4NI 3A9KA 4IW0A 1UD7A 3N30A 4MDKE 2JUOA 2JRHA 1H4RA 3VUYA 4EFOA 2DZJA 3KW5B 5D94A 3ZLZA 5D6JB 2IO2B 2BKFA 2I1JA 1WGHA 2KJ6A 4ICVA 2KFKB 1E8XA 3ONSA 4A20A 2ASQA 4NAWA 4IWPA 1UGMA 1LQBA 2M1MA 3EFUA 3PPAA 2MBHA 3ZW3A 2NBUA 1WX8A 3DPDA 3PRPB 4AP4C 3DBHI 3NY5A 4HCNB 3ZRFA 2WWZA 4IG7B 1MG8A 2FUHB 1ZW7A 3DCGA 2LXAA 1CMXB 3DVNU 4IWQA 4XZ4A 2WX0A 3A9JB 3QWZB 4FHKA 1E5WA 2G3QB 1WYWB 4IC7B 3RT3B 4NJ7A 1HE8A 3DDCB 2K39A 1V9JA 4MGKE 1LXDA 2QHOA 2KLGA 2NR2A 3QX1A 3P2BA 4ICUA 3ZNID 2KQ7A 2J0JA 2KMAA 2R2QA 4HJKA 2BWES 2D07B 2KNBA 5GMVA 3X23A 2JXXA 2MW5A 3ALBA 2BKRB 2FCMA 2WX1A 2MX2A 2KD0A 4W9JA 1RRBA 2VRRB 4DHZE 4GDLB 2DAJA 3JYUA 4FBJB 1FXTB 5CHFA 2J0KA 3PRMB 1L7YA 2O2VA 2ZPNA 4FN2A 2AEHA 2AL3A 2FCQA 2KC1A 2LRUA 4IM2A 4ANUA 4HLEA 3L13A 3DBLI 4J6IA 4A3OA 2GOWA 2O2VB 4GIVA 3U8ZA 5C1ZA 4II3B 3KYCD 5G55A 2ZNVC 4KIKB 4JGHB 3DBRI 4DWFA 4MSMB 2MBOA 4XC2A 3NZSA 2V1YA 1I42A 3W1YA 1WJ6A 2KQSA 3U30A 1TGZB 1XT9B 3UGBB 3DBSA 3ECIA 4KSKC 1J19A 1KJTA 1NI2A 1OEYJ 1UELA 2BWFA 3HHMA 1V86A 3M95A 1WGDA 4GGQA 4MGIE 4OVUA 2KDIA 3ZNZB 4EKUA 1GC6A 1WGRA 2L76A 4ZRKA 4LDTD 1E90A 2LVQA 3EHVA 2DENB 2HTHA 4GB9A 3ZUNA 3IHPC 3ZNHB 3EC8A 3TMPB 4HDQA 3AU4A 4JQWC 2CHZA 3H1UA 2DYOA 3WIMA 2NVUI 3MJWA 2HD5B 3UIPB 2C7MB 2KK8A 3PRZA 5DPSA 3IVFA 2A5UA 1RFAA 1UZXB 3WAMA 3K9PB 4KZCA 2MP2A 2PE9A 2KFJA 3RD2A 1XQQA 2Y5BB 2K8HA 2RGFA 4HVBA 4URKA 2BGFA 2BYFA 3AU5A 4AJWA 4NAWB 4B6WA 4B9KA 5LXIB 4GDLA 3PVLA 3X0WA 4HK2A 3QCAA 3SHQA 2FIDA 5JHBA 1A5RA 1I35A 3PLVA 2LWPA 4WJOA 3TCAA 1WZ0A 4GMVA 1L2NA 3NS8A 1J0GA 3PTFC 1QZEA 4BBNF 2L00B 4BKSD 3S2AA 1S3SG 2ZZPB 1YX5B 3MHSD 3H9DA 3JSVA 5DPRA 5CX3A 4DHJD 3PZDA 2C5LC 4I6PA 4WJNA 4II2B 4PS3A 3VUXA 1GNUA 4EOYA 4TQ0A 2HE7A 4RM9A 3DQVA 3RUIB 1WM2A 3OJ3A 1GUAB 2KJRA 2LGXA 4MGYE 2C7HA 5IAAC 4TQ1A 2CHWA 2N7EA 5D2MB 3DOWA 4AJYB 4FULA 3QJZA 3LJ3A 4GXBA 3KUCB 3SU8X 4KZ0A 3UQBA 4W9LA 4GU2A 2L0FA 1WE6A 2YVCA 4FJYA 2M0XA 3A4SC 2BPSA 2L3ZA 2A4ZA 2JF5A 3A9JA 3CSFA 2AYOB 2KKCA 2LXCA 1P98A 3SDLC 2JZZA 2MLBA 4E3CA 3H6NA 1Z5SB 3I3TB 5AEKB 1WX7A 4HDOA 3UINB 4BKGA 1G6JA 2NCNA 5BO4B 4BBNC 3BY4B 5DCNA 3N3KB 4KIKA 3A4RA 3W1SC 1F9JA 1P3QU 2KN5A 2LGDA 4HPLB 3WA0A 2FAZA 2M17A 3CF6E 4GN1A 4TKNA 1V5OA 2KX0A 4P7IA 2KX3A 3T9LA 1UBQA 2GBKA 1WMHB 2HJ8A 3Q3JA 4LDTB 1WXAA 1V49A 1Y8RC 1YQBA 2RPQA 4IM0A 4PS8A 3L10B 3R7RA 3VAWA 1WXSA 3W1SA 1TZ1A 3SD5A 1R4MI 3QIJA 3N32A 2FIFA 4YL8A 2GBMA 4EZLA 5JHAA 2C7NB 4G50A 2LD9A 2D11A 1P9DU 4N9F4 2DYBA 2RR9A 3TJPA 2ZJDA 1GJZA 1WF9A 4BOZB 2JPHA 2L0TA 2WYQA 4WAAA 2IO0B 2JRIB 5EDSA 4NQKE 4WWOA 5HKHA 1NBFC 5CHVC 3M62B 1ZKHA 2KZRA 3ZDMC 3B1LX 5J17A 2EMTA 1PQSA 3ZKJC 1V6EA 1C1YB 1GG3A 2JVCA 2C9WB 2O6VA 3AI5A 3APFA 4W9IA 4TUUA 5L95C 1UH6A 2KLCA 3HM3A 2DYMA 3IBEA 2UYZB 2FNJB 4FA6A 4I6LB 3APCA 4BVUC 2KFKA 3IFWB 4HCPB 3R66C 2K6DB 4MH0E 1V80A 1X1MA 2FCSA 3L17A 2L8JA 3K9OB 3PREA 4MEMA 4AUQC 2N1VA 1WH3A 1WRDB 4ZDVA 2XBBC 1IPGA 2RSUA 1U4AA 4G3XB 3HK0A 2D10A 3LDZE 5JZEB 4NY0A 2KDBA 4AOFA 2IZVB 4W9KA 3JSVB 3L08A 3ZNGC 4F7ZA 3VTUA 5AZGA 2GBJA 2AL6A 2JY6A 4K7WA 2G4DB 2V3SA 3KYDD 2V4LA 4BFRA 1WXVA 1E7UA 1LFDA 2J7QB 2LVPA 2N9XA 2W9NA 3VTWA 2K1FA 3PHWB 2GBRA 3U7DA 5JH5C 4MSQB 3IG3A 3UIOB 5IA7A 5J18A 4W9EA 2C60A 3QC8B 2YLMA 2KVRA 1EO6A 2LVOA 2KDEB 4MM3A 3KUDB 5DPTA 4ANXA 4IUMB 4EEWA 3V61A 2LASA 3M3JA 3Q3FA 3RZFA 3VH3B 4JL9A 4ZRIA 3T8MA 4X57B 3C0RB 3ML8A 2WDTB 4AWJA 4DBGA 3BINA 1SE9A 2MRPA 3WAOA 4CYEA 2K8CA 3VHTC 4CO7A 2BYEA 4KDLB 4W9GA 1JRUA 5FR6A 4EZKA 4MGZE 2MSED 2ZCCA 1ISNA 4NQLB 1IYFA 4ANWA 2K8BA 3GZNI 4DHZB 2NPTB 1WR6E 2DHZA 2IY1B 3PHXB 4DHJB 2N4FA 2IYDB 1D3ZA 1V2YA 2M8SA 3V6CB 2D2QA 4EUTA 1WMHA 2LUEA 4HPMB 5C23A 1TTNA 3VXWA 4A3PA 2MBQA 2NBVB 1BT0A 4F8CB 3QQ8B 1WXMA 4E74A 2KO3A 4OVVA 1RLFA 4NPNA 4DDID 2EMSA 2O6VD 4KVGB 4GSWA 2OOBB 4K1RB 4NJ6A 1IP9A 1J8CA 1AARA 1Q1OA 1Z2MA 4W9CA 3ZIMA 4K7UA 1KOTA 2OJRA 4LJOB 3R7QA 4PS7A 3PLUA 4E71A 2ZVNA 3JW0X 4HXDA 1P0RA 3AXCA 3VVWB 2G4SA 1H8CA 4M8NA 2B3AA 2KTRB 2LI5A 5L83A 4B95A 4K81A 1OEYA 1XD3B 3L54A 1WJUA 3O65B 4WWNA 3WAPA 2MP2B 2G45B 3PS6A 1YJ1A 3HIZA 2LZ6A 4PYZA 5E6OA 4DDGD 1ZGUB 5KHQA 1VCBA 3A1QA 1E7VA 2XK5B 4FJVB 1WI0A 4ZRJA 2KOXA 3VTVA 3TBLD 2N1WA 2UWQA 4MJSA 3VQIA 4BKTA 2DAFA 3L16A 3CSTA 3QA8A 2CKHB 3VH4B 1KM7A 2MWSB 3PT2B 2GBNA 1YIWA 1WX9A 5J2RA 4G0NB 4RM8A 5AZFA 4BKSA 1UBIA 2DX5B 4FHJA 4DK5A 2KC2A 2LGYA 1V5TA 4IWOA 1EUVB 3QAQA 3MTNB 4GDKB 4KSLC 4M8MA 3VDZA 2NBWB 5CTRC 2CU1A 2NS5A 3VFKA 2LRWA 2JZ3B 4ASWC 2MCNB 1VD2A 2KWCA 2PPHA 2KXJA 2FCNA 2ZNVB 1OGWA 4KV2A 1YD8U 3B0AA
chains in the Genus database with same CATH superfamily
4ZHOA 1C3TA 2R2OA 1ZOYB 2DNFA 3PGEA 2LJ5A 2NMQA 3ZQ4A 1F2RI 5GXGB 4KGSA 2Y3AA 3B08A 4G11A 2DZIA 1TJEA 1T0RC 1FCCC 3DVGY 4WJPA 4XDDA 2JZPA 3FILA 1WE7A 3W5UB 1Q10A 2NTTA 1F1HA 2KWUB 3IXSA 3NHEB 4LCDE 1C9FA 3PSEB 1UWXA 1UUPA 5G5GA 4K3CA 4NNJB 1QQRA 4KDIC 2X8XX 2CR5A 2QC8A 2ZPYA 1N5WA 4LTUA 2BTEA 3PV1A 1C77A 1VDVA 4ITKA 3UF8A 4FJZA 4KKJA 2WP9B 1KLVA 2BF8B 2K25A 3RZWC 1WJ4A 2IO3B 2K6QA 2Z59B 3H7PA 3NOBA 4GDKA 1WY8A 4TV3A 4YSYB 3M63B 2WXMA 3IT4B 4HEA1 2LGIA 3AE6B 4FADA 3T3NA 5CHWA 3V60A 2MQJA 2BYVE 4LNNA 4I6NB 1WR1A 3L0WB 1WFYA 4HWIB 2KJHB 2ZVOA 4WH4A 1RM6C 4W9DA 2MBBB 4N6EB 2CS4A 1MFWA 2Z0DB 3I5JC 4YTPB 2N7DA 3ZTDA 1S1QB 2KANA 3DWMA 4RFBA 1WRIA 2JQRB 2WXHA 4WQOB 3KWVA 1FFUA 4WQMA 4IDIA 5D94A 5D6JB 1WGKA 3P4RB 1WGHA 1R7SA 2V9HA 3EFUA 4R3DA 3PRPB 4AP4C 3DBHI 4EE2A 4HROA 4P1BC 3EGRA 2FUHB 1PGAA 4RGNA 3DVNU 4XZ4A 5EE3A 4IC7B 4FHKA 2G3QB 4C56C 1HE8A 3AEFB 3MC0B 4K3BA 2K39A 1V9JA 2W82A 3GE3C 3P2BA 1ZPSA 4ICUA 2QJLA 3NUHB 2J0JA 1C78A 2KNBA 4ARIA 2MW5A 1FIQA 2FCMA 1SJHD 2Z8LA 1I4HA 2N9LA 1VRAB 2RMMA 1AW7A 2MJDA 4JPSA 2DAJA 1HZ5A 4FN2A 2FCQA 3L13A 3DBLI 4J6IA 5C1ZA 2INPE 3KYCD 4LLGM 2WXFA 3W2DA 4KIKB 4JGHB 3RNGC 2V1YA 3W1YA 1MI0A 4KSKC 1J19A 2BWFA 4MGIE 3M95A 4P6VF 2INNE 4C7ZA 4ZRKA 4B0MA 1JWBD 3HRDD 2HTHA 4GB9A 3U52E 3B2GA 4HDQA 4JQWC 3H1UA 2DYOA 2NVUI 3MC8A 3UIPB 5HFYA 2A5UA 2EKIA 1RFAA 3WAMA 3K9PB 3FC4A 4KZCA 1XEEA 2K8HA 2RGFA 1NENB 4HVBA 2IDYA 4B9KA 4NAWB 3RI7C 1I35A 2WLBA 1OQRA 3PLVA 2KQ4X 3Q14C 3PZ7A 1L2NA 4MACA 3NS8A 1J0GA 3AEAB 2L00B 3URYA 2J42A 3PZDA 4WJNA 1AYFA 1N63A 1E7PB 3OWEB 1KLGD 3OJ3A 1N5XA 1FMAD 2HJ1A 4AS1A 2YEPF 4AJYB 2L83A 4FULA 3KUCB 4C80A 3UQBA 4W9LA 1WE6A 3N1XC 4ARCA 1JCKB 3A9JA 1P98A 1R4MB 3N1ZC 2QCZA 3UINB 3BY4B 4HPLB 3WA0A 4GN1A 4TKNA 2KX0A 4P7IA 3T9LA 1UBQA 2HJ8A 3Q3JA 4LDTB 1WXAA 1YQBA 2ZW1A 4L23A 3VAWA 1EU4A 4EZLA 3AE5B 4M0WA 2LD9A 3E9SA 2WXQA 2QEJC 2ZJDA 2L0TA 4WAAA 4WWOA 1T0SC 3M62B 1ZKHA 3AH7A 3ZDMC 1WSPA 4KGTA 3ZKJC 1V6EA 3LYYA 3APFA 5L95C 1D5ZC 1UH6A 2KLCA 3BYTB 4RGMA 3APCA 3IFWB 4P1CC 3R66C 1NYQA 4MH0E 1X1MA 1T0QC 1XF5L 3K9OB 3DBRB 4LNKA 2XBBC 4RGOS 2BS3B 3BK2A 4F7ZA 3AV8A 3ZNGC 1L4ZB 2PVOD 2G4DB 1HA5A 2V4LA 1WXVA 2N9XA 3Q3MC 2K1FA 3PHWB 2GBRA 2LJIA 3U7DA 5JH5C 4MSQB 5IA7A 5J18A 3Q3NC 1N61A 3QC8B 2KVRA 1EO6A 4EEWA 3M3JA 1TY2A 4JL9A 1GOZA 2SEBD 4X57B 2DLBA 3C0RB 3C8YA 1FXIA 4UDUC 2WDTB 1JWMD 4CO7A 1QLBB 1JRUA 5FR6A 1FRDA 