2ZCKP

Crystal structure of a ternary complex between psa, a substrat-acyl intermediate and an activating antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP01
1IQIA 2ALPA 5FPYA 2A32A 1HAHH 5LPRA 3MNXA 1OWDA 1N6XA 1HBTH 4X1SU 2Z9KA 1G2MA 4MNXA 2UUKB 1KIGH 3BG4C 1ANCA 1AI8H 4Z0KA 1AFQC 1KYNA 1V2NT 3FP8E 4ZKNU 1W10U 1WV7H 3RMNH 4X1RU 1ZPZA 3BSQA 2R2WU 1WCZA 4NA8A 4YTAA 1HAGE 1AWHB 1FAKH 2ZFQH 4YLQH 1EP6A 1O5GH 3UR6A 1VCPA 4FUDA 2TGAA 1W12U 3LJJA 1HNEE 3TK9A 1KDQB 3SJKA 1P06A 2GCHF 1ZOMA 3GCTF 2ZI2H 3R3GB 1AIXH 4WMFA 3RU4D 2P3UB 5E0GA 2AFQB 1L1JA 1O3EA 3TJNA 1PPCE 4IMZA 3RXLA 3Q3KA 1S84A 1UTKA 2VH0A 2VWOA 4Y6DA 5JBCS 1A2CH 1AHTH 2VB0A 3BF6H 1W13U 4ZUHA 5FBIA 4ZHLU 1SR5C 4GPGA 7GCHG 4A1TA 3OY5U 4XFQA 4B71A 1ELDE 1GG6B 1HAZB 1SGFA 4I33A 1XMNB 3BEFB 1P3CA 2ZZUH 1GJBB 5GCHG 3M61U 1F5RA 1HAVB 2BD8A 2XWBI 3OSYA 1CHOG 4XDEA 1YPHC 3SNEA 2BDBA 3TK6A 1SBWA 3F9FA 1RTFB 1B0FA 2W3IA 5F8ZA 3S0NA 2V0BA 4BTTB 4GSOA 2H5DA 1ZGIA 5AFYH 2A4RA 1C2JA 1FI8A 2FOHA 1J9CH 1K1PA 1DOJA 4UEHH 3NCLA 1O3GA 2RCEA 3C1KA 2ODQA 4XOJA 1P01A 4IW4E 2B5TB 2DE9A 1G3BA 4Q7XA 4SGBE 1GCDA 3T62A 2J34A 1SGTA 1T8MA 2CGAA 1E36B 2CXVA 3ATWA 4LZ4B 1ZRKA 1CHOF 2GT7A 4E05H 2VVCA 1C2EA 2AGEX 1NRPH 3LGYA 2G52A 3ZZBA 2ZPSA 1W3CA 4LK4A 3K2UA 1UTNA 3HGNA 4UFEH 3PM3A 1ELTA 2GT8A 2F91A 3M35A 2TPIZ 3LDXH 1OSSA 2GKVE 2HOBA 3TITA 2AIPA 4M7GA 1O2NA 1ZZZA 3P95A 2R2MB 1GG6C 4NCYA 2VU8E 1ABIH 4FXGH 1XUKA 2VWNA 1O2XA 4JYUH 2GZ8A 3VFEA 1C1QA 1A0JA 2IN2A 4DY7B 3SOSA 2FTMA 3CENA 1MKXH 2JH5D 1P3EA 5DK1A 2EEKA 1RIWB 3SU5A 1EZXC 5A0AE 2WPIS 3NWUA 1OWJA 2OBQA 1C1TA 1BTUA 2VVUA 2XTTB 3VB6A 3UIRA 1SGNE 3OU0A 3L6PA 1EAIA 2G51A 2ZFFH 2ILNA 2J9NA 2HVXA 4UONA 1C5SA 1C1NA 2UWPA 3AVZA 4JCNA 4ABIA 1EB2A 4INKA 4X0WU 1LPGB 1GCTB 2BVXH 2G5NA 3BN9A 5F8TA 2ANYA 5LGOA 4ISLA 3ENSB 3E6PH 4U2WA 3EQ0H 4AZ2B 1HIAA 2G55A 2XC0A 2Y5GA 4OS7A 4LZ1H 5GIBA 2KAIA 3S7KB 1HGTH 4NIYA 1P12E 4Y8YA 1CBWB 2BD2A 1ELVA 1QQ4A 2C90B 2C4FH 1DPOA 3FZDA 3UTUH 1PPZA 3FZZA 1BTPA 1C2MA 3QZRA 1ZR0A 1UCYH 2EA3A 2ZHFH 1OKXA 1C1OA 1G3DA 3JZ1B 5A8XA 4GCHG 1FPCH 2ZCHP 4AG2A 1S82A 3LIWA 4TY7A 2RA0A 4NFFA 1GHWH 1W0YH 1GL1A 1Y5UT 1CGIE 2PSYA 1TA2A 2BQWB 1RIWC 3MNCA 2VJ1A 2ZU4A 1ELGA 2THFB 5HYOA 2ZU5A 4AORA 1IQMA 1LVBA 1YC0A 3EA8A 4O3TA 5DP6A 5EQRA 4ABGA 1A0LA 1W14U 4DJZB 1C1SA 2RA3A 3I29A 1UTLM 4THNH 4BAMB 4YESB 4GCHF 5DG6A 3RMLH 1LHGH 5FXLA 1L0ZA 2A7CA 1NFYA 4I7YH 2Z6BD 3HPTB 2FM2A 1WTHD 3KQEA 2OBOA 4ESTE 1PQ5A 2VIVA 3QTVH 4Y79A 4O03A 1CBWC 3MH6A 4Y7BA 2BXUH 1UVOA 2ZKSA 8GCHG 1TX7A 2SGAA 3A87A 1OP2A 1V2PT 3SU0A 2ZPRA 1CHGA 4NA9H 3STJA 3BEIB 1YPKH 4Q7YA 1FV9A 1WYKA 1BTHH 3MH5A 1L2EA 3E90B 1HXFH 1E37B 1TRNA 3TGIE 1FY5A 5F03A 3LH3A 1O39A 1QBVH 2W5EA 3GCHB 3QUMP 1FQ3A 5DP3A 1D3PB 4H6TA 4CRBA 5T6DA 1O5DH 1DWEH 1SSXA 1V2OT 3H7TA 3P8OA 3S69A 1AKSB 1LPKB 1C1PA 1XKAC 2FXRA 4FU7A 1JBUH 1KSNA 4D76A 8GCHF 4NIXA 1NRSH 4BXSA 5JYIA 1C9PA 5K7RA 4MNWA 2FZZA 1TGCA 1J16A 1MH0A 2ALVA 5DP5A 1O3PB 1YPJH 3EAJA 1S5SA 3GYLB 3E3TA 1UHBB 4BTIB 4ZHMU 4D9RA 1BRUP 1IQGA 4R0IA 1IQLA 3U8RH 1K1IA 2FESH 1OP0A 2QXGA 3AAUA 1MMJN 1GI9B 1O5CB 1QQUA 4NFEA 2UWLA 3ZVFA 1BB0B 3MNBA 3C27B 1AB9B 3LT3A 1VZQH 3QTOH 5K0HA 3B8JA 4KELA 4RKJB 2SGFE 4B74A 1XUJA 4E7RG 1D3TB 2A7HA 2ZDNA 1ANBA 1CQQA 1GBJA 1NESE 4YT7H 1E35B 1HB0B 2BD3A 1FN6A 3FVFB 5L2ZH 1WTGH 1GI4A 4ZKSU 3E16B 2BY7X 2V3OH 3D23A 3UR9A 2ASUB 3GCHC 4JZDH 5BPEA 1F5LA 2EI6A 1DVAH 2XBWA 3RXOA 3BTKE 3EGKH 1ETTH 2A4QA 3HK6B 2G4TA 2Z9LA 3O8BA 2GDEH 2QC2A 3ELAH 2BD4A 4CR9A 3TVJB 1UVPA 1O5EH 3WY8A 3L3TA 4CRFA 3ZZ5A 2OINA 1QBNA 3VGCC 3TIUA 1GI5A 3V13A 1QRWA 2QAAA 4AFUA 1C2FA 2BLQA 3ZVCA 1FY3A 2WPLS 4MG3A 4YO9A 1N8OB 2ZC9H 2F9VA 1TONA 1YPHE 2XRCA 3SO3A 3BV9B 2VNTA 4TWYA 5C67A 1C5TA 3KIDU 4GUXA 3SJIA 1O3JA 1DANH 1QRXA 1Z7KA 3PLPA 2HPQH 4FVBA 1AB9C 1QURH 5IYTA 1SQOA 3M3SA 1XXFA 4BNRA 1SGPE 1T8OA 1QBOA 1SGEE 3PWBA 1C2HA 4DIIH 2VH6A 3PLKA 3DHKH 4F49A 1KLIH 2V6NA 2R9PA 1MTUA 1C5UA 1B0EA 1UTQA 1QJ7B 4U01A 1BTZA 1Z1IA 1DWDH 1GJDB 3SGAE 4A5TS 4CBOA 3SV2H 5I25A 3D65E 3SV7A 1THPB 3BTEE 2G00A 3FP7E 4LXBH 1K21H 2GGVB 1UK4A 2A4GA 3DFJA 1H9IE 1MZAA 5DP4A 3DA9B 5A0BA 1SGQE 1NRNH 2PKAA 1G36A 1ZHRA 5A8YA 3UY9A 5T6FA 3MO6A 3SUGA 1C5NH 1TNJA 4D9QA 1MD8A 3V3MA 1N8OC 5FBEA 1LVYA 1EZSC 1C2GA 1DLEA 1TABE 1Y3UA 6ESTA 1ZJKA 3GICB 1HDTH 1Z1JA 1E38B 3A7TA 1EX3A 1AN1E 1RRKA 2C93B 2O8TA 4VGCC 2QY0B 1GVLA 1YCPH 4JK5A 1NT1A 1GVZA 1UTOA 2VIDA 2JH6D 5GWZA 1UO6A 2A2XH 2A2QH 3F9EA 3LH1A 5AVDA 4AYVB 1LTOA 2GV6A 1ARBA 1MKWH 1ACBE 2ULLA 1C5QA 3LONA 1SI5H 1Z6JH 2BX3A 5JPMH 3MOCA 1O37A 1P8VC 1RGQA 1ZRBA 2B7DH 3GISB 3W94A 3M36A 5ESBA 1GBAA 1O2IA 4B73A 3PB1E 2PFEA 2PTCE 1ZSLA 4BAOB 1Y5BT 5I46H 1O3LA 1TGSZ 2QIQA 3RXSA 7KMEH 2UWOA 2HGTH 2O8UA 2XNIA 3FANA 3LOXA 1LKAA 2WPHS 3RLWH 1C2LA 4TYDA 5L6NH 4D8NA 4NSYA 2OUAA 1OWIA 5E0JA 1K28D 2BX4A 2XBYA 4MLFB 5PTPA 1UTMA 5F8XA 1GVKB 3IG6B 4XSKU 4B2AA 1GI8B 1SFQB 4XE4A 4I8GA 1FUJA 1D3DB 5BRRE 1TX6A 3HGPA 4J2YB 1DXWA 4B1TA 4LOYH 1Y59T 4AFSA 1BRAA 2P16A 1TMTH 2VIPA 2QXJA 1GI1A 2G5VA 3F68H 1G3CA 2QXHA 2ZDAH 5GPIB 