2ZCKP

Crystal structure of a ternary complex between psa, a substrat-acyl intermediate and an activating antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Prostate-specific antigen
total genus 53
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP01
3FFGA 3GY7A 1UTLM 1O5GH 1P10A 3MMGA 1EX3A 1PPEE 2P59A 1A5IA 1XUKA 1SQOA 1O36A 2SNWA 1C1UH 2CHAC 1EPTC 1F5LA 2O9QA 3BTEE 4GCHF 1QJ7B 1TOCB 3GOVB 3LONA 1HCGA 5A8ZA 4R0IA 1FI8A 2C90B 2BD8A 1OWDA 3LJOA 1O2TA 5AF9H 1EZQA 1QBNA 3F1SB 4H4FA 3UOPA 4INKA 3MH7A 1C2LA 5DO4H 2QYIA 2ASUB 3P92A 4O97A 4KTCA 5JDUB 2ZI2H 1AO5A 2Q6DA 1AVGH 1DICA 1LPZB 1NRNH 2BMGB 2HNTC 1RTFB 1VGCB 2WINI 1C5VA 1OWIA 1VJAU 3GYLB 1MKXK 2AERH 3KGPA 3A8BA 4I8HA 1SOZA 2SGPE 4OS2A 3RXPA 1T8OA 5FXLA 3IITA 1O5BB 2WPKS 2FS8A 4LXBH 4NZLA 5E2PA 1LCYA 3CS0A 1KY9A 3RM0H 3NK8A 1IQEA 3C27B 4K3JA 2AMDA 3SV7A 1QTFA 2OINA 2QN5T 2BLQA 5LPFA 1H9LB 4OGYA 3SJIA 2ZHQH 5EODA 3UOUA 1D6WA 1J8AA 4HZHA 1NFYA 3SGAE 1LHGH 3VEQB 3UIRA 1NPMA 3FP6E 4Y71A 1W13U 2GZ8A 3ZZ9A 3PO1C 2OBOA 1P2MA 1RTKA 5DP8A 3OX7U 2J94A 3OY6U 2ODPA 5JPMH 1QJ1B 3PLKA 4DJZB 3JZ1B 2CHAB 3MOCA 3M35A 1QB9A 2PUXB 3SU5A 2O8WA 1GI5A 2OLGA 1D6RA 4BNRA 3U8TH 3VPKA 4ZHMU 1C1VH 1QRXA 2R3UA 4K5ZA 2BDHA 1V2QT 2ZDMA 4ABEA 2B0FA 1TPAE 4BTTB 1OXGA 1P2NA 2FEQH 4X1QU 1GJDB 3QWCH 4Y0YE 3SNCA 4CREA 3RXRA 3A86A 3TH3H 3H7TA 1E37B 3D65E 5B6OA 3A7TA 2O8LA 3R0FA 5GCHF 5ESBA 1O3PB 1A61H 1BTHH 1JIRA 2RG3A 1JWTA 6GCHF 3RXJA 2XRCA 3SGBE 1E35B 1O5AB 5H4IB 4DY7B 3GICB 2PKSC 1W10U 1NY22 1BT7A 1HAHH 1O0DH 1C1RA 1W0YH 1S6FA 3MH5A 2Z9KA 4YTAA 2QGRA 1ABJH 4YOGA 3ATWA 5EGMA 5CE1A 2OC0A 1S6HA 1QR3E 2TGPZ 1PYTD 2AGEX 1UCYE 1YBWA 4K2YA 1KXDA 1FY5A 2WPJS 1GJ5H 4ISOA 1NO9H 2J2UA 2PUQH 1IQFA 3DT0H 1QCPA 2IJOB 1EAWA 1ACBE 1EZSC 1NESE 4NG9H 4UONA 3GY3A 5GXPA 1VJ9U 2A1DB 1TWXB 2D8WA 1HRTH 1K1MA 4X6NA 2BXTH 3V3MA 1HFDA 3ZVEA 1TAWA 2ZTZA 1BJVA 1A3BH 3L3TA 5FBIA 2ZDNA 3BN9A 3SV9A 4JZEH 4JMYA 1NT1A 4ABDA 1XUJA 3SUGA 3GY2A 2OCVB 4IC5A 3RMLH 1SC8U 3VB6A 3SI3H 4I8JA 1J16A 1SLXB 3SHAH 5HYOA 3OU0A 1AWHB 2ZFFH 1L1NA 1E38B 2PHBA 3PLPA 1GMHF 1YYY1 5A8XA 1Z8JB 1MTNB 1EJMA 1T8MA 1RTLA 1BDAA 3VGCC 2ZHDA 1ELTA 4ZKNU 4X2XA 3ZV9A 3DD2H 2DUCA 2J38A 2NU1E 4LK4A 1TNJA 2CN0H 1HPGA 1QL7A 1S0RA 1O2SA 2OBQA 2OC1A 2FOAA 1MAXA 2WV5A 3UY9A 3M3SA 1KXFA 4ZH8A 4E05H 1JRTA 1GJ9B 2IN2A 5DP3A 4O3UA 1GMDF 3STIA 4NFEA 3V13A 1TE0A 4BTUB 1FIWA 4NIYA 3SNAA 1J17T 2VB0A 5A09A 1QNJA 3EA9A 4XSKU 1LTOA 1C1OA 3SN8A 2J92A 1DPOA 1VITF 1T7CA 1KSNA 5DPAA 2THFB 1A5GH 3BEIB 1ARCA 2GCHG 2XYAA 1ELFA 1E0FD 4BAKB 2Z9GA 4YO9A 1UTMA 1GJBB 4YOIA 1GWAA 1LVBA 2UUKB 2B7DH 1Y5UT 1GI4A 2HVXA 4MNVA 1P04A 3MWIU 4MNYA 5FBEA 4DOQA 1AY6H 1GMHG 2QA9E 1O2JA 1K2I1 2J95A 4SGAE 2QXJA 3QUMP 3SUDA 1BB0B 1GBHA 1SVPA 4ZUHA 1BBRK 5FCKA 4RKJB 1BMAA 3SZNA 1RD3B 1BHXF 4FUEA 4AG1A 1HIAA 2CF8H 1ELAA 1W2KH 2JH0D 3BTDE 2QXGA 2A45B 1TMUH 1EP5A 3TH2H 3DFLA 4YLQH 1V2WT 1A2CH 2G52A 1ETRH 1OP0A 1HDTH 2ZU4A 3BTME 5AFZH 1O2HA 4XBBA 1ESBA 4AYVB 1Z8IB 3D49H 3MNSA 7GCHG 5C20A 1TQ0B 2ALPA 1VITG 2A32A 1O3HA 2UUYA 5C2ZA 3BIVH 3F9HA 1CHOG 4B2CA 1ZMNA 4Y79A 1JRSA 1BBRE 2Y6TA 3TJUA 1G32B 1B0FA 1EOJA 3MO3A 1Y8TA 1SR5C 1LPGB 3VGCB 4A1TA 3HGPA 1SQTA 1VCPA 3A83A 4U32A 4DIIH 1UVUH 5GPIB 4I8KA 4BAQB 3SU6A 5JYIA 1THPB 1O3AA 4HTCH 3SV6A 4Y76A 2BOKA 1L1GA 2BD5A 1HAVB 1UTJA 4XE4A 3BTQE 3ATKA 1TIOA 1AIXH 1O30A 2A4QA 4GHTA 3M5NA 3F68H 2PTCE 1V3XA 1ABIH 1TNKA 2HPQH 2BX4A 1RS0A 3GCNA 2ZIQH 3T5FH 4CH2B 1FPHH 1ZYOA 1GPZA 1ZSJA 3ELAH 1JXPA 3A88A 3H7OA 1DXPA 1NU9A 2P95A 4KTUA 3K2UA 3GCOA 1CT4E 1OS8A 1K28D 1Q3XA 2BDGA 1FY3A 2ZPRA 1O5DH 3LC3A 4M7GA 2A4GA 1O3GA 4TWWA 4Y10E 2ZECA 2R2MB 2O8TA 1NFUA 2ZQ1A 3P6ZB 4FU8A 1AKSA 4XDEA 1P57B 4IN2A 1GJ7B 3QX5H 2BQ7B 2H9TH 2VIOA 4GCHG 1ELEE 1GBJA 1O3OA 3S9CA 2F83A 1C1NA 1FZZA 2BY6X 1O2RA 1EAUA 3EDXB 1SGPE 1Z6EA 4X6OA 3T2NA 1ZHPA 1IQNA 1LPKB 5IYTA 1CBWC 3A7WA 4ABBA 2GD4B 1HAZB 4YT6H 1BHXB 3UR6A 2VH0A 3GDSA 4E7NA 1CGIE 1C1TA 1DY9A 1P2IA 4FVDA 3D23A 3MNXA 3U8RH 1P3EA 3STJA 4FUBA 1GBIA 4K1EA 