2ZCCA 5IP4D 1GB1A 4ANWA 4DHZB 2NPTB 2M8SA 1FEHA 2D2QA 1J7AA 1WYGA 4EUTA 4F8CB 3QQ8B 4E74A 1RFKA 2EMSA 2IPKD 2O6VD 4K1RB 1ZP0B 2FUG1 4P16A 4S17A 3ZIMA 2WXKA 1HQRD 1RWSA 1UWMA 3R7QA 4WURA 3ZYYX 3JW0X 2MEKA 3ETRA 4LNFA 2LI5A 5T8IA 3EFCA 4K81A 3O65B 2MP2B 2DWQA 1WXQA 1L6VA 4DDGD 1E7VA 2XK5B 2OJWA 4XYCA 5BMIA 3SFEB 3PT2B 1CQVA 3B2FA 2KC2A 3QAQA 4GDKB 4M8MA 2NBWB 2BQQA 2M19A 3T3OA 3I57A 1ET6A 1TT5B 2KVZA 3TEXA 2FCNA 1YD8U 2WXOA 4ZRPA 1FXAA 1WGGA 2MBEA 1TBEA 2NPTA 3DHHC 3V6EB 2JSVX 4OW0A 2XEWA 5DPWA 3DVGX 3AEGB 1IUEA 2KDFB 1L0YB 1V1PB 1T3QA 1SGHA 1KRHA 1R4NB 2AWTA 1FM0D 5LXHA 4IM3A 4PYUA 4TSSA 1GAQB 3KVFB 2QILA 2DBYA 1V81A 1SXTA 2E3TA 5D3DA 2LUMA 1JWUD 1IBXA 4JIOU 1SE2A 2VH1A 3RNCC 1EF1A 4XX5A 2K0PA 2KAJA 2PEAA 1JWAD 3FKYA 1SIFA 3A9KB 2Z0EB 4K7SA 3HM6X 4ZYNA 2EKEC 4C00A 2N9PC 2W3SA 4HKZE 3RULA 3JVZX 2AX5A 3NVVA 3NVWA 2JT4B 3R3MA 2J0MA 4RF0A 1Q0WB 4MELA 2XK5A 1TYGB 1B1ZA 2NTSA 1J7CA 4CQNA 2OHFA 2MA9B 2PVGC 1PYWD 4RMAA 3V62A 2PE6B 3WALA 3CMMB 3KH0A 1YX6B 1R4NI 3GS2A 4IW0A 1YN5A 1MPEA 2JUOA 5BYSA 3TEYA 1L5PA 3KW5B 3ZLZA 3W5VB 3P1MA 2BKFA 2KFKB 3ONSA 4NAWA 4IWPA 1HTOA 3ZW3A 1WX8A 3ZRFA 1PDXA 3R8BA 3DCGA 2LXAA 1CMXB 2WGSA 3QWZB 1WYWB 1N62A 5E6JA 3WCQA 4MGKE 1LXDA 4C4VB 2NR2A 3QX1A 1EWCA 1ZDXA 2RDGA 3ZNID 3NG0A 4DXGA 2Y5CA 3SR6A 5GMVA 2D07B 1XLQA 1SEBD 4A6QA 1RRBA 1TIFA 4FBJB 3JYUA 2TSSA 2ACZB 1L7YA 2HDEA 2ZPNA 2AL3A 4ANUA 5D3IB 4HLEA 3AE3B 2GOWA 3U8ZA 4II3B 3RFZB 5FKAC 4KX6B 2FE8A 3NS1A 4MSMB 1ROEA 4YWGG 4XC2A 3LB8C 1I42A 1LGRA 3N9YC 2KQSA 1TGZB 1XCQL 1XT9B 2N0SB 3ECIA 1OEYJ 1NI2A 3MC9A 4OVUA 4XWTA 2VZKD 2L76A 1V1OA 2DENB 3IHPC 4RGTA 1E0ZA 2LMCA 1XQQA 4L1BA 3AU5A 4AJWA 1JMLA 2WXNA 2J52A 1JWSD 5LXIB 3PVLA 1T5XD 2IGHA 3QCAA 3SHQA 1A5RA 4OZBA 1DGJA 1RYJA 1TKGA 2KN4A 1S3SG 3H9DA 4DHJD 5CX3A 3AE2B 1I4QA 2GRIA 3E56A 3GB1A 2HE7A 3RUIB 2LGXA 3BIID 4MGYE 5IAAC 4TQ1A 1I4GA 4RNAA 5D2MB 3DOWA 3C19A 3UI3A 3LJ3A 3AN1A 2J4XA 1VZ6A 4GU2A 3N1YC 2YVCA 4FJYA 4QAYA 2JF5A 3CSFA 2AYOB 1V1PA 1XXGA 1YN4A 3H6NA 1P7FA 1Z5SB 3I3TB 5BO4B 4KIKA 5EE1A 4A9AA 2WU5B 2KN5A 2M17A 1V5OA 3V3XA 3EUB2 1Y8RC 4DXFA 1WXSA 1I7HA 1R4MI 2W3RA 3QIJA 4YL8A 2GBMA 5JHAA 4HPPA 1VJKA 4D2KA 1L6UA 4L2YA 3IT6B 2MHJA 4LNOA 2MJEA 4BOZB 2AQ2B 2KYWA 2JRIB 5EDSA 5CHVC 3KWLA 2KZRA 3R2IA 2EMTA 1C76A 2L1AA 2MJ3A 2JVCA 3AI5A 4YTMB 2ICIA 2UYZB 2FNJB 4C4VA 4I6LB 2R61A 4BVUC 2K6DB 3L17A 2L8JA 3PREA 4WIPA 4MEMA 4AUQC 3NVYA 4ZDVA 1WH3A 4PK1A 2RSUA 5JZEB 3BYYB 1YQ4B 4NY0A 4ZHPA 2GBJA 2AL6A 2V3SA 2RPVA 4US9A 3DHGC 2J7QB 4HKQA 3VTWA 1K52A 4W9EA 2LVOA 1TY0A 3KLSX 5AUKA 3IAM1 3T8MA 3ZGZA 4OZAA 3BINA 4H2AA 3AEEB 3VHTC 3TEZA 1ZXHA 1DOIA 3AMZA 2K8BA 3GZNI 1K51A 1WR6E 2DHZA 2IY1B 1XO3A 3U4EG 5BMGA 1V2YA 4WAFA 5C23A 1TTNA 4A3PA 2MBQA 2NBVB 1BT0A 1WXMA 5BMHA 1TKYA 4NPNA 4KVGB 1J8CA 1Q1OA 2CJNA 4K7UA 1KOTA 2D3BA 2OJRA 2PW9A 4LJOB 4E71A 1P0RA 1FNVA 2V3NA 2JWUA 1ZDVA 4LNIA 1EU3A 1WJUA 4WWNA 3ZJVA 3O13A 1ZGUB 5KHQA 3A1QA 1MJDA 2AQ1B 1ET9A 4FJVB 1KLUD 1WI0A 2BW2A 2KOXA 4MJSA 3VQIA 2D5GA 1JRPA 2DAFA 3VH4B 1KM7A 2GBNA 1WX9A 4G0NB 4RM8A 4BKSA 1UBIA 3Q6BA 3CWIA 3MTNB 5CTRC 4ACFA 3VFKA 2LRWA 3ZXVA 2MCNB 1KF6B 2PPHA 1I4PA 1OGWA 4KV2A 3B0AA 2PJHA 4JLCA 5LNK1 4O1NA 3RNEC 2L7RA 1T0YA 2L05A 1Q5WB 4BOSC 2MH7A 1NI3A 1YOVB 4MJSB 4W9FA 2KHWB 4KGRA 1BUIC 4ANVA 4JWSC 2J53A 2WDQB 3Q8CA 3EECA 4IKGA 1C4CA 4LK0M 2BB6A 4M0WB 1M94A 2X38A 4MM3B 3RYTA 4J3OD 3OLMD 4WWPA 2RD0A 3LXFA 3OAWA 2KMCA 3NVZA 4DXAB 3QARA 1GPXA 3GOEA 2I1KA 1HEZE 2JYEA 5AZHA 3QK0A 1LO5D 2CHXA 3BWUD 3NZUA 3DWGC 3P4QB 2IJ0A 4ZYSA 4OHJA 3TIXA 1TS3A 5E6NA 2O6VB 1E8WA 1RAXA 2CU3A 3KUZA 3AE4B 3D32A 3OG5A 3B9JA 3H7PB 4EZJA 1WGYA 3RCZA 5IKCM 1IGCA 3VUWA 1VR9A 3RNAC 2KTFA 3ENEA 2WNMA 2JWZA 3APDA 3ZVVA 1VLBA 3AULA 4LJPB 3ZDTA 3ML9A 2XNAC 2REXA 2D3GA 1KH0A 1AN8A 2BYTA 3ZO5B 2IBIB 3CIRB 1WM3A 1WZ3A 4CHKA 5KHOA 3TL5A 2ZCBA 5G2NA 3Q69A 3A9KA 2KMMA 3N30A 4MDKE 4BZAA 4EFOA 4ZOHC 5C3JB 2I1JA 3RN9C 4ICVA 4A20A 2ASQA 1OFFA 1UGMA 1LQBA 1VZ8A 2NBUA 1D6EC 3DPDA 3NY5A 4XGAB 1D5MC 2WWZA 4IWQA 2GI9A 3A9JB 3RT3B 1E5WA 3Q8FA 3DDCB 3ZXRA 2KLGA 3HUIA 2V0GA 5I4DA 2KQ7A 4US8A 2KMAA 2R2QA 4HJKA 3SFDB 2JXXA 4YT0B 1EM7A 3VR8B 2BKRB 2WX1A 2MX2A 2KD0A 4W9JA 3HVZA 4GDLB 5CHFA 3RPFC 3DHIC 4IM2A 2ZW0A 4A3OA 4GIVA 5G55A 5BYQA 1IBXB 3DBRI 2K3UA 1WJ6A 3UGBB 3DBSA 3QHTA 1KJTA 3WANA 1UELA 1V86A 1WGDA 4EKUA 4JX1C 1GC6A 1I4XA 1WGRA 1E90A 1WWTA 3EC8A 3MJWA 4FXCA 2C7MB 2KK8A 1UZXB 2PE9A 3RD2A 2PLPA 4NAMA 3SEBA 1YJJA 2BGFA 2BYFA 4GDLA 2G9HD 2KACA 3L4PA 3X0WA 2FIDA 4GLSC 3AM9A 1FNWA 2PMVA 2LWPA 3TCAA 1WZ0A 2M56B 1QZEA 4BKSD 3S2AA 1ESFA 1UF0A 2C5LC 4I6PA 3VUXA 1GNUA 4EOYA 4TQ0A 4RM9A 3AE1B 3DQVA 1A70A 3I9V1 1ENFA 2ONQA 2N7EA 1M4VA 1FO4A 1CK1A 1GB4A 3QJZA 2LHDA 3SU8X 4KZ0A 2EELA 1FPYA 2L0FA 3A4SC 2BPSA 2A4ZA 2VH2A 1SB3C 2LXCA 2JZZA 1E9MA 1PFDA 1WX7A 4HDOA 4BKGA 1G6JA 2NCNA 3BVMA 2ON8A 5DCNA 3N3KB 2L52A 3A4RA 1AWDA 3TUOA 1YJIA 1XCTL 2LGDA 3NJTA 4Q2JA 3NZ3A 2GBKA 3L10B 1TZ1A 3N32A 2FIFA 2FBWB 3N20C 2N7JA 1P9DU 4N9F4 2DYBA 2RR9A 1N6ZA 1GJZA 1P7EA 3PZ8A 1JROA 4RF1A 4NQKE 3ABVB 5HKHA 3B1LX 4YSXB 5J17A 4USAA 3BK1A 1GG3A 2C9WB 2O6VA 4W9IA 3HM3A 1PUTA 2KFKA 4HCPB 1C79A 1V80A 5H8YE 1QOGA 4XE0A 1WRDB 1IPGA 1U4AA 4G3XB 4N58A 1NEKB 4B0EA 3LDZE 2KDBA 5HHDG 4W9KA 3JSVB 3L08A 3VTUA 5JXVA 5AZGA 4K7WA 1QF6A 4AQ7A 4BFRA 4YTNB 1E7UA 3UIOB 3AEDB 1V8CA 2PTLA 4ANXA 4IUMB 1UNSA 1T6BX 2LASA 3EA6A 4BAXA 3Q3FA 2AQ3B 3ML8A 4AWJA 1SE9A 3AB5A 3WAOA 4DQOC 1DYQA 2BYEA 4KDLB 4W9GA 4OZCA 3FILB 2H89B 4EZKA 4MGZE 2MSED 3U7ZA 4A90A 2BS2B 1D3ZA 3V6CB 4HPMB 2UU7A 1V97A 2JYTA 2WXGA 3ZJUA 5TSSA 4DDID 4OVVA 1RLFA 1VZ7A 3AECB 4GSWA 2OOBB 1SJED 1Z2MA 3P4SB 1CJEA 3PLUA 4M02A 2RDBC 2ZVNA 3VRBB 3AXCA 2G4SA 1H8CA 2B3AA 5C2TB 5AUIA 4YXDB 5L83A 1XD3B 3WAPA 3PS6A 5E6OA 2BT6A 2D3CA 2B76B 2IGDA 4ZRJA 1XLOA 3TBLD 3AE9B 4BKTA 1QOBA 3L16A 2KWDA 2MWSB 1YIWA 3Q8EA 5J2RA 2LFIA 1PGXA 4OVZA 4FHJA 4DK5A 4KSLC 3U2SC 3J9CA 2JZ3B 2KDMA 1QOFA 2WXRA 1VD2A 5IN7A 2ZNVB 3IAS1 2WHIA 5E6PA 5LLIA 1ZE3D 2INDC 4M01A 1GC7A 3AE8B 5HI1A 3A1QB 1OTRB 2JXTA 3H7SA 2IY0B 3I63C 2I38A 3RNBC 4PT5A 3ZRCA 1XLNA 2WS3B 1EF5A 2IO1B 4WJQA 1E8YA 1I4RA 2DZMA 3ZTCA 1E10A 5TR5A 1LM8B 2OEDA 4FLHA 1NDDA 2M4NA 4HRSA 1WJNA 2N9EB 1NVID 3MJ5A 1SE4A 3TSSA 1L4DB 3MHZA 4N59A 1P1AA 1E8ZA 2BB5A 5MPOA 1FNUA 1SSNA 3VR9B 2GMIC 2ZEQA 1DOYA 1KFYB 1TKEA 4W9HA 1WIAA 1SBBB 2G1EA 1HTQA 3V05A 4F1SA 2KTRA 1DOXA 1NYRA 1ZUD2 4A55A 1OQYA 1ACCA 3OJ4B 4C7YA 1K8RB 1K53A 3DVNV 3UQAA 3GE8C 2CJOA 4XDCA 2WXJA 4GOCA 5IOIA 5D7GA 2DZKA 2WXLA 2KWVB 3TEWA 3A33B 4NJCA 1UD7A 1OQQA 3BVGA 2JRHA 1H4RA 3VUYA 2DZJA 4RH6A 2IO2B 2KJ6A 1E8XA 1YN3A 2M1MA 3PPAA 2MBHA 4HCNB 2WDRB 4IG7B 1MG8A 4NZLB 1ZW7A 3MP9A 2WX0A 4NJ7A 1F77A 1BXTA 2QHOA 1SF0A 2BWES 3X23A 5FK9C 3ALBA 2VRRB 4DHZE 1K50A 1MVKA 2LGSA 1FXTB 2J0KA 3PRMB 2O2VA 1TZOA 2SAKA 4MH8A 2AEHA 2KC1A 2LRUA 1FCLA 1EWYC 2O2VB 4WWMA 1STEA 2ZNVC 4DWFA 5G5HA 1MHXA 2MBOA 1MG4A 3NZSA 3P63A 3U30A 3Q8AA 2E6XA 2VZKB 3HHMA 4GGQA 2K5PA 2KDIA 3ZNZB 2KT7A 1F52A 4LDTD 1YNTE 