2ZCKP

Crystal structure of a ternary complex between psa, a substrat-acyl intermediate and an activating antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule keywords Prostate-specific antigen
molecule tags Immune system
total genus 53
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP01
4NCYA 1J8AA 3NWUA 1V2MT 1C5UA 1HLTH 6CHAB 1BIOA 1IQEA 1GJ8B 1GJ4H 2FIRH 3LOXA 5FPSA 1ZHRA 1LPZB 1O37A 1Q3XA 2IOTA 4HGCA 1O2QA 5EU8A 1P2JA 4DJZB 4X1RU 1OWEA 2O8WA 1AY6H 3A84A 2WPJS 3E1XB 3QGJA 1AE5A 2ZDAH 2QXJA 8KME2 5A8YA 2ODPA 1EZSC 4CBOA 3TPIZ 1C1UH 1BMMH 1AVWA 4XBDA 1FPCH 3PTNA 1F92A 1K21H 1NFWA 2ZFPH 2BD2A 3SU0A 3FFGA 5ETXA 1WOFA 1EAXA 1FDPA 3FAOA 1TX8A 1XUHA 4I31A 4CRDA 2D1JA 2PW8H 1MZAA 4B2AA 5C67A 2UWLA 2WYJA 2G51A 1MH0A 4XE4A 3GISB 2QY0B 2PSYA 4E05H 3MOCA 1XKBC 4XSKU 1OSSA 4O9VA 1KIGH 1ZMNA 1N6XA 1UCYK 1ZTLA 2R9PA 4Q2KA 1CHOG 2GV7A 4AFSA 3UQOA 4ZHAA 6GCHF 1IAUA 1P03A 1DX5M 3KQCA 3BTME 1SGFA 1NO9H 1AVGH 4H6TA 5TCCA 5EPNA 1C5TA 2P8OC 3H7TA 6LPRA 1L1NA 1HJ8A 2R2WU 3LT3A 1QB6A 1NU9A 2ZGJA 3SUEA 2O8TA 1UTKA 1Z6JH 1GCTC 2HALA 1V2ST 1YPEH 1C4V2 3SUDA 2VIQA 1GMHG 1O2XA 1P0SH 1TABE 1HAPH 1DOJA 4AYYB 1BRUP 3RDZA 1LTOA 3RXSA 3IITA 1GMDF 1DDJA 1F2SE 4IW4E 5L2YH 1P01A 4NIVA 1SGPE 4GCHF 1ARBA 4BTTB 3BEFB 1SGYE 1O5AB 2F9VA 2XBVA 3TIUA 4CRBA 2BDHA 3DD2H 3MU4A 2TGPZ 5LPFA 1HAOH 3QO6A 2V0BA 2QC2A 3A7ZA 2LPRA 2BLOA 3S69A 1LHEH 5EXNA 4UE7H 2F9OA 1GG6C 4AG2A 4JYUH 5C3NA 1MD7A 2SNVA 1ANEA 8GCHG 1AFEH 1KY9A 2BMGB 4O97A 3EA8A 1YCPH 4FXGH 1K1NA 3ZZ4A 3GICB 1FV9A 1C5LH 1QGFA 4DY7B 2ANMH 1GHBG 3M5OA 1J15A 1P2OA 1ZR0A 3V0XA 2HGTH 1UHBB 4ISLA 1C2FA 3FP8E 2B0FA 1HCGA 1K1LA 3NPSA 1S0QA 3U1IB 5GWZA 3RXIA 2AFQB 3QN7A 2BLVA 1QJ6B 1DT2A 1HJAB 4A1VA 3PV4A 3QDZB 5C5OA 3E6PH 4DOQA 1C5PA 2GD4B 1UVPA 5EG4A 3QTVH 4Y7AA 3SJOA 5DP6A 2GGVB 1H1BA 2V3HH 3DUXH 1SLXB 2VGCC 1AHTH 3KEEA 2OC1A 1NFXA 3HK3B 5DP7A 1YPHE 4X6NA 2H9TH 3AASA 2F3CE 4WWYA 2BDBA 4U2WA 3BV9B 5ESTE 5E0HA 1OP8A 5DK1A 3K6YA 3F9GA 5AFYH 4LZ1H 2ZU3A 1P2NA 1ELEE 3N7OA 1O2SA 3B23B 2G5VA 1KDQA 4BAQB 4CRFA 2GVFA 4KGAA 3LGWA 4JZDH 4X2XA 2HNTE 1ZZZA 3QUMP 3TK5A 3H7OA 2QV1A 3QWCH 4B74A 2OTVA 4NZQA 1GDNA 3HGNA 2F91A 3VXFH 2JETB 1ETRH 4CBNA 1G9IE 2KAIA 1C5VA 1QTFA 2AH4X 1GBFA 1C1MA 4OGYA 2W7SA 2VNTA 3RXQA 1EPTA 1YPJH 1QQUA 1ZRKA 4FUCA 1NRPH 4D9RA 4X6OA 3EDXB 1V2UT 2B5TB 3BTWE 1FJSA 1L2EA 4IBLH 1RGQA 2HVXA 3AVZA 3RC4A 3P70B 1TBQH 1D4PB 1MTVA 3AAVA 3ATIA 2FOCA 1ACBE 1SB1H 5DP3A 4A1XA 6CHAC 1TMBH 4B2CA 1QL7A 1HBTH 2FYQA 3RXJA 2DUCA 1ZHPA 2JH0D 4UDWH 1AVXA 2XC4A 2C3SA 3MO3A 3ODFA 2Z3DA 1TNJA 2W5EA 3P8NA 4I32A 2UUKB 3LIWA 1SGQE 2P3FH 1J16A 3RMMH 1CSOE 1JIMA 5DPAA 4CREA 1MAYA 2VH6A 1VITH 1WYKA 3RMNH 4MDSA 1C1RA 4DW2U 5E0JA 1CO7E 8ESTE 3RXVA 2J95A 2OQUA 2EA3A 1FIWA 4B71A 3VB4A 3A81A 4FUJA 4ZMAH 1WCZA 2F9BH 3MH4A 1ETSH 2TBSA 3UIRA 3C1KA 1G3CA 2BDGA 4K2YA 3KF2A 3LH1A 1CT2E 4AFQA 5J4QA 2A4OA 3UWJH 1AFQB 3BIVH 2FOGA 2CN0H 3A82A 1XXDA 4HFPB 2TIOA 1YP9A 4NIYA 3ATWA 2Z7FE 3PROA 1GBBA 5IDKA 1LCYA 4THNH 1TYNA 2F83A 2Q6GA 1SC8U 1V3XA 2ZGCA 3TH2H 3RXAA 1XVMA 3IWMA 4I8KA 4ZHMU 1TRMA 4E06H 3W94A 1SG8B 1TRYA 1G3DA 1HAXB 4F4OC 4Q7XA 4OS4A 5EODA 1S83A 2WPKS 2GZ9A 1AMHA 1Z8RA 3ZZBA 3OU0A 1DWBH 4YT6H 3UPEA 1V6DA 1BCUH 1BBRE 3K2UA 1OXGA 5FHTA 1SI5H 4I33A 1SR5C 1HGTH 2QAAA 1C4U2 5GJ4B 3BG4B 3LDXH 5GCHF 5EOKA 1O3EA 5A8XA 1DUEA 4XBBA 3O8DA 1C2MA 2V6NA 1V2OT 1P3EA 4IC6A 3U1JB 5EXMA 1O3BA 2G4TA 3GCOA 4MQAA 1JBUH 1C5MD 3BEIB 1SMFE 1UTPA 1RIWB 1TGSZ 2ZCHP 3GDSA 2XYAA 2OC0A 1SQAA 1N1LA 2PTNA 4ZKRU 1UK4A 5PTPA 3BF6H 3SV6A 1M9UA 3AW1A 2HPQH 4IMQA 2EI7A 4U30A 2H2ZA 4X8VH 2Z9IA 5JBTA 4U01A 2ZZUH 1XMNB 2R2MB 3V13A 1G3EA 1F7ZA 2YNBA 1EQ9A 3MH6A 3RXTA 1OWHA 4WF8A 1ZSLA 1HJAC 3E0PB 4UONA 1OOKB 3I77A 1H9LB 5DO4H 2G52A 2BD9A 1P2KA 2ODQA 4WMDA 3O8BA 4CH2B 3MFJA 1LVMA 3QZQA 3ZZCA 4NIWA 3KN2A 3EYDA 3C27B 1HIAA 1JRSA 2BDIA 3U8TH 3ATKA 1DWEH 4E7RG 1SBWA 4A5TS 1QA0A 4DVAU 1SOZA 2ULLA 1ZYOA 1H4WA 1GPZA 1NN6A 1IQGA 5A0BA 3LJOA 1ZPCA 1C1OA 1GJ6A 3MNSA 1EJAA 2ZWLH 5GIBA 2FTLE 3Q00A 3FVFB 3HATH 2Y82A 1RTKA 1JRTA 3ZYDA 1AO5A 3TH3H 2VVVA 1K2I1 3M5NA 2JETC 2QCYA 3SI3H 1CGHA 5SGAE 1C2LA 3ZVDA 3TGIE 4SGBE 1HJ9A 1O3NA 4X1QU 1V2LT 1ZGIA 1IQLA 4K8BA 3LKWA 3RXDA 1UVUH 2Y7ZA 5FBIA 1KTTB 1DLKB 2GT8A 1TOCB 1V2VT 1ZPZA 1C5ZB 2ZHEH 1MTSA 2EC9H 1TA6A 1NRRH 1GVKB 3M5MA 1EOLA 2I6SA 1Z7KA 3MU0A 1ETTH 1O2MA 1ANBA 1EJNA 2KAIB 1TA2A 1O2IA 1UTOA 2OCVB 3UOUA 4GVUA 4GSOA 1EPTB 3Q77A 3MH7A 1OWDA 4JMYA 1O0DH 1CHOF 3RXKA 1P57B 2C90B 3HKJB 1ZMJA 2FM2A 3VB6A 1Y8TA 1DWDH 5DP5A 2OD3B 1IQIA 1EAIA 1P2QA 2A4RA 3RXHA 4UFGH 2A2QH 2QXIA 4X1PU 2C8WB 1O5DH 1W8BH 2SGEE 4CR5A 3MU5A 7ESTE 3A7TA 1GVZA 2ZHFH 5EW2H 1YPKH 3S7HB 3PLKA 1MAXA 1JOUB 2VIWA 1EZXC 1TLDA 1BBRH 4AB8A 3SNDA 4Y0ZE 2HPPH 3RU4E 1DVAH 2PKAA 3BTGE 4A92A 2BXUH 1TMTH 4YM9A 4JK6A 2G5NA 1OP2A 3CS0A 1EP5A 4R8TB 3BTHE 1NPMA 2VWLA 1AFQC 3MI4A 1GL0E 4PROA 2Q6FA 2PUQH 4YESB 3SJIA 2Z3EA 1Z8JB 1TNIA 4NFFA 7KMEH 4CRGA 5L30H 1MU8B 3SW2B 1OWKA 1GJCB 2QXGA 1PQ8A 2WPMS 3VEQB 1S84A 3GCTG 1FY8E 1A61H 2J9NA 3A8CA 1V2RT 1DXWA 1O31A 4MVNA 1SGFG 