1LVMA 1LO6A 4WMDA 1BRCE 1SGQE 2GTBA 1S85A 1SGCA 1FIZA 2BVRH 2ZDKA 3UWJH 3A87A 2BLVA 4JYTA 1GJCB 1N6YA 2TRMA 1V2ST 3RXLA 2P16A 3Q3XA 1O3MA 5HM2A 2BLWA 1Z1JA 3QTVH 1YLDA 1T8NA 5TCCA 4KP0A 1P2QA 3MHWU 4CR9A 2GP9B 3ODDA 1YF4A 3GYMA 1TRYA 3KEEA 1SMFE 4VGCB 1VITH 3MO9A 1UVPA 1O2MA 5L30H 1DS2E 1ELCA 4NWLA 1F5RA 1HB0B 3FANA 2C8ZB 3TH4H 1P01A 3KN2A 1CU1A 1CT0E 1YPLH 1MTUA 1MQ6A 2BD3A 1QA0A 4FUHA 1LKAA 1W7GH 1SLWB 4X8SH 1J14A 1L2EA 2V3HH 2A2QH 2DE9A 1GGDB 1FAXA 2ANMH 3ZZCA 1HIAB 1HXFH 1PQ7A 4D76A 1AWFH 5AVDA 4IMZA 3NXPA 2CMYA 2RDLA 1Q2WA 4K8YA 1G37A 2WPLS 2WPMS 4NA7A 4E7RG 2NU4E 1VR1H 2C93B 1DM4B 1G3EA 2LPRA 2FOFA 1GJ6A 4Q2KA 2F3CE 1Y3XA 2ZDVH 1IHTH 1IQLA 5F8ZA 2XWAA 3AAVA 2AH4X 1VGCC 2D2DA 1NS3A 2BDAA 2C3SA 4ZXXH 5JB9S 1KXCA 1T4UH 3RDZA 1SGRE 1N8OC 2A7CA 9ESTA 5L2ZH 4ASHA 6GCHG 2AGIX 3RXHA 1FDPA 1VCWA 2H9HA 5JBTA 1DWCH 5DP7A 1AUJA 3E6PH 8GCHF 2YNBA 2TBSA 1BRAA 5CHAC 3RMMH 5EXLA 2J4IA 3V0XA 8KME2 1O3LA 2FX6A 1UTOA 1EASA 1FY8E 1P2JA 3U98H 4K1SA 1WV7H 5F8XA 1THRH 2Z9JA 2ZDAH 1P02A 2P3FH 4ABAA 1O39A 3HKIB 4ABHA 1CHGA 4D8NA 1RJXB 2FODA 3ZVCA 2ZKSA 1FONA 2Z7FE 1GVLA 3PWCA 4H6TA 5EPYA 3MH4A 1F0RA 2WUCA 2A5AA 1ETTH 3RXQA 1K1IA 1ZSKA 3PMHB 1OPHB 2W26A 1RRKA 1DX5M 1HV7A 2AYWA 3RC5A 5FCRA 2XBXA 5BRRE 2FTMA 2ZGHA 2FS9A 1DWDH 2F9UA 1ZTLA 1GVKB 1A3EH 2BQWB 1DT2A 1ZRKA 2TPIZ 1C2MA 4K69A 2G00A 1C9PA 1KTSB 2FTLE 1ANDA 4IMQA 4Z6AH 1GDQA 1EZXC 1INCA 8GCHG 1GI9B 2ZDLA 5C67A 2A4OA 3MNBA 5GCHG 1C2DA 1ANEA 2ZGCA 1C5RA 2P93A 2A31A 1BUIA 1GHXH 3PTNA 2Q1JA 4RSPA 1XMNB 1C5YB 2QY0B 1TOMH 1FY1A 1T32A 1BRBE 1KDQB 1N6XA 2VIQA 3AVZA 2OC8A 4WH6A 1BMNH 1CQQA 5F03A 1KTTB 1PPFE 2VGCB 1E34B 3RUOA 4X8TH 5EQQA 1OOKB 1GBEA 2QAAA 2VIWA 3S7HB 2OXSA 2BDCA 4NZQA 3S9BA 1GBDA 2FI5E 1HNEE 3RC6A 1HJAB 1AB9B 1TFXA 2XBWA 3VB3A 1GCDA 2G4TA 1MH0A 2ZPQA 4CRAA 2VWMA 4X0WU 6ESTA 3UWIA 4FUCA 1DLKB 2GCHF 1RIWB 3SO3A 3M61U 4TYDA 5C1UA 2BB4A 1O34A 4YESB 3Q00A 3SU2A 1GI8B 3VB7A 2ALVA 1C5PA 3SGQE 4A6LA 1DSTA 3TJOA 1C5WB 4OS6A 1QL8A 1OYQA 4R8TB 1NRRH 4WY3A 1GG6B 1NM6A 2BD7A 2ZP0H 1X7AC 1DITH 3BV9B 4Y6DA 2OTVA 5C5OA 1O3IA 1O37A 1SBWA 1N1LA 1UHBB 4MPWA 1GBAA 1F0TA 3HKJB 1DOJA 1TA6A 3OYPA 1CA0B 4AB8A 8ESTE 2OQ5A 1YP9A 1K9OE 2O8MA 1GJ8B 3UNRA 1P12E 1V2JT 1C9TA 1KYNA 4QT8C 4THNH 1O2PA 3GDVA 3MU1A 4ISHH 1CA0C 3M5OA 1IQJA 1D9IA 1TGSZ 4FVBA 1PPBH 3Q3KA 3LKWA 2QC2A 4D9RA 3U1JB 2Q6GA 2ZC9H 4NCYA 2GT7A 4JK6A 1V2KT 3TU7H 2ZU3A 1ID5H 4WJG2 1GDNA 1DDJA 1FN6A 1WCZA 3BTFE 1SLUB 4AORA 2W7UA 2QV1A 1O3FA 2VGCC 2VH6A 3M7TA 4X6MA 3QZRA 3BTWE 1AUTC 1SQAA 3TNTA 2BOHB 4CHAC 3VXEH 4HGCA 4IW4E 1ELGA 2IOTA 1VZQH 2XCFA 2GZ7A 2ODYB 2FO9A 1Y3UA 1C5UA 4DURA 4NSVA 1GI1A 1MQ5A 1ELBA 2FIRH 2V6NA 1XKBC 1ELVA 1QFKH 1GCTC 1O5CB 1YPHE 3FVFB 3SJ9A 5A0AE 1QQ4A 3KQDA 3S7KB 2C8WB 3U1IB 5EW2H 1UTPA 4MTBA 2HNTE 2BVSH 2CV3A 2EI8A 3BEFB 4K60A 1YC0A 1TMTH 4MDSA 1OYTH 4YLUA 5LPEA 3GCHB 2J9NA 1HAOH 1HAGE 3ZYEA 1BQYA 2ZGJA 3UPEA 5EG4A 1GHBG 3F9EA 3QDZB 3SUEA 1O2NA 1DSUA 1DANH 3OTJE 4ZKSU 4AOQA 1ZOMA 1Z71A 1BTZA 3FAOA 2NU3E 1UVTH 4ZMAH 1YPHC 1KXEA 1TPOA 1QIXB 1Y5AT 2VINA 1RXPA 3I29A 1D3QB 2JH6D 3ZZAA 1MU6B 3RXDA 1BA8B 1OSSA 2H5CA 3LGYA 3P70B 4B1TA 1BTUA 1SFIA 3RMNH 3SU3A 7ESTE 1AB9C 3GCTF 2BHGA 1SGFG 2Y7ZA 4J2YB 3VXFH 4B2AA 1MTSA 5I25A 4CBNA 1FV9A 4F4OC 3U8OH 3ESTA 1JBUH 3QZQA 3RXUA 1MU8B 3EGKH 4NIXA 5A8YA 2UWOA 3KHVA 2BLOA 3KF2A 3RLWH 1XUGA 2WUBA 3S0NA 2PSYA 1ZR0A 5F8TA 3NZIA 1F0UA 1NU7B 1NZQH 2HWLB 3SORA 2FX4A 3LC5A 4CRBA 2BDBA 4B71A 4WWYA 3FZZA 3RU4D 3C1KA 2C8XB 1CVWH 1BJUA 1ZGVA 3AW1A 4I32A 3ZVAA 3E0NB 1D3DB 2GT8A 4TY6A 3RP2A 2STBE 4WXIA 2J34A 3ZZDA 1KDQA 1GBTA 1P11E 1N8OB 3RXBA 2PR3A 4AB9A 2IPHA 2ESTE 3ZZ4A 3P8OA 1AZZA 1DFPA 1ZTKA 1NN6A 1MBMA 1HUTH 1NC6A 3KQBA 4ZKOU 1W14U 1UTKA 4AG2A 1SFQB 3RXCA 4E06H 3PMJA 4FXGH 5C5NA 1Y3YA 5FPSA 1O31A 2BD4A 1S5SA 4CR5A 3SJ8A 3ATMA 5FX5A 4GVUA 1UK3A 1P06A 3W95A 4B74A 1SB1H 2ZTYA 1LHCH 1GBKA 3GISB 8LPRA 1FMGA 2GX4A 2FYRA 2A7JA 2FOHA 2SGDE 2BTCE 1L1JA 1V2NT 1YPEH 2FM2A 3K6YA 2G55A 2GV7A 2ZO3H 3ENSB 1DLEA 