1J7BA 2LVQA 3EHVA 1HXYD 1D4BA 3ZUNA 3ZNHB 3TMPB 1IGDA 2IGGA 3AU4A 1C4PA 2CHZA 3WIMA 2BBCA 2HD5B 5IO9A 3PRZA 5DPSA 3IVFA 2MP2A 2KFJA 1KTKA 2Y5BB 4URKA 1SIJA 3AE7B 4B6WA 1L0XB 3W9CB 4HK2A 5JHBA 4WJOA 1QILA 1TS2A 4GMVA 4IOIE 3PTFC 3DBHB 1BMLC 1QT9A 3DBLB 4BBNF 3FAHA 2ZZPB 1YX5B 3MHSD 3JSVA 5DPRA 2LEKA 4PS3A 4II2B 2WXPA 2Y5PA 1WM2A 1GUAB 2KJRA 2C7HA 1C4AA 2K9XA 2CHWA 5HG2A 4GXBA 2QDFA 2I2YA 1TS5A 2M0XA 2JU6X 2L3ZA 2KKCA 3RMKC 3SDLC 2MLBA 4E3CA 5AEKB 2WQYB 4BBNC 2D3AA 2QIEB 3W1SC 1F9JA 3VRAB 1P3QU 2FAZA 3CF6E 2GB1A 2KX3A 4M00A 1WMHB 1V49A 1UGJA 2RPQA 4IM0A 1SE3A 4PS8A 1E6EB 3R7RA 2JX5A 3RNFC 3W1SA 3SD5A 1FFVA 2C7NB 4ZRQA 2BS4B 4G50A 1QKZA 2D11A 1TS4A 4KKIA 3TJPA 1WF9A 5H92C 3H8HA 2JPHA 2WYQA 2IO0B 1B9RA 2W54A 2WDVB 1NBFC 4MT5A 1PQSA 4S0RA 1YMHE 1C1YB 4HJGE 4TUUA 2M0AA 2DYMA 3IBEA 4FA6A 2HTME 2FCSA 2WU2B 2N1VA 3KQ4A 3HK0A 4XWWA 2D10A 5EE9A 2GLSA 4AOFA 2IZVB 3ZJTA 2JY6A 2L32A 2PKOA 3HVDA 3NRZA 3KYDD 2W9NA 1LFDA 4DHJB 2LVPA 2V4IB 2WXIA 2YEPB 3IG3A 3Q3OC 2C60A 2YLMA 1JALA 2KDEB 4MM3A 4TMAB 3KUDB 5DPTA 5BYRA 2INCC 3V61A 3PO0A 3RZFA 3VH3B 4ZRIA 3AEBB 4DBGA 2MRPA 4CYEA 1PGBA 2K8CA 1ZXIA 1MHHE 1IYFA 1ISNA 4NQLB 3BVZA 3Q2AC 3PHXB 2N4FA 2IYDB 5FR3A 1WMHA 2LUEA 3VXWA 4A8XC 2XN9C 2KO3A 1F0ZA 4NJ6A 1IP9A 2N9KA 2PIAA 4RCOA 1AARA 4W9CA 1D5XC 3GP7A 3MFGA 2QMTA 4PS7A 1YQ3B 1JW9D 3VVWB 4HXDA 2BVCA 1Y56A 4M8NA 4REZA 1N60A 2H88B 2KTRB 4B95A 1OEYA 2W55A 3L54A 5EE0A 1FD6A 3R2TA 1F2RC 1FRRA 2G45B 1YJ1A 3HIZA 2LZ6A 1QOAA 4PYZA 3GZNB 1VCBA 4YSZB 4JE3B 1HZ6A 4JWUC 3VTVA 1CZPA 2Q5WD 2N1WA 2UWQA 1JQ4A 1L0VB 2LHEA 3CSTA 3QA8A 2CKHB 2RDHA 2V3PA 3P4PB 5AZFA 2DX5B 2LGYA 3P42A 1V5TA 4IWOA 1EUVB 3VDZA 2K22A 2CU1A 2NS5A 3BZDB 2QSDA 4ASWC 3Q8BA 2KWCA 1XLPA 2KXJA
chains in the Genus database with same CATH topology
2PJHA 4JLCA 1C3TA 2R2OA 1WGGA 5E6PA 2MBEA 3PGEA 5LLIA 2LJ5A 2L7RA 1TBEA 1T0YA 2NPTA 3V6EB 1GC7A 2L05A 1Q5WB 2XEWA 5DPWA 3A1QB 1OTRB 4BOSC 3B08A 4G11A 4MJSB 2DZIA 3DVGX 3H7SA 4W9FA 2IY0B 2KDFB 2KHWB 4WJPA 3DVGY 1SGHA 4ANVA 1WE7A 2AWTA 3ZRCA 5LXHA 4IM3A 3EECA 4PYUA 1EF5A 2IO1B 4WJQA 1E8YA 4M0WB 1M94A 2DZMA 3ZTCA 5TR5A 3RYTA 3KVFB 1LM8B 2KWUB 4WWPA 3OLMD 2RD0A 4FLHA 1NDDA 3NHEB 4LCDE 1V81A 2M4NA 2KMCA 3OAWA 3PSEB 4DXAB 3QARA 1WJNA 2N9EB 4NNJB 3GOEA 2I1KA 5AZHA 4KDIC 4JIOU 2CR5A 2ZPYA 3QK0A 2CHXA 3NZUA 1P1AA 1E8ZA 1EF1A 3TIXA 3PV1A 5E6NA 2O6VB 1E8WA 4XX5A 1RAXA 3QHTA 4FJZA 3UF8A 3KUZA 3WANA 1KLVA 2BF8B 2K25A 3D32A 2PEAA 3H7PB 4EZJA 2GMIC 1WGYA 3RZWC 1SIFA 2ZEQA 3RCZA 3A9KB 1WJ4A 2IO3B 2Z0EB 2K6QA 4K7SA 3VUWA 3HM6X 2Z59B 3H7PA 2EKEC 2KTFA 3NOBA 4GDKA 4W9HA 4ZYNA 1WY8A 1WIAA 4TV3A 3M63B 2N9PC 3ENEA 4F1SA 3RULA 3JVZX 2KTRA 4FADA 2JWZA 3APDA 5CHWA 3V60A 2JT4B 3ZVVA 3R3MA 1OQYA 2J0MA 2MQJA 3AULA 1Q0WB 2BYVE 3OJ4B 4MELA 4LJPB 3ZDTA 3ML9A 4I6NB 2XK5A 1WR1A 2REXA 3L0WB 2D3GA 1K8RB 1WFYA 4HWIB 2KJHB 2ZVOA 3DVNV 3ZO5B 2IBIB 3UQAA 4W9DA 2MBBB 2CS4A 2MA9B 2Z0DB 1WM3A 1WZ3A 2N7DA 3ZTDA 4CHKA 4GOCA 4RMAA 5D7GA 1S1QB 2KANA 3V62A 2PE6B 5KHOA 3WALA 2DZKA 3TL5A 2ZCBA 3CMMB 2KWVB 5G2NA 3A33B 3KH0A 1YX6B 4WQOB 1R4NI 3A9KA 4IW0A 1UD7A 3N30A 4MDKE 2JUOA 2JRHA 1H4RA 3VUYA 4EFOA 2DZJA 3KW5B 5D94A 3ZLZA 5D6JB 2IO2B 2BKFA 2I1JA 1WGHA 2KJ6A 4ICVA 2KFKB 1E8XA 3ONSA 4A20A 2ASQA 4NAWA 4IWPA 1UGMA 1LQBA 2M1MA 3EFUA 3PPAA 2MBHA 3ZW3A 2NBUA 1WX8A 3DPDA 3PRPB 4AP4C 3DBHI 3NY5A 4HCNB 3ZRFA 2WWZA 4IG7B 1MG8A 2FUHB 1ZW7A 3DCGA 2LXAA 1CMXB 3DVNU 4IWQA 4XZ4A 2WX0A 3A9JB 3QWZB 4FHKA 1E5WA 2G3QB 1WYWB 4IC7B 3RT3B 4NJ7A 1HE8A 3DDCB 2K39A 1V9JA 4MGKE 1LXDA 2QHOA 2KLGA 2NR2A 3QX1A 3P2BA 4ICUA 3ZNID 2KQ7A 2J0JA 2KMAA 2R2QA 4HJKA 2BWES 2D07B 2KNBA 5GMVA 3X23A 2JXXA 2MW5A 3ALBA 2BKRB 2FCMA 2WX1A 2MX2A 2KD0A 4W9JA 1RRBA 2VRRB 4DHZE 4GDLB 2DAJA 3JYUA 4FBJB 1FXTB 5CHFA 2J0KA 3PRMB 1L7YA 2O2VA 2ZPNA 4FN2A 2AEHA 2AL3A 2FCQA 2KC1A 2LRUA 4IM2A 4ANUA 4HLEA 3L13A 3DBLI 4J6IA 4A3OA 2GOWA 2O2VB 4GIVA 3U8ZA 5C1ZA 4II3B 3KYCD 5G55A 2ZNVC 4KIKB 4JGHB 3DBRI 4DWFA 4MSMB 2MBOA 4XC2A 3NZSA 2V1YA 1I42A 3W1YA 1WJ6A 2KQSA 3U30A 1TGZB 1XT9B 3UGBB 3DBSA 3ECIA 4KSKC 1J19A 1KJTA 1NI2A 1OEYJ 1UELA 2BWFA 3HHMA 1V86A 3M95A 1WGDA 4GGQA 4MGIE 4OVUA 2KDIA 3ZNZB 4EKUA 1GC6A 1WGRA 2L76A 4ZRKA 4LDTD 1E90A 2LVQA 3EHVA 2DENB 2HTHA 4GB9A 3ZUNA 3IHPC 3ZNHB 3EC8A 3TMPB 4HDQA 3AU4A 4JQWC 2CHZA 3H1UA 2DYOA 3WIMA 2NVUI 3MJWA 2HD5B 3UIPB 2C7MB 2KK8A 3PRZA 5DPSA 3IVFA 2A5UA 1RFAA 1UZXB 3WAMA 3K9PB 4KZCA 2MP2A 2PE9A 2KFJA 3RD2A 1XQQA 2Y5BB 2K8HA 2RGFA 4HVBA 4URKA 2BGFA 2BYFA 3AU5A 4AJWA 4NAWB 4B6WA 4B9KA 5LXIB 4GDLA 3PVLA 3X0WA 4HK2A 3QCAA 3SHQA 2FIDA 5JHBA 1A5RA 1I35A 3PLVA 2LWPA 4WJOA 3TCAA 1WZ0A 4GMVA 1L2NA 3NS8A 1J0GA 3PTFC 1QZEA 4BBNF 2L00B 4BKSD 3S2AA 1S3SG 2ZZPB 1YX5B 3MHSD 3H9DA 3JSVA 5DPRA 5CX3A 4DHJD 3PZDA 2C5LC 4I6PA 4WJNA 4II2B 4PS3A 3VUXA 1GNUA 4EOYA 4TQ0A 2HE7A 4RM9A 3DQVA 3RUIB 1WM2A 3OJ3A 1GUAB 2KJRA 2LGXA 4MGYE 2C7HA 5IAAC 4TQ1A 2CHWA 2N7EA 5D2MB 3DOWA 4AJYB 4FULA 3QJZA 3LJ3A 4GXBA 3KUCB 3SU8X 4KZ0A 3UQBA 4W9LA 4GU2A 2L0FA 1WE6A 2YVCA 4FJYA 2M0XA 3A4SC 2BPSA 2L3ZA 2A4ZA 2JF5A 3A9JA 3CSFA 2AYOB 2KKCA 2LXCA 1P98A 3SDLC 2JZZA 2MLBA 4E3CA 3H6NA 1Z5SB 3I3TB 5AEKB 1WX7A 4HDOA 3UINB 4BKGA 1G6JA 2NCNA 5BO4B 4BBNC 3BY4B 5DCNA 3N3KB 4KIKA 3A4RA 3W1SC 1F9JA 1P3QU 2KN5A 2LGDA 4HPLB 3WA0A 2FAZA 2M17A 3CF6E 4GN1A 4TKNA 1V5OA 2KX0A 4P7IA 2KX3A 3T9LA 1UBQA 2GBKA 1WMHB 2HJ8A 3Q3JA 4LDTB 1WXAA 1V49A 1Y8RC 1YQBA 2RPQA 4IM0A 4PS8A 3L10B 3R7RA 3VAWA 1WXSA 3W1SA 1TZ1A 3SD5A 1R4MI 3QIJA 3N32A 2FIFA 4YL8A 2GBMA 4EZLA 5JHAA 2C7NB 4G50A 2LD9A 2D11A 1P9DU 4N9F4 2DYBA 2RR9A 3TJPA 2ZJDA 1GJZA 1WF9A 4BOZB 2JPHA 2L0TA 2WYQA 4WAAA 2IO0B 2JRIB 5EDSA 4NQKE 4WWOA 5HKHA 1NBFC 5CHVC 3M62B 1ZKHA 2KZRA 3ZDMC 3B1LX 5J17A 2EMTA 1PQSA 3ZKJC 1V6EA 1C1YB 1GG3A 2JVCA 2C9WB 2O6VA 3AI5A 3APFA 4W9IA 4TUUA 5L95C 1UH6A 2KLCA 3HM3A 2DYMA 3IBEA 2UYZB 2FNJB 4FA6A 4I6LB 3APCA 4BVUC 2KFKA 3IFWB 4HCPB 3R66C 2K6DB 4MH0E 1V80A 1X1MA 2FCSA 3L17A 2L8JA 3K9OB 3PREA 4MEMA 4AUQC 2N1VA 1WH3A 1WRDB 4ZDVA 2XBBC 1IPGA 2RSUA 1U4AA 4G3XB 3HK0A 2D10A 3LDZE 5JZEB 4NY0A 2KDBA 4AOFA 2IZVB 4W9KA 3JSVB 3L08A 3ZNGC 4F7ZA 3VTUA 5AZGA 2GBJA 2AL6A 2JY6A 4K7WA 2G4DB 2V3SA 3KYDD 2V4LA 4BFRA 1WXVA 1E7UA 1LFDA 2J7QB 2LVPA 2N9XA 2W9NA 3VTWA 2K1FA 3PHWB 2GBRA 3U7DA 5JH5C 4MSQB 3IG3A 3UIOB 5IA7A 5J18A 4W9EA 2C60A 3QC8B 2YLMA 2KVRA 1EO6A 2LVOA 2KDEB 4MM3A 3KUDB 5DPTA 4ANXA 4IUMB 4EEWA 3V61A 2LASA 3M3JA 3Q3FA 3RZFA 3VH3B 4JL9A 4ZRIA 3T8MA 4X57B 3C0RB 3ML8A 2WDTB 4AWJA 4DBGA 3BINA 1SE9A 2MRPA 3WAOA 4CYEA 2K8CA 3VHTC 4CO7A 2BYEA 4KDLB 4W9GA 1JRUA 5FR6A 4EZKA 4MGZE 2MSED 2ZCCA 1ISNA 4NQLB 1IYFA 4ANWA 2K8BA 3GZNI 4DHZB 2NPTB 1WR6E 2DHZA 2IY1B 3PHXB 4DHJB 2N4FA 2IYDB 1D3ZA 1V2YA 2M8SA 3V6CB 2D2QA 4EUTA 1WMHA 2LUEA 4HPMB 5C23A 1TTNA 3VXWA 4A3PA 2MBQA 2NBVB 1BT0A 4F8CB 3QQ8B 1WXMA 4E74A 2KO3A 4OVVA 1RLFA 4NPNA 4DDID 2EMSA 2O6VD 4KVGB 4GSWA 2OOBB 4K1RB 4NJ6A 1IP9A 1J8CA 1AARA 1Q1OA 1Z2MA 4W9CA 3ZIMA 4K7UA 1KOTA 2OJRA 4LJOB 3R7QA 4PS7A 3PLUA 4E71A 2ZVNA 3JW0X 4HXDA 