3T5FH 3BG8A 3VPKA 3RXBA 3P8NA 1O2UA 3SGQE 4DG4A 1PYTC 1J8AA 2J94A 1M9UA 2F3CE 1OYQA 2FLRH 3G01A 1NFWA 2CF8H 1O31A 3A83A 4UFGH 1FIWA 2GCHG 1ETRH 2B8OH 2J2UA 1GBLA 5LPFA 4FUGA 1EXFA 2H9HA 1MKXK 1DFPA 1NU7B 1P09A 4K69A 2WV4A 3UQOA 1GI7B 2ZCLP 1BMNH 2BMGB 3LC5A 2PUQH 3AAVA 4MDSA 1ZLRA 2VVVA 1XUIA 2BLWA 3SU1A 4MVNA 1KDQA 4JZIA 4UFFH 1S6FA 1SLUB 1NROH 2PTNA 1AY6H 3MFJA 5TJXA 4K1EA 3QO6A 2D2DA 3T29A 3F9GA 2O9QA 3A80A 2PSXA 1EJMA 2UUJB 4WXIA 1BA8B 3OY6U 1O2QA 2GZ7A 2K1QA 3PMJA 2A1DB 3P6ZB 3TU7H 3NXPA 2GP9B 3A8CA 2A45B 1GMHG 2C8XB 5DGJA 5CHAB 3ESTA 3TPIZ 1GBIA 3BTDE 1Y3YA 3A7YA 2ZGCA 1EPTC 1MTVA 4QT8C 5C5OA 2B9LA 5A2MH 2RG3A 4OS1A 1L4ZA 1L1GA 3VXFH 2BDYA 2M5TA 2Y7ZA 3UFAA 5A09A 1O3DA 1LHEH 2FP7B 4YOJA 1FONA 1HV7A 3NZIA 1HJAB 5GXPA 2ANKH 1HAVA 2OQ5A 5HM9A 2VWMA 2ZGJA 4X1PU 5F6MA 4OGXA 1C5MD 3Q3XA 4NZLA 1YPGH 1HXEH 1GMHF 4O3UA 1UJ1A 1SHHB 3ZZCA 4ABJA 1O0DH 4DT7B 2O8MA 3SBKA 1THSH 1ESTA 2GCTC 3Q77A 5FCRA 2ZDKA 3ZVAA 1Y3WA 2TBSA 4K1TA 2ZFSA 2O8WA 1XX9A 1KTSB 3CS7A 4ZROA 1P2JA 1QNJA 4Y7AA 3M5NA 1ZTKA 2ZDLA 1MBMA 1O35A 1S81A 1BHXF 3HATH 3U1JB 1JXPA 2SGQE 4D7FA 1NC6A 1CGJE 1RTKA 4ABDA 3A7XA 2WPKS 4MTBA 1WU1A 4BAHB 1ZJDA 4K60A 1DY8A 1EZQA 2Z9IA 1ZYOA 3S9BA 2CHAB 2HNTC 1HYLA 1TBRH 5CHAC 1ZMNA 1FIZA 2VGCB 1YLDA 3RXQA 1OYTH 4JZFH 1PPHE 3KL6A 1KXCA 1SQTA 5L2YH 1F2SE 3T25A 1EAUA 1YPMH 1O2SA 1P2QA 4J1YA 2FOCA 2NU4E 2NU2E 3F6UH 3ZZAA 2VINA 4CRCA 1OS8A 1QB9A 4RKOB 1HJAC 5A8ZA 1DITH 5EXLA 3FAOA 1IQEA 4X6MA 4Q7ZA 4H6SB 2BVRH 1K1NA 3PYHA 4MPVA 5AF9H 1HAYB 1F0RA 3SNCA 1O2HA 5EU8A 1UCYE 2NU0E 4U32A 2BXTH 3OTJE 1F0SA 4X8SH 2WPMS 3SV6A 3RXTA 1ELFA 1SOTA 4FUFA 2ZP0H 3U8TH 1HUTH 1DWBH 1GPZA 2SGDE 4A1VA 3A7VA 3ZVGA 1BQYA 1DSTA 4JZ1A 1J15A 2HALA 1T4VH 3KQBA 3BTHE 3UNSA 4RSPA 3BTFE 1AQ7A 3ATKA 2AGGX 2STAE 3RC6A 1DICA 3VB5A 1LDTT 5EPYA 1O3OA 2PW8H 1SGYE 2FIRH 1KY9A 1FY8E 1DM4B 1GL0E 2FOMB 1O5FH 4AB8A 3V12A 4NWLA 2ZGBH 1YBWA 3W95A 1P11E 2IJOB 2CHAC 1INCA 1BBRH 1Z8RA 2BDIA 4Q80A 2VGCC 3GY2A 3TJOA 1TFXA 4I32A 2FI3E 3SQEE 3M3VA 3BEUA 2Y80A 5DPAA 7LPRA 1BHXB 2HPPH 5GDSH 1XUHA 3RP2A 2ANMH 1N1LA 4Y8ZA 2PWXA 3SNDA 2OLGA 1GJ8B 2EC9H 3MH4A 1AZZA 2GMTB 5ABWA 1C1WH 1GHZA 1GBCA 1TGTA 1PPGE 1GJ7B 4NZQA 2BTCE 2W7UA 2NWNA 5C1YA 1GJ6A 1C5ZB 1EASA 1SC8U 2ZQ2A 2DUCA 2QGRA 3VXEH 5JBTA 2BZ6H 1NZQH 1YPLH 3SUFA 1V2RT 1DX5M 1MQ5A 3GY7A 4O97A 4Y71A 1JIRA 1MTNC 2TGDA 1X7AC 2FYQA 2VIOA 3PTNA 1PFXC 1T8LA 5EG4A 1TIOA 3O8RA 2VIWA 4JMYA 1NFUA 5C3NA 3RXJA 1O2ZA 2Z9GA 5FCKA 1GBFA 1CVWH 1KXBA 1BJVA 1H4WA 1YLCA 3URCA 4XBBA 1HAIH 3U69H 1K22H 4BOHA 2BOKA 3SHAH 1EQ9A 3EYDA 4DURA 3Q00A 2C8YB 4Y0YE 2ZHEH 1D9IA 1QJ6B 1XVMA 2A4OA 4JK6A 1TB6H 3MI4A 4KTSA 5JB8S 1RD3B 3ZYDA 1GBBA 1BMLA 4MNVA 2F9OA 3B23B 3QWCH 1CT4E 1GJ9B 4WMEA 1GGDB 1O3MA 1OX1A 3TH2H 1C5VA 2BZAA 2F9BH 1TQ0B 1IHTH 2PR3A 5EOKA 1AKSA 1YP9A 2I6QA 1CE5A 1ESAA 2BHGA 3MHWU 2GMTC 1MU6B 1GBTA 3KGPA 1QA0A 1H8IH 3A88A 2OC1A 2FTLE 1HAXB 1OOKB 5EW2H 4ABAA 2BD7A 2BOHB 2WYGA 1C5RA 4MPUA 2DE8A 1C9TA 3IWMA 4K3JA 3RXVA 3V0XA 1VCQA 2D26C 2FMJA 2BDGA 2V35A 3P17H 1UHBA 4BTUB 2FOFA 2ZHQH 3VGCB 2AMPA 1TPPA 4KTCA 4MNYA 4X8TH 3LGWA 2ESTE 4IBLH 1GDNA 2A0QB 2R3UA 3HKJB 1RFNA 1GHAG 1KXFA 3A8BA 1GMCG 3QGNB 1LVMA 5J4SA 1GJCB 1TPAE 2Y7XA 1UK2A 2FDAA 2ZWLH 3GCOA 1KTTB 1QA7A 1EAXA 1C1UH 2BD5A 3D49H 4GVUA 2BYAX 3PROA 4R8TB 1O34A 1AD8H 1XVOA 4X1NU 3LGVA 4ABBA 3K6YA 1KXEA 4IN1A 4TY6A 4AGJA 4B76A 4BAQB 1K1MA 2WPJS 3N7OA 1HCGA 1ZSKA 5L30H 2BLOA 2FOGA 4UE7H 2GD4B 3A84A 1A1RA 3URDA 4WH6A 1V2WT 1O2MA 1GGDC 1GHAF 6CHAB 1GMCF 1MKWK 4BXWA 1NRRH 8KME2 3A81A 2FPZA 3VB4A 1QHRB 1T7CA 1GI0A 3M3TA 1C5PA 4AN7A 4ISNA 1EJNA 2ZDMA 2B0FA 4X6PA 1S85A 1A5HA 1F0UA 4NG9H 1A61H 3GDUA 1W11U 3ZZ9A 1C5YB 5B6OA 1WOFA 4NWKA 4OS4A 2BLVA 2WINI 4F4OC 1SFIA 3O8DA 1CT0E 2CMYA 2ZA5A 3BIVH 1QFKH 2LPRA 1O2KA 2OD3B 1LCYA 1XM1A 1GHXH 2FODA 2EI7A 4WMDA 3QLPH 1ZHPA 2P8OB 3LJOA 1UTPA 1BJUA 4IMQA 2XCNA 1EOJA 1HPGA 3VB7A 1MAYA 1RS0A 3KN2A 5LPEA 1UVSH 4IC5A 2BY5X 3TLOA 4VGCB 3BTTE 2H6MA 3GY6A 3SV8A 3LGTA 1MTSA 1EZUC 5E8EH 2QF3A 3ZZ8A 1ZPCA 1ZGVA 2XYAA 3UNRA 1QL9A 1FY1A 1GBEA 4WXVA 1N6YA 1QB1A 1G2LA 4Y10E 6CHAC 1HJ8A 3GY4A 4WVPE 3TNTA 1P2OA 2XXLA 2GV7A 1ELEE 1CGHA 1QR3E 2CF9H 5DO4H 1C1VH 1E34B 3BTGE 3TH4H 4NSVA 4IS5A 1Z71A 6GCHF 1F92A 4ZHAA 3RM2H 1AVWA 2F9UA 1SVPA 4IN2A 2VIQA 1ABJH 3ZZ7A 3PTBA 3AW1A 3TNSA 4ABHA 1YF4A 3P8FA 5EXMA 4WF8A 3RXAA 3AASA 1CA0B 2ZFPH 4DW2U 2RDLA 3M5OA 2P8OC 1ZSJA 2WUCA 2H2ZA 1QTFA 1L4DA 2Z9JA 1HLTH 1VJ9U 1PPEE 3DUXH 1MCTA 1WQVH 2PUXB 2ZCKP 1OXGA 3UPEA 2C8WB 3H7OA 1JRTA 1O2LA 2Q1JA 4ISHH 1D6WA 2Z94A 5JB9S 3P70B 1BMAA 2SNVA 3RXRA 1B5GH 4ABFA 1P0SH 1GI6A 1NS3A 1AE8H 4OS5A 1TYNA 1FPHH 2QV1A 4K1SA 3UOPA 3NUMA 1LVOA 3SV9A 4Q2KA 1FLEE 4AX9H 3LKWA 2BD9A 1AMHA 2Q6DA 4FVDA 2CN0H 3SUEA 2ZF0H 3MMGA 3LC3A 1Z8JB 1QB6A 1OWHA 1JOUB 1IQFA 3BTQE 4AFZA 1Z6EA 5ETXA 2ZU3A 2JETB 2XC5A 1BCUH 2C8ZB 1O2YA 2HNTF 1FMGA 4TWWA 1P2NA 3A89A 1T4UH 2ZPQA 1JMOH 1LKBA 1F7ZA 2J95A 2AGIX 1TLDA 2BQ6B 1SB1H 3UWIA 2ZECA 1GDUA 1SLXB 1SHYA 1YYY1 1C1RA 3GY5A 1CA0C 1GBMA 1OWKA 1SGFG 1MBQA 3MU4A 2FLBH 