1H9HE 4GAWA 1O2LA 1JIMA 1G30B 2ZG0H 2FOCA 4LZ4B 3OY5U 1QURH 4A7IB 5TJXA 2YOLA 4ZAEA 2FYQA 4NWKA 5DKMA 1F7ZA 3EA8A 2RA0A 5HMAA 4FUFA 1G2MA 3M3VA 4B73A 1BZXE 1G3DA 2CGAA 1LDTT 1KLJH 1TQ7B 1QJ6B 2GMTB 2TGDA 3KIDU 1BTXA 3RXIA 5C1YA 2XTTB 1K22H 4INHA 5GDSH 3RU4E 4DCDA 2ZHFH 1MZAA 2H6MA 2VNTA 2BY5X 1ESAA 1O2KA 5JB8S 5ABWA 3UR9A 3T25A 2ZNKH 1UJ1A 2V35A 4DIHH 4Q80A 1C5OH 1P2OA 3SQHE 1FLEE 1CGHA 2Z94A 1C5TA 1V2UT 1CSOE 1TYNA 4B2BA 1H9IE 3BIUH 1ORFA 3N7OA 3UQVA 5LGOA 3M7UA 2KAIB 3NPSA 4JYVH 1IQMA 4MPUA 2XW9A 2GV6A 4FUIA 3K9XB 4UE7H 2QXHA 4FU7A 1THSH 3A7ZA 1AFQC 4IC6A 5F6MA 3TK5A 1IOEA 1H4WA 1CBWB 1D3PB 1GBMA 1W3CA 2GVFA 3UREA 1A0JA 4FUDA 1IAUA 4DW2U 3E1XB 3M5MA 3TGIE 6CHAB 4JZDH 4AGJA 1EPTB 5E0GA 1C5NH 1MCTA 3ZV8A 2SNVA 1UHBA 3RXOA 1SSXA 5EW1H 1GHVH 4AGKA 4A1XA 3LGWA 1V2TT 2P94A 2AMPA 1BTPA 4X8UH 3ZVBA 3ZZ6A 3RXGA 3VB4A 2BX3A 4D9QA 5DJ7A 1Z1IA 4JK5A 3CP7A 1C1PA 3RU4T 4WH8A 5J4QA 2QCYA 2WYGA 2M5TA 2VWNA 4OS1A 4ISNA 2BDYA 1SLVB 1TGBA 1MUEB 1OWEA 5DP5A 2UUFB 1C5XB 1KLIH 4Y7BA 1C1QA 3A8CA 1TB6H 3BG8A 1GI7B 1TNGA 1O38A 1GBFA 3T28A 1SGDE 5K7RA 1HAYB 1HXEH 4NIVA 2WPIS 1P09A 3RM2H 1DUAA 1WU1A 1AE5A 4BANB 3HGNA 1C2FA 4ABGA 2R0LA 4NGAH 1UVSH 3MI4A 1BOQA 1P05A 3WY8A 5LPRA 2ZPSA 4PROA 3ZVFA 1EJNA 3EAJA 2FDAA 2BZAA 3CS7A 4A5TS 2GDDA 4JCNA 1IQKA 2TGTA 4WVPE 4K1TA 4NSYA 4X2YA 1YCPM 4I31A 3FP7E 1HYLA 2AEIH 3BTKE 2AIPA 1TABE 4OS4A 2GCTC 3T26A 2CF9H 2XNIA 1TBRH 1ZPZA 2PGBB 5E8EH 1A4WH 1YKTA 5HXFA 2H9EH 1FPCH 3SOSA 2PLXA 2PW8H 4UEHH 2Y5FA 3U9AH 1V2VT 3F9GA 2FI4E 1O2XA 1A0HB 1C2IA 2ZCKP 1QRWA 1AMHA 2F91A 3A84A 3A7XA 1TX7A 3W94A 1GHAG 1B0EA 5EQSA 4CH8B 3AASA 3P8GA 1ZHRA 2XWBI 1DWBH 2WYJA 1ZMJA 3ZZ7A 1GI3A 3URCA 2G8TA 4UD9H 1A1RA 2Z9IA 1A0LA 3PMAB 1NROH 3BTHE 2TIOA 1S84A 4H6SB 4JYUH 1CT2E 3GY8A 2A0QB 3TLOA 1FN8A 2F9NA 1SGEE 1KIGH 3V7TA 2G5NA 2C8YB 4NA8A 1HBTH 1W0ZU 2OQUA 4Q7ZA 1ELDE 4X2WA 4B76A 1B7XB 2ZFTA 3AW0A 3SUFA 1ZPCA 2BM2A 4B75A 3QGJA 2FOMB 3U69H 2R2WU 1G36A 4OS5A 2BZ6H 4Y8YA 2AMQA 1PPZA 1GHZA 7GCHF 2Z3DA 5GJ4B 1MKWK 4X8VH 4AFSA 1O2WA 2H1UA 4HFPB 1HJAC 5FX6A 1DVAH 3M5LA 1C2GA 1SL3A 1ESTA 1XUIA 1GHBF 2SGQE 2FOGA 2Y5GA 2ZHEH 2ANKH 4A92A 2K1QA 5L2YH 2UWPA 1GDUA 1PQ5A 3F6UH 2AFQB 1LMWB 1W11U 2JKHA 1C5ZB 3A85A 1AGJA 3TITA 1SGNE 4Y7AA 2GKVE 3RC4A 1ZMLA 1ZTJA 2ZGXH 1P8VC 3GCHC 2ZWLH 3SI4H 3KQCA 2NU0E 2CXVA 2BYAX 2BD2A 2PTNA 1PQAA 2HPPH 2Y80A 2W3IA 1GBCA 1A46H 3E0PB 2VVVA 3SW2B 4UDWH 3SHCH 4DT7B 4FU9A 1SGFA 1YLCA 3EQ0H 1S83A 4IBLH 3E8LA 4UFEH 1YCPK 4ISLA 1QL9A 4X1NU 4Q7XA 1AHTH 1BMLA 3NKKA 3LH3A 1OKXA 4HI3A 3ZVGA 1XX9A 1MKXH 1GMDG 1HAIH 1HAXB 3QGNB 1GHWH 5DP4A 1D3TB 3B8JA 1TNIA 3O8BA 2FPZA 5FAHA 3SQEE 3MFJA 3E3TA 4ABIA 1O3NA 5ETXA 1WQVH 4TPIZ 2G4UA 1O35A 3H5CB 5DP6A 2P8OC 3PROA 3MH6A 1F0SA 1UTQA 1SGIB 2ZZUH 1NRSH 2QF3A 4WMFA 5T6FA 1FQ3A 2XC0A 3I77A 1SPJA 1MTNC 1O3DA 1PFXC 2G5VA 1Z8GA 3S9AA 2HALA 1AD8H 5K0HA 4WF8A 3NCLA 3TJNA 2P3TB 4XBCA 5E2OA 3LJJA 1C4V2 1WTGH 4CRDA 4UFDH 1PPGE 3PTBA 1O3BA 1EB2A 1PQ8A 5SGAE 2BXUH 3LGUA 1P3CA 4Y8XA 1ZJDA 3DA9B 1FY4A 1B5GH 1AVXA 1OWKA 2EC9H 1C2EA 3PB1E 9LPRA 1HAVA 1XVMA 1C2JA 5ESTE 1WSSH 1ZGIA 1S81A 1GBLA 3KQEA 1ZSLA 4ZKRU 3Q77A 2PKAA 3D62A 4TPYA 3MU0A 4NA9H 4YT7H 2PWXA 3LGTA 3SJOA 2NWNA 2XBYA 4AN7A 4MPXA 6LPRA 4X1PU 2VWLA 1XXFA 1QHRB 2HGTH 3GCTG 4BAHB 1A5HA 1HJ9A 3E90B 3RXVA 3RLYH 4BAMB 4MVNA 1RIWC 2R0KA 1S0QA 2ZF0H 1MBQA 1SI5H 1WTHD 4NFFA 3RXMA 5CHAB 4J1YA 3KCGH 2PKAB 1MTWA 1T31A 2BY9X 1QBOA 2Y7XA 1GMCF 1C1MA 1O2UA 2EEKA 1O2IA 4WMEA 2BY7X 3M7QA 3PYHA 1BTYA 3SJKA 5TCAA 1HJ8A 1L0ZA 2I6SA 3EYDA 1YPGH 1TGCA 1AFQB 4OGXA 3RXAA 1FXYA 5GWZA 3P17H 4MPVA 2F9OA 2JETB 2ANYA 4GHQA 2LNCA 4AFZA 2RCEA 1KLTA 3SV2H 4VGCC 1UCYK 2F9VA 4ZXYH 2UUJB 3P8FA 3TGKE 1YPJH 3M36A 3UFAA 1T4VH 3RXFA 1TNLA 1V6DA 3A82A 1T8LA 3SV8A 1CA8B 1SHYA 3L6PA 1GJ4H 5BPEA 4FUGA 5G4BA 5DP9A 1GL1A 4GUXA 5HM9A 1UK2A 2Y81A 2ZCLP 1HLTH 1LQDB 3GDUA 4I7YH 2ANWA 1DXWA 5EU8A 5PTPA 3MNCA 1O2QA 2DE8A 1PPCE 4GSOA 3A7YA 2D26C 2D1JA 5EPNA 5JBBS 1DUEA 1SGYE 3E91A 1CE5A 5T6GA 1TALA 