1P0RA 3AXCA 3VVWB 2G4SA 1H8CA 4M8NA 2B3AA 2KTRB 2LI5A 5L83A 4B95A 4K81A 1OEYA 1XD3B 3L54A 1WJUA 3O65B 4WWNA 3WAPA 2MP2B 2G45B 3PS6A 1YJ1A 3HIZA 2LZ6A 4PYZA 5E6OA 4DDGD 1ZGUB 5KHQA 1VCBA 3A1QA 1E7VA 2XK5B 4FJVB 1WI0A 4ZRJA 2KOXA 3VTVA 3TBLD 2N1WA 2UWQA 4MJSA 3VQIA 4BKTA 2DAFA 3L16A 3CSTA 3QA8A 2CKHB 3VH4B 1KM7A 2MWSB 3PT2B 2GBNA 1YIWA 1WX9A 5J2RA 4G0NB 4RM8A 5AZFA 4BKSA 1UBIA 2DX5B 4FHJA 4DK5A 2KC2A 2LGYA 1V5TA 4IWOA 1EUVB 3QAQA 3MTNB 4GDKB 4KSLC 4M8MA 3VDZA 2NBWB 5CTRC 2CU1A 2NS5A 3VFKA 2LRWA 2JZ3B 4ASWC 2MCNB 1VD2A 2KWCA 2PPHA 2KXJA 2FCNA 2ZNVB 1OGWA 4KV2A 1YD8U 3B0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJH A;  4JLC A;  1C3T A;  2R2O A;  1WGG A;  5E6P A;  2MBE A;  3PGE A;  5LLI A;  2LJ5 A;  2L7R A;  1TBE A;  1T0Y A;  2NPT A;  3V6E B;  1GC7 A;  2L05 A;  1Q5W B;  2XEW A;  5DPW A;  3A1Q B;  1OTR B;  4BOS C;  3B08 A;  4G11 A;  4MJS B;  2DZI A;  3DVG X;  3H7S A;  4W9F A;  2IY0 B;  2KDF B;  2KHW B;  4WJP A;  3DVG Y;  1SGH A;  4ANV A;  1WE7 A;  2AWT A;  3ZRC A;  5LXH A;  4IM3 A;  3EEC A;  4PYU A;  1EF5 A;  2IO1 B;  4WJQ A;  1E8Y A;  4M0W B;  1M94 A;  2DZM A;  3ZTC A;  5TR5 A;  3RYT A;  3KVF B;  1LM8 B;  2KWU B;  4WWP A;  3OLM D;  2RD0 A;  4FLH A;  1NDD A;  3NHE B;  4LCD E;  1V81 A;  2M4N A;  2KMC A;  3OAW A;  3PSE B;  4DXA B;  3QAR A;  1WJN A;  2N9E B;  4NNJ B;  3GOE A;  2I1K A;  5AZH A;  4KDI C;  4JIO U;  2CR5 A;  2ZPY A;  3QK0 A;  2CHX A;  3NZU A;  1P1A A;  1E8Z A;  1EF1 A;  3TIX A;  3PV1 A;  5E6N A;  2O6V B;  1E8W A;  4XX5 A;  1RAX A;  3QHT A;  4FJZ A;  3UF8 A;  3KUZ A;  3WAN A;  1KLV A;  2BF8 B;  2K25 A;  3D32 A;  2PEA A;  3H7P B;  4EZJ A;  2GMI C;  1WGY A;  3RZW C;  1SIF A;  2ZEQ A;  3RCZ A;  3A9K B;  1WJ4 A;  2IO3 B;  2Z0E B;  2K6Q A;  4K7S A;  3VUW A;  3HM6 X;  2Z59 B;  3H7P A;  2EKE C;  2KTF A;  3NOB A;  4GDK A;  4W9H A;  4ZYN A;  1WY8 A;  1WIA A;  4TV3 A;  3M63 B;  2N9P C;  3ENE A;  4F1S A;  3RUL A;  3JVZ X;  2KTR A;  4FAD A;  2JWZ A;  3APD A;  5CHW A;  3V60 A;  2JT4 B;  3ZVV A;  3R3M A;  1OQY A;  2J0M A;  2MQJ A;  3AUL A;  1Q0W B;  2BYV E;  3OJ4 B;  4MEL A;  4LJP B;  3ZDT A;  3ML9 A;  4I6N B;  2XK5 A;  1WR1 A;  2REX A;  3L0W B;  2D3G A;  1K8R B;  1WFY A;  4HWI B;  2KJH B;  2ZVO A;  3DVN V;  3ZO5 B;  2IBI B;  3UQA A;  4W9D A;  2MBB B;  2CS4 A;  2MA9 B;  2Z0D B;  1WM3 A;  1WZ3 A;  2N7D A;  3ZTD A;  4CHK A;  4GOC A;  4RMA A;  5D7G A;  1S1Q B;  2KAN A;  3V62 A;  2PE6 B;  5KHO A;  3WAL A;  2DZK A;  3TL5 A;  2ZCB A;  3CMM B;  2KWV B;  5G2N A;  3A33 B;  3KH0 A;  1YX6 B;  4WQO B;  1R4N I;  3A9K A;  4IW0 A;  1UD7 A;  3N30 A;  4MDK E;  2JUO A;  2JRH A;  1H4R A;  3VUY A;  4EFO A;  2DZJ A;  3KW5 B;  5D94 A;  3ZLZ A;  5D6J B;  2IO2 B;  2BKF A;  2I1J A;  1WGH A;  2KJ6 A;  4ICV A;  2KFK B;  1E8X A;  3ONS A;  4A20 A;  2ASQ A;  4NAW A;  4IWP A;  1UGM A;  1LQB A;  2M1M A;  3EFU A;  3PPA A;  2MBH A;  3ZW3 A;  2NBU A;  1WX8 A;  3DPD A;  3PRP B;  4AP4 C;  3DBH I;  3NY5 A;  4HCN B;  3ZRF A;  2WWZ A;  4IG7 B;  1MG8 A;  2FUH B;  1ZW7 A;  3DCG A;  2LXA A;  1CMX B;  3DVN U;  4IWQ A;  4XZ4 A;  2WX0 A;  3A9J B;  3QWZ B;  4FHK A;  1E5W A;  2G3Q B;  1WYW B;  4IC7 B;  3RT3 B;  4NJ7 A;  1HE8 A;  3DDC B;  2K39 A;  1V9J A;  4MGK E;  1LXD A;  2QHO A;  2KLG A;  2NR2 A;  3QX1 A;  3P2B A;  4ICU A;  3ZNI D;  2KQ7 A;  2J0J A;  2KMA A;  2R2Q A;  4HJK A;  2BWE S;  2D07 B;  2KNB A;  5GMV A;  3X23 A;  2JXX A;  2MW5 A;  3ALB A;  2BKR B;  2FCM A;  2WX1 A;  2MX2 A;  2KD0 A;  4W9J A;  1RRB A;  2VRR B;  4DHZ E;  4GDL B;  2DAJ A;  3JYU A;  4FBJ B;  1FXT B;  5CHF A;  2J0K A;  3PRM B;  1L7Y A;  2O2V A;  2ZPN A;  4FN2 A;  2AEH A;  2AL3 A;  2FCQ A;  2KC1 A;  2LRU A;  4IM2 A;  4ANU A;  4HLE A;  3L13 A;  3DBL I;  4J6I A;  4A3O A;  2GOW A;  2O2V B;  4GIV A;  3U8Z A;  5C1Z A;  4II3 B;  3KYC D;  5G55 A;  2ZNV C;  4KIK B;  4JGH B;  3DBR I;  4DWF A;  4MSM B;  2MBO A;  4XC2 A;  3NZS A;  2V1Y A;  1I42 A;  3W1Y A;  1WJ6 A;  2KQS A;  3U30 A;  1TGZ B;  1XT9 B;  3UGB B;  3DBS A;  3ECI A;  4KSK C;  1J19 A;  1KJT A;  1NI2 A;  1OEY J;  1UEL A;  2BWF A;  3HHM A;  1V86 A;  3M95 A;  1WGD A;  4GGQ A;  4MGI E;  4OVU A;  2KDI A;  3ZNZ B;  4EKU A;  1GC6 A;  1WGR A;  2L76 A;  4ZRK A;  4LDT D;  1E90 A;  2LVQ A;  3EHV A;  2DEN B;  2HTH A;  4GB9 A;  3ZUN A;  3IHP C;  3ZNH B;  3EC8 A;  3TMP B;  4HDQ A;  3AU4 A;  4JQW C;  2CHZ A;  3H1U A;  2DYO A;  3WIM A;  2NVU I;  3MJW A;  2HD5 B;  3UIP B;  2C7M B;  2KK8 A;  3PRZ A;  5DPS A;  3IVF A;  2A5U A;  1RFA A;  1UZX B;  3WAM A;  3K9P B;  4KZC A;  2MP2 A;  2PE9 A;  2KFJ A;  3RD2 A;  1XQQ A;  2Y5B B;  2K8H A;  2RGF A;  4HVB A;  4URK A;  2BGF A;  2BYF A;  3AU5 A;  4AJW A;  4NAW B;  4B6W A;  4B9K A;  5LXI B;  4GDL A;  3PVL A;  3X0W A;  4HK2 A;  3QCA A;  3SHQ A;  2FID A;  5JHB A;  1A5R A;  1I35 A;  3PLV A;  2LWP A;  4WJO A;  3TCA A;  1WZ0 A;  4GMV A;  1L2N A;  3NS8 A;  1J0G A;  3PTF C;  1QZE A;  4BBN F;  2L00 B;  4BKS D;  3S2A A;  1S3S G;  2ZZP B;  1YX5 B;  3MHS D;  3H9D A;  3JSV A;  5DPR A;  5CX3 A;  4DHJ D;  3PZD A;  2C5L C;  4I6P A;  4WJN A;  4II2 B;  4PS3 A;  3VUX A;  1GNU A;  4EOY A;  4TQ0 A;  2HE7 A;  4RM9 A;  3DQV A;  3RUI B;  1WM2 A;  3OJ3 A;  1GUA B;  2KJR A;  2LGX A;  4MGY E;  2C7H A;  5IAA C;  4TQ1 A;  2CHW A;  2N7E A;  5D2M B;  3DOW A;  4AJY B;  4FUL A;  3QJZ A;  3LJ3 A;  4GXB A;  3KUC B;  3SU8 X;  4KZ0 A;  3UQB A;  4W9L A;  4GU2 A;  2L0F A;  1WE6 A;  2YVC A;  4FJY A;  2M0X A;  3A4S C;  2BPS A;  2L3Z A;  2A4Z A;  2JF5 A;  3A9J A;  3CSF A;  2AYO B;  2KKC A;  2LXC A;  1P98 A;  3SDL C;  2JZZ A;  2MLB A;  4E3C A;  3H6N A;  1Z5S B;  3I3T B;  5AEK B;  1WX7 A;  4HDO A;  3UIN B;  4BKG A;  1G6J A;  2NCN A;  5BO4 B;  4BBN C;  3BY4 B;  5DCN A;  3N3K B;  4KIK A;  3A4R A;  3W1S C;  1F9J A;  1P3Q U;  2KN5 A;  2LGD A;  4HPL B;  3WA0 A;  2FAZ A;  2M17 A;  3CF6 E;  4GN1 A;  4TKN A;  1V5O A;  2KX0 A;  4P7I A;  2KX3 A;  3T9L A;  1UBQ A;  2GBK A;  1WMH B;  2HJ8 A;  3Q3J A;  4LDT B;  1WXA A;  1V49 A;  1Y8R C;  1YQB A;  2RPQ A;  4IM0 A;  4PS8 A;  3L10 B;  3R7R A;  3VAW A;  1WXS A;  3W1S A;  1TZ1 A;  3SD5 A;  1R4M I;  3QIJ A;  3N32 A;  2FIF A;  4YL8 A;  2GBM A;  4EZL A;  5JHA A;  2C7N B;  4G50 A;  2LD9 A;  2D11 A;  1P9D U;  4N9F 4;  2DYB A;  2RR9 A;  3TJP A;  2ZJD A;  1GJZ A;  1WF9 A;  4BOZ B;  2JPH A;  2L0T A;  2WYQ A;  4WAA A;  2IO0 B;  2JRI B;  5EDS A;  4NQK E;  4WWO A;  5HKH A;  1NBF C;  5CHV C;  3M62 B;  1ZKH A;  2KZR A;  3ZDM C;  3B1L X;  5J17 A;  2EMT A;  1PQS A;  3ZKJ C;  1V6E A;  1C1Y B;  1GG3 A;  2JVC A;  2C9W B;  2O6V A;  3AI5 A;  3APF A;  4W9I A;  4TUU A;  5L95 C;  1UH6 A;  2KLC A;  3HM3 A;  2DYM A;  3IBE A;  2UYZ B;  2FNJ B;  4FA6 A;  4I6L B;  3APC A;  4BVU C;  2KFK A;  3IFW B;  4HCP B;  3R66 C;  2K6D B;  4MH0 E;  1V80 A;  1X1M A;  2FCS A;  3L17 A;  2L8J A;  3K9O B;  3PRE A;  4MEM A;  4AUQ C;  2N1V A;  1WH3 A;  1WRD B;  4ZDV A;  2XBB C;  1IPG A;  2RSU A;  1U4A A;  4G3X B;  3HK0 A;  2D10 A;  