4ZKRU 3NK8A 1ZTJA 2WV5A 3ZZDA 1SQAA 5EW1H 1G32B 1SMFE 1DUAA 1BRBE 3A82A 3MU5A 2BDAA 2GX4A 3RXFA 1Q2WA 4GHQA 1RJXB 1MD7A 2PKSB 1O2GH 2I6SA 1EPTB 2QYIA 2NU1E 4B2BA 1U6QA 2W26A 1NY22 4INLA 1DLKB 5IDKA 2H9EH 1O5BB 4X1QU 4I8JA 3ZV9A 1BMMH 1TPOA 3QN7A 3MYWA 1EOLA 3ZZ4A 3SHCH 1O3AA 5C20A 1AWFH 1O36A 5JBAS 2FEQH 3RU4E 1T32A 4X2VA 2GTBA 3ATIA 2GCTB 2JETC 2GVFA 1GBHA 4BAKB 1VGCB 1LQDB 1V2ST 3LGUA 1K1OA 3BTME 1RXPA 1S0RA 4MQAA 3KEEA 1V2TT 1C5OH 1QRZA 2Z3DA 2YNBA 1IHSH 1W2KH 4ISIH 4JYTA 4DVAU 3RXEA 1BUIA 1ESBA 1TRYA 2FS9A 3MO3A 4WJG2 2ZDVH 2G8TA 1THRH 5FAHA 2FX6A 3FFGA 1FXYA 4H4FA 5A0CA 3OYPA 1YGCH 1EAWA 2AIQA 3P8GA 3MNSA 4ZKOU 4IGDA 2O8LA 3ODFA 4X2YA 1TALA 1BBRK 2PKSC 4CBNA 3MU0A 2ZEBA 1HFDA 3MTYA 5EGMA 3KQCA 3O8CA 1NPMA 3GCNA 3SUDA 3SU4A 1GHYH 2TGPZ 1UCYK 3TH3H 1O33A 1C4V2 1UVTH 5DJ7A 1OWEA 1VR1H 4I8HA 1UMAH 3FP6E 1TNLA 3GY8A 2A31A 1FJSA 3ZVEA 1LMWB 4AOQA 1KXDA 2P3FH 2R0LA 1KLJH 4I8KA 1TAWA 2PLXA 2P94A 1AVXA 2FOEA 4MPXA 4B75A 4Y76A 1VGCC 4YT6H 1IOEA 2UUFB 2YOLA 2ZTYA 3E0PB 4BANB 1Y5AT 1AU8A 5DP9A 3SI3H 1UK3A 1P57B 3SZNA 1YPEH 2VWLA 1TNKA 4ISOA 2BY9X 5C1XA 5J4QA 3K65B 5FPTA 1GI2A 4FUEA 3PWCA 1V2JT 1Q31A 7GCHF 2XCFA 3OX7U 2ZU2A 4B2CA 1A3BH 5FX5A 1L1NA 2BB4A 1DUEA 5GCHF 1TMUH 4Z6AH 1CA8B 1YCPM 3KHVA 1VCWA 2FYRA 3BIUH 4GHTA 1P03A 3QZQA 1K1LA 3IITA 1TA6A 2OC0A 2BDCA 4K8YA 4FUCA 1MTWA 2UUYA 1BBRE 1HJ9A 2ZG0H 2PGQB 2OCVB 5JDUB 1ELCA 1O3KA 1LQEA 4AGKA 1P02A 2GDDA 1G30B 1KXAA 2BM2A 1O2JA 1YKTA 4CRDA 1H1BA 2TIOA 1TMBH 1T8NA 2G4UA 1WSSH 2R0KA 3TGJE 3UQVA 2JH0D 2G81E 3CP7A 1MTNB 4I8LA 1AE5A 3A86A 3RM0H 1AO5A 1BTYA 4X8VH 1BZXE 1AFEH 5HGGA 3QK1A 1QGFA 5T6GA 5HMAA 5C1UA 4NGAH 3RLYH 5FHTA 2ZTZA 1P2MA 4XBDA 1SL3A 1Y3VA 3Q3YA 2PHBA 3SGBE 3PLBA 4FUBA 1C5XB 1O2OA 3QX5H 4FUJA 2ZGHA 1XXDA 2STBE 4D7GA 3SORA 1S0QA 3PV4A 1RTLA 2ZTXA 4DCDA 1AUJA 1UVUH 2WYJA 4YOGA 3SW2B 1FN8A 1K9OE 3ZV8A 2TRMA 1V2QT 2H9TH 2FWWA 3TK5A 4A6LA 1XUFA 1HIAB 4E7NA 1GJ4H 1G9IE 5DP7A 1W7XH 2J92A 1TE0A 3RMOH 3A7WA 4OS2A 1GBKA 3K9XB 1W0ZU 2F83A 4X6OA 1SLWB 2KAIB 3SU3A 1O3BA 4FUIA 2HLCA 4OS6A 2YNAA 2F9NA 2IPHA 6LPRA 3UREA 1CU1A 4CHAB 3RDZA 5EQSA 2JKHA 4HI3A 1O5AB 3GDVA 3GYMA 3E8LA 4UDWH 5HM2A 1TNHA 5H4IB 1EP5A 1MCVA 1OP8A 1VITG 1W7GH 3F9HA 1VJAU 3BTWE 1VITH 3VB3A 3STIA 2ZHWH 1IAUA 1NN6A 4ZAEA 4FU8A 4OGYA 2OC8A 4YLUA 1A5IA 3RXGA 1B7XB 3M5LA 1ID5H 1SLVB 4ZMAH 9ESTA 3MH7A 5JBBS 2TGTA 1K2I1 1C2IA 3PMAB 3GY3A 1CO7E 3EA9A 2ZGXH 5ESTE 3SJ9A 4H42U 1IQJA 2FO9A 4CRGA 1GCTC 3GOVB 1O3FA 2SGPE 3ATLA 1A5GH 1GHBG 3KNXA 1C5WB 3T2NA 1HAOH 3RXCA 2HRVA 1Q3XA 1A4WH 1VITF 2Z7FE 5E2PA 1BT7A 1V2KT 3M7QA 1EJAA 2XWAA 1ETSH 4U30A 3ZVBA 1NRQH 1TBZH 3KQDA 5E0HA 4IC6A 3SNAA 3SQHE 1YM0A 1BDAA 3PMHB 3SNBA 4K8BA 3L33A 1GWAA 3SI4H 1MZDA 4HZHA 4A1XA 4UFDH 1PPBH 5C5NA 2PV9B 2AMQA 2A7JA 1H9HE 1PJPA 1Y3XA 5EPNA 1ORFA 1V6DA 4FU9A 4WH8A 7ESTE 3RXPA 4AG1A 2AYWA 2SGEE 1GHBF 4CHAC 3MO9A 2XBXA 1F5KU 3HKIB 3UOUA 9LPRA 3NPSA 1O2WA 2BQ7B 5EODA 1TRMA 1BOQA 1SGCA 1DS2E 1O2PA 2BVSH 5HXFA 1MAXA 1F0TA 4AB9A 3H5CB 3SU6A 2D1JA 2W7SA 3S9CA 1TPSA 1DE7H 4WY3A 4INHA 1XKBC 4NIWA 1P10A 1GJ5H 1TBQH 3RMMH 1UTJA 3P92A 4Y11E 4KP0A 1ANEA 4ZXYH 1LO6A 3PO1B 2D8WA 2GZ9A 4I31A 1O3CA 5T3HA 1O2VA 1SG8B 2ODYB 2BY8X 3A8AA 1SPJA 2OP9A 1NM6A 1YCPK 2ODPA 3A7ZA 3K6ZA 4JYVH 4AFQA 1TQ7B 2FX4A 3RXHA 3DT0H 1S6HA 1SGDE 3VEQB 1SGRE 3I77A 2P93A 1GDQA 4GAWA 2BDHA 3PMBB 4O9VA 2Q6FA 1TGBA 3I78A 2H5CA 1O3NA 1J14A 1QL8A 3MU1A 1ZHMA 1PYTD 1DXPA 1ZMLA 5FX6A 1IQKA 2Y82A 3TGKE 2WUBA 1AGJA 2P3TB 3TJUA 4XBCA 3RXMA 2V3HH 3ZVDA 1WBGB 4TPIZ 1WAYB 1G37A 1HRTH 2QF0A 4X8UH 1FDPA 1XUGA 2QA9E 2XBVA 5AHGH 4ZXXH 4KKDA 2OC7A 2XC4A 1EATA 1TX8A 2ZHDA 1NFXA 1DDJA 1ELBA 1FZZA 1W8BH 1SGIB 2Y81A 3A8DA 4DIHH 5AFZH 1CT2E 2NU3E 1P9UA 3RXDA 1P9SA 4HTCH 3SJ8A 6GCHG 3ZZ3A 3LU9B 1A0HB 3PO1C 2ZFRH 3ODDA 3U98H 5CE1A 1GI3A 1ZPBA 2ZFTA 3RC4A 3JZ2B 3QGJA 1BTXA 4HGCA 3ZYEA 1H8DH 1BIOA 2PGBB 1BTWA 2AEIH 4NA7A 2SFAA 1O30A 3EA7A 3D62A 1K1JA 1GBDA 2ZNKH 1EUFA 1IQNA 1C5LH 1JWTA 1LHCH 3UNQA 4PROA 4Y8XA 1V2MT 1V2UT 4CH8B 1BRCE 1TNIA 4AYYB 1G3EA 3RU4T 3M7TA 2FOBA 2HNTE 2Y5FA 2Z3CA 1AVGH 1O3IA 2R3YA 1EB1H 2W3KA 1A46H 5TCAA 3B9FH 4CRAA 1C4U2 4DGJA 3S7HB 1WUNH 2AERH 1TWXB 2A5IA 4DOQA 1PPFE 4YOIA 1ZTLA 1CSOE 3MU8A 1C2DA 4JZEH 1AZ8A 5TCCA 1Z8IB 3E1XB 1H9LB 3UUZA 2P95A 4A92A 2ZU1A 3UWJH 3RC5A 1DWCH 1P2IA 3SJOA 1TGNA 1P2KA 1BITA 3RXUA 2P59A 4YM9A 5G4BA 1NTPA 5DP8A 4ZH8A 2OXSA 2J38A 1GMDG 3EE0B 5FPSA 1O38A 3SU2A 3DFLA 3M7UA 1ZMJA 2ANWA 2PKAB 1NU9A 1WQSA 2AMDA 4SGAE 3A85A 3TJVA 4WWYA 1O32A 4RN6A 3QDZB 4ASHA 1Z8GA 5C2ZA 3M5MA 1O3HA 2OQUA 3R0FA 5EQQA 1PQ7A 4YZUA 3KF2A 1FAXA 4TPYA 2Z3EA 2AS9A 2ZO3H 1S83A 1HAPH 2F9PA 2SNWA 2IOTA 2EI8A 1GMDF 1JRSA 1O2RA 1D4PB 4K5ZA 1DY9A 2Y5HA 5SGAE 1TOCB 2XW9A 1MQ6A 1DT2A 2ZIQH 4GLYA 1V2LT 1TNGA 2HWLB 2FI4E 3RXIA 3ITIA 2OTVA 1Y8TA 2J4IA 1QCPA 5CMXH 4KGAA 1FNIA 1SOZA 1D6RA 4HFPB 4MPWA 1LHFH 3ATMA 2QCYA 1V3XA 3E91A 1AUTC 2AH4X 1ELAA 1GHVH 3RUOA 4NIVA 3V7TA 1TOMH 1A7SA 3GDSA 4CR5A 2LNCA 3T27A 3NKKA 4FUHA 1QL7A 1LPZB 3BG4B 1J17T 1AFQB 1JIMA 2FS8A 1EPTA 1P04A 1QJ1B 3LGIA 4A7IB 2A5KA 2QN5T 1D3QB 3EDXB 3RXKA 4ABEA 1NO9H 1QIXB 2ZQ1A 5EXNA 1FY4A 1PQAA 1P05A 1ANDA 1MU8B 3MWIU 3HK3B 2Y6TA 5LH8A 3U8OH 4E06H 2QXIA 3ZZ6A 4KTUA 2CV3A 3DD2H 2BY6X 4CREA 2C3SA 1C1MA 2H1UA 1T31A 2Q6GA 1ARCA 3U9AH 1EKBB 2CJIA 3Q76A 1V2VT 1E0FD 1QY6A 4UD9H 1C4Y2 4X2WA 8LPRA 3AW0A 3T26A 3U1IB 8ESTE 1A3EH 4Y0ZE 3KCGH 3T28A 4X6NA 5GJ4B 3E0NB 4K2YA 3CS0A 1LHDH 1OPHB 3F1SB 4X2XA 2FOAA 1IQHA 1PQ8A 1MUEB 5DKMA 2A5AA 1GJAB 1DSUA 1C2KA 1KLTA 1O2TA 3M37A 3SN8A 3S9AA 5E2OA 3GCTG 2FI5E 4CH2B 3LPRA