8GCHF 1YKTA 1G3BA 4YO9A 3M7UA 5A0CA 3R0FA 1V2PT 1WTHD 2XCFA 4X2WA 3NXPA 3E0NB 4X8UH 1Q2WA 2J2UA 1FIZA 3UY9A 1GHVH 1SGCA 4AZ2B 2W26A 2PGQB 2ZPSA 1HV7A 2J92A 2PKSB 1BJUA 2PTCE 3BG4C 1EP6A 1C2JA 1EZQA 1O2GH 1UK3A 1IQJA 2R3UA 1D3TB 4QT8C 1W0YH 1XM1A 1FN6A 4INHA 1F0SA 1FAKH 3ZVFA 1SGDE 3GY6A 1ELVA 2SGPE 4KP0A 5JBAS 1GMCG 1BITA 1A0HB 2BOKA 4OS1A 2ALVA 2VJ1A 3DA9B 3SOSA 1SLVB 2OC8A 2ZCLP 3LJJA 1RIWC 1FONA 2H5DA 1FI8A 4FUBA 2ZC9H 3VB3A 1YM0A 1WQSA 3D49H 2VIVA 4ABIA 2RDLA 1Y5AT 1UCYH 1L4ZA 2Q6DA 5T6DA 4K3JA 5I25A 1WTGH 1O2NA 4K1SA 1SSXA 1OX1A 3RU4D 1GI9B 1ELBA 1AIXH 1RRKA 4O3UA 9ESTA 2SNWA 3MYWA 1UTJA 4Y8XA 4FVDA 1P2IA 3A88A 5A2MH 2P94A 2PGBB 1GCDA 1P06A 2BX4A 2H5CA 2VWMA 1WAYB 1O2YA 3EQ0H 1EAWA 3K65B 1O3KA 1TGCA 1ID5H 2Z3CA 5H4IB 2QA9E 3UOPA 1QBOA 1SHHB 1L1JA 5DKMA 1D6RA 4ISOA 4LXBH 5EGMA 1C1QA 1EAUA 1GI2A 3NCLA 2NU2E 1NT1A 1QNJA 2FI4E 2ZCKP 1BJVA 1GHYH 2BY8X 3A7XA 1VGCB 4I8LA 4RN6A 4WXVA 2P59A 1O2WA 5LPEA 3SUGA 1HIAB 3KIDU 4R0IA 1K1JA 1S85A 1SFIA 2WUCA 2GZ8A 3SJ9A 2LNCA 1FZZA 4Q80A 1QR3E 4AB9A 1P12E 1V2KT 3RM2H 5FAHA 2CXVA 3PMHB 3U98H 4X1SU 1WBGB 3SU2A 1GWAA 1OP0A 4ESTE 5FX6A 3RU4T 3UR9A 5E2PA 1V2NT 5AHGH 1TX7A 4X1NU 1GJDB 3RXBA 3TLOA 2PSXA 1WQVH 3M36A 1MCTA 4A6LA 2GZ7A 2J4IA 2PV9B 1G2MA 4IS5A 1TBRH 2QYIA 1EB2A 1EPTC 5CE1A 2V35A 1HAHH 2VIPA 3B9FH 3GYMA 3I29A 8LPRA 1G37A 3EA9A 2Y5FA 3Q3KA 1RS0A 2FI3E 5C1XA 1O35A 4AX9H 2B7DH 1ANDA 1ESBA 3A8DA 1A0LA 4AN7A 2XBWA 1BDAA 3KL6A 1TE0A 2WV4A 2ALPA 3TNTA 4NA9H 2HRVA 1FMGA 1DE7H 5HGGA 2K1QA 1NFUA 2RG3A 2P95A 3D65E 3U9AH 1EASA 3A83A 3UR6A 2SFAA 2GCTB 3BTFE 1TX6A 1SVPA 2GT7A 1G36A 4JZ1A 4Y76A 1J17T 1GGDB 1C1TA 5F8ZA 3V12A 1AZ8A 3KQBA 1YGCH 2FO9A 1SQTA 4TWWA 1O5GH 3AAUA 5EXLA 3RXRA 1F0TA 1D9IA 1P09A 1O2RA 1ZTKA 4BAMB 3UNQA 4YZUA 3KCGH 1BT7A 1GHAF 3TH4H 3T28A 2PKAB 3MU1A 1A5GH 4NWLA 1IHTH 1K28D 1GBAA 1UK2A 3SU3A 1H8IH 4CHAB 1C2DA 2P3UB 3MNBA 1FY5A 1G30B 1O34A 1W7GH 5JB9S 3RM0H 1SGRE 1VZQH 3PLPA 1QBVH 1XX9A 4INLA 3S9AA 2Y80A 2BD8A 5GPIB 4BAKB 1O2OA 1D3PB 1P05A 1QBNA 4CR9A 4DIIH 1TPAE 1RD3B 4DURA 4LOYH 2FOAA 1C4Y2 2H1UA 1QQ4A 4ASHA 1LVOA 3F9EA 2PKSC 2BQWB 2BVRH 1A0JA 3LGUA 3A89A 1C2GA 1C2KA 4YLUA 3F1SB 1CHGA 2C93B 4NIXA 1W12U 1ZSKA 5EQQA 2ZA5A 4I8JA 3L6PA 4TY7A 2BZ6H 1OWIA 3ZVBA 1VCQA 3E91A 3HKIB 2C4FH 1MUEB 1O3IA 4MPWA 2ZG0H 2FODA 1Y3WA 1YPMH 2STAE 3MNXA 3LGTA 4X2VA 4GAWA 4AFZA 1YCPK 2BB4A 2ZU5A 5LPRA 4DG4A 2ZU2A 3RMLH 1MZDA 4WMFA 3PWCA 2VWOA 5EW1H 3MO6A 1GI6A 2PWXA 3RLWH 1HXEH 2UUFB 4ABJA 4M7GA 2Z9KA 1T8MA 2BQ6B 2G55A 3O8CA 2PFEA 1SGIB 1YC0A 3PO1B 1BUIA 1ELFA 3DFJA 2BQ7B 1DICA 2VVUA 3S9BA 1SLUB 4MTBA 4I7YH 4CRCA 2AIQA 2G81E 4NZLA 2FYRA 1MBQA 2NU1E 1C5SA 2XWBI 5E2OA 3UNSA 4OS5A 3V7TA 1H9IE 2ANWA 1OPHB 1MU6B 3T62A 2BX3A 1GBLA 1XUFA 4ISNA 3RXOA 1QRXA 2EI8A 4DIHH 1O2HA 1A5HA 1INCA 2FOFA 1SOTA 2NWNA 3LGYA 2PHBA 4KELA 1S5SA 3ZVCA 5L2ZH 3CP7A 1BTWA 5BPEA 2WYGA 1AWFH 1GL1A 2JH6D 1NRQH 1O3PB 2PR3A 3ZZ7A 5B6OA 2ILNA 3BN9A 3UWIA 1IQHA 4GUXA 1VGCC 1YPLH 4ABGA 1MKXH 3JZ2B 1N8OB 2AGIX 5AF9H 1E36B 1EOJA 1GJBB 1CQQA 4IN2A 1GI3A 4AOQA 3EA7A 1AUJA 3A85A 2WINI 1O2TA 3ENSB 2FOBA 1C2HA 4FUGA 1THSH 1SGTA 3OYPA 4ZUHA 1SLWB 1GI0A 1O30A 3ZVGA 4JCNA 3LU9B 2CHAB 3T25A 1SL3A 2VIDA 5JDUB 4INKA 3MHWU 4K8YA 4H6SB 1N6YA 1T8NA 1DSUA 3UQVA 2DE8A 3KGPA 3GOVB 3GCTF 4Y79A 5JPMH 1LPGB 2A45B 1PJPA 5ESBA 3S9CA 1E34B 1HDTH 1XVOA 3A7WA 3M7TA 1CT0E 1O2UA 1CA8B 5A8ZA 3TJUA 2BZAA 1IOEA 1FPHH 2BD7A 2FLBH 4XOJA 1O2VA 1KYNA 2BY7X 3B8JA 1HRTH 3RUOA 1ESTA 1C9TA 1GHAG 2GCTC 2HOBA 2BVSH 1ELAA 4FU9A 4I8GA 1C5YB 4D8NA 3SUFA 2CV3A 1O32A 2ZPQA 2BDYA 4K1TA 2GDDA 3ATLA 1GGDC 2O8MA 2OLGA 1LKBA 1TOMH 2CF9H 3T2NA 2QXHA 1E37B 1XUIA 4OGXA 4CH8B 1O39A 4O3TA 3TVJB 1BMNH 3H5CB 3P8OA 1K1IA 3NKKA 4KTSA 1LHDH 3SV9A 1GMCF 2A5KA 3E90B 1DWCH 1EUFA 2JKHA 4BOHA 3MO9A 3UUZA 3SV2H 5C1UA 2UWPA 3PB1E 4CHAC 1W10U 2PUXB 3QX5H 2TGDA 2XC5A 2D8WA 3T29A 1Y59T 5I46H 1TAWA 1JXPA 1Q31A 1BTHH 1VITF 2Z94A 5HYOA 3ZVAA 4XDEA 1S81A 1QJ1B 5JYIA 4Y7BA 2ZFSA 3VB5A 1NRSH 2TGTA 2A1DB 1Z71A 4Y6DA 2FOEA 2TPIZ 1YLCA 3G01A 2BM2A 1Z8IB 2STBE 2ZHDA 3M37A 1YLDA 2BYAX 3WY8A 1IQKA 1GVLA 1HXFH 2B9LA 1P2MA 1W0ZU 2C8ZB 3VGCB 1VJAU 1O2JA 1S0RA 1UCYE 1KTSB 2ZDKA 2AMPA 1Z1IA 2VB0A 4NG9H 1WSSH 1XXFA 3QTOH 2P3TB 1MKWK 1KDQB 5G4BA 1LVYA 4UEHH 3M3VA 3D23A 4K69A 5JBCS 1DFPA 1RXPA 1JWTA 3L3TA 3M5LA 1CGIE 1C1PA 1HAIH 2ZDMA 1SGNE 1UJ1A 1MBMA 4K1EA 1LMWB 1A2CH 1Z6EA 3OTJE 4Z6AH 4CRAA 4NSVA 5C5NA 1MCVA 2FWWA 2ZQ2A 3MMGA 1TBZH 5CHAB 1AD8H 3U8OH 1ZTJA 2ZNKH 3TITA 1DANH 4X8TH 1O2ZA 3V3MA 2O8LA 2AEIH 1DY8A 1O33A 3PO1C 4DGJA 2IJOB 1MTNB 1C1NA 3AW0A 3URCA 1LDTT 1T4UH 1BRBE 4B2BA 2B8OH 2FX6A 2YNAA 4D7GA 1C2IA 4FVBA 2Y5HA 1T31A 2J34A 4GPGA 1A7SA 2AMQA 3TJOA 3SGBE 4MNWA 3QK1A 1Y3UA 7GCHF 3F68H 3GCNA 4KTCA 2Y6TA 1C2EA 5F6MA 1LHFH 2HNTF 1CE5A 1D3QB 1GDUA 4B73A 2A0QB 3FZDA 1THPB 3Q76A 5E8EH 3HPTB 3SNEA 1N8OC 1O3LA 3MNCA 1UHBA 4NFEA 3T26A 2P93A 1ZOMA 2G8TA 2ZU4A 2GDEH 1RFNA 1XUGA 1MMJN 2A5AA 1GBTA 1W7XH 2CF8H 2W3KA 1S82A 1BTUA 2GCHG 1T8LA 3TNSA 1OYTH 2A7JA 5LH8A 1YBWA 1W11U 2W7UA 2CHAC 1WV7H 3ZZ3A 2A4GA 