3LDZ E;  5JZE B;  4NY0 A;  2KDB A;  4AOF A;  2IZV B;  4W9K A;  3JSV B;  3L08 A;  3ZNG C;  4F7Z A;  3VTU A;  5AZG A;  2GBJ A;  2AL6 A;  2JY6 A;  4K7W A;  2G4D B;  2V3S A;  3KYD D;  2V4L A;  4BFR A;  1WXV A;  1E7U A;  1LFD A;  2J7Q B;  2LVP A;  2N9X A;  2W9N A;  3VTW A;  2K1F A;  3PHW B;  2GBR A;  3U7D A;  5JH5 C;  4MSQ B;  3IG3 A;  3UIO B;  5IA7 A;  5J18 A;  4W9E A;  2C60 A;  3QC8 B;  2YLM A;  2KVR A;  1EO6 A;  2LVO A;  2KDE B;  4MM3 A;  3KUD B;  5DPT A;  4ANX A;  4IUM B;  4EEW A;  3V61 A;  2LAS A;  3M3J A;  3Q3F A;  3RZF A;  3VH3 B;  4JL9 A;  4ZRI A;  3T8M A;  4X57 B;  3C0R B;  3ML8 A;  2WDT B;  4AWJ A;  4DBG A;  3BIN A;  1SE9 A;  2MRP A;  3WAO A;  4CYE A;  2K8C A;  3VHT C;  4CO7 A;  2BYE A;  4KDL B;  4W9G A;  1JRU A;  5FR6 A;  4EZK A;  4MGZ E;  2MSE D;  2ZCC A;  1ISN A;  4NQL B;  1IYF A;  4ANW A;  2K8B A;  3GZN I;  4DHZ B;  2NPT B;  1WR6 E;  2DHZ A;  2IY1 B;  3PHX B;  4DHJ B;  2N4F A;  2IYD B;  1D3Z A;  1V2Y A;  2M8S A;  3V6C B;  2D2Q A;  4EUT A;  1WMH A;  2LUE A;  4HPM B;  5C23 A;  1TTN A;  3VXW A;  4A3P A;  2MBQ A;  2NBV B;  1BT0 A;  4F8C B;  3QQ8 B;  1WXM A;  4E74 A;  2KO3 A;  4OVV A;  1RLF A;  4NPN A;  4DDI D;  2EMS A;  2O6V D;  4KVG B;  4GSW A;  2OOB B;  4K1R B;  4NJ6 A;  1IP9 A;  1J8C A;  1AAR A;  1Q1O A;  1Z2M A;  4W9C A;  3ZIM A;  4K7U A;  1KOT A;  2OJR A;  4LJO B;  3R7Q A;  4PS7 A;  3PLU A;  4E71 A;  2ZVN A;  3JW0 X;  4HXD A;  1P0R A;  3AXC A;  3VVW B;  2G4S A;  1H8C A;  4M8N A;  2B3A A;  2KTR B;  2LI5 A;  5L83 A;  4B95 A;  4K81 A;  1OEY A;  1XD3 B;  3L54 A;  1WJU A;  3O65 B;  4WWN A;  3WAP A;  2MP2 B;  2G45 B;  3PS6 A;  1YJ1 A;  3HIZ A;  2LZ6 A;  4PYZ A;  5E6O A;  4DDG D;  1ZGU B;  5KHQ A;  1VCB A;  3A1Q A;  1E7V A;  2XK5 B;  4FJV B;  1WI0 A;  4ZRJ A;  2KOX A;  3VTV A;  3TBL D;  2N1W A;  2UWQ A;  4MJS A;  3VQI A;  4BKT A;  2DAF A;  3L16 A;  3CST A;  3QA8 A;  2CKH B;  3VH4 B;  1KM7 A;  2MWS B;  3PT2 B;  2GBN A;  1YIW A;  1WX9 A;  5J2R A;  4G0N B;  4RM8 A;  5AZF A;  4BKS A;  1UBI A;  2DX5 B;  4FHJ A;  4DK5 A;  2KC2 A;  2LGY A;  1V5T A;  4IWO A;  1EUV B;  3QAQ A;  3MTN B;  4GDK B;  4KSL C;  4M8M A;  3VDZ A;  2NBW B;  5CTR C;  2CU1 A;  2NS5 A;  3VFK A;  2LRW A;  2JZ3 B;  4ASW C;  2MCN B;  1VD2 A;  2KWC A;  2PPH A;  2KXJ A;  2FCN A;  2ZNV B;  1OGW A;  4KV2 A;  1YD8 U;  3B0A A; 
#chains in the Genus database with same CATH topology
 4ZHO A;  1C3T A;  2R2O A;  1ZOY B;  2DNF A;  3PGE A;  2LJ5 A;  2NMQ A;  3ZQ4 A;  1F2R I;  5GXG B;  4KGS A;  2Y3A A;  3B08 A;  4G11 A;  2DZI A;  1TJE A;  1T0R C;  1FCC C;  3DVG Y;  4WJP A;  4XDD A;  2JZP A;  3FIL A;  1WE7 A;  3W5U B;  1Q10 A;  2NTT A;  1F1H A;  2KWU B;  3IXS A;  3NHE B;  4LCD E;  1C9F A;  3PSE B;  1UWX A;  1UUP A;  5G5G A;  4K3C A;  4NNJ B;  1QQR A;  4KDI C;  2X8X X;  2CR5 A;  2QC8 A;  2ZPY A;  1N5W A;  4LTU A;  2BTE A;  3PV1 A;  1C77 A;  1VDV A;  4ITK A;  3UF8 A;  4FJZ A;  4KKJ A;  2WP9 B;  1KLV A;  2BF8 B;  2K25 A;  3RZW C;  1WJ4 A;  2IO3 B;  2K6Q A;  2Z59 B;  3H7P A;  3NOB A;  4GDK A;  1WY8 A;  4TV3 A;  4YSY B;  3M63 B;  2WXM A;  3IT4 B;  4HEA 1;  2LGI A;  3AE6 B;  4FAD A;  3T3N A;  5CHW A;  3V60 A;  2MQJ A;  2BYV E;  4LNN A;  4I6N B;  1WR1 A;  3L0W B;  1WFY A;  4HWI B;  2KJH B;  2ZVO A;  4WH4 A;  1RM6 C;  4W9D A;  2MBB B;  4N6E B;  2CS4 A;  1MFW A;  2Z0D B;  3I5J C;  4YTP B;  2N7D A;  3ZTD A;  1S1Q B;  2KAN A;  3DWM A;  4RFB A;  1WRI A;  2JQR B;  2WXH A;  4WQO B;  3KWV A;  1FFU A;  4WQM A;  4IDI A;  5D94 A;  5D6J B;  1WGK A;  3P4R B;  1WGH A;  1R7S A;  2V9H A;  3EFU A;  4R3D A;  3PRP B;  4AP4 C;  3DBH I;  4EE2 A;  4HRO A;  4P1B C;  3EGR A;  2FUH B;  1PGA A;  4RGN A;  3DVN U;  4XZ4 A;  5EE3 A;  4IC7 B;  4FHK A;  2G3Q B;  4C56 C;  1HE8 A;  3AEF B;  3MC0 B;  4K3B A;  2K39 A;  1V9J A;  2W82 A;  3GE3 C;  3P2B A;  1ZPS A;  4ICU A;  2QJL A;  3NUH B;  2J0J A;  1C78 A;  2KNB A;  4ARI A;  2MW5 A;  1FIQ A;  2FCM A;  1SJH D;  2Z8L A;  1I4H A;  2N9L A;  1VRA B;  2RMM A;  1AW7 A;  2MJD A;  4JPS A;  2DAJ A;  1HZ5 A;  4FN2 A;  2FCQ A;  3L13 A;  3DBL I;  4J6I A;  5C1Z A;  2INP E;  3KYC D;  4LLG M;  2WXF A;  3W2D A;  4KIK B;  4JGH B;  3RNG C;  2V1Y A;  3W1Y A;  1MI0 A;  4KSK C;  1J19 A;  2BWF A;  4MGI E;  3M95 A;  4P6V F;  2INN E;  4C7Z A;  4ZRK A;  4B0M A;  1JWB D;  3HRD D;  2HTH A;  4GB9 A;  3U52 E;  3B2G A;  4HDQ A;  4JQW C;  3H1U A;  2DYO A;  2NVU I;  3MC8 A;  3UIP B;  5HFY A;  2A5U A;  2EKI A;  1RFA A;  3WAM A;  3K9P B;  3FC4 A;  4KZC A;  1XEE A;  2K8H A;  2RGF A;  1NEN B;  4HVB A;  2IDY A;  4B9K A;  4NAW B;  3RI7 C;  1I35 A;  2WLB A;  1OQR A;  3PLV A;  2KQ4 X;  3Q14 C;  3PZ7 A;  1L2N A;  4MAC A;  3NS8 A;  1J0G A;  3AEA B;  2L00 B;  3URY A;  2J42 A;  3PZD A;  4WJN A;  1AYF A;  1N63 A;  1E7P B;  3OWE B;  1KLG D;  3OJ3 A;  1N5X A;  1FMA D;  2HJ1 A;  4AS1 A;  2YEP F;  4AJY B;  2L83 A;  4FUL A;  3KUC B;  4C80 A;  3UQB A;  4W9L A;  1WE6 A;  3N1X C;  4ARC A;  1JCK B;  3A9J A;  1P98 A;  1R4M B;  3N1Z C;  2QCZ A;  3UIN B;  3BY4 B;  4HPL B;  3WA0 A;  4GN1 A;  4TKN A;  2KX0 A;  4P7I A;  3T9L A;  1UBQ A;  2HJ8 A;  3Q3J A;  4LDT B;  1WXA A;  1YQB A;  2ZW1 A;  4L23 A;  3VAW A;  1EU4 A;  4EZL A;  3AE5 B;  4M0W A;  2LD9 A;  3E9S A;  2WXQ A;  2QEJ C;  2ZJD A;  2L0T A;  4WAA A;  4WWO A;  1T0S C;  3M62 B;  1ZKH A;  3AH7 A;  3ZDM C;  1WSP A;  4KGT A;  3ZKJ C;  1V6E A;  3LYY A;  3APF A;  5L95 C;  1D5Z C;  1UH6 A;  2KLC A;  3BYT B;  4RGM A;  3APC A;  3IFW B;  4P1C C;  3R66 C;  1NYQ A;  4MH0 E;  1X1M A;  1T0Q C;  1XF5 L;  3K9O B;  3DBR B;  4LNK A;  2XBB C;  4RGO S;  2BS3 B;  3BK2 A;  4F7Z A;  3AV8 A;  3ZNG C;  1L4Z B;  2PVO D;  2G4D B;  1HA5 A;  2V4L A;  1WXV A;  2N9X A;  3Q3M C;  2K1F A;  3PHW B;  2GBR A;  2LJI A;  3U7D A;  5JH5 C;  4MSQ B;  5IA7 A;  5J18 A;  3Q3N C;  1N61 A;  3QC8 B;  2KVR A;  1EO6 A;  4EEW A;  3M3J A;  1TY2 A;  4JL9 A;  1GOZ A;  2SEB D;  4X57 B;  2DLB A;  3C0R B;  3C8Y A;  1FXI A;  4UDU C;  2WDT B;  1JWM D;  4CO7 A;  1QLB B;  1JRU A;  5FR6 A;  1FRD A;  2ZCC A;  5IP4 D;  1GB1 A;  4ANW A;  4DHZ B;  2NPT B;  2M8S A;  1FEH A;  2D2Q A;  1J7A A;  1WYG A;  4EUT A;  4F8C B;  3QQ8 B;  4E74 A;  1RFK A;  2EMS A;  2IPK D;  2O6V D;  4K1R B;  1ZP0 B;  2FUG 1;  4P16 A;  4S17 A;  3ZIM A;  2WXK A;  1HQR D;  1RWS A;  1UWM A;  3R7Q A;  4WUR A;  3ZYY X;  3JW0 X;  2MEK A;  3ETR A;  4LNF A;  2LI5 A;  5T8I A;  3EFC A;  4K81 A;  3O65 B;  2MP2 B;  2DWQ A;  1WXQ A;  1L6V A;  4DDG D;  1E7V A;  2XK5 B;  2OJW A;  4XYC A;  5BMI A;  3SFE B;  3PT2 B;  1CQV A;  3B2F A;  2KC2 A;  3QAQ A;  4GDK B;  4M8M A;  2NBW B;  2BQQ A;  2M19 A;  3T3O A;  3I57 A;  1ET6 A;  1TT5 B;  2KVZ A;  3TEX A;  2FCN A;  1YD8 U;  2WXO A;  4ZRP A;  1FXA A;  1WGG A;  2MBE A;  1TBE A;  2NPT A;  3DHH C;  3V6E B;  2JSV X;  4OW0 A;  2XEW A;  5DPW A;  3DVG X;  3AEG B;  1IUE A;  2KDF B;  1L0Y B;  1V1P B;  1T3Q A;  1SGH A;  1KRH A;  1R4N B;  2AWT A;  1FM0 D;  5LXH A;  4IM3 A;  4PYU A;  4TSS A;  