chains in the Genus database with same CATH superfamily
1IQIA 2ALPA 5FPYA 2A32A 1HAHH 5LPRA 3MNXA 1OWDA 1N6XA 1HBTH 4X1SU 2Z9KA 1G2MA 4MNXA 2UUKB 1KIGH 3BG4C 1ANCA 1AI8H 4Z0KA 1AFQC 1KYNA 1V2NT 3FP8E 4ZKNU 1W10U 1WV7H 3RMNH 4X1RU 1ZPZA 3BSQA 2R2WU 1WCZA 3N7DA 4NA8A 4YTAA 1HAGE 1AWHB 1FAKH 2ZFQH 4YLQH 1EP6A 1O5GH 3UR6A 1VCPA 4FUDA 2TGAA 1W12U 3LJJA 1HNEE 3TK9A 1KDQB 3SJKA 1P06A 2GCHF 1ZOMA 3GCTF 2ZI2H 3R3GB 1AIXH 4WMFA 3RU4D 1UW7A 2P3UB 5E0GA 2AFQB 1L1JA 1O3EA 3TJNA 1PPCE 4IMZA 3RXLA 3Q3KA 1S84A 1UTKA 2VH0A 2VWOA 4Y6DA 5JBCS 1A2CH 1AHTH 1OHHD 2VB0A 3BF6H 1W13U 4ZUHA 5FBIA 4ZHLU 1SR5C 4GPGA 7GCHG 2F4LA 4A1TA 3OY5U 4XFQA 4B71A 1ELDE 1GG6B 2WZQA 1HAZB 1SGFA 4I33A 1XMNB 3BEFB 1P3CA 2ZZUH 1GJBB 2VBCA 5GCHG 3M61U 1F5RA 1HAVB 2BD8A 2XWBI 3OSYA 2KCPA 1CHOG 4XDEA 4XD7D 1YPHC 2YMSB 3SNEA 2BDBA 3TK6A 1SBWA 3F9FA 1RTFB 1B0FA 2W3IA 5F8ZA 3S0NA 2V0BA 4BTTB 4GSOA 2H5DA 3F0PA 1ZGIA 5AFYH 2A4RA 4B6EA 1C2JA 1FI8A 2FOHA 1J9CH 1K1PA 1DOJA 4UEHH 3NCLA 1O3GA 2RCEA 3C1KA 2ODQA 4XOJA 1P01A 2KCYA 4IW4E 4DT4A 2B5TB 2DE9A 1G3BA 4Q7XA 4SGBE 1GCDA 3T62A 2J34A 1SGTA 1T8MA 2CGAA 3U28C 1E36B 2CXVA 3ATWA 4LZ4B 1ZRKA 1CHOF 2GT7A 4E05H 2VVCA 1C2EA 2AGEX 1NRPH 3LGYA 2G52A 3ZZBA 2ZPSA 1W3CA 4LK4A 3K2UA 1UTNA 3HGNA 4UFEH 3PM3A 1ELTA 2GT8A 2F91A 3M35A 2TPIZ 3LDXH 1OSSA 2XOKD 2GKVE 2HOBA 3TITA 2AIPA 4M7GA 1O2NA 1ZZZA 3P95A 2R2MB 1GG6C 4NCYA 2VU8E 1ABIH 4FXGH 1XUKA 2VWNA 1O2XA 4JYUH 2GZ8A 3VFEA 1C1QA 1A0JA 2IN2A 4DY7B 4B6FA 3SOSA 2FTMA 3CENA 1MKXH 2JH5D 1P3EA 5DK1A 2EEKA 1RIWB 3SU5A 1EZXC 5A0AE 2WPIS 3NWUA 2YMSC 1OWJA 2OBQA 1C1TA 1BTUA 2VVUA 2XTTB 3VB6A 3UIRA 1SGNE 3OU0A 3L6PA 1EAIA 2G51A 2ZFFH 2ILNA 2J9NA 2HVXA 4UONA 1C5SA 1C1NA 2UWPA 3AVZA 4JCNA 4ABIA 1EB2A 2V7QD 4INKA 4X0WU 1LPGB 1GCTB 2BVXH 2G5NA 3BN9A 5F8TA 2ANYA 5LGOA 4ISLA 3ENSB 3E6PH 4U2WA 3UAIC 3EQ0H 4AZ2B 1HIAA 2G55A 2XC0A 4RI0A 2Y5GA 4OS7A 5IK2D 2WHXA 4LZ1H 5GIBA 2KAIA 3S7KB 1HGTH 4NIYA 1P12E 4Y8YA 1CBWB 3OAAD 2BD2A 1ELVA 4OM9A 1QQ4A 2C90B 2C4FH 1DPOA 3FZDA 3UTUH 1PPZA 3FZZA 1BTPA 1C2MA 3QZRA 1ZR0A 1UCYH 2EA3A 2ZHFH 1OKXA 1C1OA 1G3DA 3JZ1B 5A8XA 5GNDA 4GCHG 1FPCH 2ZCHP 4AG2A 1S82A 3LIWA 4TY7A 2RA0A 4NFFA 1GHWH 1W0YH 1GL1A 1Y5UT 1CGIE 2PSYA 1TA2A 2BQWB 3F2FA 1RIWC 3MNCA 2VJ1A 2ZU4A 1ELGA 2THFB 5HYOA 2ZU5A 4AORA 1IQMA 1LVBA 1YC0A 3EA8A 4O3TA 5DP6A 5EQRA 4ABGA 1A0LA 1W14U 4DJZB 1C1SA 2RA3A 3I29A 1UTLM 4THNH 4BAMB 4YESB 4GCHF 5DG6A 3RMLH 1LHGH 5FXLA 1L0ZA 5C0TA 2A7CA 1NFYA 4I7YH 2Z6BD 4YXWD 3HPTB 2FM2A 1WTHD 3KQEA 2OBOA 4ESTE 1PQ5A 2VIVA 3QTVH 5F53A 4Y79A 4ACBA 4O03A 1CBWC 3OE7D 3MH6A 4Y7BA 2BXUH 1UVOA 2ZKSA 8GCHG 1TX7A 2SGAA 3A87A 1OP2A 1V2PT 3SU0A 2ZPRA 3WWFA 1CHGA 4NA9H 3STJA 3BEIB 1YPKH 4Q7YA 1FV9A 1WYKA 1BTHH 3MH5A 1L2EA 3E90B 1HXFH 1E37B 1TRNA 3TGIE 1FY5A 5F03A 3LH3A 1O39A 1QBVH 2W5EA 3GCHB 3QUMP 1FQ3A 5DP3A 1D3PB 4H6TA 5B6LA 4CRBA 5T6DA 1O5DH 1DWEH 1SSXA 1V2OT 3H7TA 3P8OA 3S69A 1AKSB 1LPKB 1C1PA 1XKAC 2FXRA 4FU7A 1JBUH 1KSNA 4D76A 8GCHF 4NIXA 1NRSH 4BXSA 5JYIA 1C9PA 5K7RA 4MNWA 2FZZA 1TGCA 1J16A 1MH0A 2ALVA 5DP5A 1O3PB 1YPJH 3EAJA 1S5SA 3GYLB 3E3TA 1UHBB 4BTIB 4ZHMU 4D9RA 1BRUP 1IQGA 4R0IA 1IQLA 3U8RH 1K1IA 2FESH 1OP0A 2QXGA 3AAUA 1MMJN 5T1VA 1GI9B 1O5CB 1QQUA 3N99A 4ASUD 4NFEA 2UWLA 3ZVFA 1BB0B 3MNBA 3C27B 2IJD1 1AB9B 3LT3A 1VZQH 3QTOH 5K0HA 1VKYA 3B8JA 4KELA 4RKJB 2SGFE 3FKSD 4B74A 2QE7D 1XUJA 4E7RG 1D3TB 2A7HA 2ZDNA 1ANBA 2W6ID 1CQQA 1GBJA 1NESE 4YT7H 1E35B 1HB0B 2BD3A 1FN6A 4TT3D 1NBMD 3FVFB 5L2ZH 1WTGH 1GI4A 4ZKSU 3E16B 2BY7X 2V3OH 3D23A 3UR9A 2ASUB 3GCHC 4JZDH 5BPEA 1F5LA 2EI6A 1DVAH 2XBWA 3RXOA 3PRDA 3BTKE 3EGKH 1ETTH 2A4QA 3HK6B 2G4TA 2Z9LA 3O8BA 2GDEH 2QC2A 3ELAH 2BD4A 4CR9A 3TVJB 1UVPA 4P02A 1E79D 1O5EH 3WY8A 3L3TA 4CRFA 3ZZ5A 2OINA 1QBNA 3VGCC 3DSPA 3TIUA 1GI5A 3V13A 1QRWA 2QAAA 4AFUA 1C2FA 2BLQA 3ZVCA 1FY3A 2WPLS 4MG3A 4YO9A 1N8OB 2J98A 2ZC9H 2F9VA 1TONA 1YPHE 2XRCA 3SO3A 3F2GA 3FN8A 3BV9B 2VNTA 4TWYA 5C67A 1C5TA 3KIDU 4GUXA 3SJIA 1O3JA 4Q63A 1DANH 1QRXA 1Z7KA 3PLPA 2HPQH 4FVBA 1AB9C 1QURH 5IYTA 3VG8A 1SQOA 3M3SA 1XXFA 4BNRA 1SGPE 1T8OA 1QBOA 1SGEE 3PWBA 1C2HA 4DIIH 2VH6A 3PLKA 3DHKH 4F49A 1KLIH 2V6NA 2R9PA 1MTUA 1C5UA 1B0EA 1UTQA 1QJ7B 4U01A 1BTZA 1Z1IA 1DWDH 1GJDB 3SGAE 4A5TS 4CBOA 3SV2H 5I25A 3D65E 3SV7A 1THPB 3BTEE 2G00A 3FP7E 4LXBH 1K21H 2GGVB 1UK4A 2A4GA 3DFJA 1H9IE 1MZAA 5DP4A 3DA9B 5A0BA 1SGQE 2L74A 1NRNH 2J5UA 2PKAA 1G36A 1ZHRA 5A8YA 3UY9A 5T6FA 3MO6A 3SUGA 1C5NH 1TNJA 4D9QA 1MD8A 3V3MA 1N8OC 5FBEA 5DN6D 1LVYA 2L6OA 1EZSC 1C2GA 1DLEA 1TABE 1Y3UA 6ESTA 1ZJKA 