1A4WH 1GI1A 2NU3E 2ZF0H 1GDQA 1BZXE 1TQ7B 3PM3A 1NC6A 4AORA 4XBCA 2Y5GA 2VWNA 1EJMA 3VFEA 3CENA 4TPYA 1FNIA 2ZGBH 3T5FH 4X6PA 2W3IA 3ODDA 1D6WA 1QURH 1T8OA 1HPGA 2ASUB 3D62A 2BVXH 2Y81A 3FANA 4ABAA 2ZU1A 4E7NA 3OX7U 3P92A 5TJXA 4VGCB 3BTQE 2WPHS 2ZTYA 2AERH 1BRCE 3OSYA 3UREA 3UNRA 1JIRA 4JK5A 3BTDE 2UUYA 1AU8A 3SORA 1TQ0B 3FP6E 3UTUH 4GLYA 4XFQA 3K9XB 3P8GA 5E0GA 2FS8A 6ESTA 2IN2A 2RA3A 4HZHA 1ZMLA 2XWAA 1KXBA 4B1TA 2BHGA 1MTUA 5HMAA 3RXGA 3ZZ6A 3SNBA 1TPPA 2XRCA 4X8SH 3SJ8A 2SGAA 1CBWB 1BTZA 3QLPH 4BTIB 3R3GB 1NS3A 2J94A 2Y7XA 2PLXA 2ZFQH 1VITG 1H8DH 4Y0YE 1ZRBA 1FAXA 1TGBA 1BOQA 4FU8A 5DJ7A 3PTBA 4WMEA 1ZSJA 3NK8A 2XBXA 3LC5A 1C1SA 1ABJH 1FUJA 1U6QA 2XNIA 1CT4E 1O5CB 1BQYA 4FUDA 1BTYA 4D7FA 1O2LA 2SGDE 3E3TA 1PPZA 3F9FA 4JZIA 3SI4H 4ABEA 4ZHLU 2WPIS 3MH5A 4OS2A 1Y3XA 2P16A 2QF3A 1UTNA 3BG8A 3LH3A 3M3TA 2ZECA 1HAGE 3KQEA 4LK4A 4X2YA 1C5QA 1GHXH 1P9UA 1V2TT 3KNXA 2R3YA 5FPTA 3URDA 1V2QT 4YTAA 3TU7H 3SQHE 1BB0B 2NU0E 1FY3A 1HB0B 1OWJA 2I6QA 4K5ZA 4KTUA 2A32A 3FZZA 1P9SA 2BDCA 4HI3A 1ARCA 1Y3VA 1T4VH 4NA8A 3VGCC 4Z0KA 3SU6A 9LPRA 3A8BA 1TNLA 2Z9GA 2VU8E 1AKSA 4BXSA 3UFAA 2XC0A 3FP7E 2DE9A 1S6FA 1A3EH 2Z6BD 3PMBB 3LONA 1LQEA 2QF0A 2XW9A 3SV8A 2ZDNA 1QY6A 3SU1A 1O5BB 2F9UA 2H6MA 4YOGA 4FUEA 4HTCH 1KXAA 4YT7H 3M35A 1IQNA 2C8XB 5HM2A 1VCWA 5DP9A 4MPXA 1PPCE 4B75A 4J2YB 1CU1A 1AN1E 3F9HA 4DT7B 3F6UH 4AGJA 2TGAA 1NY22 4Y71A 1GI8B 1TPOA 1AUTC 1W3CA 3RXUA 5CHAC 1EKBB 7GCHG 1YPGH 3HGPA 2XCNA 1TWXB 2F9NA 5AFZH 1YPHC 1MTNC 3ZZAA 2OBQA 1O38A 3U8RH 2CMYA 3ELAH 1GBIA 3ZV8A 3NZIA 3RXCA 1CGJE 3A8AA 1NM6A 1TNKA 4ZAEA 2ZO3H 1NU7B 4RKJB 1KLIH 3S7KB 4YOIA 4NA7A 5HM9A 1TMUH 5T6GA 3GY8A 4UFDH 3RMOH 5JBBS 2XBYA 1LQDB 2HNTC 2ZDLA 1J9CH 4UFFH 2V3OH 3TJVA 1CVWH 1QL9A 2OXSA 1DS2E 1IHSH 3P95A 3STIA 2ZKSA 1P10A 1DSTA 1O3CA 1NESE 4OS6A 1B0FA 1AQ7A 1BTXA 3SNCA 1GI5A 3M3SA 1TGNA 3BTKE 1W13U 1GBEA 5EPYA 2EI6A 2WUBA 1C5XB 1FXYA 3Q3XA 1KXEA 3RC5A 2ZEBA 3SNAA 3BIUH 2FLRH 3LPRA 1MQ5A 5FCRA 4IN1A 4JYTA 2HWLB 2ZFTA 1AB9B 2IPHA 4DCDA 2BY5X 1QFKH 1FLEE 4WH6A 3A86A 5IYTA 1A1RA 1NTPA 3EE0B 1PPFE 3A7YA 2R0KA 1ABIH 4ABHA 1P3CA 4BAOB 4IC5A 2O8UA 3O8RA 1GBJA 1H9HE 2SGFE 2VINA 1ELDE 1KXDA 4ZXXH 1HAVA 2AS9A 1F5LA 5LGOA 2GP9B 4WY3A 1V2WT 1F0RA 1GBDA 1SFQB 3E8LA 1GBCA 1BTPA 1GJ9B 1Y3YA 1QB9A 4ISHH 4X6MA 2ZGHA 4VGCC 3VXEH 1HNEE 1O5FH 1BHXB 1SPJA 3QZRA 4MPVA 4AYVB 1DY9A 2BDAA 1SHYA 4O03A 1B7XB 3GDVA 4ZH8A 1BHXF 2A7CA 3U69H 1HYLA 4NGAH 2FXRA 1A3BH 1DITH 1ELCA 5AVDA 1ZLRA 1CBWC 1O3OA 4LZ4B 1O3MA 5BRRE 3NUMA 1AGJA 2ZGXH 3P8FA 2GTBA 1OYQA 1GJ7B 4A7IB 1RTFB 3W95A 2FEQH 1UTLM 1Z8GA 1UVOA 1L4DA 4TYDA 3QGNB 3L33A 1C1WH 4FUFA 1CA0B 3E16B 2CGAA 4SGAE 5K7RA 1FY4A 3BEUA 2ZFRH 5DGJA 1Y5UT 2Z9JA 4ABFA 4FU7A 3TJNA 2UUJB 3SGQE 2Q1JA 5FXLA 1ELGA 3SV7A 2BOHB 1HAZB 1K22H 3SHAH 4FUHA 4YOJA 4ZKNU 2NU4E 1VCPA 2RA0A 1LVBA 3HK6B 2BD3A 2XXLA 4H4FA 1AWHB 3P6ZB 1S6HA 3I78A 4D9QA 2BLWA 1B5GH 4X0WU 4MG3A 1O2PA 1O3HA 2GX4A 1QIXB 4TWYA 1AE8H 4RKOB 2G4UA 4IMZA 3SZNA 1P8VC 1E38B 4YLQH 5C20A 2FP7B 2FESH 1OS8A 3JZ1B 1UMAH 2M5TA 2OINA 1K1PA 1C5WB 2ANKH 1O5EH 4A1TA 2FDAA 1XKAC 5FX5A 6GCHG 2RCEA 4GHQA 1E35B 2BY9X 3RP2A 4MNXA 1BA8B 1BMLA 1UO6A 1ZJKA 4AFUA 1TNGA 2VH0A 2ZP0H 3MWIU 4UD9H 1G32B 2BXTH 3DFLA 1EATA 1AKSB 1KXFA 1LHCH 3DHKH 2XTTB 1ESAA 3BTTE 3M61U 1PQAA 3RXFA 4Q7YA 4AG1A 2FI5E 1PYTC 1GBMA 4IGDA 5DG6A 2F9PA 1GMDG 3P17H 2BD5A 4TPIZ 1GBHA 4GCHG 3S0NA 2GCHF 2A4QA 1WU1A 1K1MA 1LKAA 3LGVA 1GHZA 1HUTH 1ZGVA 4NWKA 2EEKA 1C9PA 2QN5T 5K0HA 5F03A 4MLFB 2OP9A 1HFDA 3GYLB 1GI4A 2ESTE 4ZROA 1EZUC 1DXPA 5J4SA 2ZPRA 4NSYA 1DLEA 1QB1A 2GMTB 2O9QA 2ZFFH 1TGTA 3GCHB 1DM4B 1K9OE 2FOHA 3SGAE 2H9HA 4WVPE 1UVTH 1IQMA 2G00A 1QRZA 3CS7A 4OS7A 1MKXK 2YOLA 5DP4A 1AI8H 1MKWH 2CJIA 3PYHA 1KXCA 1T7CA 3ZV9A 3GY4A 1O36A 5L6NH 4MNYA 5FCKA 4WH8A 4ZKSU 2ZDVH 5T3HA 3A80A 3TGJE 2FS9A 1F0UA 1O3GA 4TY6A 7LPRA 4ISIH 1JMOH 2UWOA 1QJ7B 4JZEH 5TCAA 2FZZA 1NZQH 2QGRA 4J1YA 2BLQA 1PFXC 1WUNH 3KQDA 3RXLA 1AB9C 1PPEE 5EQSA 2SGQE 1V2JT 5FBEA 1O2KA 1C5OH 2Z9LA 1DUAA 1GBKA 2C8YB 2D2DA 1O3FA 1ORFA 1ANCA 1VJ9U 3DT0H 4BXWA 2OBOA 1A5IA 1ELTA 3KHVA 3OY6U 1PQ7A 3IG6B 1C5NH 3ATMA 1DPOA 1FY1A 5HXFA 3PMJA 4UFEH 3ZYEA 3T27A 1GJ5H 1L0ZA 4B76A 3VB7A 3ZVEA 1W14U 1O3AA 2R0LA 1QL8A 2ZTXA 2A31A 3TK6A 1HAVB 1MQ6A 3ITIA 2VIOA 3ESTA 2ZTZA 3BTEE 3PLBA 1F5RA 1TONA 1UVSH 4WXIA 1GJAB 1O3JA 3MTYA 5T6FA 5A09A 4ABDA 1P04A 4AGKA 4ABBA 2ODYB 4I8HA 1KSNA 1TRNA 5GDSH 2FMJA 3STJA 1PPBH 5C1YA 5EQRA 3RLYH 2ANYA 5DP8A 2ZQ1A 1F5KU 1CA0C 2OQ5A 2FOMB 5FPYA 1TPSA 3GY2A 2P8OB 1EX3A 1PPGE 1X7AC 3RXEA 1PQ5A 1XUKA 1YCPM 4F49A 5A0AE 1TB6H 2BD4A 1ZPBA 1Y5BT 1RJXB 1TIOA 4BTUB 3RC6A 2ZHWH 2AIPA 3SN8A 4Y10E 2THFB 2VVCA 1HAYB 1GCTB 1NFYA 2D26C 2QIQA 4WJG2 3GDUA 4U32A 1BRAA 2AMDA 2J38A 4ZKOU 1NROH 4D76A 1IQFA 3GY3A 4Y11E 5C2ZA 1P02A 2AGEX 1THRH 5GXPA 2WV5A 3GY5A 1SGEE 4MPUA 4Y8ZA 4BANB 1K1OA 3BSQA 2OUAA 1L1GA 2HLCA 2BY6X 3LC3A 3EGKH 1TFXA 1XUJA 1EB1H 4BNRA 1E0FD 2WPLS 1GMHF 1B0EA 1GG6B 1O3DA 1UTMA 1PYTD 2FTMA 4JYVH 3SJKA 3TK9A 1LHGH 1KLTA 2JH5D 1MTWA 3ZZ5A 3SU5A 4RSPA 1C5RA 1PPHE 1GI7B 2GV6A 2ZIQH 1ZJDA 2AGGX 4BAHB 1FN8A 1RTLA 1QHRB 3K6ZA 1TALA 5CMXH 1G2LA 3TGKE 3RXMA 4FUIA 4Q7ZA 3SU4A 3ZZ8A 2A5IA 5F8TA 1QRWA 2AYWA 3RXPA 5GCHG 2VGCB 1NRNH 1GHBF 1P11E 1FQ3A 4ZXYH 1LO6A 3A87A 1QCPA 3ZZ9A 1YF4A 2BTCE 2ZHQH 1ZHMA 1QA7A 3GY7A 4JZFH 2A2XH 1EXFA 1GHWH 3PMAB 1D3DB 1BBRK 2GMTC 4KKDA 1T32A 1W2KH 1UTQA 2FX4A 3ZZDA 3GCHC 3VPKA 2A7HA 3OY5U 2GKVE 1J14A 1TNHA 2OC7A 3A7VA 3PWBA 3EAJA 2ZI2H 1Z1JA 1SQOA 3SO3A 3Q3YA 3MU8A 1AZZA 1C1VH 4GHTA 5F8XA 1A46H 2TRMA 1KLJH 4H42U 1LPKB 5JB8S 4K60A 5ABWA 3SQEE 3SBKA 3M7QA 2FPZA 4Y8YA 1YYY1 1VR1H 3LGIA 1OKXA 1BMAA 4MNVA 3SHCH 2H9EH 1MD8A