1GAQ B;  3KVF B;  2QIL A;  2DBY A;  1V81 A;  1SXT A;  2E3T A;  5D3D A;  2LUM A;  1JWU D;  1IBX A;  4JIO U;  1SE2 A;  2VH1 A;  3RNC C;  1EF1 A;  4XX5 A;  2K0P A;  2KAJ A;  2PEA A;  1JWA D;  3FKY A;  1SIF A;  3A9K B;  2Z0E B;  4K7S A;  3HM6 X;  4ZYN A;  2EKE C;  4C00 A;  2N9P C;  2W3S A;  4HKZ E;  3RUL A;  3JVZ X;  2AX5 A;  3NVV A;  3NVW A;  2JT4 B;  3R3M A;  2J0M A;  4RF0 A;  1Q0W B;  4MEL A;  2XK5 A;  1TYG B;  1B1Z A;  2NTS A;  1J7C A;  4CQN A;  2OHF A;  2MA9 B;  2PVG C;  1PYW D;  4RMA A;  3V62 A;  2PE6 B;  3WAL A;  3CMM B;  3KH0 A;  1YX6 B;  1R4N I;  3GS2 A;  4IW0 A;  1YN5 A;  1MPE A;  2JUO A;  5BYS A;  3TEY A;  1L5P A;  3KW5 B;  3ZLZ A;  3W5V B;  3P1M A;  2BKF A;  2KFK B;  3ONS A;  4NAW A;  4IWP A;  1HTO A;  3ZW3 A;  1WX8 A;  3ZRF A;  1PDX A;  3R8B A;  3DCG A;  2LXA A;  1CMX B;  2WGS A;  3QWZ B;  1WYW B;  1N62 A;  5E6J A;  3WCQ A;  4MGK E;  1LXD A;  4C4V B;  2NR2 A;  3QX1 A;  1EWC A;  1ZDX A;  2RDG A;  3ZNI D;  3NG0 A;  4DXG A;  2Y5C A;  3SR6 A;  5GMV A;  2D07 B;  1XLQ A;  1SEB D;  4A6Q A;  1RRB A;  1TIF A;  4FBJ B;  3JYU A;  2TSS A;  2ACZ B;  1L7Y A;  2HDE A;  2ZPN A;  2AL3 A;  4ANU A;  5D3I B;  4HLE A;  3AE3 B;  2GOW A;  3U8Z A;  4II3 B;  3RFZ B;  5FKA C;  4KX6 B;  2FE8 A;  3NS1 A;  4MSM B;  1ROE A;  4YWG G;  4XC2 A;  3LB8 C;  1I42 A;  1LGR A;  3N9Y C;  2KQS A;  1TGZ B;  1XCQ L;  1XT9 B;  2N0S B;  3ECI A;  1OEY J;  1NI2 A;  3MC9 A;  4OVU A;  4XWT A;  2VZK D;  2L76 A;  1V1O A;  2DEN B;  3IHP C;  4RGT A;  1E0Z A;  2LMC A;  1XQQ A;  4L1B A;  3AU5 A;  4AJW A;  1JML A;  2WXN A;  2J52 A;  1JWS D;  5LXI B;  3PVL A;  1T5X D;  2IGH A;  3QCA A;  3SHQ A;  1A5R A;  4OZB A;  1DGJ A;  1RYJ A;  1TKG A;  2KN4 A;  1S3S G;  3H9D A;  4DHJ D;  5CX3 A;  3AE2 B;  1I4Q A;  2GRI A;  3E56 A;  3GB1 A;  2HE7 A;  3RUI B;  2LGX A;  3BII D;  4MGY E;  5IAA C;  4TQ1 A;  1I4G A;  4RNA A;  5D2M B;  3DOW A;  3C19 A;  3UI3 A;  3LJ3 A;  3AN1 A;  2J4X A;  1VZ6 A;  4GU2 A;  3N1Y C;  2YVC A;  4FJY A;  4QAY A;  2JF5 A;  3CSF A;  2AYO B;  1V1P A;  1XXG A;  1YN4 A;  3H6N A;  1P7F A;  1Z5S B;  3I3T B;  5BO4 B;  4KIK A;  5EE1 A;  4A9A A;  2WU5 B;  2KN5 A;  2M17 A;  1V5O A;  3V3X A;  3EUB 2;  1Y8R C;  4DXF A;  1WXS A;  1I7H A;  1R4M I;  2W3R A;  3QIJ A;  4YL8 A;  2GBM A;  5JHA A;  4HPP A;  1VJK A;  4D2K A;  1L6U A;  4L2Y A;  3IT6 B;  2MHJ A;  4LNO A;  2MJE A;  4BOZ B;  2AQ2 B;  2KYW A;  2JRI B;  5EDS A;  5CHV C;  3KWL A;  2KZR A;  3R2I A;  2EMT A;  1C76 A;  2L1A A;  2MJ3 A;  2JVC A;  3AI5 A;  4YTM B;  2ICI A;  2UYZ B;  2FNJ B;  4C4V A;  4I6L B;  2R61 A;  4BVU C;  2K6D B;  3L17 A;  2L8J A;  3PRE A;  4WIP A;  4MEM A;  4AUQ C;  3NVY A;  4ZDV A;  1WH3 A;  4PK1 A;  2RSU A;  5JZE B;  3BYY B;  1YQ4 B;  4NY0 A;  4ZHP A;  2GBJ A;  2AL6 A;  2V3S A;  2RPV A;  4US9 A;  3DHG C;  2J7Q B;  4HKQ A;  3VTW A;  1K52 A;  4W9E A;  2LVO A;  1TY0 A;  3KLS X;  5AUK A;  3IAM 1;  3T8M A;  3ZGZ A;  4OZA A;  3BIN A;  4H2A A;  3AEE B;  3VHT C;  3TEZ A;  1ZXH A;  1DOI A;  3AMZ A;  2K8B A;  3GZN I;  1K51 A;  1WR6 E;  2DHZ A;  2IY1 B;  1XO3 A;  3U4E G;  5BMG A;  1V2Y A;  4WAF A;  5C23 A;  1TTN A;  4A3P A;  2MBQ A;  2NBV B;  1BT0 A;  1WXM A;  5BMH A;  1TKY A;  4NPN A;  4KVG B;  1J8C A;  1Q1O A;  2CJN A;  4K7U A;  1KOT A;  2D3B A;  2OJR A;  2PW9 A;  4LJO B;  4E71 A;  1P0R A;  1FNV A;  2V3N A;  2JWU A;  1ZDV A;  4LNI A;  1EU3 A;  1WJU A;  4WWN A;  3ZJV A;  3O13 A;  1ZGU B;  5KHQ A;  3A1Q A;  1MJD A;  2AQ1 B;  1ET9 A;  4FJV B;  1KLU D;  1WI0 A;  2BW2 A;  2KOX A;  4MJS A;  3VQI A;  2D5G A;  1JRP A;  2DAF A;  3VH4 B;  1KM7 A;  2GBN A;  1WX9 A;  4G0N B;  4RM8 A;  4BKS A;  1UBI A;  3Q6B A;  3CWI A;  3MTN B;  5CTR C;  4ACF A;  3VFK A;  2LRW A;  3ZXV A;  2MCN B;  1KF6 B;  2PPH A;  1I4P A;  1OGW A;  4KV2 A;  3B0A A;  2PJH A;  4JLC A;  5LNK 1;  4O1N A;  3RNE C;  2L7R A;  1T0Y A;  2L05 A;  1Q5W B;  4BOS C;  2MH7 A;  1NI3 A;  1YOV B;  4MJS B;  4W9F A;  2KHW B;  4KGR A;  1BUI C;  4ANV A;  4JWS C;  2J53 A;  2WDQ B;  3Q8C A;  3EEC A;  4IKG A;  1C4C A;  4LK0 M;  2BB6 A;  4M0W B;  1M94 A;  2X38 A;  4MM3 B;  3RYT A;  4J3O D;  3OLM D;  4WWP A;  2RD0 A;  3LXF A;  3OAW A;  2KMC A;  3NVZ A;  4DXA B;  3QAR A;  1GPX A;  3GOE A;  2I1K A;  1HEZ E;  2JYE A;  5AZH A;  3QK0 A;  1LO5 D;  2CHX A;  3BWU D;  3NZU A;  3DWG C;  3P4Q B;  2IJ0 A;  4ZYS A;  4OHJ A;  3TIX A;  1TS3 A;  5E6N A;  2O6V B;  1E8W A;  1RAX A;  2CU3 A;  3KUZ A;  3AE4 B;  3D32 A;  3OG5 A;  3B9J A;  3H7P B;  4EZJ A;  1WGY A;  3RCZ A;  5IKC M;  1IGC A;  3VUW A;  1VR9 A;  3RNA C;  2KTF A;  3ENE A;  2WNM A;  2JWZ A;  3APD A;  3ZVV A;  1VLB A;  3AUL A;  4LJP B;  3ZDT A;  3ML9 A;  2XNA C;  2REX A;  2D3G A;  1KH0 A;  1AN8 A;  2BYT A;  3ZO5 B;  2IBI B;  3CIR B;  1WM3 A;  1WZ3 A;  4CHK A;  5KHO A;  3TL5 A;  2ZCB A;  5G2N A;  3Q69 A;  3A9K A;  2KMM A;  3N30 A;  4MDK E;  4BZA A;  4EFO A;  4ZOH C;  5C3J B;  2I1J A;  3RN9 C;  4ICV A;  4A20 A;  2ASQ A;  1OFF A;  1UGM A;  1LQB A;  1VZ8 A;  2NBU A;  1D6E C;  3DPD A;  3NY5 A;  4XGA B;  1D5M C;  2WWZ A;  4IWQ A;  2GI9 A;  3A9J B;  3RT3 B;  1E5W A;  3Q8F A;  3DDC B;  3ZXR A;  2KLG A;  3HUI A;  2V0G A;  5I4D A;  2KQ7 A;  4US8 A;  2KMA A;  2R2Q A;  4HJK A;  3SFD B;  2JXX A;  4YT0 B;  1EM7 A;  3VR8 B;  2BKR B;  2WX1 A;  2MX2 A;  2KD0 A;  4W9J A;  3HVZ A;  4GDL B;  5CHF A;  3RPF C;  3DHI C;  4IM2 A;  2ZW0 A;  4A3O A;  4GIV A;  5G55 A;  5BYQ A;  1IBX B;  3DBR I;  2K3U A;  1WJ6 A;  3UGB B;  3DBS A;  3QHT A;  1KJT A;  3WAN A;  1UEL A;  1V86 A;  1WGD A;  4EKU A;  4JX1 C;  1GC6 A;  1I4X A;  1WGR A;  1E90 A;  1WWT A;  3EC8 A;  3MJW A;  4FXC A;  2C7M B;  2KK8 A;  1UZX B;  2PE9 A;  3RD2 A;  2PLP A;  4NAM A;  3SEB A;  1YJJ A;  2BGF A;  2BYF A;  4GDL A;  2G9H D;  2KAC A;  3L4P A;  3X0W A;  2FID A;  4GLS C;  3AM9 A;  1FNW A;  2PMV A;  2LWP A;  3TCA A;  1WZ0 A;  2M56 B;  1QZE A;  4BKS D;  3S2A A;  1ESF A;  1UF0 A;  2C5L C;  4I6P A;  3VUX A;  1GNU A;  4EOY A;  4TQ0 A;  4RM9 A;  3AE1 B;  3DQV A;  1A70 A;  3I9V 1;  1ENF A;  2ONQ A;  2N7E A;  1M4V A;  1FO4 A;  1CK1 A;  1GB4 A;  3QJZ A;  2LHD A;  3SU8 X;  4KZ0 A;  2EEL A;  1FPY A;  2L0F A;  3A4S C;  2BPS A;  2A4Z A;  2VH2 A;  1SB3 C;  2LXC A;  2JZZ A;  1E9M A;  1PFD A;  1WX7 A;  4HDO A;  4BKG A;  1G6J A;  2NCN A;  3BVM A;  2ON8 A;  5DCN A;  3N3K B;  2L52 A;  3A4R A;  1AWD A;  3TUO A;  1YJI A;  1XCT L;  2LGD A;  3NJT A;  4Q2J A;  3NZ3 A;  2GBK A;  3L10 B;  1TZ1 A;  3N32 A;  2FIF A;  2FBW B;  3N20 C;  2N7J A;  1P9D U;  4N9F 4;  2DYB A;  2RR9 A;  1N6Z A;  1GJZ A;  1P7E A;  3PZ8 A;  1JRO A;  4RF1 A;  4NQK E;  3ABV B;  5HKH A;  3B1L X;  4YSX B;  5J17 A;  4USA A;  3BK1 A;  1GG3 A;  2C9W B;  2O6V A;  4W9I A;  3HM3 A;  1PUT A;  2KFK A;  4HCP B;  1C79 A;  1V80 A;  5H8Y E;  1QOG A;  4XE0 A;  1WRD B;  1IPG A;  1U4A A;  4G3X B;  4N58 A;  1NEK B;  4B0E A;  3LDZ E;  2KDB A;  5HHD G;  4W9K A;  3JSV B;  3L08 A;  3VTU A;  5JXV A;  5AZG A;  4K7W A;  1QF6 A;  