5HGGA 2VIVA 3TGJE 4KKDA 3MO6A 1BRUP 1K1LA 1H8DH 4IN1A 1J15A 1RGQA 5DG6A 3LT3A 2YNAA 4ISIH 1EAIA 1F2SE 4LOYH 1LHDH 2V3OH 2ZFQH 5EOKA 1G3BA 1C5QA 1P03A 4A1VA 3URDA 2BQ6B 3SU1A 4BXWA 1TGNA 1ANCA 1TNHA 4F49A 3L33A 3Q3YA 5C3NA 2AS9A 2HOBA 2BVXH 1NRPH 1LKBA 3K65B 1MD8A 4YOJA 1XUHA 4I33A 2ZA5A 1P0SH 2EI7A 2PV9B 1HGTH 2PSXA 1DE7H 1IHSH 3FZDA 1OP2A 2JETC 2OD3B 4BAOB 1O2OA 3A89A 3AAUA 1Z6JH 4O9VA 1V2LT 4KELA 1Y5BT 1G9IE 1GGDC 3NWUA 4ZROA 2VU8E 3UUZA 3S69A 5EXMA 4RKOB 1O33A 1AKSB 1BTWA 1W7XH 2XC5A 2GZ9A 1O3CA 1YCPH 4Y11E 3QLPH 2SGAA 2V0BA 2QF0A 2P3UB 3MU5A 2FLRH 3QK1A 1GI2A 1O32A 3R3GB 2EA3A 1OX1A 3IG6B 3HPTB 1EB1H 3O8DA 1EP6A 1L4DA 2Z9LA 1H8IH 3BEUA 1Y3WA 1XUFA 4X2VA 2OP9A 2FWWA 2A4RA 2ZU2A 2ZTXA 2B8OH 1EZUC 1ARBA 1ZPBA 1YGCH 3ODFA 1BBRH 4CRFA 4Z0KA 3BSQA 1EKBB 1JMOH 3ZVDA 2ZCHP 1AE8H 3A7VA 3GY6A 3HATH 2BD9A 4XFQA 1SGTA 3G01A 1OP8A 3LGVA 1TPSA 3T29A 2Y82A 1D4PB 1K21H 1C4Y2 1O3JA 2JH5D 1TBQH 1XXDA 3MU4A 4O03A 5I46H 2GDEH 2FP7B 2NU2E 1G3CA 2P8OB 1NTPA 3P8NA 1MAYA 5L6NH 2HLCA 3F9FA 2BY8X 5AFYH 4CRGA 1V2OT 2FOEA 4CBOA 4X1RU 5E0JA 3SU4A 4BOHA 3VFEA 1GHAF 1PJPA 3QO6A 1O2GH 4TY7A 5FHTA 1H1BA 4DVAU 2SGFE 3TK6A 3ZYDA 3Q76A 1TONA 2CJIA 2G81E 2HRVA 2AIQA 1O3EA 1MZDA 4LZ1H 1RFNA 3GY4A 1SOTA 1XVOA 4AZ2B 3TJVA 1BITA 3BF6H 3TPIZ 1K1PA 2O8UA 1QGFA 1LHFH 4Q7YA 3O8CA 1FUJA 3SBKA 1MMJN 2W5EA 1OWJA 3A8AA 1EAXA 1IQGA 1K1JA 1NFXA 1WOFA 4DG4A 4YM9A 5DGJA 3ATLA 1UCYH 1MCVA 1TRNA 3ZZBA 4UFGH 2H5DA 3SU0A 3ZZ3A 5A0BA 2FXRA 4X6PA 2A5IA 2QXIA 3FP8E 1AFEH 2Z3EA 2SGEE 3HK3B 1U6QA 1CGJE 1MD7A 3RXKA 1UVOA 1C4U2 1DWEH 4I8GA 1IQIA 3BG4B 1O3KA 2VWOA 4XBDA 2A7HA 3B9FH 3M3TA 3SNBA 2A2XH 4O3TA 2R3YA 2VJ1A 4MNXA 4X1SU 1L4ZA 2VVCA 5JBCS 1F5KU 1Y3VA 4JZ1A 1EQ9A 2VVUA 1JOUB 2B9LA 5E0HA 1OWHA 2RA3A 4MG3A 1NRQH 2R9PA 7LPRA 1C5MD 2KAIA 1W8BH 1WYKA 1WUNH 3V12A 5IDKA 2FZZA 2Z6BD 3IWMA 1QBVH 1P2KA 1UTNA 2FOBA 1KXAA 3T62A 7KMEH 1QQUA 3SNDA 2Q6FA 5CMXH 2AGGX 1AU8A 1C2HA 1TMBH 2SFAA 3VB5A 1UK4A 2ODQA 4TWYA 3A8DA 1AI8H 1GG6C 2ZFPH 3PLBA 1TX6A 1WAYB 3RMOH 2A5KA 1TA2A 1BMMH 1GI0A 1QA7A 1GI6A 3KL6A 3P95A 1AVWA 4YZUA 3UTUH 2F9BH 1EPTA 1GVZA 1SG8B 1ZRBA 4KGAA 1YPKH 4ZHLU 1UO6A 4OS7A 2PFEA 2F9PA 1XM1A 5FPYA 3MU8A 1A7SA 3B23B 3GY5A 2GGVB 1TGTA 3TK9A 4IS5A 1O2ZA 5T6DA 5A0CA 3LGIA 1EATA 3HK6B 3TIUA 1BIOA 1ZHMA 1O5FH 1VCQA 1UMAH 1CO7E 3K6ZA 4I8LA 1MTVA 1O2YA 1QY6A 1AQ7A 2W3KA 1ZJKA 4GLYA 3LU9B 4AX9H 1P9SA 1J9CH 5DK1A 4MNWA 4IGDA 1QB6A 4U2WA 1V2PT 2UWLA 1NFWA 3M37A 3KNXA 4CHAB 1EOLA 2H2ZA 1G2LA 3UNSA 4D7GA 3DUXH 1WQSA 2OC7A 2QIQA 5EXNA 2Y5HA 2ZEBA 1C1SA 2ULLA 2PKSB 2EI6A 1P9UA 1S82A 3ATIA 3JZ2B 1W12U 5GIBA 3ITIA 1QB1A 3PWBA 4MQAA 1LQEA 3UNQA 1GL0E 1GCTB 3SNEA 3NUMA 3E16B 1TLDA 1LVYA 3BG4C 1FNIA 3T27A 2ZGBH 4AFUA 1EJAA 1KXBA 1M9UA 1ANBA 1GHYH 2WV4A 3PV4A 5JBAS 3DFJA 2PGQB 1TRMA 1V2RT 1E36B 5J4SA 4ESTE 3MYWA 3LH1A 2XC4A 3PM3A 3QTOH 2ZHWH 4JZFH 4JZIA 4MLFB 1WBGB 1Z7KA 4SGBE 3RXSA 4U30A 1BCUH 1EUFA 2XCNA 3LIWA 4FUJA 2ZQ2A 3RXTA 1FJSA 1PPHE 4K8BA 1LHEH 1TX8A 2ILNA 1SHHB 3OSYA 1AN1E 3UQOA 4BXSA 1O5EH 1HAPH 3I78A 5FPTA 2ZU1A 5LH8A 5C1XA 1C5LH 1QRZA 2B5TB 4BTIB 1ZZZA 1ZLRA 2FESH 4Y0ZE 1MKWH 1K1OA 5AHGH 2I6QA 2VIDA 2HNTF 2FLBH 3TNSA 5EQRA 2XBVA 6CHAC 4RN6A 1Z8RA 3PO1B 4INLA 1LVOA 3QN7A 3O8RA 3A81A 1C2KA 1TBZH 4H42U 1GBBA 1YPMH 3PMBB 3RXEA 1ETSH 1C5SA 2TGAA 4U01A 2C4FH 1EXFA 2BDIA 3LOXA 3LPRA 3DHKH 1GJAB 1O2VA 2FMJA 3BTTE 2W7SA 1YM0A 2GCTB 2WPHS 4ABFA 1C1WH 1CHOF 2G51A 3A80A 4XOJA 1XKAC 1FAKH 3BTGE 5A2MH 4D7FA 4AFQA 4ZHAA 4AYYB 1TPPA 1K1NA 2XXLA 3TVJB 1F92A 5T3HA 3MTYA 3ZZ8A 1AZ8A 3EA7A 1Q31A 2ZFRH 4CRCA 4NIWA 2Z3CA 4Y8ZA 2GMTC 1Y59T 3CENA 3EE0B 1V2MT 4ABJA 4WXVA 2ZU5A 1GMCG 4UFFH 4KTSA 3ZZ5A 1DY8A 1IQHA 2ZFSA 4GPGA 2STAE 3LDXH 4DGJA 2FI3E 2VIPA 1PYTC 2OUAA
chains in the Genus database with same CATH superfamily