chains in the Genus database with same CATH superfamily
4NCYA 1J8AA 3NWUA 1V2MT 1C5UA 1HLTH 6CHAB 3F2FA 1BIOA 1IQEA 1GJ8B 1GJ4H 2FIRH 3LOXA 5FPSA 1ZHRA 1LPZB 1O37A 1Q3XA 2IOTA 4HGCA 1O2QA 5EU8A 1P2JA 4DJZB 4X1RU 1OWEA 2O8WA 1AY6H 3A84A 2WPJS 3E1XB 3QGJA 1AE5A 2ZDAH 2QXJA 8KME2 5A8YA 2ODPA 1EZSC 4CBOA 3TPIZ 3OAAD 1C1UH 1BMMH 1AVWA 4XBDA 1FPCH 3PTNA 3F0PA 1F92A 1K21H 1NFWA 2ZFPH 2BD2A 3SU0A 3FFGA 5ETXA 1WOFA 1EAXA 1FDPA 3FAOA 1TX8A 1XUHA 4I31A 4CRDA 2D1JA 2PW8H 1MZAA 4B2AA 5C67A 2UWLA 2WYJA 3PV2A 4F48B 2G51A 1MH0A 4XE4A 3GISB 2QY0B 2PSYA 4E05H 3MOCA 1XKBC 4XSKU 1OSSA 4O9VA 1KIGH 1ZMNA 1N6XA 1UCYK 1ZTLA 2R9PA 4Q2KA 1CHOG 2GV7A 4AFSA 3UQOA 4ZHAA 6GCHF 1IAUA 3W1EA 1P03A 1DX5M 3KQCA 5EJZA 3BTME 1SGFA 1NO9H 1AVGH 4H6TA 5TCCA 5EPNA 1C5TA 2P8OC 3H7TA 6LPRA 1L1NA 1HJ8A 2R2WU 3LT3A 1QB6A 1NU9A 2ZGJA 3SUEA 2O8TA 1UTKA 1Z6JH 1GCTC 2HALA 1V2ST 1YPEH 1C4V2 3SUDA 2VIQA 1GMHG 1O2XA 1P0SH 5EIYA 2V3MA 1TABE 1HAPH 1DOJA 4AYYB 1BRUP 3RDZA 1LTOA 3RXSA 3IITA 1GMDF 1DDJA 1F2SE 4IW4E 5L2YH 1P01A 4NIVA 1SGPE 4GCHF 1ARBA 4BTTB 3BEFB 1SGYE 1O5AB 2F9VA 2XBVA 3TIUA 4CRBA 2BDHA 3DD2H 3MU4A 2TGPZ 5LPFA 1HAOH 3QO6A 2V0BA 4P02A 2QC2A 3A7ZA 2LPRA 2BLOA 3S69A 1LHEH 5C17A 5EXNA 4UE7H 2F9OA 1GG6C 2KX4A 4AG2A 4JYUH 5C3NA 1MD7A 2SNVA 1ANEA 8GCHG 1AFEH 1KY9A 2BMGB 4O97A 3EA8A 1YCPH 4FXGH 1K1NA 3ZZ4A 3GICB 1FV9A 1C5LH 1QGFA 4DY7B 2HVYB 2ANMH 1GHBG 3M5OA 1J15A 1P2OA 1ZR0A 3V0XA 2HGTH 1UHBB 4ISLA 1C2FA 3FP8E 2B0FA 1HCGA 1K1LA 3NPSA 3VG8A 1S0QA 3U1IB 5GWZA 3RXIA 2AFQB 3QN7A 2BLVA 1QJ6B 1DT2A 1HJAB 4A1VA 3PV4A 3QDZB 5C5OA 3E6PH 4DOQA 1C5PA 2GD4B 1UVPA 5EG4A 3QTVH 4Y7AA 3SJOA 5DP6A 2GGVB 1H1BA 2V3HH 3DUXH 1SLXB 2VGCC 1AHTH 3KEEA 2JIZD 2OC1A 1NFXA 3HK3B 5DP7A 1YPHE 4X6NA 3F3BA 2H9TH 3AASA 2F3CE 4WWYA 5HKKD 2BDBA 4U2WA 3BV9B 5ESTE 5E0HA 1OP8A 2VBCA 4RT1A 5DK1A 3K6YA 3F9GA 5AFYH 4LZ1H 2XNDD 2ZU3A 1P2NA 1ELEE 3N7OA 1O2SA 3B23B 2EY4C 2G5VA 1KDQA 4BAQB 4CRFA 3DCLA 2GVFA 4KGAA 3LGWA 4JZDH 4X2XA 2HNTE 1ZZZA 1E1RD 3QUMP 3TK5A 3H7OA 2QV1A 3QWCH 4B74A 2OTVA 1WDIA 4NZQA 1GDNA 3HGNA 2F91A 3VXFH 2JETB 1ETRH 4CBNA 1G9IE 2KAIA 1C5VA 1QTFA 1W0JD 2AH4X 1GBFA 1C1MA 4OGYA 2W7SA 2VNTA 3RXQA 1EPTA 1YPJH 1QQUA 1ZRKA 4FUCA 1NRPH 4D9RA 4X6OA 3EDXB 1V2UT 2B5TB 3BTWE 4M9FA 1FJSA 1L2EA 4IBLH 3F2GA 1RGQA 2HVXA 3AVZA 3RC4A 3P70B 1TBQH 1D4PB 1MTVA 3AAVA 3ATIA 2FOCA 1ACBE 1SB1H 5DP3A 4A1XA 6CHAC 1TMBH 4B2CA 4P00A 1QL7A 1HBTH 2FYQA 3RXJA 2DUCA 1ZHPA 2JH0D 4UDWH 1AVXA 2XC4A 2C3SA 3MO3A 3ODFA 2Z3DA 1TNJA 2W5EA 3P8NA 4I32A 2UUKB 3LIWA 1SGQE 2P3FH 1J16A 3RMMH 1CSOE 1JIMA 5DPAA 4CREA 1MAYA 2VH6A 1VITH 1WYKA 3RMNH 4MDSA 1C1RA 4DW2U 5E0JA 1CO7E 3H09A 8ESTE 3RXVA 2J95A 2OQUA 1UW7A 2EA3A 1FIWA 4B71A 3VB4A 3A81A 4FUJA 4ZMAH 5C0TA 1WCZA 2F9BH 3MH4A 1ETSH 2TBSA 3UIRA 3C1KA 1G3CA 2BDGA 4K2YA 3KF2A 2JJ1D 3LH1A 2WHXA 1CT2E 4AFQA 5J4QA 2A4OA 3UWJH 1AFQB 3BIVH 2JJ2D 2FOGA 2CN0H 3A82A 4F55A 1XXDA 4HFPB 2TIOA 1YP9A 4NIYA 3ATWA 2Z7FE 3PROA 1GBBA 5IDKA 1LCYA 4THNH 1TYNA 2F83A 2Q6GA 1SC8U 1V3XA 2ZGCA 3TH2H 3RXAA 1XVMA 3IWMA 4I8KA 5KGOA 4ZHMU 1TRMA 4E06H 3W94A 1SG8B 1TRYA 1G3DA 1HAXB 4F4OC 4Q7XA 4OS4A 5EODA 2KCPA 3F2HA 1S83A 2WPKS 2GZ9A 1AMHA 1Z8RA 3ZZBA 3OU0A 1DWBH 4YT6H 3UPEA 4XD7D 1V6DA 1K0HA 1BCUH 1BBRE 3K2UA 1OXGA 4FETA 5FHTA 1SI5H 2IPQX 4I33A 5EJ1A 1SR5C 1HGTH 2KZ4A 2QAAA 1C4U2 5GJ4B 3BG4B 3LDXH 5GCHF 1BMFD 5EOKA 1O3EA 5A8XA 1DUEA 4XBBA 5B6LA 3O8DA 1C2MA 2V6NA 1V2OT 1P3EA 3FOAA 4IC6A 3U1JB 4TSFD 5EXMA 3WWFA 1E79D 1O3BA 2G4TA 3GCOA 4MQAA 1JBUH 1C5MD 3BEIB 1SMFE 1UTPA 1RIWB 1TGSZ 2ZCHP 3GDSA 2XYAA 2OC0A 1SQAA 1N1LA 2PTNA 4ZKRU 1UK4A 5PTPA 3BF6H 3SV6A 1M9UA 3AW1A 2HPQH 4IMQA 2EI7A 4Q63A 4U30A 2H2ZA 4X8VH 2Z9IA 5JBTA 4U01A 2ZZUH 1XMNB 2R2MB 3V13A 1G3EA 1F7ZA 2YNBA 1EQ9A 2LP6A 3MH6A 3RXTA 4ZCNA 1OWHA 4WF8A 1ZSLA 1HJAC 3E0PB 4UONA 1OOKB 3I77A 1H9LB 5DO4H 2G52A 2BD9A 3N7EA 1P2KA 2ODQA 4WMDA 3NRLA 3O8BA 4CH2B 3MFJA 1LVMA 3QZQA 3ZZCA 4NIWA 3KN2A 3EYDA 3C27B 1HIAA 1JRSA 2BDIA 3U8TH 3ATKA 1DWEH 4E7RG 1SBWA 4A5TS 1QA0A 4DVAU 1SOZA 2ULLA 1ZYOA 1H4WA 1GPZA 1NN6A 1IQGA 5A0BA 3LJOA 1ZPCA 1C1OA 1GJ6A 3MNSA 2HLDD 1EJAA 2ZWLH 5GIBA 2FTLE 3F0OA 3Q00A 3FVFB 3HATH 2Y82A 1RTKA 1JRTA 3ZYDA 1AO5A 3TH3H 2VVVA 1K2I1 3M5NA 3GS9A 2JETC 2QCYA 3SI3H 1CGHA 5SGAE 1C2LA 1S6LA 3ZVDA 3TGIE 4SGBE 1HJ9A 1O3NA 4TT3D 4X1QU 1V2LT 1ZGIA 1IQLA 4K8BA 2RFKC 3LKWA 3RXDA 1UVUH 2Y7ZA 5FBIA 1KTTB 1DLKB 2GT8A 1TOCB 1V2VT 1ZPZA 1C5ZB 2ZHEH 1MTSA 2EC9H 1TA6A 1NRRH 1GVKB 3M5MA 1EOLA 