3GICB 1HDTH 1Z1JA 1E38B 3A7TA 1EX3A 1AN1E 1RRKA 2C93B 2O8TA 4VGCC 2QY0B 1GVLA 1YCPH 4JK5A 1NT1A 1GVZA 1UTOA 2VIDA 2JDID 2JH6D 5GWZA 1UO6A 2A2XH 2A2QH 3F9EA 3LH1A 5AVDA 4AYVB 1LTOA 2GV6A 1ARBA 1MKWH 1ACBE 2ULLA 1C5QA 3LONA 1SI5H 1Z6JH 2BX3A 5JPMH 3MOCA 1O37A 1P8VC 1RGQA 1ZRBA 2B7DH 3GISB 3W94A 3M36A 5ESBA 1GBAA 1O2IA 4B73A 2F43B 3PB1E 4Q4LA 2PFEA 2PTCE 1ZSLA 4BAOB 1Y5BT 5I46H 1O3LA 1TGSZ 2QIQA 3RXSA 7KMEH 5EIYA 2UWOA 2HGTH 2O8UA 2XNIA 3FANA 3LOXA 5KECA 1LKAA 2WPHS 3RLWH 1C2LA 4TYDA 5L6NH 4D8NA 4NSYA 2OUAA 1OWIA 5E0JA 1K28D 2BX4A 2XBYA 4MLFB 5PTPA 1UTMA 5F8XA 1GVKB 3IG6B 4XSKU 4B2AA 1GI8B 1SFQB 4XE4A 4I8GA 1FUJA 1D3DB 5BRRE 1TX6A 3HGPA 4J2YB 1DXWA 4B1TA 4LOYH 1Y59T 4AFSA 1BRAA 2P16A 1TMTH 2VIPA 2QXJA 1GI1A 2G5VA 3F68H 1G3CA 2QXHA 4FETA 2ZDAH 5HIZA 5GPIB 3T5FH 3BG8A 3VPKA 3RXBA 2K8IA 3P8NA 1O2UA 3SGQE 4DG4A 1PYTC 1J8AA 2J94A 1M9UA 2F3CE 1OYQA 2FLRH 3G01A 1NFWA 2CF8H 1O31A 3A83A 4UFGH 1FIWA 2GCHG 1ETRH 2B8OH 2J2UA 1GBLA 5LPFA 4FUGA 1EXFA 2H9HA 1MKXK 1DFPA 1NU7B 1P09A 4K69A 2WV4A 3UQOA 1GI7B 2ZCLP 1BMNH 2BMGB 3LC5A 2PUQH 3AAVA 4MDSA 5CDFE 1WDIA 1ZLRA 2VVVA 1XUIA 2BLWA 3SU1A 4FOUC 1KDQA 4MVNA 4JZIA 4UFFH 1S6FA 1SLUB 1NROH 2PTNA 1AY6H 3MFJA 5TJXA 4K1EA 3QO6A 2D2DA 3T29A 3F9GA 2O9QA 3A80A 2PSXA 1EJMA 2UUJB 4WXIA 1BA8B 3OY6U 1O2QA 2GZ7A 2K1QA 3PMJA 2A1DB 3P6ZB 3TU7H 3NXPA 2GP9B 1W0JD 3A8CA 2A45B 1GMHG 2C8XB 5DGJA 5CHAB 3ESTA 3TPIZ 1GBIA 3BTDE 1Y3YA 2AHME 3A7YA 2ZGCA 1EPTC 1MTVA 4QT8C 5C5OA 2B9LA 5A2MH 2RG3A 4OS1A 1L4ZA 1L1GA 3VXFH 2BDYA 2M5TA 2Y7ZA 3UFAA 3W1EA 5A09A 1O3DA 1LHEH 2FP7B 4YOJA 1FONA 1HV7A 3NZIA 1HJAB 5GXPA 2ANKH 1HAVA 2OQ5A 5HM9A 2VWMA 2ZGJA 4X1PU 5F6MA 4OGXA 1C5MD 3Q3XA 4NZLA 1YPGH 1HXEH 1GMHF 4O3UA 1UJ1A 1SHHB 3ZZCA 4ABJA 1O0DH 4DT7B 2O8MA 3SBKA 1THSH 1ESTA 2GCTC 3Q77A 5FCRA 2ZDKA 3ZVAA 1Y3WA 2TBSA 4K1TA 5KEDA 2ZFSA 2O8WA 1XX9A 1KTSB 3CS7A 4ZROA 1P2JA 1QNJA 4Y7AA 3M5NA 1ZTKA 2ZDLA 1MBMA 1O35A 1S81A 1BHXF 3HATH 3U1JB 1JXPA 2SGQE 4D7FA 1NC6A 4P00A 2K0QA 1CGJE 1RTKA 4ABDA 3A7XA 2WPKS 4MTBA 1WU1A 4BAHB 1ZJDA 4K60A 1DY8A 1EZQA 2Z9IA 1ZYOA 3S9BA 2CHAB 2HNTC 1HYLA 4XRNA 1TBRH 5CHAC 1ZMNA 1FIZA 2VGCB 1YLDA 3RXQA 2EY4C 1OYTH 4JZFH 1PPHE 3KL6A 1KXCA 1SQTA 5L2YH 1F2SE 3T25A 1EAUA 1YPMH 1O2SA 1P2QA 4J1YA 2FOCA 2NU4E 2NU2E 3F6UH 3ZZAA 2VINA 4CRCA 1OS8A 1QB9A 4RKOB 1HJAC 5A8ZA 1DITH 5EXLA 3FAOA 1IQEA 4X6MA 4Q7ZA 4H6SB 2BVRH 3H09A 1K1NA 3PYHA 2CK3D 4MPVA 5AF9H 1HAYB 1F0RA 3SNCA 1O2HA 5EU8A 1UCYE 2NU0E 4U32A 2BXTH 3OTJE 1F0SA 4X8SH 2WPMS 3SV6A 3RXTA 1ELFA 2KCAA 1SOTA 4FUFA 2ZP0H 3U8TH 1HUTH 1DWBH 1GPZA 2SGDE 1SKYE 4A1VA 3A7VA 3ZVGA 1BQYA 1DSTA 4JZ1A 3NRLA 1J15A 2GJGA 2HALA 3F0OA 1T4VH 3KQBA 3BTHE 3UNSA 4RSPA 3BTFE 1AQ7A 3ATKA 2AGGX 2STAE 3RC6A 1DICA 3VB5A 1LDTT 5EPYA 1O3OA 2PW8H 1SGYE 2FIRH 1KY9A 1FY8E 1DM4B 1GL0E 1YY3A 2FOMB 1O5FH 4AB8A 3V12A 4NWLA 2ZGBH 1YBWA 3W95A 2QF4A 1P11E 2IJOB 2CHAC 1INCA 1BBRH 1Z8RA 2BDIA 4Q80A 2VGCC 3GY2A 3TJOA 1TFXA 4I32A 2FI3E 3SQEE 3M3VA 3BEUA 2Y80A 2RFKC 5DPAA 7LPRA 1BHXB 2HPPH 5GDSH 1XUHA 3RP2A 2ANMH 1N1LA 4Y8ZA 2PWXA 3SNDA 2OLGA 1GJ8B 2EC9H 3MH4A 1AZZA 2GMTB 5ABWA 2HVYB 1C1WH 1GHZA 1GBCA 1TGTA 1PPGE 1GJ7B 4NZQA 2BTCE 2W7UA 2NWNA 5C1YA 3ZIAD 1GJ6A 1C5ZB 1EASA 1SC8U 2ZQ2A 2DUCA 2QGRA 3VXEH 5JBTA 2BZ6H 1NZQH 1YPLH 3SUFA 1V2RT 1DX5M 1MQ5A 3GY7A 4O97A 4Y71A 1JIRA 1MTNC 2TGDA 1X7AC 2FYQA 2VIOA 3PTNA 1PFXC 1T8LA 5EG4A 1TIOA 3O8RA 2VIWA 4JMYA 1NFUA 5C3NA 3RXJA 1O2ZA 2Z9GA 1K0HA 5FCKA 1GBFA 1CVWH 1KXBA 1BJVA 1H4WA 1YLCA 3URCA 4XBBA 1HAIH 3U69H 1K22H 4BOHA 2BOKA 3SHAH 1EQ9A 3EYDA 4DURA 3Q00A 1YLNA 2C8YB 4Y0YE 2ZHEH 1D9IA 1QJ6B 1XVMA 2A4OA 4JK6A 1TB6H 3MI4A 4KTSA 5JB8S 1RD3B 3ZYDA 1GBBA 1BMLA 1FX0B 4MNVA 2F9OA 1H8HD 3B23B 3QWCH 1CT4E 1GJ9B 4WMEA 1GGDB 1O3MA 1OX1A 3TH2H 1C5VA 1COWD 2BZAA 2F9BH 1TQ0B 1IHTH 2PR3A 5EOKA 1AKSA 1YP9A 2I6QA 1CE5A 1ESAA 2BHGA 3MHWU 2GMTC 1MU6B 1GBTA 3KGPA 1QA0A 3OEED 1H8IH 3A88A 2OC1A 2FTLE 1HAXB 1OOKB 5EW2H 4ABAA 2BD7A 2BOHB 2WYGA 1C5RA 4MPUA 2DE8A 1C9TA 3IWMA 4K3JA 3RXVA 3V0XA 1VCQA 2D26C 2FMJA 2BDGA 2V35A 3P17H 5C17A 1UHBA 4BTUB 2FOFA 2ZHQH 3VGCB 2AMPA 1TPPA 4KTCA 4MNYA 4X8TH 3LGWA 2ESTE 3OFND 4IBLH 3KYGA 1GDNA 2A0QB 2R3UA 3HKJB 2V3MA 1RFNA 1GHAG 1KXFA 3A8BA 1GMCG 3QGNB 1LVMA 5J4SA 1GJCB 1TPAE 2Y7XA 1UK2A 3DSGA 2WV9A 2FDAA 2ZWLH 3GCOA 1KTTB 1QA7A 1EAXA 1C1UH 2BD5A 3D49H 4GVUA 2BYAX 3PROA 4R8TB 1O34A 1AD8H 1XVOA 4X1NU 3LGVA 4ABBA 3K6YA 1KXEA 4IN1A 4TY6A 4AGJA 4B76A 4BAQB 1K1MA 2WPJS 3N7OA 1HCGA 1ZSKA 5L30H 2BLOA 2FOGA 4UE7H 2GD4B 3A84A 1A1RA 3URDA 4WH6A 1W0KD 1V2WT 1O2MA 1GGDC 1GHAF 6CHAB 1GMCF 1MKWK 4BXWA 1NRRH 8KME2 3A81A 2FPZA 3VB4A 1QHRB 1T7CA 1GI0A 3M3TA 1C5PA 4AN7A 4ISNA 1EJNA 2ZDMA 2B0FA 4X6PA 1S85A 1A5HA 1F0UA 4NG9H 1A61H 3GDUA 1W11U 3ZZ9A 1C5YB 5B6OA 1WOFA 4NWKA 2KR7A 4OS4A 2WSSD 2BLVA 2WINI 4F4OC 1BMFD 1SFIA 1MABB 3O8DA 1CT0E 2CMYA 2ZA5A 3BIVH 2OK5A 1QFKH 2LPRA 1O2KA 2OD3B 1LCYA 1XM1A 1GHXH 2FODA 2EI7A 4RT1A 2XNDD 3PV2A 4WMDA 3QLPH 1ZHPA 2P8OB 3LJOA 1UTPA 1BJUA 4IMQA 2XCNA 1EOJA 1HPGA 3VB7A 1MAYA 1RS0A 3KN2A 5LPEA 1UVSH 4IC5A 2BY5X 3TLOA 