4AQ7 A;  4BFR A;  4YTN B;  1E7U A;  3UIO B;  3AED B;  1V8C A;  2PTL A;  4ANX A;  4IUM B;  1UNS A;  1T6B X;  2LAS A;  3EA6 A;  4BAX A;  3Q3F A;  2AQ3 B;  3ML8 A;  4AWJ A;  1SE9 A;  3AB5 A;  3WAO A;  4DQO C;  1DYQ A;  2BYE A;  4KDL B;  4W9G A;  4OZC A;  3FIL B;  2H89 B;  4EZK A;  4MGZ E;  2MSE D;  3U7Z A;  4A90 A;  2BS2 B;  1D3Z A;  3V6C B;  4HPM B;  2UU7 A;  1V97 A;  2JYT A;  2WXG A;  3ZJU A;  5TSS A;  4DDI D;  4OVV A;  1RLF A;  1VZ7 A;  3AEC B;  4GSW A;  2OOB B;  1SJE D;  1Z2M A;  3P4S B;  1CJE A;  3PLU A;  4M02 A;  2RDB C;  2ZVN A;  3VRB B;  3AXC A;  2G4S A;  1H8C A;  2B3A A;  5C2T B;  5AUI A;  4YXD B;  5L83 A;  1XD3 B;  3WAP A;  3PS6 A;  5E6O A;  2BT6 A;  2D3C A;  2B76 B;  2IGD A;  4ZRJ A;  1XLO A;  3TBL D;  3AE9 B;  4BKT A;  1QOB A;  3L16 A;  2KWD A;  2MWS B;  1YIW A;  3Q8E A;  5J2R A;  2LFI A;  1PGX A;  4OVZ A;  4FHJ A;  4DK5 A;  4KSL C;  3U2S C;  3J9C A;  2JZ3 B;  2KDM A;  1QOF A;  2WXR A;  1VD2 A;  5IN7 A;  2ZNV B;  3IAS 1;  2WHI A;  5E6P A;  5LLI A;  1ZE3 D;  2IND C;  4M01 A;  1GC7 A;  3AE8 B;  5HI1 A;  3A1Q B;  1OTR B;  2JXT A;  3H7S A;  2IY0 B;  3I63 C;  2I38 A;  3RNB C;  4PT5 A;  3ZRC A;  1XLN A;  2WS3 B;  1EF5 A;  2IO1 B;  4WJQ A;  1E8Y A;  1I4R A;  2DZM A;  3ZTC A;  1E10 A;  5TR5 A;  1LM8 B;  2OED A;  4FLH A;  1NDD A;  2M4N A;  4HRS A;  1WJN A;  2N9E B;  1NVI D;  3MJ5 A;  1SE4 A;  3TSS A;  1L4D B;  3MHZ A;  4N59 A;  1P1A A;  1E8Z A;  2BB5 A;  5MPO A;  1FNU A;  1SSN A;  3VR9 B;  2GMI C;  2ZEQ A;  1DOY A;  1KFY B;  1TKE A;  4W9H A;  1WIA A;  1SBB B;  2G1E A;  1HTQ A;  3V05 A;  4F1S A;  2KTR A;  1DOX A;  1NYR A;  1ZUD 2;  4A55 A;  1OQY A;  1ACC A;  3OJ4 B;  4C7Y A;  1K8R B;  1K53 A;  3DVN V;  3UQA A;  3GE8 C;  2CJO A;  4XDC A;  2WXJ A;  4GOC A;  5IOI A;  5D7G A;  2DZK A;  2WXL A;  2KWV B;  3TEW A;  3A33 B;  4NJC A;  1UD7 A;  1OQQ A;  3BVG A;  2JRH A;  1H4R A;  3VUY A;  2DZJ A;  4RH6 A;  2IO2 B;  2KJ6 A;  1E8X A;  1YN3 A;  2M1M A;  3PPA A;  2MBH A;  4HCN B;  2WDR B;  4IG7 B;  1MG8 A;  4NZL B;  1ZW7 A;  3MP9 A;  2WX0 A;  4NJ7 A;  1F77 A;  1BXT A;  2QHO A;  1SF0 A;  2BWE S;  3X23 A;  5FK9 C;  3ALB A;  2VRR B;  4DHZ E;  1K50 A;  1MVK A;  2LGS A;  1FXT B;  2J0K A;  3PRM B;  2O2V A;  1TZO A;  2SAK A;  4MH8 A;  2AEH A;  2KC1 A;  2LRU A;  1FCL A;  1EWY C;  2O2V B;  4WWM A;  1STE A;  2ZNV C;  4DWF A;  5G5H A;  1MHX A;  2MBO A;  1MG4 A;  3NZS A;  3P63 A;  3U30 A;  3Q8A A;  2E6X A;  2VZK B;  3HHM A;  4GGQ A;  2K5P A;  2KDI A;  3ZNZ B;  2KT7 A;  1F52 A;  4LDT D;  1YNT E;  1J7B A;  2LVQ A;  3EHV A;  1HXY D;  1D4B A;  3ZUN A;  3ZNH B;  3TMP B;  1IGD A;  2IGG A;  3AU4 A;  1C4P A;  2CHZ A;  3WIM A;  2BBC A;  2HD5 B;  5IO9 A;  3PRZ A;  5DPS A;  3IVF A;  2MP2 A;  2KFJ A;  1KTK A;  2Y5B B;  4URK A;  1SIJ A;  3AE7 B;  4B6W A;  1L0X B;  3W9C B;  4HK2 A;  5JHB A;  4WJO A;  1QIL A;  1TS2 A;  4GMV A;  4IOI E;  3PTF C;  3DBH B;  1BML C;  1QT9 A;  3DBL B;  4BBN F;  3FAH A;  2ZZP B;  1YX5 B;  3MHS D;  3JSV A;  5DPR A;  2LEK A;  4PS3 A;  4II2 B;  2WXP A;  2Y5P A;  1WM2 A;  1GUA B;  2KJR A;  2C7H A;  1C4A A;  2K9X A;  2CHW A;  5HG2 A;  4GXB A;  2QDF A;  2I2Y A;  1TS5 A;  2M0X A;  2JU6 X;  2L3Z A;  2KKC A;  3RMK C;  3SDL C;  2MLB A;  4E3C A;  5AEK B;  2WQY B;  4BBN C;  2D3A A;  2QIE B;  3W1S C;  1F9J A;  3VRA B;  1P3Q U;  2FAZ A;  3CF6 E;  2GB1 A;  2KX3 A;  4M00 A;  1WMH B;  1V49 A;  1UGJ A;  2RPQ A;  4IM0 A;  1SE3 A;  4PS8 A;  1E6E B;  3R7R A;  2JX5 A;  3RNF C;  3W1S A;  3SD5 A;  1FFV A;  2C7N B;  4ZRQ A;  2BS4 B;  4G50 A;  1QKZ A;  2D11 A;  1TS4 A;  4KKI A;  3TJP A;  1WF9 A;  5H92 C;  3H8H A;  2JPH A;  2WYQ A;  2IO0 B;  1B9R A;  2W54 A;  2WDV B;  1NBF C;  4MT5 A;  1PQS A;  4S0R A;  1YMH E;  1C1Y B;  4HJG E;  4TUU A;  2M0A A;  2DYM A;  3IBE A;  4FA6 A;  2HTM E;  2FCS A;  2WU2 B;  2N1V A;  3KQ4 A;  3HK0 A;  4XWW A;  2D10 A;  5EE9 A;  2GLS A;  4AOF A;  2IZV B;  3ZJT A;  2JY6 A;  2L32 A;  2PKO A;  3HVD A;  3NRZ A;  3KYD D;  2W9N A;  1LFD A;  4DHJ B;  2LVP A;  2V4I B;  2WXI A;  2YEP B;  3IG3 A;  3Q3O C;  2C60 A;  2YLM A;  1JAL A;  2KDE B;  4MM3 A;  4TMA B;  3KUD B;  5DPT A;  5BYR A;  2INC C;  3V61 A;  3PO0 A;  3RZF A;  3VH3 B;  4ZRI A;  3AEB B;  4DBG A;  2MRP A;  4CYE A;  1PGB A;  2K8C A;  1ZXI A;  1MHH E;  1IYF A;  1ISN A;  4NQL B;  3BVZ A;  3Q2A C;  3PHX B;  2N4F A;  2IYD B;  5FR3 A;  1WMH A;  2LUE A;  3VXW A;  4A8X C;  2XN9 C;  2KO3 A;  1F0Z A;  4NJ6 A;  1IP9 A;  2N9K A;  2PIA A;  4RCO A;  1AAR A;  4W9C A;  1D5X C;  3GP7 A;  3MFG A;  2QMT A;  4PS7 A;  1YQ3 B;  1JW9 D;  3VVW B;  4HXD A;  2BVC A;  1Y56 A;  4M8N A;  4REZ A;  1N60 A;  2H88 B;  2KTR B;  4B95 A;  1OEY A;  2W55 A;  3L54 A;  5EE0 A;  1FD6 A;  3R2T A;  1F2R C;  1FRR A;  2G45 B;  1YJ1 A;  3HIZ A;  2LZ6 A;  1QOA A;  4PYZ A;  3GZN B;  1VCB A;  4YSZ B;  4JE3 B;  1HZ6 A;  4JWU C;  3VTV A;  1CZP A;  2Q5W D;  2N1W A;  2UWQ A;  1JQ4 A;  1L0V B;  2LHE A;  3CST A;  3QA8 A;  2CKH B;  2RDH A;  2V3P A;  3P4P B;  5AZF A;  2DX5 B;  2LGY A;  3P42 A;  1V5T A;  4IWO A;  1EUV B;  3VDZ A;  2K22 A;  2CU1 A;  2NS5 A;  3BZD B;  2QSD A;  4ASW C;  3Q8B A;  2KWC A;  1XLP A;  2KXJ A; 
#chains in the Genus database with same CATH homology
 2PJH A;  4JLC A;  1C3T A;  2R2O A;  1WGG A;  5E6P A;  2MBE A;  3PGE A;  5LLI A;  2LJ5 A;  2L7R A;  1TBE A;  1T0Y A;  2NPT A;  3V6E B;  1GC7 A;  2L05 A;  1Q5W B;  2XEW A;  5DPW A;  3A1Q B;  1OTR B;  4BOS C;  3B08 A;  4G11 A;  4MJS B;  2DZI A;  3DVG X;  3H7S A;  4W9F A;  2IY0 B;  2KDF B;  2KHW B;  4WJP A;  3DVG Y;  1SGH A;  4ANV A;  1WE7 A;  2AWT A;  3ZRC A;  5LXH A;  4IM3 A;  3EEC A;  4PYU A;  1EF5 A;  2IO1 B;  4WJQ A;  1E8Y A;  4M0W B;  1M94 A;  2DZM A;  3ZTC A;  5TR5 A;  3RYT A;  3KVF B;  1LM8 B;  2KWU B;  4WWP A;  3OLM D;  2RD0 A;  4FLH A;  1NDD A;  3NHE B;  4LCD E;  1V81 A;  2M4N A;  2KMC A;  3OAW A;  3PSE B;  4DXA B;  3QAR A;  1WJN A;  2N9E B;  4NNJ B;  3GOE A;  2I1K A;  5AZH A;  4KDI C;  4JIO U;  2CR5 A;  2ZPY A;  3QK0 A;  2CHX A;  3NZU A;  1P1A A;  1E8Z A;  1EF1 A;  3TIX A;  3PV1 A;  5E6N A;  2O6V B;  1E8W A;  4XX5 A;  1RAX A;  3QHT A;  4FJZ A;  3UF8 A;  3KUZ A;  3WAN A;  1KLV A;  2BF8 B;  2K25 A;  3D32 A;  2PEA A;  3H7P B;  4EZJ A;  2GMI C;  1WGY A;  3RZW C;  1SIF A;  2ZEQ A;  3RCZ A;  3A9K B;  1WJ4 A;  2IO3 B;  2Z0E B;  2K6Q A;  4K7S A;  3VUW A;  3HM6 X;  2Z59 B;  3H7P A;  2EKE C;  2KTF A;  3NOB A;  4GDK A;  4W9H A;  4ZYN A;  1WY8 A;  1WIA A;  4TV3 A;  3M63 B;  2N9P C;  3ENE A;  4F1S A;  3RUL A;  3JVZ X;  2KTR A;  4FAD A;  2JWZ A;  3APD A;  5CHW A;  3V60 A;  2JT4 B;  3ZVV A;  3R3M A;  1OQY A;  2J0M A;  2MQJ A;  3AUL A;  1Q0W B;  2BYV E;  3OJ4 B;  4MEL A;  4LJP B;  3ZDT A;  3ML9 A;  4I6N B;  2XK5 A;  1WR1 A;  2REX A;  3L0W B;  2D3G A;  1K8R B;  1WFY A;  4HWI B;  2KJH B;  2ZVO A;  3DVN V;  3ZO5 B;  2IBI B;  3UQA A;  4W9D A;  2MBB B;  2CS4 A;  2MA9 B;  2Z0D B;  1WM3 A;  1WZ3 A;  2N7D A;  3ZTD A;  4CHK A;  4GOC A;  4RMA