2I6SA 1Z7KA 3MU0A 1ETTH 1O2MA 1ANBA 1EJNA 2KAIB 1TA2A 1O2IA 1UTOA 2OCVB 3UOUA 4GVUA 4GSOA 1EPTB 3Q77A 3MH7A 1OWDA 4JMYA 1O0DH 1CHOF 3RXKA 1P57B 2C90B 3HKJB 1ZMJA 2FM2A 3VB6A 1Y8TA 1DWDH 5DP5A 2OD3B 2J5UA 1IQIA 1EAIA 1P2QA 2A4RA 3RXHA 4UFGH 2A2QH 2QXIA 4X1PU 2C8WB 1O5DH 1W8BH 2SGEE 4CR5A 3MU5A 7ESTE 3A7TA 1GVZA 2ZHFH 5EW2H 1YPKH 3S7HB 1SKYE 3PLKA 1MAXA 1JOUB 2VIWA 1EZXC 1TLDA 1BBRH 4AB8A 3SNDA 4Y0ZE 2HPPH 3RU4E 1DVAH 2PKAA 3BTGE 4A92A 2BXUH 1TMTH 4DT4A 4YM9A 4JK6A 2G5NA 1OP2A 3CS0A 1EP5A 4R8TB 3BTHE 1NPMA 2VWLA 1AFQC 3MI4A 1GL0E 4PROA 2Q6FA 2PUQH 4YESB 3SJIA 2Z3EA 1Z8JB 1TNIA 4NFFA 7KMEH 4CRGA 5L30H 1MU8B 3SW2B 3MQKC 1OWKA 1GJCB 2QXGA 1PQ8A 2WPMS 3VEQB 1S84A 3GCTG 1FY8E 1A61H 2J9NA 3A8CA 1V2RT 1DXWA 1O31A 2F4LA 4MVNA 1SGFG 3DSGA 1YKTA 8GCHF 1G3BA 4YO9A 3M7UA 5A0CA 3R0FA 1V2PT 1WTHD 5DSFA 2XCFA 4X2WA 3NXPA 3E0NB 4X8UH 1Q2WA 2J2UA 1FIZA 3UY9A 1GHVH 1SGCA 4AZ2B 1YY3A 1OHHD 4YXWD 2W26A 3SYJA 2PGQB 2ZPSA 1HV7A 2J97A 2K0QA 2J92A 2PKSB 1BJUA 2PTCE 3BG4C 1EP6A 1C2JA 1EZQA 1O2GH 1UK3A 1IQJA 2R3UA 1D3TB 4QT8C 1W0YH 1XM1A 1FN6A 4INHA 1F0SA 1FAKH 3ZVFA 1SGDE 3GY6A 1ELVA 2SGPE 4KP0A 5JBAS 1GMCG 1BITA 1A0HB 2BOKA 3OE7D 4OS1A 2ALVA 2VJ1A 3DA9B 3SOSA 1SLVB 2OC8A 2ZCLP 3LJJA 1RIWC 1FONA 2H5DA 1FI8A 4FUBA 2ZC9H 3VB3A 1YM0A 1WQSA 3D49H 2VIVA 4ABIA 2RDLA 1Y5AT 1UCYH 1L4ZA 2LELA 2Q6DA 5T6DA 4K3JA 5I25A 1WTGH 1O2NA 3OEED 4K1SA 1SSXA 1OX1A 3RU4D 1GI9B 1ELBA 1AIXH 1RRKA 4O3UA 9ESTA 2SNWA 3MYWA 1UTJA 4Y8XA 4FVDA 1P2IA 3A88A 5A2MH 2P94A 2PGBB 1GCDA 1P06A 2BX4A 2H5CA 2VWMA 1WAYB 1O2YA 3EQ0H 1EAWA 3K65B 1O3KA 1TGCA 1ID5H 2Z3CA 5H4IB 2QA9E 3UOPA 1QBOA 2PP6A 1SHHB 1L1JA 5DKMA 1D6RA 4ISOA 4LXBH 5EGMA 1C1QA 1EAUA 1GI2A 3NCLA 2NU2E 1NT1A 1QNJA 2FI4E 2ZCKP 1BJVA 1GHYH 2BY8X 3A7XA 1VGCB 4I8LA 4RN6A 4WXVA 2P59A 1O2WA 5LPEA 3SUGA 1HIAB 3KIDU 4R0IA 1K1JA 1S85A 1SFIA 2WUCA 2GZ8A 3SJ9A 2LNCA 1FZZA 4Q80A 1QR3E 4AB9A 1P12E 1V2KT 3RM2H 5FAHA 2CXVA 3PMHB 3U98H 4X1SU 1WBGB 3SU2A 1GWAA 1OP0A 4ESTE 5FX6A 3RU4T 3UR9A 2RDEA 5E2PA 1V2NT 5AHGH 1TX7A 4X1NU 1GJDB 3RXBA 3TLOA 2PSXA 1WQVH 3M36A 1MCTA 4A6LA 1COWD 2GZ7A 2J4IA 2PV9B 1G2MA 4IS5A 1TBRH 2QYIA 1EB2A 5CDFE 1EPTC 5CE1A 2V35A 1HAHH 2VIPA 3B9FH 3GYMA 3I29A 8LPRA 1G37A 3EA9A 2Y5FA 3Q3KA 1RS0A 2FI3E 5C1XA 1O35A 4AX9H 2B7DH 1ANDA 1ESBA 3A8DA 1A0LA 4AN7A 2XBWA 2KCOA 1BDAA 3KL6A 1TE0A 2WV4A 2ALPA 3TNTA 4NA9H 2HRVA 1FMGA 1FX0B 4AC9A 1DE7H 3N7DA 5HGGA 2K1QA 1NFUA 2RG3A 2P95A 3D65E 3U9AH 1EASA 3A83A 3UR6A 2SFAA 2GCTB 4Q4LA 3BTFE 1TX6A 1SVPA 2GT7A 1G36A 4JZ1A 4Y76A 1J17T 1GGDB 1C1TA 5F8ZA 2OK5A 3V12A 1AZ8A 3KQBA 1YGCH 2FO9A 1SQTA 4TWWA 1O5GH 3AAUA 5EXLA 3RXRA 1F0TA 1D9IA 1P09A 1O2RA 1ZTKA 4BAMB 3UNQA 4YZUA 3KCGH 1BT7A 1GHAF 3DSOA 3TH4H 3T28A 2PKAB 3MU1A 1A5GH 4NWLA 1IHTH 1K28D 1GBAA 1UK2A 3SU3A 1H8IH 4CHAB 1C2DA 2P3UB 5DN6D 3MNBA 1FY5A 1G30B 1O34A 1W7GH 5JB9S 2IJD1 3RM0H 1H8HD 1SGRE 1VZQH 3PLPA 1QBVH 1XX9A 4INLA 3S9AA 2Y80A 2BD8A 5GPIB 4BAKB 1E1QD 1O2OA 1D3PB 1P05A 1QBNA 4CR9A 4ACAA 4DIIH 1TPAE 1RD3B 4DURA 4LOYH 2FOAA 1C4Y2 2H1UA 1QQ4A 4ASHA 1LVOA 3F9EA 2PKSC 2BQWB 2BVRH 1A0JA 5IK2D 3LGUA 3A89A 1C2GA 1MABB 1C2KA 4YLUA 3F1SB 1CHGA 2C93B 4NIXA 1W12U 1ZSKA 5EQQA 2ZA5A 4I8JA 3L6PA 4TY7A 2BZ6H 1OWIA 3ZVBA 2QF4A 1VCQA 3E91A 3HKIB 2C4FH 1MUEB 1O3IA 4MPWA 2ZG0H 2FODA 1Y3WA 1YPMH 2STAE 3MNXA 3LGTA 4X2VA 4GAWA 4AFZA 1YCPK 2BB4A 2ZU5A 5LPRA 4DG4A 2ZU2A 3RMLH 1MZDA 4WMFA 3UAIC 3PWCA 2VWOA 5EW1H 3MO6A 1GI6A 2PWXA 3RLWH 1HXEH 2UUFB 4ABJA 3N99A 3EE7A 4M7GA 2Z9KA 1T8MA 2BQ6B 2WV9A 2G55A 3O8CA 2PFEA 1SGIB 1YC0A 3PO1B 1BUIA 1ELFA 3DFJA 2BQ7B 1DICA 2VVUA 3S9BA 1SLUB 4MTBA 4I7YH 4CRCA 2AIQA 2G81E 4NZLA 2FYRA 1MBQA 2NU1E 1C5SA 2XWBI 5E2OA 3UNSA 4OS5A 3V7TA 1H9IE 2ANWA 1OPHB 1MU6B 3T62A 2BX3A 1GBLA 1XUFA 4ISNA 3RXOA 1QRXA 2EI8A 4DIHH 1O2HA 1A5HA 1INCA 2FOFA 1SOTA 2NWNA 3LGYA 2PHBA 4KELA 1S5SA 3ZVCA 5L2ZH 3CP7A 1BTWA 5BPEA 2WYGA 1AWFH 1GL1A 2JH6D 1NRQH 2YMSB 1O3PB 5CHBA 2PR3A 3ZZ7A 5B6OA 2ILNA 3BN9A 3UWIA 1IQHA 4GUXA 2KFWA 1VGCC 1YPLH 4ABGA 1MKXH 3JZ2B 1N8OB 2AGIX 5AF9H 1E36B 1EOJA 1GJBB 1CQQA 4IN2A 1GI3A 4AOQA 3EA7A 1AUJA 3A85A 2WINI 1O2TA 3ENSB 2FOBA 1C2HA 4FUGA 1THSH 2WPDD 1SGTA 3OYPA 4ZUHA 1SLWB 1GI0A 4ACBA 1O30A 3ZVGA 4JCNA 3LU9B 2CHAB 3T25A 1SL3A 2VIDA 2QF5A 5JDUB 4INKA 3MHWU 4K8YA 4H6SB 1N6YA 1T8NA 2KR7A 1DSUA 3UQVA 2DE8A 3KGPA 2V7QD 2GJGA 3GOVB 3GCTF 4Y79A 5JPMH 1LPGB 2A45B 1PJPA 5ESBA 3S9CA 1E34B 1HDTH 1XVOA 3A7WA 3M7TA 3PRBA 5KECA 1CT0E 1O2UA 1CA8B 5A8ZA 3TJUA 2BZAA 1IOEA 1FPHH 2BD7A 2FLBH 4XOJA 1O2VA 1KYNA 2BY7X 3B8JA 1HRTH 3CNRA 1ESTA 3RUOA 1C9TA 1GHAG 2GCTC 2HOBA 2BVSH 1ELAA 4FU9A 4I8GA 1C5YB 4D8NA 3SUFA 2CV3A 1O32A 1W0KD 2BDYA 2ZPQA 4K1TA 2GDDA 3ATLA 1GGDC 2O8MA 2OLGA 1LKBA 1TOMH 2CF9H 3T2NA 2QXHA 1E37B 1XUIA 4OGXA 4CH8B 1O39A 5C94A 4O3TA 3TVJB 1BMNH 3H5CB 3P8OA 1K1IA 3NKKA 4KTSA 1LHDH 3SV9A 4XRNA 1GMCF 2A5KA 3E90B 1DWCH 1EUFA 2JKHA 4BOHA 3MO9A 3UUZA 3SV2H 5C1UA 2UWPA 3PB1E 4Z1MD 4CHAC 1W10U 2PUXB 3QX5H 2TGDA 2XC5A 2D8WA 3T29A 1WXRA 1Y59T 5I46H 1TAWA 1JXPA 1Q31A 1BTHH 5EJLA 1VITF 2Z94A 5HYOA 3ZVAA 4XDEA 1S81A 1QJ1B 