4VGCB 3BTTE 2H6MA 3GY6A 3SV8A 3LGTA 1MTSA 1EZUC 5E8EH 2QF3A 3ZZ8A 1ZPCA 1ZGVA 2XYAA 4TSFD 3UNRA 1QL9A 1FY1A 1GBEA 4WXVA 3N7EA 1N6YA 1QB1A 1G2LA 4Y10E 6CHAC 1HJ8A 3GY4A 4WVPE 3TNTA 1P2OA 2XXLA 4F48B 2GV7A 1ELEE 1CGHA 1QR3E 2CF9H 5DO4H 1C1VH 1E34B 3BTGE 3TH4H 4NSVA 4IS5A 1Z71A 6GCHF 1F92A 4ZHAA 3RM2H 1AVWA 2F9UA 5HKKD 1SVPA 4IN2A 2VIQA 1ABJH 3ZZ7A 3PTBA 3AW1A 3TNSA 4ABHA 1YF4A 3P8FA 5EJZA 5EXMA 4WF8A 2RDEA 3RXAA 3AASA 1CA0B 2ZFPH 4DW2U 2RDLA 3M5OA 2P8OC 1ZSJA 2WUCA 2H2ZA 1QTFA 1L4DA 2Z9JA 1HLTH 1VJ9U 1PPEE 3DUXH 1MCTA 1WQVH 2PUXB 2ZCKP 1OXGA 3UPEA 2C8WB 3H7OA 1JRTA 1O2LA 2Q1JA 4ISHH 1KMHB 1D6WA 2Z94A 5JB9S 3P70B 4F55A 1BMAA 2SNVA 3RXRA 1B5GH 4ABFA 1P0SH 1GI6A 1NS3A 1AE8H 4OS5A 1TYNA 1FPHH 2QV1A 4K1SA 2QF5A 3UOPA 3NUMA 1LVOA 3SV9A 4Q2KA 1FLEE 4AX9H 3LKWA 2BD9A 1AMHA 2Q6DA 4FVDA 2CN0H 3SUEA 2ZF0H 3MMGA 3LC3A 1Z8JB 1QB6A 1OWHA 1JOUB 1IQFA 3BTQE 4AFZA 1Z6EA 5ETXA 2ZU3A 2JETB 2XC5A 1BCUH 2C8ZB 1O2YA 2HNTF 1FMGA 4TWWA 1P2NA 3A89A 1T4UH 2ZPQA 1JMOH 1LKBA 5DSFA 1F7ZA 5HIYA 2J95A 2AGIX 1TLDA 2BQ6B 1SB1H 2YMSD 3UWIA 2ZECA 1GDUA 1SLXB 1SHYA 1YYY1 1C1RA 3GY5A 1CA0C 1GBMA 1OWKA 1SGFG 1MBQA 3MU4A 3CNRA 2FLBH 4ZKRU 3NK8A 1ZTJA 2WV5A 3ZZDA 1SQAA 5EW1H 1G32B 1SMFE 1DUAA 1BRBE 3A82A 3MU5A 2BDAA 2LP6A 2GX4A 3RXFA 1Q2WA 4GHQA 1RJXB 1MD7A 1O2GH 2I6SA 2PKSB 1EPTB 2QYIA 2NU1E 4B2BA 1U6QA 2W26A 1NY22 4INLA 2M2AA 1DLKB 5IDKA 2H9EH 1O5BB 4X1QU 4I8JA 3ZV9A 1BMMH 1TPOA 3QN7A 2W6JD 3MYWA 1EOLA 3ZZ4A 3SHCH 1O3AA 5C20A 1AWFH 1O36A 1WXRA 5JBAS 2FEQH 2KFWA 3RU4E 1T32A 4X2VA 2GTBA 3ATIA 2GCTB 2JETC 2GVFA 1GBHA 4BAKB 1VGCB 1LQDB 1V2ST 3LGUA 1K1OA 3BTME 1RXPA 1S0RA 4MQAA 3KEEA 1V2TT 1C5OH 1QRZA 2Z3DA 2YNBA 1IHSH 1W2KH 4ISIH 4JYTA 4DVAU 3RXEA 1BUIA 1ESBA 1TRYA 2FS9A 3MO3A 4WJG2 2ZDVH 2G8TA 1THRH 5FAHA 2EQNA 2FX6A 3FFGA 1FXYA 4H4FA 5A0CA 3OYPA 1YGCH 1EAWA 2AIQA 3P8GA 3MNSA 4ZKOU 4IGDA 2O8LA 3ODFA 4X2YA 1TALA 1BBRK 2PKSC 4CBNA 3MU0A 2ZEBA 1HFDA 3MTYA 5EGMA 3KQCA 3O8CA 1NPMA 3GCNA 3SUDA 3SU4A 1GHYH 2TGPZ 1UCYK 3TH3H 1O33A 1C4V2 1UVTH 5DJ7A 1OWEA 1VR1H 4HG6A 4I8HA 1UMAH 3FP6E 1TNLA 3WW7A 3GY8A 2A31A 1FJSA 3ZVEA 1LMWB 4AOQA 1KXDA 4ZCNA 2P3FH 2R0LA 1KLJH 4I8KA 1TAWA 2PLXA 2P94A 1AVXA 2FOEA 4MPXA 4B75A 4Y76A 1VGCC 4YT6H 1IOEA 2UUFB 2YOLA 2ZTYA 3E0PB 4BANB 2KCOA 1Y5AT 1AU8A 5DP9A 3SI3H 1E1QD 1UK3A 1P57B 3SZNA 1YPEH 2VWLA 1TNKA 4ISOA 2BY9X 5C1XA 5J4QA 3K65B 5FPTA 1GI2A 4FUEA 3PWCA 1V2JT 1Q31A 7GCHF 2XCFA 3OX7U 2ZU2A 4B2CA 1A3BH 3PV5A 5FX5A 1L1NA 2BB4A 1DUEA 5GCHF 1TMUH 4Z6AH 1CA8B 1YCPM 3KHVA 1VCWA 2FYRA 3BIUH 4GHTA 1P03A 3QZQA 1K1LA 3IITA 1TA6A 2OC0A 2BDCA 4K8YA 4FUCA 1MTWA 2UUYA 1BBRE 1HJ9A 2ZG0H 2PGQB 2OCVB 5JDUB 1ELCA 1O3KA 1LQEA 4AGKA 1P02A 2GDDA 1G30B 4M9FA 1KXAA 2BM2A 2LELA 1O2JA 1YKTA 4CRDA 1H1BA 2TIOA 1TMBH 1T8NA 2G4UA 1WSSH 3AK5A 2PP6A 2R0KA 3TGJE 3UQVA 2JH0D 2G81E 3CP7A 1MTNB 4I8LA 1AE5A 3A86A 3RM0H 1AO5A 1BTYA 4X8VH 1BZXE 1AFEH 5HGGA 3QK1A 1QGFA 5T6GA 5HMAA 5C1UA 4NGAH 3RLYH 2IPQX 5FHTA 2ZTZA 1P2MA 4XBDA 1SL3A 1Y3VA 3Q3YA 2PHBA 3SGBE 3PLBA 2J97A 3PRBA 1C5XB 1O2OA 4FUBA 5FL7D 3QX5H 4FUJA 2ZGHA 1XXDA 2STBE 4D7GA 3SORA 1S0QA 3PV4A 1RTLA 2ZTXA 4DCDA 1AUJA 1UVUH 2WYJA 4YOGA 3SW2B 1S6LA 3KYFA 1FN8A 1K9OE 3ZV8A 2TRMA 4ACAA 1V2QT 2H9TH 2FWWA 3TK5A 4A6LA 1XUFA 1HIAB 4E7NA 1GJ4H 1G9IE 5DP7A 1W7XH 2J92A 1TE0A 3RMOH 3A7WA 4OS2A 1GBKA 3K9XB 1W0ZU 2F83A 4X6OA 1SLWB 2KAIB 3SU3A 1O3BA 4FUIA 2HLCA 4OS6A 2YNAA 2F9NA 2IPHA 6LPRA 1E1RD 3UREA 1CU1A 4CHAB 3RDZA 5EQSA 2JKHA 4HI3A 1O5AB 3GDVA 3GYMA 3E8LA 4UDWH 5HM2A 1TNHA 5H4IB 4I86A 1EP5A 1MCVA 1OP8A 1VITG 1W7GH 3F9HA 1VJAU 3BTWE 1VITH 3VB3A 3STIA 2ZHWH 1IAUA 1NN6A 4ZAEA 4FU8A 4OGYA 2OC8A 2JJ2D 1A5IA 4YLUA 3RXGA 1B7XB 3M5LA 1ID5H 2JJ1D 1SLVB 4ZMAH 9ESTA 3MH7A 5JBBS 2TGTA 1K2I1 3MQKC 1C2IA 3PMAB 3GY3A 1CO7E 3EA9A 2ZGXH 5ESTE 3SJ9A 4H42U 1IQJA 2FO9A 4CRGA 1GCTC 3GOVB 3F2HA 1O3FA 2SGPE 3ATLA 1A5GH 1GHBG 3FO8D 3KNXA 1C5WB 3T2NA 1HAOH 3RXCA 2HRVA 1Q3XA 1A4WH 1VITF 2Z7FE 5E2PA 1BT7A 1V2KT 3M7QA 1EJAA 2XWAA 1ETSH 4U30A 3ZVBA 1NRQH 1TBZH 3KQDA 5E0HA 4IC6A 3SNAA 3SQHE 1YM0A 1BDAA 3DSOA 3PMHB 3SNBA 4K8BA 3L33A 1GWAA 3SI4H 1MZDA 4HZHA 4A1XA 4UFDH 1PPBH 5C5NA 2PV9B 2AMQA 2A7JA 1H9HE 1PJPA 1Y3XA 5EPNA 1ORFA 1V6DA 4FU9A 4WH8A 7ESTE 3RXPA 4AG1A 2AYWA 2SGEE 1GHBF 4CHAC 3MO9A 2XBXA 1F5KU 3HKIB 3UOUA 9LPRA 3NPSA 1O2WA 2BQ7B 5EODA 1TRMA 1BOQA 1SGCA 1DS2E 1O2PA 3UB0A 2BVSH 5HXFA 1NBME 1MAXA 1F0TA 4AB9A 3H5CB 3SU6A 2D1JA 2W7SA 3S9CA 1TPSA 1DE7H 4WY3A 4INHA 1XKBC 4NIWA 1P10A 1GJ5H 1TBQH 3RMMH 1UTJA 3P92A 4Y11E 4KP0A 4RT0A 1ANEA 4ZXYH 1LO6A 2KX4A 3PO1B 2D8WA 2GZ9A 4I31A 1O3CA 5T3HA 1O2VA 1SG8B 2ODYB 2BY8X 3A8AA 1SPJA 2OP9A 1NM6A 1YCPK 2ODPA 3A7ZA 3K6ZA 4JYVH 3WWBA 4AFQA 1TQ7B 2FX4A 3RXHA 3DT0H 1S6HA 1SGDE 3VEQB 1SGRE 3I77A 2P93A 1GDQA 4GAWA 2BDHA 3PMBB 4O9VA 2Q6FA 1TGBA 3I78A 2H5CA 1O3NA 1J14A 1QL8A 3MU1A 5EJ1A 1ZHMA 1PYTD 1DXPA 1ZMLA 5FX6A 1IQKA 2Y82A 3TGKE 2WUBA 1AGJA 2P3TB 3TJUA 4XBCA 3RXMA 2V3HH 3ZVDA 1WBGB 4TPIZ 1WAYB 1G37A 1HRTH 2QF0A 4X8UH 1FDPA 1XUGA 2QA9E 2XBVA 5AHGH 3SZEA 4ZXXH 4KKDA 2OC7A 2XC4A 1EATA 1TX8A 