3FFGA 3GY7A 1UTLM 1O5GH 1P10A 3MMGA 1EX3A 1PPEE 2P59A 1A5IA 1XUKA 2K8IA 1SQOA 1O36A 2SNWA 1C1UH 2CHAC 1EPTC 1F5LA 2O9QA 3BTEE 4GCHF 1QJ7B 1TOCB 3GOVB 3LONA 3F0PA 1HCGA 5A8ZA 4R0IA 1FI8A 2C90B 2BD8A 1OWDA 3LJOA 1O2TA 5AF9H 4ACAA 1EZQA 1QBNA 3F1SB 4H4FA 3UOPA 4INKA 3MH7A 1C2LA 5DO4H 2QYIA 2ASUB 3P92A 4O97A 4KTCA 5JDUB 2ZI2H 1AO5A 2Q6DA 1AVGH 1DICA 1LPZB 1NRNH 2BMGB 2HNTC 1RTFB 1VGCB 2WINI 1C5VA 1OWIA 1VJAU 3GYLB 1MKXK 2AERH 3KGPA 3A8BA 4I8HA 1SOZA 2SGPE 4OS2A 3RXPA 1T8OA 5FXLA 3IITA 1O5BB 2WPKS 2FS8A 4LXBH 4NZLA 5E2PA 1LCYA 3CS0A 1KY9A 3RM0H 4FOUC 3NK8A 1IQEA 3C27B 4K3JA 2AMDA 3SV7A 1QTFA 2KX4A 2OINA 2QN5T 2BLQA 5LPFA 1H9LB 4OGYA 3SJIA 2ZHQH 5EODA 3UOUA 1D6WA 5HIZA 1J8AA 4HZHA 1NFYA 3SGAE 1LHGH 3VEQB 3UIRA 1NPMA 3FP6E 3OEHD 4Y71A 2QF5A 1W13U 2GZ8A 3ZZ9A 3PO1C 2OBOA 1P2MA 1RTKA 5DP8A 3OX7U 2J94A 3OY6U 2ODPA 5JPMH 1QJ1B 3PLKA 4DJZB 3JZ1B 2CHAB 2XNDD 3MOCA 3M35A 1QB9A 2PUXB 3SU5A 2O8WA 1GI5A 2OLGA 1D6RA 4BNRA 3U8TH 3VPKA 4ZHMU 1C1VH 1QRXA 2R3UA 4K5ZA 2BDHA 1V2QT 2ZDMA 4ABEA 2B0FA 2KR7A 1TPAE 4BTTB 1OXGA 1P2NA 4HG6A 2FEQH 4X1QU 3PV5A 1GJDB 3QWCH 4Y0YE 3SNCA 5KGOA 4CREA 3RXRA 3A86A 3TH3H 3H7TA 1E37B 3D65E 5B6OA 3A7TA 2O8LA 3R0FA 5GCHF 5ESBA 2HVYB 1O3PB 1A61H 1BTHH 1JIRA 2RG3A 1JWTA 3OE7D 3RXJA 6GCHF 2XRCA 3SGBE 1E35B 1O5AB 5H4IB 2J97A 4DY7B 3GICB 2PKSC 1W10U 1NY22 1BT7A 1HAHH 1O0DH 1C1RA 1W0YH 1S6FA 3MH5A 2Z9KA 4YTAA 2QGRA 1ABJH 4YOGA 3ATWA 1E1QD 5EGMA 5CE1A 2OC0A 1S6HA 1QR3E 2TGPZ 1PYTD 2AGEX 1UCYE 1YBWA 4K2YA 1KXDA 1FY5A 2WPJS 1GJ5H 4ISOA 1NO9H 2J2UA 2PUQH 1IQFA 3DT0H 1QCPA 2IJOB 1EAWA 1ACBE 1EZSC 1NESE 4NG9H 4UONA 3GY3A 5IK2D 5GXPA 1VJ9U 2A1DB 1TWXB 2D8WA 1HRTH 1K1MA 4B6FA 4X6NA 2BXTH 3V3MA 1HFDA 3ZVEA 1TAWA 2ZTZA 1BJVA 1A3BH 3L3TA 5FBIA 2ZDNA 3BN9A 3DSOA 4JZEH 3SV9A 4JMYA 1NT1A 4ABDA 1XUJA 3SUGA 3GY2A 2OCVB 4IC5A 3RMLH 1SC8U 3VB6A 3SI3H 4I8JA 1J16A 1SLXB 2JDID 3SHAH 3OU0A 5HYOA 1AWHB 2ZFFH 1E1RD 1COWD 1E38B 1L1NA 2PHBA 1GMHF 3PLPA 1YYY1 5A8XA 1Z8JB 1MTNB 1EJMA 1T8MA 1RTLA 1BDAA 3VGCC 2ZHDA 1ELTA 5HIYA 4ZKNU 4X2XA 3ZV9A 3DD2H 2DUCA 2J38A 2NU1E 4LK4A 1TNJA 2CN0H 1HPGA 1QL7A 1S0RA 1O2SA 2OBQA 2OC1A 2FOAA 1MAXA 2WV5A 3UY9A 3M3SA 1KXFA 4ZH8A 4E05H 1JRTA 1GJ9B 2IN2A 3F3BA 5DP3A 4O3UA 1GMDF 3STIA 5HKKD 4NFEA 3V13A 1TE0A 4BTUB 1FIWA 4NIYA 3SNAA 1J17T 2VB0A 5A09A 1QNJA 3EA9A 4XSKU 1LTOA 1C1OA 3SN8A 2J92A 1DPOA 1VITF 1T7CA 1KSNA 5DPAA 2THFB 1A5GH 3BEIB 1ARCA 2GCHG 2XYAA 1ELFA 1E0FD 4BAKB 2Z9GA 4YO9A 2WHXA 1UTMA 1GJBB 4YOIA 1GWAA 1LVBA 4XD7D 2UUKB 2B7DH 5EJLA 1Y5UT 1GI4A 2HVXA 4MNVA 1P04A 3MWIU 4MNYA 5FBEA 4DOQA 1AY6H 1GMHG 2QA9E 1O2JA 1K2I1 2J95A 4SGAE 2QXJA 3QUMP 3SUDA 1BB0B 1GBHA 1SVPA 4ZUHA 1BBRK 5FCKA 4RKJB 1BMAA 3SZNA 1RD3B 1BHXF 4FUEA 4AG1A 1HIAA 2CF8H 1ELAA 1W2KH 2JH0D 3BTDE 2QXGA 2A45B 1TMUH 1EP5A 3TH2H 3DFLA 4YLQH 1SKYE 1V2WT 1A2CH 2G52A 1ETRH 1OP0A 1HDTH 2ZU4A 3BTME 5AFZH 1O2HA 4XBBA 1ESBA 4AYVB 1Z8IB 3D49H 3MNSA 7GCHG 5C20A 1TQ0B 2ALPA 1VITG 2A32A 1O3HA 2UUYA 5C2ZA 3BIVH 3F9HA 1CHOG 4B2CA 1ZMNA 4Y79A 1JRSA 1BBRE 2Y6TA 3TJUA 1G32B 1B0FA 1EOJA 3MO3A 1NBME 1SR5C 1Y8TA 1LPGB 3VGCB 4A1TA 3HGPA 1SQTA 1VCPA 3A83A 4U32A 4DIIH 1UVUH 5GPIB 4I8KA 4BAQB 3SU6A 5JYIA 1THPB 1O3AA 4HTCH 3SV6A 4Y76A 2BOKA 1L1GA 2BD5A 1HAVB 1UTJA 4XE4A 3BTQE 3ATKA 1TIOA 1AIXH 1O30A 2A4QA 4GHTA 3M5NA 3F68H 2PTCE 1V3XA 1ABIH 1TNKA 2HPQH 2BX4A 1RS0A 3GCNA 2ZIQH 3T5FH 4CH2B 1FPHH 1ZYOA 1GPZA 1ZSJA 3ELAH 1JXPA 3A88A 3H7OA 1DXPA 1NU9A 2P95A 4KTUA 3K2UA 3GCOA 2WZQA 5T1VA 1CT4E 1OS8A 2OK5A 1K28D 1Q3XA 2BDGA 1FY3A 2ZPRA 1O5DH 3LC3A 4M7GA 2A4GA 1O3GA 4TWWA 4Y10E 2ZECA 3UAIC 2R2MB 2O8TA 1NFUA 2ZQ1A 3N7DA 3P6ZB 4FU8A 1AKSA 4XDEA 1P57B 4IN2A 1GJ7B 3QX5H 2BQ7B 2H9TH 2VIOA 4GCHG 1ELEE 1GBJA 1O3OA 3S9CA 2F83A 1C1NA 1FZZA 2BY6X 1O2RA 1EAUA 3EDXB 1SGPE 1Z6EA 2K0QA 4X6OA 3MQKC 3T2NA 1ZHPA 1NBMD 1IQNA 1LPKB 5GNDA 5IYTA 1CBWC 3A7WA 4ABBA 2GD4B 1HAZB 4YT6H 1BHXB 3UR6A 2VH0A 3GDSA 4E7NA 1CGIE 1C1TA 1DY9A 1P2IA 4FVDA 3D23A 3MNXA 3U8RH 1P3EA 3STJA 1WXRA 4FUBA 1GBIA 4K1EA 3WWBA 1LVMA 1LO6A 4WMDA 1BRCE 1SGQE 2GTBA 1S85A 1SGCA 3GS9A 1FIZA 2BVRH 2ZDKA 3UWJH 3A87A 2BLVA 4JYTA 1GJCB 1N6YA 2TRMA 1V2ST 3RXLA 2P16A 3Q3XA 1O3MA 5HM2A 2BLWA 1Z1JA 3QTVH 1YLDA 1T8NA 5TCCA 4KP0A 1P2QA 2KCOA 