5JYIA 4Y7BA 2ZFSA 3VB5A 1NRSH 2K8IA 2TGTA 2A1DB 1Z71A 2XOKD 4Y6DA 5F53A 2FOEA 2TPIZ 1YLCA 3G01A 4ASUD 2BM2A 1Z8IB 2STBE 2ZHDA 3M37A 1YLDA 2BYAX 3WY8A 1IQKA 1GVLA 1HXFH 2B9LA 3U28C 2CK3D 1P2MA 1W0ZU 2C8ZB 3VGCB 1VJAU 1O2JA 1S0RA 1UCYE 1KTSB 2ZDKA 2AMPA 1Z1IA 2VB0A 4NG9H 1WSSH 1XXFA 3QTOH 2P3TB 1MKWK 1KDQB 5G4BA 1LVYA 4UEHH 3M3VA 3D23A 4K69A 5JBCS 1DFPA 4FOUC 1RXPA 1JWTA 3L3TA 3M5LA 1CGIE 1C1PA 1HAIH 2ZDMA 1SGNE 1UJ1A 1MBMA 4K1EA 1LMWB 1A2CH 1Z6EA 3OTJE 4Z6AH 4CRAA 4NSVA 5C5NA 1MCVA 2FWWA 2ZQ2A 3MMGA 1TBZH 5CHAB 1AD8H 3U8OH 1ZTJA 2L74A 2ZNKH 3TITA 1DANH 4X8TH 1O2ZA 3V3MA 2O8LA 2AEIH 1DY8A 1O33A 3PO1C 4DGJA 2IJOB 1MTNB 1C1NA 3AW0A 3URCA 1LDTT 1T4UH 1BRBE 4OM9A 3UB0A 4B2BA 2B8OH 2WSSD 2FX6A 2YNAA 4D7GA 2L6OA 1KMHB 1C2IA 4FVBA 2Y5HA 1T31A 2J34A 4GPGA 1A7SA 2AMQA 3TJOA 3SGBE 4MNWA 3QK1A 1Y3UA 7GCHF 3F68H 3GCNA 4KTCA 2Y6TA 1C2EA 5F6MA 2YMSC 1LHFH 3PV5A 2HNTF 1CE5A 1D3QB 1GDUA 4B73A 2A0QB 3FZDA 1THPB 3Q76A 5E8EH 3HPTB 3SNEA 1N8OC 1O3LA 3MNCA 1UHBA 4NFEA 3T26A 2P93A 1ZOMA 2G8TA 2ZU4A 2GDEH 1RFNA 1XUGA 1MMJN 1H8ED 1GBTA 1W7XH 2A5AA 2CF8H 2W3KA 1S82A 1BTUA 2GCHG 1T8LA 3TNSA 1OYTH 2A7JA 5LH8A 1YBWA 1W11U 2W7UA 2CHAC 1WV7H 3ZZ3A 2A4GA 1A4WH 1GI1A 2NU3E 2ZF0H 1GDQA 1BZXE 1TQ7B 3PM3A 1NC6A 4AORA 4XBCA 2Y5GA 2VWNA 1EJMA 3VFEA 3CENA 4TPYA 3KYFA 1FNIA 2ZGBH 3T5FH 2F43B 2AHME 4X6PA 2W3IA 3ODDA 1D6WA 1QURH 2J98A 1T8OA 3PRDA 1HPGA 2ASUB 3D62A 2BVXH 2Y81A 3FANA 4ABAA 2ZU1A 5FL7D 4E7NA 3OX7U 3P92A 5TJXA 4VGCB 3BTQE 2WPHS 2ZTYA 2AERH 1BRCE 3OSYA 3UREA 3UNRA 1JIRA 4JK5A 3BTDE 2UUYA 1AU8A 3SORA 1TQ0B 3FP6E 4RT0A 3UTUH 4GLYA 4XFQA 3K9XB 3P8GA 5E0GA 2FS8A 6ESTA 2IN2A 2RA3A 4HZHA 1ZMLA 2XWAA 1KXBA 4B1TA 2BHGA 1MTUA 5HMAA 3RXGA 3ZZ6A 3SNBA 1TPPA 2XRCA 4X8SH 3SJ8A 2SGAA 1CBWB 1BTZA 3QLPH 4BTIB 3R3GB 1NS3A 2J94A 2Y7XA 2PLXA 2ZFQH 1VITG 1H8DH 4Y0YE 1ZRBA 1FAXA 1TGBA 1BOQA 4FU8A 5DJ7A 3PTBA 4WMEA 1ZSJA 3NK8A 5C0UA 2XBXA 3LC5A 1C1SA 1ABJH 1FUJA 1U6QA 2XNIA 1CT4E 1O5CB 1BQYA 4FUDA 1BTYA 4D7FA 2QE7D 1O2LA 2SGDE 3E3TA 1PPZA 2KCAA 3F9FA 4JZIA 3SI4H 4ABEA 4ZHLU 2WPIS 3MH5A 4OS2A 1Y3XA 2P16A 2QF3A 1UTNA 3BG8A 3LH3A 3M3TA 2ZECA 1HAGE 3KQEA 4LK4A 4X2YA 1C5QA 1GHXH 1P9UA 1V2TT 3KNXA 2R3YA 5FPTA 3URDA 1V2QT 4YTAA 3TU7H 3SQHE 1BB0B 2NU0E 1FY3A 1HB0B 3OFND 1OWJA 2I6QA 4K5ZA 4KTUA 2A32A 3FZZA 1P9SA 2BDCA 4HI3A 1ARCA 1Y3VA 5KEDA 1T4VH 4NA8A 3VGCC 4Z0KA 3SU6A 9LPRA 1NBME 3A8BA 1TNLA 2Z9GA 2VU8E 1AKSA 4BXSA 3UFAA 2XC0A 3FP7E 2DE9A 1S6FA 1A3EH 2Z6BD 3PMBB 3LONA 1LQEA 2QF0A 2XW9A 3AK5A 3SV8A 2ZDNA 1QY6A 3SU1A 1O5BB 2F9UA 2H6MA 4YOGA 4FUEA 4HTCH 1KXAA 4YT7H 3M35A 1IQNA 2C8XB 5HM2A 1VCWA 5DP9A 4MPXA 1PPCE 4B75A 4J2YB 1CU1A 1AN1E 3F9HA 4DT7B 3F6UH 4AGJA 4B6FA 2TGAA 1NY22 4Y71A 1GI8B 1TPOA 1AUTC 1W3CA 3RXUA 5CHAC 1EKBB 7GCHG 1YPGH 3HGPA 2XCNA 1TWXB 2F9NA 2YMSD 5AFZH 1YPHC 1MTNC 3ZZAA 2OBQA 1O38A 3U8RH 2CMYA 3ELAH 1GBIA 3ZV8A 3NZIA 3RXCA 1CGJE 3A8AA 1NM6A 1TNKA 4ZAEA 2ZO3H 1NU7B 4RKJB 1KLIH 3S7KB 4YOIA 4NA7A 5HM9A 1TMUH 5T6GA 3GY8A 4UFDH 3RMOH 5JBBS 2XBYA 1LQDB 2HNTC 2ZDLA 1J9CH 4UFFH 2V3OH 3TJVA 1CVWH 1QL9A 2OXSA 1DS2E 1IHSH 3P95A 3STIA 2ZKSA 1P10A 1DSTA 1O3CA 1NESE 4OS6A 1B0FA 1AQ7A 1BTXA 3SNCA 1GI5A 3M3SA 1TGNA 3BTKE 1W13U 1GBEA 5EPYA 2EI6A 2WUBA 1C5XB 1FXYA 3Q3XA 1KXEA 3RC5A 5HIYA 2ZEBA 3SNAA 3BIUH 2FLRH 3LPRA 1MQ5A 5FCRA 2WZQA 4IN1A 4JYTA 2HWLB 2ZFTA 1AB9B 2IPHA 4DCDA 1NBMD 2BY5X 1QFKH 1QZ8A 1FLEE 4WH6A 3A86A 5IYTA 1A1RA 1NTPA 3EE0B 1PPFE 3A7YA 2R0KA 3KQ5A 1ABIH 4ABHA 1P3CA 4BAOB 4IC5A 2O8UA 3O8RA 1GBJA 1H9HE 2SGFE 2VINA 1ELDE 1KXDA 4ZXXH 1HAVA 2AS9A 1F5LA 5LGOA 2GP9B 4WY3A 1V2WT 1F0RA 1GBDA 1SFQB 3E8LA 1GBCA 1BTPA 1GJ9B 1Y3YA 1QB9A 4ISHH 1VKYA 4X6MA 2ZGHA 4VGCC 3VXEH 1HNEE 1O5FH 1BHXB 1SPJA 3QZRA 4MPVA 3OEHD 4AYVB 1DY9A 2BDAA 1SHYA 4O03A 1B7XB 3GDVA 4ZH8A 1BHXF 2A7CA 2J98B 3U69H 4B6EA 1HYLA 4NGAH 2FXRA 1A3BH 1DITH 1ELCA 5AVDA 1ZLRA 1CBWC 1O3OA 4LZ4B 1O3MA 5BRRE 3NUMA 1AGJA 1YWUA 2ZGXH 3P8FA 2GTBA 1OYQA 1GJ7B 4A7IB 1RTFB 3W95A 2FEQH 1UTLM 1Z8GA 1UVOA 1L4DA 4TYDA 3QGNB 3L33A 1C1WH 4FUFA 1CA0B 3E16B 2CGAA 4SGAE 5K7RA 1FY4A 3BEUA 2ZFRH 5DGJA 1Y5UT 2Z9JA 4ABFA 4FU7A 3DSPA 3TJNA 1YLNA 2UUJB 3SGQE 2Q1JA 5FXLA 1ELGA 3SV7A 2BOHB 1HAZB 1K22H 3SHAH 4FUHA 4YOJA 3FO8D 4ZKNU 2NU4E 1VCPA 2RA0A 2W6ID 1LVBA 3HK6B 2BD3A 2XXLA 4H4FA 1AWHB 3P6ZB 1S6HA 3I78A 4D9QA 2BLWA 1B5GH 4X0WU 4MG3A 1O2PA 1O3HA 2GX4A 1QIXB 4TWYA 1AE8H 4RKOB 2G4UA 4IMZA 3SZNA 1P8VC 1E38B 4YLQH 5C20A 2FP7B 2FESH 1OS8A 3JZ1B 1UMAH 2M5TA 2OINA 1K1PA 1C5WB 2ANKH 1O5EH 4A1TA 2FDAA 1XKAC 5FX5A 6GCHG 2RCEA 4GHQA 1E35B 2BY9X 3RP2A 4MNXA 5T1VA 1BA8B 1BMLA 1UO6A 1ZJKA 3WW7A 4AFUA 1TNGA 2VH0A 2ZP0H 3MWIU 5HIZA 4UD9H 1G32B 2JDID 2BXTH 3DFLA 1EATA 1AKSB 1KXFA 1LHCH 3DHKH 2XTTB 1ESAA 3BTTE 3M61U 1PQAA 3RXFA 1SQRA 4Q7YA 4AG1A 2FI5E 1PYTC 1GBMA 4IGDA 5DG6A 2F9PA 1GMDG 3P17H 2BD5A 4TPIZ 1GBHA 4GCHG 3S0NA 2GCHF 2A4QA 1WU1A 1K1MA 1LKAA 3LGVA 1GHZA 1HUTH 1ZGVA 4NWKA 5GNDA 2EEKA 1C9PA 2QN5T 5K0HA 5F03A 4MLFB 2OP9A 1HFDA 3GYLB 1GI4A 2ESTE 4ZROA 1EZUC 1DXPA 5J4SA 2ZPRA 4NSYA 1DLEA 1QB1A 2GMTB 2O9QA 3OTPA 2ZFFH 1TGTA 3GCHB 1DM4B 