2ZHDA 1NFXA 5EJLA 3DCLA 1DDJA 1ELBA 1FZZA 1W8BH 1SGIB 2Y81A 3A8DA 4DIHH 5AFZH 1CT2E 2NU3E 1P9UA 3RXDA 1P9SA 4HTCH 3SJ8A 6GCHG 3ZZ3A 3LU9B 1A0HB 3PO1C 2ZFRH 3ODDA 3U98H 5CE1A 1GI3A 1ZPBA 2ZFTA 3RC4A 3JZ2B 3QGJA 1BTXA 4HGCA 3ZYEA 1H8DH 1BIOA 1YWUA 2PGBB 1BTWA 2AEIH 4NA7A 2SFAA 1O30A 3EA7A 3D62A 1K1JA 1GBDA 2ZNKH 2J98B 1EUFA 1IQNA 1C5LH 1JWTA 1LHCH 3UNQA 4PROA 4Y8XA 1V2MT 1V2UT 4CH8B 1BRCE 1TNIA 4AYYB 1G3EA 3RU4T 3M7TA 2FOBA 2HNTE 2Y5FA 2Z3CA 1AVGH 1O3IA 2R3YA 1EB1H 2W3KA 1A46H 5TCAA 3GS9A 3B9FH 4CRAA 1C4U2 4DGJA 3S7HB 1WUNH 2AERH 1TWXB 2A5IA 4DOQA 1PPFE 4YOIA 1ZTLA 1CSOE 3MU8A 1C2DA 4JZEH 1AZ8A 5TCCA 1Z8IB 3E1XB 1H9LB 3UUZA 2P95A 4A92A 2ZU1A 3UWJH 3RC5A 1DWCH 1P2IA 3SJOA 1TGNA 1P2KA 1BITA 3RXUA 2P59A 4YM9A 3F3BA 3OTPA 5G4BA 1NTPA 1QZ8A 5DP8A 4ZH8A 2OXSA 2J38A 5CHBA 1GMDG 3EE0B 5FPSA 1O38A 3SU2A 3DFLA 3M7UA 1SQRA 1ZMJA 2ANWA 2PKAB 1NU9A 4AC9A 1WQSA 2AMDA 4SGAE 3A85A 3TJVA 4WWYA 1O32A 4RN6A 3QDZB 4ASHA 1Z8GA 5C2ZA 3M5MA 1O3HA 2OQUA 3R0FA 5EQQA 1PQ7A 4YZUA 3KF2A 1FAXA 4TPYA 2Z3EA 2AS9A 2ZO3H 1S83A 1HAPH 2F9PA 2SNWA 2IOTA 2EI8A 1GMDF 1JRSA 1O2RA 1D4PB 4K5ZA 1DY9A 2Y5HA 5SGAE 1TOCB 2XW9A 1MQ6A 3KQ5A 1DT2A 2ZIQH 4GLYA 1V2LT 1TNGA 2HWLB 2HLDD 2FI4E 3RXIA 3ITIA 2OTVA 1Y8TA 2J4IA 1QCPA 5CMXH 2JIZD 4KGAA 1FNIA 3SYJA 1SOZA 1D6RA 4HFPB 4MPWA 1LHFH 3ATMA 5KGOA 4Z1MD 2QCYA 1V3XA 3E91A 1AUTC 2AH4X 1ELAA 1GHVH 3RUOA 4NIVA 3V7TA 1TOMH 1A7SA 2KZ4A 3GDSA 4CR5A 2LNCA 3T27A 3NKKA 4FUHA 1QL7A 1LPZB 3BG4B 1J17T 1AFQB 1JIMA 2FS8A 1EPTA 1P04A 1QJ1B 3LGIA 4A7IB 2A5KA 2QN5T 1D3QB 3EDXB 3RXKA 4ABEA 1NO9H 1QIXB 2ZQ1A 5EXNA 1EFRD 1FY4A 1PQAA 1P05A 1ANDA 3FOAA 1MU8B 3MWIU 3HK3B 2Y6TA 5LH8A 3U8OH 4E06H 2QXIA 3ZZ6A 4KTUA 2CV3A 3DD2H 2BY6X 4CREA 2C3SA 1C1MA 3OEHD 2H1UA 1T31A 2Q6GA 1ARCA 2WPDD 3U9AH 1EKBB 2CJIA 3Q76A 1V2VT 1E0FD 1QY6A 4UD9H 1C4Y2 4X2WA 2KM0A 8LPRA 3AW0A 3T26A 3U1IB 8ESTE 1A3EH 1H8ED 4Y0ZE 3EE7A 3KCGH 3T28A 4X6NA 5GJ4B 3E0NB 4K2YA 3CS0A 1LHDH 1OPHB 3F1SB 4X2XA 2FOAA 1IQHA 1PQ8A 1MUEB 5DKMA 2A5AA 1GJAB 5C94A 1DSUA 1C2KA 1KLTA 1O2TA 3M37A 3SN8A 3S9AA 5C0UA 5E2OA 3GCTG 2FI5E 4CH2B 3LPRA
chains in the Genus database with same CATH topology
1IQIA 2ALPA 5FPYA 2A32A 1HAHH 5LPRA 3MNXA 1OWDA 1N6XA 1HBTH 4X1SU 2Z9KA 1G2MA 4MNXA 2UUKB 1KIGH 3BG4C 1ANCA 1AI8H 4Z0KA 1AFQC 1KYNA 1V2NT 3FP8E 4ZKNU 1W10U 1WV7H 3RMNH 4X1RU 1ZPZA 3BSQA 2R2WU 1WCZA 4NA8A 4YTAA 1HAGE 1AWHB 1FAKH 2ZFQH 4YLQH 1EP6A 1O5GH 3UR6A 1VCPA 4FUDA 2TGAA 1W12U 3LJJA 1HNEE 3TK9A 1KDQB 3SJKA 1P06A 2GCHF 1ZOMA 3GCTF 2ZI2H 3R3GB 1AIXH 4WMFA 3RU4D 2P3UB 5E0GA 2AFQB 1L1JA 1O3EA 3TJNA 1PPCE 4IMZA 3RXLA 3Q3KA 1S84A 1UTKA 2VH0A 2VWOA 4Y6DA 5JBCS 1A2CH 1AHTH 2VB0A 3BF6H 1W13U 4ZUHA 5FBIA 4ZHLU 1SR5C 4GPGA 7GCHG 4A1TA 3OY5U 4XFQA 4B71A 1ELDE 1GG6B 1HAZB 1SGFA 4I33A 1XMNB 3BEFB 1P3CA 2ZZUH 1GJBB 5GCHG 3M61U 1F5RA 1HAVB 2BD8A 2XWBI 3OSYA 1CHOG 4XDEA 1YPHC 3SNEA 2BDBA 3TK6A 1SBWA 3F9FA 1RTFB 1B0FA 2W3IA 5F8ZA 3S0NA 2V0BA 4BTTB 4GSOA 2H5DA 1ZGIA 5AFYH 2A4RA 1C2JA 1FI8A 2FOHA 1J9CH 1K1PA 1DOJA 4UEHH 3NCLA 1O3GA 2RCEA 3C1KA 2ODQA 4XOJA 1P01A 4IW4E 2B5TB 2DE9A 1G3BA 4Q7XA 4SGBE 1GCDA 3T62A 2J34A 1SGTA 1T8MA 2CGAA 1E36B 2CXVA 3ATWA 4LZ4B 1ZRKA 1CHOF 2GT7A 4E05H 2VVCA 1C2EA 2AGEX 1NRPH 3LGYA 2G52A 3ZZBA 2ZPSA 1W3CA 4LK4A 3K2UA 1UTNA 3HGNA 4UFEH 3PM3A 1ELTA 2GT8A 2F91A 3M35A 2TPIZ 3LDXH 1OSSA 2GKVE 2HOBA 3TITA 2AIPA 4M7GA 1O2NA 1ZZZA 3P95A 2R2MB 1GG6C 4NCYA 2VU8E 1ABIH 4FXGH 1XUKA 2VWNA 1O2XA 4JYUH 2GZ8A 3VFEA 1C1QA 1A0JA 2IN2A 4DY7B 3SOSA 2FTMA 3CENA 1MKXH 2JH5D 1P3EA 5DK1A 2EEKA 1RIWB 3SU5A 1EZXC 5A0AE 2WPIS 3NWUA 1OWJA 2OBQA 1C1TA 1BTUA 2VVUA 2XTTB 3VB6A 3UIRA 1SGNE 3OU0A 3L6PA 1EAIA 2G51A 2ZFFH 2ILNA 2J9NA 2HVXA 4UONA 1C5SA 1C1NA 2UWPA 3AVZA 4JCNA 4ABIA 1EB2A 4INKA 4X0WU 1LPGB 1GCTB 2BVXH 2G5NA 3BN9A 5F8TA 2ANYA 5LGOA 4ISLA 3ENSB 3E6PH 4U2WA 3EQ0H 4AZ2B 1HIAA 2G55A 2XC0A 2Y5GA 4OS7A 4LZ1H 5GIBA 2KAIA 3S7KB 1HGTH 4NIYA 1P12E 4Y8YA 1CBWB 2BD2A 1ELVA 1QQ4A 2C90B 2C4FH 1DPOA 3FZDA 3UTUH 1PPZA 3FZZA 1BTPA 1C2MA 3QZRA 1ZR0A 1UCYH 2EA3A 2ZHFH 1OKXA 1C1OA 1G3DA 3JZ1B 5A8XA 4GCHG 1FPCH 2ZCHP 4AG2A 1S82A 3LIWA 4TY7A 2RA0A 4NFFA 1GHWH 1W0YH 1GL1A 1Y5UT 1CGIE 2PSYA 1TA2A 2BQWB 1RIWC 3MNCA 2VJ1A 2ZU4A 1ELGA 2THFB 5HYOA 2ZU5A 4AORA 1IQMA 1LVBA 1YC0A 3EA8A 4O3TA 5DP6A 5EQRA 4ABGA 1A0LA 1W14U 4DJZB 1C1SA 2RA3A 3I29A 1UTLM 4THNH 4BAMB 4YESB 4GCHF 5DG6A 3RMLH 1LHGH 5FXLA 1L0ZA 2A7CA 1NFYA 4I7YH 2Z6BD 3HPTB 2FM2A 1WTHD 3KQEA 2OBOA 4ESTE 1PQ5A 2VIVA 3QTVH 4Y79A 4O03A 1CBWC 3MH6A 4Y7BA 2BXUH 1UVOA 2ZKSA 8GCHG 1TX7A 2SGAA 3A87A 1OP2A 1V2PT 3SU0A 2ZPRA 1CHGA 4NA9H 3STJA 3BEIB 1YPKH 4Q7YA 1FV9A 1WYKA 1BTHH 3MH5A 1L2EA 3E90B 1HXFH 1E37B 1TRNA 3TGIE 1FY5A 5F03A 3LH3A 1O39A 1QBVH 2W5EA 3GCHB 3QUMP 1FQ3A 5DP3A 1D3PB 4H6TA 4CRBA 5T6DA 1O5DH 1DWEH 1SSXA 1V2OT 3H7TA 3P8OA 3S69A 1AKSB 1LPKB 1C1PA 1XKAC 2FXRA 4FU7A 1JBUH 1KSNA 4D76A 8GCHF 4NIXA 1NRSH 4BXSA 5JYIA 1C9PA 5K7RA 4MNWA 2FZZA 1TGCA 1J16A 1MH0A 2ALVA 5DP5A 1O3PB 1YPJH 3EAJA 1S5SA 3GYLB 3E3TA 1UHBB 4BTIB 4ZHMU 4D9RA 1BRUP 1IQGA 4R0IA 1IQLA 3U8RH 