A;  5D7G A;  1S1Q B;  2KAN A;  3V62 A;  2PE6 B;  5KHO A;  3WAL A;  2DZK A;  3TL5 A;  2ZCB A;  3CMM B;  2KWV B;  5G2N A;  3A33 B;  3KH0 A;  1YX6 B;  4WQO B;  1R4N I;  3A9K A;  4IW0 A;  1UD7 A;  3N30 A;  4MDK E;  2JUO A;  2JRH A;  1H4R A;  3VUY A;  4EFO A;  2DZJ A;  3KW5 B;  5D94 A;  3ZLZ A;  5D6J B;  2IO2 B;  2BKF A;  2I1J A;  1WGH A;  2KJ6 A;  4ICV A;  2KFK B;  1E8X A;  3ONS A;  4A20 A;  2ASQ A;  4NAW A;  4IWP A;  1UGM A;  1LQB A;  2M1M A;  3EFU A;  3PPA A;  2MBH A;  3ZW3 A;  2NBU A;  1WX8 A;  3DPD A;  3PRP B;  4AP4 C;  3DBH I;  3NY5 A;  4HCN B;  3ZRF A;  2WWZ A;  4IG7 B;  1MG8 A;  2FUH B;  1ZW7 A;  3DCG A;  2LXA A;  1CMX B;  3DVN U;  4IWQ A;  4XZ4 A;  2WX0 A;  3A9J B;  3QWZ B;  4FHK A;  1E5W A;  2G3Q B;  1WYW B;  4IC7 B;  3RT3 B;  4NJ7 A;  1HE8 A;  3DDC B;  2K39 A;  1V9J A;  4MGK E;  1LXD A;  2QHO A;  2KLG A;  2NR2 A;  3QX1 A;  3P2B A;  4ICU A;  3ZNI D;  2KQ7 A;  2J0J A;  2KMA A;  2R2Q A;  4HJK A;  2BWE S;  2D07 B;  2KNB A;  5GMV A;  3X23 A;  2JXX A;  2MW5 A;  3ALB A;  2BKR B;  2FCM A;  2WX1 A;  2MX2 A;  2KD0 A;  4W9J A;  1RRB A;  2VRR B;  4DHZ E;  4GDL B;  2DAJ A;  3JYU A;  4FBJ B;  1FXT B;  5CHF A;  2J0K A;  3PRM B;  1L7Y A;  2O2V A;  2ZPN A;  4FN2 A;  2AEH A;  2AL3 A;  2FCQ A;  2KC1 A;  2LRU A;  4IM2 A;  4ANU A;  4HLE A;  3L13 A;  3DBL I;  4J6I A;  4A3O A;  2GOW A;  2O2V B;  4GIV A;  3U8Z A;  5C1Z A;  4II3 B;  3KYC D;  5G55 A;  2ZNV C;  4KIK B;  4JGH B;  3DBR I;  4DWF A;  4MSM B;  2MBO A;  4XC2 A;  3NZS A;  2V1Y A;  1I42 A;  3W1Y A;  1WJ6 A;  2KQS A;  3U30 A;  1TGZ B;  1XT9 B;  3UGB B;  3DBS A;  3ECI A;  4KSK C;  1J19 A;  1KJT A;  1NI2 A;  1OEY J;  1UEL A;  2BWF A;  3HHM A;  1V86 A;  3M95 A;  1WGD A;  4GGQ A;  4MGI E;  4OVU A;  2KDI A;  3ZNZ B;  4EKU A;  1GC6 A;  1WGR A;  2L76 A;  4ZRK A;  4LDT D;  1E90 A;  2LVQ A;  3EHV A;  2DEN B;  2HTH A;  4GB9 A;  3ZUN A;  3IHP C;  3ZNH B;  3EC8 A;  3TMP B;  4HDQ A;  3AU4 A;  4JQW C;  2CHZ A;  3H1U A;  2DYO A;  3WIM A;  2NVU I;  3MJW A;  2HD5 B;  3UIP B;  2C7M B;  2KK8 A;  3PRZ A;  5DPS A;  3IVF A;  2A5U A;  1RFA A;  1UZX B;  3WAM A;  3K9P B;  4KZC A;  2MP2 A;  2PE9 A;  2KFJ A;  3RD2 A;  1XQQ A;  2Y5B B;  2K8H A;  2RGF A;  4HVB A;  4URK A;  2BGF A;  2BYF A;  3AU5 A;  4AJW A;  4NAW B;  4B6W A;  4B9K A;  5LXI B;  4GDL A;  3PVL A;  3X0W A;  4HK2 A;  3QCA A;  3SHQ A;  2FID A;  5JHB A;  1A5R A;  1I35 A;  3PLV A;  2LWP A;  4WJO A;  3TCA A;  1WZ0 A;  4GMV A;  1L2N A;  3NS8 A;  1J0G A;  3PTF C;  1QZE A;  4BBN F;  2L00 B;  4BKS D;  3S2A A;  1S3S G;  2ZZP B;  1YX5 B;  3MHS D;  3H9D A;  3JSV A;  5DPR A;  5CX3 A;  4DHJ D;  3PZD A;  2C5L C;  4I6P A;  4WJN A;  4II2 B;  4PS3 A;  3VUX A;  1GNU A;  4EOY A;  4TQ0 A;  2HE7 A;  4RM9 A;  3DQV A;  3RUI B;  1WM2 A;  3OJ3 A;  1GUA B;  2KJR A;  2LGX A;  4MGY E;  2C7H A;  5IAA C;  4TQ1 A;  2CHW A;  2N7E A;  5D2M B;  3DOW A;  4AJY B;  4FUL A;  3QJZ A;  3LJ3 A;  4GXB A;  3KUC B;  3SU8 X;  4KZ0 A;  3UQB A;  4W9L A;  4GU2 A;  2L0F A;  1WE6 A;  2YVC A;  4FJY A;  2M0X A;  3A4S C;  2BPS A;  2L3Z A;  2A4Z A;  2JF5 A;  3A9J A;  3CSF A;  2AYO B;  2KKC A;  2LXC A;  1P98 A;  3SDL C;  2JZZ A;  2MLB A;  4E3C A;  3H6N A;  1Z5S B;  3I3T B;  5AEK B;  1WX7 A;  4HDO A;  3UIN B;  4BKG A;  1G6J A;  2NCN A;  5BO4 B;  4BBN C;  3BY4 B;  5DCN A;  3N3K B;  4KIK A;  3A4R A;  3W1S C;  1F9J A;  1P3Q U;  2KN5 A;  2LGD A;  4HPL B;  3WA0 A;  2FAZ A;  2M17 A;  3CF6 E;  4GN1 A;  4TKN A;  1V5O A;  2KX0 A;  4P7I A;  2KX3 A;  3T9L A;  1UBQ A;  2GBK A;  1WMH B;  2HJ8 A;  3Q3J A;  4LDT B;  1WXA A;  1V49 A;  1Y8R C;  1YQB A;  2RPQ A;  4IM0 A;  4PS8 A;  3L10 B;  3R7R A;  3VAW A;  1WXS A;  3W1S A;  1TZ1 A;  3SD5 A;  1R4M I;  3QIJ A;  3N32 A;  2FIF A;  4YL8 A;  2GBM A;  4EZL A;  5JHA A;  2C7N B;  4G50 A;  2LD9 A;  2D11 A;  1P9D U;  4N9F 4;  2DYB A;  2RR9 A;  3TJP A;  2ZJD A;  1GJZ A;  1WF9 A;  4BOZ B;  2JPH A;  2L0T A;  2WYQ A;  4WAA A;  2IO0 B;  2JRI B;  5EDS A;  4NQK E;  4WWO A;  5HKH A;  1NBF C;  5CHV C;  3M62 B;  1ZKH A;  2KZR A;  3ZDM C;  3B1L X;  5J17 A;  2EMT A;  1PQS A;  3ZKJ C;  1V6E A;  1C1Y B;  1GG3 A;  2JVC A;  2C9W B;  2O6V A;  3AI5 A;  3APF A;  4W9I A;  4TUU A;  5L95 C;  1UH6 A;  2KLC A;  3HM3 A;  2DYM A;  3IBE A;  2UYZ B;  2FNJ B;  4FA6 A;  4I6L B;  3APC A;  4BVU C;  2KFK A;  3IFW B;  4HCP B;  3R66 C;  2K6D B;  4MH0 E;  1V80 A;  1X1M A;  2FCS A;  3L17 A;  2L8J A;  3K9O B;  3PRE A;  4MEM A;  4AUQ C;  2N1V A;  1WH3 A;  1WRD B;  4ZDV A;  2XBB C;  1IPG A;  2RSU A;  1U4A A;  4G3X B;  3HK0 A;  2D10 A;  3LDZ E;  5JZE B;  4NY0 A;  2KDB A;  4AOF A;  2IZV B;  4W9K A;  3JSV B;  3L08 A;  3ZNG C;  4F7Z A;  3VTU A;  5AZG A;  2GBJ A;  2AL6 A;  2JY6 A;  4K7W A;  2G4D B;  2V3S A;  3KYD D;  2V4L A;  4BFR A;  1WXV A;  1E7U A;  1LFD A;  2J7Q B;  2LVP A;  2N9X A;  2W9N A;  3VTW A;  2K1F A;  3PHW B;  2GBR A;  3U7D A;  5JH5 C;  4MSQ B;  3IG3 A;  3UIO B;  5IA7 A;  5J18 A;  4W9E A;  2C60 A;  3QC8 B;  2YLM A;  2KVR A;  1EO6 A;  2LVO A;  2KDE B;  4MM3 A;  3KUD B;  5DPT A;  4ANX A;  4IUM B;  4EEW A;  3V61 A;  2LAS A;  3M3J A;  3Q3F A;  3RZF A;  3VH3 B;  4JL9 A;  4ZRI A;  3T8M A;  4X57 B;  3C0R B;  3ML8 A;  2WDT B;  4AWJ A;  4DBG A;  3BIN A;  1SE9 A;  2MRP A;  3WAO A;  4CYE A;  2K8C A;  3VHT C;  4CO7 A;  2BYE A;  4KDL B;  4W9G A;  1JRU A;  5FR6 A;  4EZK A;  4MGZ E;  2MSE D;  2ZCC A;  1ISN A;  4NQL B;  1IYF A;  4ANW A;  2K8B A;  3GZN I;  4DHZ B;  2NPT B;  1WR6 E;  2DHZ A;  2IY1 B;  3PHX B;  4DHJ B;  2N4F A;  2IYD B;  1D3Z A;  1V2Y A;  2M8S A;  3V6C B;  2D2Q A;  4EUT A;  1WMH A;  2LUE A;  4HPM B;  5C23 A;  1TTN A;  3VXW A;  4A3P A;  2MBQ A;  2NBV B;  1BT0 A;  4F8C B;  3QQ8 B;  1WXM A;  4E74 A;  2KO3 A;  4OVV A;  1RLF A;  4NPN A;  4DDI D;  2EMS A;  2O6V D;  4KVG B;  4GSW A;  2OOB B;  4K1R B;  4NJ6 A;  1IP9 A;  1J8C A;  1AAR A;  1Q1O A;  1Z2M A;  4W9C A;  3ZIM A;  4K7U A;  1KOT A;  2OJR A;  4LJO B;  3R7Q A;  4PS7 A;  3PLU A;  4E71 A;  2ZVN A;  3JW0 X;  4HXD A;  1P0R A;  3AXC A;  3VVW B;  2G4S A;  1H8C A;  4M8N A;  2B3A A;  2KTR B;  2LI5 A;  5L83 A;  4B95 A;  4K81 A;  1OEY A;  1XD3 B;  3L54 A;  1WJU A;  3O65 B;  4WWN A;  3WAP A;  2MP2 B;  2G45 B;  3PS6 A;  1YJ1 A;  3HIZ A;  2LZ6 A;  4PYZ A;  5E6O A;  4DDG D;  1ZGU B;  5KHQ A;  1VCB A;  3A1Q A;  1E7V A;  2XK5 B;  4FJV B;  1WI0 A;  4ZRJ A;  2KOX A;  3VTV A;  3TBL D;  2N1W A;  2UWQ A;  4MJS A;  3VQI A;  4BKT A;  2DAF A;  3L16 A;  3CST A;  3QA8 A;  2CKH B;  3VH4 B;  1KM7 A;  2MWS B;  3PT2 B;  2GBN A;  1YIW A;  1WX9 A;  5J2R A;  4G0N B;  4RM8 A;  5AZF A;  4BKS A;  1UBI A;  2DX5 B;  4FHJ A;  4DK5 A;  2KC2 A;  2LGY A;  1V5T A;  4IWO A;  1EUV B;  3QAQ A;  3MTN B;  4GDK B;  4KSL C;  4M8M A;  3VDZ A;  2NBW B;  5CTR C;  2CU1 A;  2NS5 A;  3VFK A;  2LRW A;  2JZ3 B;  4ASW C;  2MCN B;  1VD2 A;  2KWC A;  2PPH A;  2KXJ A;  2FCN A;  2ZNV B;  1OGW A;  4KV2 A;  1YD8 U;  3B0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...