1K9OE 2FOHA 3SGAE 2H9HA 4WVPE 1UVTH 1IQMA 2G00A 1QRZA 3CS7A 4OS7A 1MKXK 2YOLA 5DP4A 1AI8H 1MKWH 2CJIA 3PYHA 1KXCA 1T7CA 3ZV9A 3GY4A 1O36A 5L6NH 4MNYA 5FCKA 4WH8A 3SZEA 4ZKSU 2ZDVH 5T3HA 3A80A 3TGJE 2FS9A 1F0UA 1O3GA 4TY6A 7LPRA 4ISIH 1JMOH 2UWOA 1QJ7B 4JZEH 5TCAA 2FZZA 1NZQH 2QGRA 4J1YA 2BLQA 1PFXC 1WUNH 3KQDA 4HG6A 1AB9C 1PPEE 3RXLA 5EQSA 2SGQE 1V2JT 4I86A 1O2KA 5FBEA 1C5OH 2Z9LA 1DUAA 1GBKA 2C8YB 2D2DA 1O3FA 1ORFA 1ANCA 2W6JD 1VJ9U 3DT0H 4BXWA 2OBOA 1A5IA 1ELTA 3KHVA 3OY6U 1PQ7A 3IG6B 1C5NH 3ATMA 1DPOA 1FY1A 5HXFA 3PMJA 4UFEH 3ZYEA 3T27A 1GJ5H 1L0ZA 4B76A 3VB7A 3ZVEA 1W14U 1O3AA 2R0LA 1QL8A 2ZTXA 2A31A 3TK6A 1HAVB 1MQ6A 3ITIA 2VIOA 3ESTA 2ZTZA 3BTEE 3PLBA 1F5RA 1TONA 1UVSH 4WXIA 1GJAB 1O3JA 2M2AA 3MTYA 5T6FA 5A09A 4ABDA 1P04A 4AGKA 4ABBA 2ODYB 4I8HA 1KSNA 1TRNA 5GDSH 2FMJA 3STJA 1PPBH 3FN8A 5C1YA 5EQRA 3RLYH 2ANYA 3KYGA 5DP8A 2ZQ1A 1F5KU 1CA0C 2OQ5A 2FOMB 5FPYA 1TPSA 3GY2A 2P8OB 1EX3A 1PPGE 1X7AC 3RXEA 1PQ5A 1XUKA 1YCPM 4F49A 5A0AE 1TB6H 2BD4A 1ZPBA 1Y5BT 3ZIAD 1RJXB 1TIOA 4BTUB 3RC6A 2ZHWH 2AIPA 3SN8A 4Y10E 2THFB 2VVCA 1HAYB 1GCTB 1NFYA 2D26C 2QIQA 4WJG2 3GDUA 4U32A 1BRAA 2AMDA 2J38A 4ZKOU 1NROH 4D76A 1IQFA 3GY3A 4Y11E 5C2ZA 1P02A 2AGEX 1THRH 5GXPA 2WV5A 3GY5A 1SGEE 4MPUA 4Y8ZA 4BANB 1K1OA 3BSQA 2OUAA 1L1GA 2HLCA 2BY6X 3LC3A 3EGKH 1TFXA 1XUJA 1EB1H 4BNRA 1E0FD 2WPLS 1GMHF 1B0EA 1GG6B 1O3DA 1UTMA 1PYTD 2FTMA 4JYVH 3SJKA 3TK9A 1LHGH 1KLTA 2JH5D 1MTWA 3ZZ5A 3SU5A 4RSPA 1C5RA 1PPHE 1GI7B 2GV6A 2ZIQH 1ZJDA 3FKSD 2AGGX 4BAHB 4RI0A 1FN8A 1RTLA 1QHRB 3K6ZA 1TALA 5CMXH 2KM0A 1G2LA 3TGKE 3RXMA 4FUIA 4Q7ZA 3SU4A 2EQNA 3ZZ8A 2A5IA 5F8TA 1QRWA 2AYWA 3RXPA 5GCHG 2VGCB 1NRNH 1GHBF 1P11E 1FQ3A 4ZXYH 1LO6A 3A87A 1QCPA 3ZZ9A 1YF4A 2BTCE 2ZHQH 1ZHMA 1QA7A 3GY7A 4JZFH 2A2XH 1EFRD 1EXFA 1GHWH 3PMAB 1D3DB 1BBRK 2GMTC 4KKDA 1T32A 1W2KH 1UTQA 2FX4A 3ZZDA 3GCHC 3VPKA 2A7HA 3OY5U 2GKVE 1J14A 1TNHA 2KCYA 2OC7A 3A7VA 3PWBA 3EAJA 2ZI2H 1Z1JA 1SQOA 3SO3A 3Q3YA 3MU8A 1AZZA 1C1VH 4GHTA 5F8XA 1A46H 2TRMA 1KLJH 4H42U 1LPKB 5JB8S 4K60A 5ABWA 3SQEE 3SBKA 3WWBA 3M7QA 2FPZA 4Y8YA 1YYY1 1VR1H 3LGIA 1OKXA 1BMAA 4MNVA 3SHCH 2H9EH 1MD8A
chains in the Genus database with same CATH topology
4NCYA 1J8AA 3NWUA 1V2MT 1C5UA 1HLTH 6CHAB 1BIOA 1IQEA 1GJ8B 1GJ4H 2FIRH 3LOXA 5FPSA 1ZHRA 1LPZB 1O37A 1Q3XA 2IOTA 4HGCA 1O2QA 5EU8A 1P2JA 4DJZB 4X1RU 1OWEA 2O8WA 1AY6H 3A84A 2WPJS 3E1XB 3QGJA 1AE5A 2ZDAH 2QXJA 8KME2 5A8YA 2ODPA 1EZSC 4CBOA 3TPIZ 1C1UH 1BMMH 1AVWA 4XBDA 1FPCH 3PTNA 1F92A 1K21H 1NFWA 2ZFPH 2BD2A 3SU0A 3FFGA 5ETXA 1WOFA 1EAXA 1FDPA 3FAOA 1TX8A 1XUHA 4I31A 4CRDA 2D1JA 2PW8H 1MZAA 4B2AA 5C67A 2UWLA 2WYJA 2G51A 1MH0A 4XE4A 3GISB 2QY0B 2PSYA 4E05H 3MOCA 1XKBC 4XSKU 1OSSA 4O9VA 1KIGH 1ZMNA 1N6XA 1UCYK 1ZTLA 2R9PA 4Q2KA 1CHOG 2GV7A 4AFSA 3UQOA 4ZHAA 6GCHF 1IAUA 1P03A 1DX5M 3KQCA 3BTME 1SGFA 1NO9H 1AVGH 4H6TA 5TCCA 5EPNA 1C5TA 2P8OC 3H7TA 6LPRA 1L1NA 1HJ8A 2R2WU 3LT3A 1QB6A 1NU9A 2ZGJA 3SUEA 2O8TA 1UTKA 1Z6JH 1GCTC 2HALA 1V2ST 1YPEH 1C4V2 3SUDA 2VIQA 1GMHG 1O2XA 1P0SH 1TABE 1HAPH 1DOJA 4AYYB 1BRUP 3RDZA 1LTOA 3RXSA 3IITA 1GMDF 1DDJA 1F2SE 4IW4E 5L2YH 1P01A 4NIVA 1SGPE 4GCHF 1ARBA 4BTTB 3BEFB 1SGYE 1O5AB 2F9VA 2XBVA 3TIUA 4CRBA 2BDHA 3DD2H 3MU4A 2TGPZ 5LPFA 1HAOH 3QO6A 2V0BA 2QC2A 3A7ZA 2LPRA 2BLOA 3S69A 1LHEH 5EXNA 4UE7H 2F9OA 1GG6C 4AG2A 4JYUH 5C3NA 1MD7A 2SNVA 1ANEA 8GCHG 1AFEH 1KY9A 2BMGB 4O97A 3EA8A 1YCPH 4FXGH 1K1NA 3ZZ4A 3GICB 1FV9A 1C5LH 1QGFA 4DY7B 2ANMH 1GHBG 3M5OA 1J15A 1P2OA 1ZR0A 3V0XA 2HGTH 1UHBB 4ISLA 1C2FA 3FP8E 2B0FA 1HCGA 1K1LA 3NPSA 1S0QA 3U1IB 5GWZA 3RXIA 2AFQB 3QN7A 2BLVA 1QJ6B 1DT2A 1HJAB 4A1VA 3PV4A 3QDZB 5C5OA 3E6PH 4DOQA 1C5PA 2GD4B 1UVPA 5EG4A 3QTVH 4Y7AA 3SJOA 5DP6A 2GGVB 1H1BA 2V3HH 3DUXH 1SLXB 2VGCC 1AHTH 3KEEA 2OC1A 1NFXA 3HK3B 5DP7A 1YPHE 4X6NA 2H9TH 3AASA 2F3CE 4WWYA 2BDBA 4U2WA 3BV9B 5ESTE 5E0HA 1OP8A 5DK1A 3K6YA 3F9GA 5AFYH 4LZ1H 2ZU3A 1P2NA 1ELEE 3N7OA 1O2SA 3B23B 2G5VA 1KDQA 4BAQB 4CRFA 2GVFA 4KGAA 3LGWA 4JZDH 4X2XA 2HNTE 1ZZZA 3QUMP 3TK5A 3H7OA 2QV1A 3QWCH 4B74A 2OTVA 4NZQA 1GDNA 3HGNA 2F91A 3VXFH 2JETB 1ETRH 4CBNA 1G9IE 2KAIA 1C5VA 1QTFA 2AH4X 1GBFA 1C1MA 4OGYA 2W7SA 2VNTA 3RXQA 1EPTA 1YPJH 1QQUA 1ZRKA 4FUCA 1NRPH 4D9RA 4X6OA 3EDXB 1V2UT 2B5TB 3BTWE 1FJSA 1L2EA 4IBLH 1RGQA 2HVXA 3AVZA 3RC4A 3P70B 1TBQH 1D4PB 1MTVA 3AAVA 3ATIA 2FOCA 1ACBE 1SB1H 5DP3A 4A1XA 6CHAC 1TMBH 4B2CA 1QL7A 1HBTH 2FYQA 3RXJA 2DUCA 1ZHPA 2JH0D 4UDWH 1AVXA 2XC4A 2C3SA 3MO3A 3ODFA 2Z3DA 1TNJA 2W5EA 3P8NA 4I32A 2UUKB 3LIWA 1SGQE 2P3FH 1J16A 3RMMH 1CSOE 1JIMA 5DPAA 4CREA 1MAYA 2VH6A 1VITH 1WYKA 3RMNH 4MDSA 1C1RA 4DW2U 5E0JA 1CO7E 8ESTE 3RXVA 2J95A 2OQUA 2EA3A 1FIWA 4B71A 3VB4A 3A81A 4FUJA 4ZMAH 1WCZA 2F9BH 3MH4A 1ETSH 2TBSA 3UIRA 3C1KA 1G3CA 2BDGA 4K2YA 3KF2A 3LH1A 1CT2E 4AFQA 5J4QA 2A4OA 3UWJH 1AFQB 3BIVH 2FOGA 2CN0H 3A82A 1XXDA 4HFPB 2TIOA 1YP9A 4NIYA 3ATWA 2Z7FE 3PROA 1GBBA 5IDKA 1LCYA 4THNH 1TYNA 2F83A 2Q6GA 1SC8U 1V3XA 2ZGCA 3TH2H 3RXAA 1XVMA 3IWMA 4I8KA 4ZHMU 1TRMA 4E06H 3W94A 1SG8B 1TRYA 1G3DA 1HAXB 4F4OC 4Q7XA 4OS4A 5EODA 1S83A 2WPKS 2GZ9A 