1K1IA 2FESH 1OP0A 2QXGA 3AAUA 1MMJN 1GI9B 1O5CB 1QQUA 4NFEA 2UWLA 3ZVFA 1BB0B 3MNBA 3C27B 1AB9B 3LT3A 1VZQH 3QTOH 5K0HA 3B8JA 4KELA 4RKJB 2SGFE 4B74A 1XUJA 4E7RG 1D3TB 2A7HA 2ZDNA 1ANBA 1CQQA 1GBJA 1NESE 4YT7H 1E35B 1HB0B 2BD3A 1FN6A 3FVFB 5L2ZH 1WTGH 1GI4A 4ZKSU 3E16B 2BY7X 2V3OH 3D23A 3UR9A 2ASUB 3GCHC 4JZDH 5BPEA 1F5LA 2EI6A 1DVAH 2XBWA 3RXOA 3BTKE 3EGKH 1ETTH 2A4QA 3HK6B 2G4TA 2Z9LA 3O8BA 2GDEH 2QC2A 3ELAH 2BD4A 4CR9A 3TVJB 1UVPA 1O5EH 3WY8A 3L3TA 4CRFA 3ZZ5A 2OINA 1QBNA 3VGCC 3TIUA 1GI5A 3V13A 1QRWA 2QAAA 4AFUA 1C2FA 2BLQA 3ZVCA 1FY3A 2WPLS 4MG3A 4YO9A 1N8OB 2ZC9H 2F9VA 1TONA 1YPHE 2XRCA 3SO3A 3BV9B 2VNTA 4TWYA 5C67A 1C5TA 3KIDU 4GUXA 3SJIA 1O3JA 1DANH 1QRXA 1Z7KA 3PLPA 2HPQH 4FVBA 1AB9C 1QURH 5IYTA 1SQOA 3M3SA 1XXFA 4BNRA 1SGPE 1T8OA 1QBOA 1SGEE 3PWBA 1C2HA 4DIIH 2VH6A 3PLKA 3DHKH 4F49A 1KLIH 2V6NA 2R9PA 1MTUA 1C5UA 1B0EA 1UTQA 1QJ7B 4U01A 1BTZA 1Z1IA 1DWDH 1GJDB 3SGAE 4A5TS 4CBOA 3SV2H 5I25A 3D65E 3SV7A 1THPB 3BTEE 2G00A 3FP7E 4LXBH 1K21H 2GGVB 1UK4A 2A4GA 3DFJA 1H9IE 1MZAA 5DP4A 3DA9B 5A0BA 1SGQE 1NRNH 2PKAA 1G36A 1ZHRA 5A8YA 3UY9A 5T6FA 3MO6A 3SUGA 1C5NH 1TNJA 4D9QA 1MD8A 3V3MA 1N8OC 5FBEA 1LVYA 1EZSC 1C2GA 1DLEA 1TABE 1Y3UA 6ESTA 1ZJKA 3GICB 1HDTH 1Z1JA 1E38B 3A7TA 1EX3A 1AN1E 1RRKA 2C93B 2O8TA 4VGCC 2QY0B 1GVLA 1YCPH 4JK5A 1NT1A 1GVZA 1UTOA 2VIDA 2JH6D 5GWZA 1UO6A 2A2XH 2A2QH 3F9EA 3LH1A 5AVDA 4AYVB 1LTOA 2GV6A 1ARBA 1MKWH 1ACBE 2ULLA 1C5QA 3LONA 1SI5H 1Z6JH 2BX3A 5JPMH 3MOCA 1O37A 1P8VC 1RGQA 1ZRBA 2B7DH 3GISB 3W94A 3M36A 5ESBA 1GBAA 1O2IA 4B73A 3PB1E 2PFEA 2PTCE 1ZSLA 4BAOB 1Y5BT 5I46H 1O3LA 1TGSZ 2QIQA 3RXSA 7KMEH 2UWOA 2HGTH 2O8UA 2XNIA 3FANA 3LOXA 1LKAA 2WPHS 3RLWH 1C2LA 4TYDA 5L6NH 4D8NA 4NSYA 2OUAA 1OWIA 5E0JA 1K28D 2BX4A 2XBYA 4MLFB 5PTPA 1UTMA 5F8XA 1GVKB 3IG6B 4XSKU 4B2AA 1GI8B 1SFQB 4XE4A 4I8GA 1FUJA 1D3DB 5BRRE 1TX6A 3HGPA 4J2YB 1DXWA 4B1TA 4LOYH 1Y59T 4AFSA 1BRAA 2P16A 1TMTH 2VIPA 2QXJA 1GI1A 2G5VA 3F68H 1G3CA 2QXHA 2ZDAH 5GPIB 3T5FH 3BG8A 3VPKA 3RXBA 3P8NA 1O2UA 3SGQE 4DG4A 1PYTC 1J8AA 2J94A 1M9UA 2F3CE 1OYQA 2FLRH 3G01A 1NFWA 2CF8H 1O31A 3A83A 4UFGH 1FIWA 2GCHG 1ETRH 2B8OH 2J2UA 1GBLA 5LPFA 4FUGA 1EXFA 2H9HA 1MKXK 1DFPA 1NU7B 1P09A 4K69A 2WV4A 3UQOA 1GI7B 2ZCLP 1BMNH 2BMGB 3LC5A 2PUQH 3AAVA 4MDSA 1ZLRA 2VVVA 1XUIA 2BLWA 3SU1A 4MVNA 1KDQA 4JZIA 4UFFH 1S6FA 1SLUB 1NROH 2PTNA 1AY6H 3MFJA 5TJXA 4K1EA 3QO6A 2D2DA 3T29A 3F9GA 2O9QA 3A80A 2PSXA 1EJMA 2UUJB 4WXIA 1BA8B 3OY6U 1O2QA 2GZ7A 2K1QA 3PMJA 2A1DB 3P6ZB 3TU7H 3NXPA 2GP9B 3A8CA 2A45B 1GMHG 2C8XB 5DGJA 5CHAB 3ESTA 3TPIZ 1GBIA 3BTDE 1Y3YA 3A7YA 2ZGCA 1EPTC 1MTVA 4QT8C 5C5OA 2B9LA 5A2MH 2RG3A 4OS1A 1L4ZA 1L1GA 3VXFH 2BDYA 2M5TA 2Y7ZA 3UFAA 5A09A 1O3DA 1LHEH 2FP7B 4YOJA 1FONA 1HV7A 3NZIA 1HJAB 5GXPA 2ANKH 1HAVA 2OQ5A 5HM9A 2VWMA 2ZGJA 4X1PU 5F6MA 4OGXA 1C5MD 3Q3XA 4NZLA 1YPGH 1HXEH 1GMHF 4O3UA 1UJ1A 1SHHB 3ZZCA 4ABJA 1O0DH 4DT7B 2O8MA 3SBKA 1THSH 1ESTA 2GCTC 3Q77A 5FCRA 2ZDKA 3ZVAA 1Y3WA 2TBSA 4K1TA 2ZFSA 2O8WA 1XX9A 1KTSB 3CS7A 4ZROA 1P2JA 1QNJA 4Y7AA 3M5NA 1ZTKA 2ZDLA 1MBMA 1O35A 1S81A 1BHXF 3HATH 3U1JB 1JXPA 2SGQE 4D7FA 1NC6A 1CGJE 1RTKA 4ABDA 3A7XA 2WPKS 4MTBA 1WU1A 4BAHB 1ZJDA 4K60A 1DY8A 1EZQA 2Z9IA 1ZYOA 3S9BA 2CHAB 2HNTC 1HYLA 1TBRH 5CHAC 1ZMNA 1FIZA 2VGCB 1YLDA 3RXQA 1OYTH 4JZFH 1PPHE 3KL6A 1KXCA 1SQTA 5L2YH 1F2SE 3T25A 1EAUA 1YPMH 1O2SA 1P2QA 4J1YA 2FOCA 2NU4E 2NU2E 3F6UH 3ZZAA 2VINA 4CRCA 1OS8A 1QB9A 4RKOB 1HJAC 5A8ZA 1DITH 5EXLA 3FAOA 1IQEA 4X6MA 4Q7ZA 4H6SB 2BVRH 1K1NA 3PYHA 4MPVA 5AF9H 1HAYB 1F0RA 3SNCA 1O2HA 5EU8A 1UCYE 2NU0E 4U32A 2BXTH 3OTJE 1F0SA 4X8SH 2WPMS 3SV6A 3RXTA 1ELFA 1SOTA 4FUFA 2ZP0H 3U8TH 1HUTH 1DWBH 1GPZA 2SGDE 4A1VA 3A7VA 3ZVGA 1BQYA 1DSTA 4JZ1A 1J15A 2HALA 1T4VH 3KQBA 3BTHE 3UNSA 4RSPA 3BTFE 1AQ7A 3ATKA 2AGGX 2STAE 3RC6A 1DICA 3VB5A 1LDTT 5EPYA 1O3OA 2PW8H 1SGYE 2FIRH 1KY9A 1FY8E 1DM4B 1GL0E 2FOMB 1O5FH 4AB8A 3V12A 4NWLA 2ZGBH 1YBWA 3W95A 1P11E 2IJOB 2CHAC 1INCA 1BBRH 1Z8RA 2BDIA 4Q80A 2VGCC 3GY2A 3TJOA 1TFXA 4I32A 2FI3E 3SQEE 3M3VA 3BEUA 2Y80A 5DPAA 7LPRA 1BHXB 2HPPH 5GDSH 1XUHA 3RP2A 2ANMH 1N1LA 4Y8ZA 2PWXA 3SNDA 2OLGA 1GJ8B 2EC9H 3MH4A 1AZZA 2GMTB 5ABWA 1C1WH 1GHZA 1GBCA 1TGTA 1PPGE 1GJ7B 4NZQA 2BTCE 2W7UA 2NWNA 5C1YA 1GJ6A 1C5ZB 1EASA 1SC8U 2ZQ2A 2DUCA 2QGRA 3VXEH 5JBTA 2BZ6H 1NZQH 1YPLH 3SUFA 1V2RT 1DX5M 1MQ5A 3GY7A 4O97A 4Y71A 1JIRA 1MTNC 2TGDA 1X7AC 2FYQA 2VIOA 3PTNA 1PFXC 1T8LA 5EG4A 1TIOA 3O8RA 2VIWA 4JMYA 1NFUA 5C3NA 3RXJA 1O2ZA 2Z9GA 5FCKA 1GBFA 1CVWH 1KXBA 1BJVA 1H4WA 1YLCA 3URCA 4XBBA 1HAIH 3U69H 1K22H 4BOHA 2BOKA 3SHAH 1EQ9A 3EYDA 4DURA 3Q00A 2C8YB 4Y0YE 2ZHEH 1D9IA 1QJ6B 1XVMA 2A4OA 4JK6A 1TB6H 3MI4A 4KTSA 5JB8S 1RD3B 3ZYDA 1GBBA 1BMLA 4MNVA 2F9OA 3B23B 3QWCH 1CT4E 1GJ9B 4WMEA 1GGDB 1O3MA 1OX1A 3TH2H 1C5VA 2BZAA 2F9BH 1TQ0B 1IHTH 2PR3A 5EOKA 1AKSA 1YP9A 2I6QA 1CE5A 1ESAA 2BHGA 3MHWU 2GMTC 1MU6B 1GBTA 3KGPA 1QA0A 1H8IH 3A88A 2OC1A 2FTLE 1HAXB 1OOKB 5EW2H 4ABAA 2BD7A 2BOHB 2WYGA 1C5RA 4MPUA 2DE8A 1C9TA 3IWMA 4K3JA 3RXVA 3V0XA 1VCQA 2D26C 2FMJA 2BDGA 2V35A 3P17H 1UHBA 4BTUB