3MHWU 2GP9B 4CR9A 3ODDA 1YF4A 3GYMA 1TRYA 3KEEA 1SMFE 4VGCB 1VITH 3MO9A 1UVPA 1O2MA 5L30H 1DS2E 1ELCA 4NWLA 4YXWD 1F5RA 1HB0B 3FANA 2C8ZB 3TH4H 1P01A 3KN2A 1CU1A 1CT0E 1YPLH 1MTUA 1MQ6A 2BD3A 1QA0A 4FUHA 1LKAA 1W7GH 1SLWB 4X8SH 1J14A 1L2EA 2V3HH 2A2QH 2DE9A 1GGDB 1FAXA 2ANMH 3ZZCA 1HIAB 1HXFH 1PQ7A 4D76A 1AWFH 5AVDA 4IMZA 3NXPA 2CMYA 2RDLA 3KYFA 1Q2WA 4K8YA 1G37A 2WPLS 2WPMS 4NA7A 4E7RG 5EJZA 2NU4E 1VR1H 2C93B 1DM4B 3W1EA 1G3EA 2LPRA 2FOFA 1GJ6A 4Q2KA 2F3CE 1Y3XA 1EFRD 1H8ED 2ZDVH 1IHTH 1IQLA 5F8ZA 2XWAA 3AAVA 2AH4X 1VGCC 2D2DA 1NS3A 2BDAA 2C3SA 4ZXXH 5JB9S 1KXCA 1T4UH 3RDZA 1SGRE 1N8OC 2A7CA 9ESTA 5L2ZH 4ASHA 6GCHG 2AGIX 3RXHA 1FDPA 1VCWA 2H9HA 5JBTA 1DWCH 5DP7A 1UW7A 1AUJA 3E6PH 8GCHF 2YNBA 2TBSA 5KECA 1BRAA 5CHAC 3RMMH 5EXLA 2J4IA 3V0XA 8KME2 4M9FA 1O3LA 2FX6A 1UTOA 1EASA 1FY8E 1P2JA 3U98H 4K1SA 1WV7H 5F8XA 1THRH 2Z9JA 2ZDAH 1P02A 2P3FH 4ABAA 1O39A 4ASUD 3HKIB 4ABHA 1CHGA 4D8NA 1RJXB 2FODA 3ZVCA 2ZKSA 1FONA 2Z7FE 1GVLA 3PWCA 4H6TA 5EPYA 3MH4A 1F0RA 2WUCA 2A5AA 1ETTH 3RXQA 1K1IA 1ZSKA 3PMHB 1OPHB 2W26A 1RRKA 1DX5M 1HV7A 2AYWA 3RC5A 3ZIAD 5FCRA 2XBXA 5BRRE 2FTMA 2ZGHA 2FS9A 5B6LA 1DWDH 2F9UA 1ZTLA 1GVKB 1A3EH 2BQWB 1DT2A 1ZRKA 3F0OA 2TPIZ 1C2MA 4K69A 1BMFD 2G00A 1C9PA 1KTSB 2FTLE 1ANDA 4IMQA 4Z6AH 1GDQA 3NRLA 1EZXC 1INCA 8GCHG 1GI9B 2ZDLA 5C67A 2A4OA 3MNBA 5GCHG 1C2DA 1ANEA 2ZGCA 1C5RA 2P93A 2A31A 1BUIA 1GHXH 3PTNA 2Q1JA 4RSPA 1XMNB 1C5YB 2QY0B 1TOMH 1FY1A 1T32A 1BRBE 1KDQB 1N6XA 2VIQA 3AVZA 2OC8A 4WH6A 1BMNH 1CQQA 5F03A 1KTTB 1PPFE 2VGCB 1E34B 3RUOA 4X8TH 5EQQA 1OOKB 2WSSD 1GBEA 2QAAA 2VIWA 3S7HB 2OXSA 2BDCA 4NZQA 3S9BA 1S6LA 1GBDA 2FI5E 1HNEE 3RC6A 1HJAB 4P00A 4OM9A 1AB9B 1TFXA 2XBWA 3VB3A 1GCDA 2G4TA 1MH0A 2ZPQA 4CRAA 2VWMA 4X0WU 6ESTA 3UWIA 4FUCA 1DLKB 2GCHF 1RIWB 3SO3A 3M61U 4TYDA 5C1UA 2BB4A 1O34A 4YESB 3Q00A 3SU2A 1GI8B 3VB7A 2ALVA 1C5PA 3SGQE 4A6LA 1DSTA 3TJOA 1C5WB 4OS6A 1QL8A 1OYQA 4R8TB 1NRRH 3FN8A 4WY3A 5EIYA 1GG6B 1NM6A 2BD7A 2ZP0H 1X7AC 1DITH 2JIZD 3BV9B 4Y6DA 2OTVA 5C5OA 1O3IA 1O37A 1SBWA 1N1LA 1UHBB 4MPWA 1GBAA 1F0TA 3HKJB 1DOJA 1TA6A 3OYPA 1CA0B 4AB8A 8ESTE 2OQ5A 1YP9A 1K9OE 2O8MA 1GJ8B 3UNRA 1P12E 1V2JT 1C9TA 1KYNA 4QT8C 4THNH 1O2PA 3GDVA 3MU1A 4ISHH 1CA0C 3M5OA 1IQJA 1D9IA 1TGSZ 4FVBA 1PPBH 3Q3KA 3LKWA 2QC2A 4D9RA 3U1JB 2Q6GA 2ZC9H 4NCYA 2GT7A 4JK6A 1SQRA 1V2KT 3TU7H 2ZU3A 1ID5H 2EQNA 4WJG2 1GDNA 1DDJA 2PP6A 1FN6A 1WCZA 3BTFE 1SLUB 4AORA 2W7UA 2QV1A 1O3FA 2VGCC 2VH6A 3M7TA 4X6MA 3QZRA 3BTWE 1AUTC 1SQAA 3TNTA 2BOHB 4CHAC 3VXEH 4HGCA 3F2FA 4IW4E 1ELGA 2IOTA 1VZQH 2XCFA 2GZ7A 2ODYB 2FO9A 1Y3UA 1C5UA 4DURA 4NSVA 1GI1A 1MQ5A 1ELBA 2FIRH 2YMSD 2V6NA 1XKBC 1ELVA 1QFKH 1GCTC 1O5CB 1YPHE 3FVFB 3SJ9A 5A0AE 1QQ4A 3KQDA 4RT1A 2C8WB 3S7KB 3U1IB 5EW2H 1UTPA 5F53A 3FOAA 5C17A 4MTBA 2HNTE 2BVSH 2CV3A 2EI8A 3BEFB 4K60A 1YC0A 1TMTH 4MDSA 1OYTH 4YLUA 5LPEA 3GCHB 2J9NA 1HAOH 1HAGE 3ZYEA 1BQYA 2ZGJA 2RFKC 3UPEA 5EG4A 1GHBG 3F9EA 3QDZB 3SUEA 1O2NA 1DSUA 1DANH 3OTJE 4ZKSU 4AOQA 1ZOMA 1Z71A 1BTZA 3FAOA 2NU3E 1UVTH 4ZMAH 1YPHC 1KXEA 1TPOA 1QIXB 1Y5AT 2VINA 1RXPA 3I29A 1E79D 1D3QB 1FX0B 2L6OA 2JH6D 3ZZAA 1MU6B 1H8HD 3RXDA 1BA8B 1OSSA 2H5CA 3LGYA 3P70B 4B1TA 1BTUA 1SFIA 3AK5A 3KYGA 3RMNH 3SU3A 7ESTE 1AB9C 3GCTF 2BHGA 1SGFG 2Y7ZA 4J2YB 3VXFH 4B2AA 1MTSA 1MABB 5I25A 3KQ5A 4CBNA 3FO8D 1FV9A 4F4OC 3U8OH 3ESTA 1JBUH 3QZQA 3RXUA 1MU8B 3EGKH 4NIXA 5A8YA 2UWOA 3KHVA 2BLOA 3KF2A 3RLWH 1XUGA 2WUBA 3S0NA 2PSYA 1ZR0A 5F8TA 3NZIA 1F0UA 1NU7B 1NZQH 2HWLB 3SORA 2FX4A 3LC5A 4CRBA 2BDBA 4B71A 4WWYA 3FZZA 3RU4D 3C1KA 5CDFE 2C8XB 1CVWH 1BJUA 1ZGVA 3AW1A 4I32A 3ZVAA 5C94A 3E0NB 1D3DB 2GT8A 4TY6A 3RP2A 2STBE 4WXIA 2J34A 3ZZDA 1KDQA 1GBTA 1P11E 1N8OB 3RXBA 2PR3A 4AB9A 2IPHA 2ESTE 3ZZ4A 3P8OA 1AZZA 1DFPA 1ZTKA 1NN6A 1MBMA 1HUTH 1NC6A 3KQBA 4ZKOU 1W14U 1UTKA 4AG2A 1SFQB 3RXCA 4E06H 3PMJA 4FXGH 5C5NA 1Y3YA 5FPSA 1O31A 2BD4A 1S5SA 4CR5A 3SJ8A 3ATMA 5FX5A 4GVUA 1UK3A 1P06A 3W95A 4B74A 1SB1H 2ZTYA 1LHCH 1GBKA 3GISB 8LPRA 1FMGA 2GX4A 4RT0A 2FYRA 2A7JA 2FOHA 