1AMHA 1Z8RA 3ZZBA 3OU0A 1DWBH 4YT6H 3UPEA 1V6DA 1BCUH 1BBRE 3K2UA 1OXGA 5FHTA 1SI5H 4I33A 1SR5C 1HGTH 2QAAA 1C4U2 5GJ4B 3BG4B 3LDXH 5GCHF 5EOKA 1O3EA 5A8XA 1DUEA 4XBBA 3O8DA 1C2MA 2V6NA 1V2OT 1P3EA 4IC6A 3U1JB 5EXMA 1O3BA 2G4TA 3GCOA 4MQAA 1JBUH 1C5MD 3BEIB 1SMFE 1UTPA 1RIWB 1TGSZ 2ZCHP 3GDSA 2XYAA 2OC0A 1SQAA 1N1LA 2PTNA 4ZKRU 1UK4A 5PTPA 3BF6H 3SV6A 1M9UA 3AW1A 2HPQH 4IMQA 2EI7A 4U30A 2H2ZA 4X8VH 2Z9IA 5JBTA 4U01A 2ZZUH 1XMNB 2R2MB 3V13A 1G3EA 1F7ZA 2YNBA 1EQ9A 3MH6A 3RXTA 1OWHA 4WF8A 1ZSLA 1HJAC 3E0PB 4UONA 1OOKB 3I77A 1H9LB 5DO4H 2G52A 2BD9A 1P2KA 2ODQA 4WMDA 3O8BA 4CH2B 3MFJA 1LVMA 3QZQA 3ZZCA 4NIWA 3KN2A 3EYDA 3C27B 1HIAA 1JRSA 2BDIA 3U8TH 3ATKA 1DWEH 4E7RG 1SBWA 4A5TS 1QA0A 4DVAU 1SOZA 2ULLA 1ZYOA 1H4WA 1GPZA 1NN6A 1IQGA 5A0BA 3LJOA 1ZPCA 1C1OA 1GJ6A 3MNSA 1EJAA 2ZWLH 5GIBA 2FTLE 3Q00A 3FVFB 3HATH 2Y82A 1RTKA 1JRTA 3ZYDA 1AO5A 3TH3H 2VVVA 1K2I1 3M5NA 2JETC 2QCYA 3SI3H 1CGHA 5SGAE 1C2LA 3ZVDA 3TGIE 4SGBE 1HJ9A 1O3NA 4X1QU 1V2LT 1ZGIA 1IQLA 4K8BA 3LKWA 3RXDA 1UVUH 2Y7ZA 5FBIA 1KTTB 1DLKB 2GT8A 1TOCB 1V2VT 1ZPZA 1C5ZB 2ZHEH 1MTSA 2EC9H 1TA6A 1NRRH 1GVKB 3M5MA 1EOLA 2I6SA 1Z7KA 3MU0A 1ETTH 1O2MA 1ANBA 1EJNA 2KAIB 1TA2A 1O2IA 1UTOA 2OCVB 3UOUA 4GVUA 4GSOA 1EPTB 3Q77A 3MH7A 1OWDA 4JMYA 1O0DH 1CHOF 3RXKA 1P57B 2C90B 3HKJB 1ZMJA 2FM2A 3VB6A 1Y8TA 1DWDH 5DP5A 2OD3B 1IQIA 1EAIA 1P2QA 2A4RA 3RXHA 4UFGH 2A2QH 2QXIA 4X1PU 2C8WB 1O5DH 1W8BH 2SGEE 4CR5A 3MU5A 7ESTE 3A7TA 1GVZA 2ZHFH 5EW2H 1YPKH 3S7HB 3PLKA 1MAXA 1JOUB 2VIWA 1EZXC 1TLDA 1BBRH 4AB8A 3SNDA 4Y0ZE 2HPPH 3RU4E 1DVAH 2PKAA 3BTGE 4A92A 2BXUH 1TMTH 4YM9A 4JK6A 2G5NA 1OP2A 3CS0A 1EP5A 4R8TB 3BTHE 1NPMA 2VWLA 1AFQC 3MI4A 1GL0E 4PROA 2Q6FA 2PUQH 4YESB 3SJIA 2Z3EA 1Z8JB 1TNIA 4NFFA 7KMEH 4CRGA 5L30H 1MU8B 3SW2B 1OWKA 1GJCB 2QXGA 1PQ8A 2WPMS 3VEQB 1S84A 3GCTG 1FY8E 1A61H 2J9NA 3A8CA 1V2RT 1DXWA 1O31A 4MVNA 1SGFG 8GCHF 1YKTA 1G3BA 4YO9A 3M7UA 5A0CA 3R0FA 1V2PT 1WTHD 2XCFA 4X2WA 3NXPA 3E0NB 4X8UH 1Q2WA 2J2UA 1FIZA 3UY9A 1GHVH 1SGCA 4AZ2B 2W26A 2PGQB 2ZPSA 1HV7A 2J92A 2PKSB 1BJUA 2PTCE 3BG4C 1EP6A 1C2JA 1EZQA 1O2GH 1UK3A 1IQJA 2R3UA 1D3TB 4QT8C 1W0YH 1XM1A 1FN6A 4INHA 1F0SA 1FAKH 3ZVFA 1SGDE 3GY6A 1ELVA 2SGPE 4KP0A 5JBAS 1GMCG 1BITA 1A0HB 2BOKA 4OS1A 2ALVA 2VJ1A 3DA9B 3SOSA 1SLVB 2OC8A 2ZCLP 3LJJA 1RIWC 1FONA 2H5DA 1FI8A 4FUBA 2ZC9H 3VB3A 1YM0A 1WQSA 3D49H 2VIVA 4ABIA 2RDLA 1Y5AT 1UCYH 1L4ZA 2Q6DA 5T6DA 4K3JA 5I25A 1WTGH 1O2NA 4K1SA 1SSXA 1OX1A 3RU4D 1GI9B 1ELBA 1AIXH 1RRKA 4O3UA 9ESTA 2SNWA 3MYWA 1UTJA 4Y8XA 4FVDA 1P2IA 3A88A 5A2MH 2P94A 2PGBB 1GCDA 1P06A 2BX4A 2H5CA 2VWMA 1WAYB 1O2YA 3EQ0H 1EAWA 3K65B 1O3KA 1TGCA 1ID5H 2Z3CA 5H4IB 2QA9E 3UOPA 1QBOA 1SHHB 1L1JA 5DKMA 1D6RA 4ISOA 4LXBH 5EGMA 1C1QA 1EAUA 1GI2A 3NCLA 2NU2E 1NT1A 1QNJA 2FI4E 2ZCKP 1BJVA 1GHYH 2BY8X 3A7XA 1VGCB 4I8LA 4RN6A 4WXVA 2P59A 1O2WA 5LPEA 3SUGA 1HIAB 3KIDU 4R0IA 1K1JA 1S85A 1SFIA 2WUCA 2GZ8A 3SJ9A 2LNCA 1FZZA 4Q80A 1QR3E 4AB9A 1P12E 1V2KT 3RM2H 5FAHA 2CXVA 3PMHB 3U98H 4X1SU 1WBGB 3SU2A 1GWAA 1OP0A 4ESTE 5FX6A 3RU4T 3UR9A 5E2PA 1V2NT 5AHGH 1TX7A 4X1NU 1GJDB 3RXBA 3TLOA 2PSXA 1WQVH 3M36A 1MCTA 4A6LA 2GZ7A 2J4IA 2PV9B 1G2MA 4IS5A 1TBRH 2QYIA 1EB2A 1EPTC 5CE1A 2V35A 1HAHH 2VIPA 3B9FH 3GYMA 3I29A 8LPRA 1G37A 3EA9A 2Y5FA 3Q3KA 1RS0A 2FI3E 5C1XA 1O35A 4AX9H 2B7DH 1ANDA 1ESBA 3A8DA 1A0LA 4AN7A 2XBWA 1BDAA 3KL6A 1TE0A 2WV4A 2ALPA 3TNTA 4NA9H 2HRVA 1FMGA 1DE7H 5HGGA 2K1QA 1NFUA 2RG3A 2P95A 3D65E 3U9AH 1EASA 3A83A 3UR6A 2SFAA 2GCTB 3BTFE 1TX6A 1SVPA 2GT7A 1G36A 4JZ1A 4Y76A 1J17T 1GGDB 1C1TA 5F8ZA 3V12A 1AZ8A 3KQBA 1YGCH 2FO9A 1SQTA 4TWWA 1O5GH 3AAUA 5EXLA 3RXRA 1F0TA 1D9IA 1P09A 1O2RA 1ZTKA 4BAMB 3UNQA 4YZUA 3KCGH 1BT7A 1GHAF 3TH4H 3T28A 2PKAB 3MU1A 1A5GH 4NWLA 1IHTH 1K28D 1GBAA 1UK2A 3SU3A 1H8IH 4CHAB 1C2DA 2P3UB 3MNBA 1FY5A 1G30B 1O34A 1W7GH 5JB9S 3RM0H 1SGRE 1VZQH 3PLPA 1QBVH 1XX9A 4INLA 3S9AA 2Y80A 2BD8A 5GPIB 4BAKB 1O2OA 1D3PB 1P05A 1QBNA 4CR9A 4DIIH 1TPAE 1RD3B 4DURA 4LOYH 2FOAA 1C4Y2 2H1UA 1QQ4A 4ASHA 1LVOA 3F9EA 2PKSC 2BQWB 2BVRH 1A0JA 3LGUA 3A89A 1C2GA 1C2KA 4YLUA 3F1SB 1CHGA 2C93B 4NIXA 1W12U 1ZSKA 5EQQA 2ZA5A 4I8JA 3L6PA 4TY7A 2BZ6H 1OWIA 3ZVBA 1VCQA 3E91A 3HKIB 2C4FH 1MUEB 1O3IA 4MPWA 2ZG0H 2FODA 1Y3WA 1YPMH 2STAE 3MNXA 3LGTA 4X2VA 4GAWA 4AFZA 1YCPK 2BB4A 2ZU5A 5LPRA 4DG4A 2ZU2A 3RMLH 1MZDA 4WMFA 3PWCA 2VWOA 5EW1H 3MO6A 1GI6A 2PWXA 3RLWH 1HXEH 2UUFB 4ABJA 4M7GA 2Z9KA 1T8MA 2BQ6B 2G55A 3O8CA 2PFEA 1SGIB 1YC0A 3PO1B 1BUIA 1ELFA 3DFJA 2BQ7B 1DICA 2VVUA 3S9BA 1SLUB 4MTBA 4I7YH 4CRCA 2AIQA 2G81E 4NZLA 2FYRA 1MBQA 2NU1E 1C5SA 2XWBI 5E2OA 3UNSA 4OS5A 3V7TA 1H9IE 2ANWA 1OPHB 1MU6B 3T62A 2BX3A 1GBLA 1XUFA 4ISNA 3RXOA 1QRXA 2EI8A 4DIHH 1O2HA 1A5HA 1INCA 2FOFA 1SOTA 2NWNA 3LGYA 2PHBA 4KELA 1S5SA 3ZVCA 5L2ZH 3CP7A 1BTWA 5BPEA 2WYGA 1AWFH 1GL1A 2JH6D 1NRQH 1O3PB 2PR3A 3ZZ7A 5B6OA 2ILNA 3BN9A 3UWIA 1IQHA 4GUXA 1VGCC 1YPLH 4ABGA 1MKXH 3JZ2B 1N8OB 2AGIX 5AF9H 1E36B 1EOJA 1GJBB 1CQQA 4IN2A 1GI3A 4AOQA 3EA7A 1AUJA 3A85A 2WINI 1O2TA 3ENSB 2FOBA 1C2HA 4FUGA 1THSH 1SGTA 3OYPA 4ZUHA 1SLWB 1GI0A 1O30A 3ZVGA 4JCNA