2SGDE 2BTCE 1L1JA 1V2NT 1YPEH 2FM2A 3K6YA 2G55A 2GV7A 2ZO3H 3ENSB 1DLEA 1H9HE 4GAWA 1O2LA 1JIMA 1G30B 2ZG0H 2FOCA 4LZ4B 3OY5U 1QURH 4A7IB 5TJXA 2W6ID 2YOLA 4ZAEA 2FYQA 4NWKA 5DKMA 1F7ZA 3EA8A 2RA0A 5HMAA 4FUFA 1G2MA 3M3VA 4B73A 4XRNA 1BZXE 1G3DA 2CGAA 1LDTT 1KLJH 1TQ7B 1QJ6B 2GMTB 2TGDA 3KIDU 1BTXA 3RXIA 5C1YA 2XTTB 1K22H 4INHA 5GDSH 3RU4E 4DCDA 2ZHFH 1MZAA 2H6MA 2VNTA 2BY5X 1ESAA 1O2KA 5JB8S 5ABWA 3UR9A 3OEED 3T25A 2ZNKH 1UJ1A 2V35A 4DIHH 4Q80A 1C5OH 1P2OA 3SQHE 1FLEE 1CGHA 2Z94A 1C5TA 1V2UT 1CSOE 1TYNA 4B2BA 1H9IE 3BIUH 1ORFA 3N7OA 3OFND 3UQVA 5LGOA 3M7UA 2KAIB 3NPSA 4JYVH 1IQMA 4MPUA 2XW9A 2GV6A 4FUIA 3K9XB 4UE7H 2QXHA 4FU7A 1THSH 3A7ZA 1AFQC 4IC6A 5F6MA 3TK5A 1IOEA 5DSFA 1H4WA 2IPQX 1CBWB 1D3PB 1GBMA 1W3CA 2GVFA 3UREA 1A0JA 4FUDA 1IAUA 4DW2U 3E1XB 3EE7A 3M5MA 3TGIE 6CHAB 4JZDH 4AGJA 1EPTB 5E0GA 1C5NH 1MCTA 3ZV8A 2SNVA 1UHBA 3RXOA 1SSXA 5EW1H 1GHVH 4AGKA 4A1XA 3LGWA 1V2TT 2P94A 2AMPA 1BTPA 4X8UH 3ZVBA 3ZZ6A 3RXGA 3VB4A 2BX3A 4D9QA 5DJ7A 1Z1IA 4JK5A 3CP7A 1C1PA 3RU4T 4WH8A 4P02A 5J4QA 2QCYA 2WYGA 2M5TA 2VWNA 4OS1A 4ISNA 2BDYA 1SLVB 1TGBA 1MUEB 1OWEA 5DP5A 2UUFB 1C5XB 1KLIH 4Y7BA 1C1QA 3A8CA 2RDEA 1TB6H 3BG8A 1GI7B 1TNGA 1O38A 4B6EA 1GBFA 3T28A 2LELA 1SGDE 5K7RA 1HAYB 1HXEH 3FKSD 4NIVA 2WPIS 1P09A 3RM2H 1W0JD 2JJ1D 1DUAA 1WU1A 1AE5A 4BANB 3HGNA 1C2FA 4ABGA 2R0LA 4NGAH 1UVSH 3MI4A 1BOQA 1P05A 3WY8A 5LPRA 2ZPSA 4PROA 3ZVFA 1EJNA 3EAJA 2FDAA 2BZAA 3CS7A 4A5TS 2GDDA 4JCNA 1IQKA 2TGTA 4WVPE 4K1TA 4NSYA 4X2YA 1YCPM 4I31A 3FP7E 1HYLA 2AEIH 3BTKE 2AIPA 1TABE 4OS4A 2GCTC 3T26A 2CF9H 3UB0A 2XNIA 1TBRH 1ZPZA 2PGBB 5E8EH 1A4WH 1YKTA 5HXFA 2H9EH 1FPCH 3SOSA 2PLXA 2PW8H 4UEHH 2Y5FA 3U9AH 1V2VT 2J5UA 3F9GA 2FI4E 1O2XA 1A0HB 1C2IA 2ZCKP 1QRWA 1AMHA 2F91A 3A84A 2F43B 3A7XA 1TX7A 3W94A 1GHAG 2KCAA 1B0EA 5EQSA 4CH8B 3AASA 3P8GA 1ZHRA 2XWBI 1DWBH 2WYJA 1ZMJA 3ZZ7A 1GI3A 3URCA 2G8TA 4UD9H 1A1RA 3SZEA 2Z9IA 1A0LA 3PMAB 1NROH 3BTHE 2TIOA 1S84A 4H6SB 4JYUH 1CT2E 3GY8A 2A0QB 3TLOA 1FN8A 2F9NA 1SGEE 5C0TA 1KIGH 3V7TA 2G5NA 2C8YB 4NA8A 1HBTH 1W0ZU 2OQUA 4Q7ZA 1ELDE 4X2WA 4B76A 1B7XB 2ZFTA 3AW0A 2YMSB 3SUFA 1ZPCA 2BM2A 4B75A 3QGJA 2FOMB 3U69H 2R2WU 1G36A 5C0UA 2KCYA 4OS5A 2BZ6H 4Y8YA 2AMQA 1PPZA 1GHZA 7GCHF 2Z3DA 5GJ4B 1K0HA 1MKWK 4X8VH 4AFSA 1O2WA 2H1UA 4HFPB 1HJAC 4TSFD 5FX6A 1YLNA 1DVAH 3M5LA 1C2GA 1SL3A 1ESTA 1XUIA 1GHBF 2SGQE 2QF4A 2FOGA 4I86A 2Y5GA 2ZHEH 2ANKH 4A92A 2K1QA 5L2YH 2UWPA 1GDUA 1PQ5A 3F6UH 3PRDA 2AFQB 1LMWB 1W11U 2JKHA 1C5ZB 3A85A 1AGJA 3TITA 1SGNE 4Y7AA 2GKVE 3RC4A 1ZMLA 1ZTJA 2ZGXH 1P8VC 3GCHC 2ZWLH 3SI4H 3KQCA 2NU0E 2CXVA 2BYAX 2BD2A 2PTNA 1PQAA 2HPPH 2Y80A 2W3IA 1GBCA 1A46H 3E0PB 2VVVA 3SW2B 4UDWH 3SHCH 4DT7B 4FU9A 1SGFA 1YLCA 2LP6A 1S83A 3EQ0H 4IBLH 3E8LA 4UFEH 1YCPK 4ISLA 1QL9A 4X1NU 3WW7A 3H09A 4Q7XA 1AHTH 1BMLA 3NKKA 3LH3A 1OKXA 2GJGA 4HI3A 3ZVGA 1XX9A 1MKXH 1GMDG 1HAIH 1HAXB 3QGNB 1GHWH 5DP4A 1D3TB 3B8JA 1TNIA 3O8BA 2FPZA 5FAHA 3SQEE 3MFJA 3E3TA 4ABIA 1O3NA 5ETXA 1WQVH 4TPIZ 2G4UA 1O35A 3H5CB 5DP6A 2P8OC 3PROA 3MH6A 1F0SA 1UTQA 2J98A 1SGIB 2ZZUH 1NRSH 2QF3A 4WMFA 5T6FA 3WWFA 1FQ3A 2XC0A 3I77A 1SPJA 1MTNC 4F48B 1O3DA 1PFXC 2G5VA 1Z8GA 3S9AA 2HALA 1AD8H 5K0HA 4WF8A 3NCLA 3TJNA 2P3TB 4XBCA 5E2OA 3LJJA 1C4V2 1WTGH 4CRDA 4UFDH 1PPGE 3PTBA 1O3BA 1EB2A 1PQ8A 5SGAE 1W0KD 2BXUH 3LGUA 1P3CA 4Y8XA 1ZJDA 3DA9B 3DSGA 1FY4A 1B5GH 1AVXA 1OWKA 2EC9H 1C2EA 3PB1E 9LPRA 1HAVA 1XVMA 1C2JA 5ESTE 1WSSH 3F2HA 1ZGIA 1S81A 1GBLA 3KQEA 1ZSLA 2KM0A 4ZKRU 1VKYA 3Q77A 2PKAA 3D62A 4TPYA 3MU0A 4NA9H 4YT7H 3VG8A 2PWXA 3LGTA 3SJOA 2NWNA 2XBYA 4AN7A 4MPXA 6LPRA 4X1PU 2VWLA 2J98B 1XXFA 1QHRB 2HGTH 3GCTG 4BAHB 1A5HA 1HJ9A 3E90B 3RXVA 3RLYH 4BAMB 4MVNA 3PRBA 1RIWC 2R0KA 1S0QA 2ZF0H 1MBQA 1SI5H 1WTHD 4NFFA 3RXMA 5CHAB 4J1YA 3KCGH 2PKAB 1MTWA 1T31A 2BY9X 1QBOA 2Y7XA 1GMCF 1C1MA 1O2UA 2EEKA 1O2IA 4WMEA 2BY7X 3M7QA 3PYHA 1BTYA 3SJKA 5TCAA 1HJ8A 1L0ZA 2I6SA 3EYDA 1YPGH 1TGCA 1AFQB 4OGXA 3RXAA 1FXYA 5GWZA 1QZ8A 3P17H 4MPVA 2F9OA 2JETB 2ANYA 4GHQA 2LNCA 4AFZA 2RCEA 1KLTA 3SV2H 4VGCC 1UCYK 2F9VA 4ZXYH 2UUJB 3P8FA 3TGKE 1YPJH 3M36A 4ACBA 3UFAA 1T4VH 3RXFA 1TNLA 1V6DA 3A82A 1T8LA 3SV8A 1CA8B 1SHYA 3L6PA 1GJ4H 5BPEA 4FUGA 5G4BA 5DP9A 1GL1A 4GUXA 5HM9A 1UK2A 2Y81A 2ZCLP 1HLTH 1LQDB 3GDUA 4I7YH 4F55A 2ANWA 1DXWA 5EU8A 5PTPA 3MNCA 1O2QA 2DE8A 1PPCE 4GSOA 3PV2A 3A7YA 2D26C 2D1JA 5EPNA 5JBBS 1DUEA 1SGYE 3E91A 1CE5A 5T6GA 1TALA 5HGGA 2VIVA 3TGJE 4KKDA 3MO6A 1BRUP 1K1LA 1H8DH 4IN1A 1J15A 1RGQA 3DCLA 5DG6A 3N99A 3LT3A 2YNAA 4ISIH 1EAIA 1F2SE 4LOYH 1LHDH 2V3OH 2ZFQH 5EOKA 1G3BA 1C5QA 1P03A 4A1VA 3URDA 2BQ6B 3SU1A 4BXWA 1TGNA 1ANCA 1TNHA 4F49A 3L33A 3Q3YA 5C3NA 2AS9A 2HOBA 2BVXH 1NRPH 1LKBA 3K65B 1MD8A 4YOJA 1XUHA 4I33A 2ZA5A 1P0SH 2EI7A 2PV9B 1HGTH 2PSXA 1DE7H 1IHSH 3FZDA 1OP2A 2JETC 2OD3B 4BAOB 1O2OA 3A89A 3AAUA 1Z6JH 4O9VA 1V2LT 4KELA 1Y5BT 1G9IE 1GGDC 3NWUA 4ZROA 2VU8E 3UUZA 3S69A 5EXMA 4RKOB 1O33A 1AKSB 1BTWA 1W7XH 2XC5A 2GZ9A 1O3CA 1YCPH 3OAAD 4Y11E 3QLPH 2SGAA 2V0BA 2QF0A 2P3UB 3MU5A 2FLRH 3QK1A 1GI2A 1O32A 3R3GB 2EA3A 1OX1A 1YWUA 4Q63A 3IG6B 3HPTB 1EB1H 3O8DA 1EP6A 1L4DA 2Z9LA 1H8IH 3BEUA 1Y3WA 1XUFA 4X2VA 2OP9A 2FWWA 3CNRA 2A4RA 2ZU2A 2ZTXA 2HLDD 2B8OH 1EZUC 1ARBA 1ZPBA 1YGCH 3ODFA 1BBRH 4CRFA 4Z0KA 3BSQA 1EKBB 1JMOH 2V7QD 2ZCHP 3ZVDA 1AE8H 3A7VA 3GY6A 3HATH 2BD9A 1OHHD 4XFQA 1SGTA 3G01A 1OP8A 3LGVA 1TPSA 3T29A 2Y82A 1D4PB 1K21H 1C4Y2 1O3JA 2JH5D 1TBQH 1XXDA 3MU4A 4O03A 5I46H 2GDEH 2FP7B 2NU2E 1G3CA 2P8OB 1NTPA 3P8NA 1MAYA 5L6NH 2HLCA 3F9FA 2BY8X 5AFYH 4CRGA 1V2OT 2FOEA 2WV9A 4CBOA 4X1RU 5E0JA 2XOKD 3SU4A 4BOHA 4Z1MD 3VFEA 1GHAF 1PJPA 3QO6A 1O2GH 4TY7A 5FHTA 2V3MA 1H1BA 4DVAU 1YY3A 2SGFE 3TK6A 3ZYDA 3Q76A 1TONA 2CJIA 2G81E 2HRVA 2AIQA 2IJD1 1O3EA 1MZDA 4LZ1H 1RFNA 3GY4A 1SOTA 1XVOA 4AZ2B 3TJVA 1BITA 3BF6H 3TPIZ 1K1PA 2O8UA 1QGFA 1LHFH 4Q7YA 3O8CA 1FUJA 3SBKA 1MMJN 2W5EA 1OWJA 3A8AA 1EAXA 1IQGA 1K1JA 1NFXA 1WOFA 4DG4A 4YM9A 5DGJA 3ATLA 1UCYH 1MCVA 1TRNA 3ZZBA 4UFGH 2H5DA 3SU0A 3ZZ3A 5A0BA 2FXRA 4X6PA 2A5IA 2QXIA 3FP8E 1AFEH 2Z3EA 2SGEE 3HK3B 1U6QA 1CGJE 1MD7A 2WPDD 3RXKA 1UVOA 1C4U2 1DWEH 4I8GA 1IQIA 3BG4B 1O3KA 2VWOA 4XBDA 2A7HA 3B9FH 3M3TA 3SNBA 2A2XH 4O3TA 2R3YA 2VJ1A 2KFWA 4MNXA 4X1SU 1L4ZA 2VVCA 5JBCS 1F5KU 1Y3VA 4JZ1A 2CK3D 1EQ9A 2VVUA 1JOUB 2B9LA 5E0HA 1OWHA 2RA3A 4MG3A 1NRQH 2R9PA 5KEDA 7LPRA 1C5MD 2KAIA 1W8BH 1WYKA 1WUNH 3OTPA 3V12A 5IDKA 2FZZA 2YMSC 2Z6BD 3IWMA 1QBVH 1P2KA 1UTNA 4AC9A 2FOBA 1KXAA 3T62A 7KMEH 1QQUA 3SNDA 2Q6FA 5CMXH 2AGGX 1AU8A 1C2HA 1TMBH 2SFAA 3VB5A 1UK4A 2ODQA 4TWYA 3A8DA 1AI8H 1GG6C 2ZFPH 3PLBA 1TX6A 1WAYB 3RMOH 2A5KA 1TA2A 1BMMH 1GI0A 1QA7A 1GI6A 3KL6A 3P95A 1AVWA 4YZUA 3UTUH 2F9BH 1EPTA 1GVZA 1SG8B 1ZRBA 4KGAA 1YPKH 4ZHLU 1UO6A 4OS7A 2PFEA 2F9PA 1XM1A 4TT3D 5FPYA 3MU8A 1A7SA 3B23B 3U28C 3GY5A 2GGVB 1TGTA 3TK9A 4IS5A 1O2ZA 5T6DA 5A0CA 3LGIA 3SYJA 1EATA 2VBCA 3HK6B 3TIUA 1BIOA 1ZHMA 1O5FH 2L74A 1VCQA 1UMAH 1CO7E 3K6ZA 4I8LA 1MTVA 1O2YA 2EY4C 1QY6A 1AQ7A 2W3KA 1ZJKA 4GLYA 2F4LA 3LU9B 4AX9H 1P9SA 1J9CH 5DK1A 4MNWA 5CHBA 4IGDA 1QB6A 4U2WA 3DSPA 1V2PT 2UWLA 1NFWA 3M37A 3KNXA 4CHAB 1EOLA 2H2ZA 1G2LA 4RI0A 3UNSA 4D7GA 3DUXH 1WQSA 2OC7A 2QIQA 5EXNA 2Y5HA 2ZEBA 1C1SA 2ULLA 2PKSB 2EI6A 1P9UA 1S82A 3ATIA 3N7EA 3JZ2B 1W12U 5GIBA 3ITIA 1QB1A 3PWBA 4MQAA 1LQEA 3UNQA 1GL0E 1GCTB 3SNEA 3NUMA 3E16B 1TLDA 1LVYA 3BG4C 1FNIA 4FETA 3T27A 2ZGBH 4AFUA 1EJAA 1KXBA 1KMHB 1M9UA 1ANBA 1GHYH 2WV4A 3PV4A 5JBAS 3DFJA 2PGQB 1TRMA 1V2RT 1E36B 5J4SA 4ESTE 2JJ2D 5FL7D 3MYWA 3LH1A 2XC4A 3PM3A 3QTOH 2ZHWH 4JZFH 4JZIA 4MLFB 1WBGB 1Z7KA 4SGBE 3RXSA 4U30A 1BCUH 1EUFA 2XCNA 3LIWA 4FUJA 2ZQ2A 3RXTA 1FJSA 4Q4LA 5DN6D 1PPHE 4K8BA 1LHEH 1TX8A 2ILNA 1SHHB 3OSYA 1AN1E 3UQOA 4BXSA 1O5EH 1HAPH 3I78A 5FPTA 2ZU1A 4DT4A 5LH8A 5C1XA 1C5LH 1QRZA 2B5TB 4BTIB 1ZZZA 1ZLRA 2FESH 4Y0ZE 1MKWH 1K1OA 5AHGH 2I6QA 2VIDA 2HNTF 2FLBH 3TNSA 5EQRA 2XBVA 6CHAC 4RN6A 1Z8RA 3PO1B 2AHME 4INLA 1LVOA 2KZ4A 3QN7A 3O8RA 3A81A 1C2KA 1TBZH 2M2AA 1GBBA 4H42U 1YPMH 3PMBB 3RXEA 1ETSH 1C5SA 2TGAA 4U01A 2C4FH 1EXFA 2BDIA 3LOXA 3LPRA 3DHKH 1GJAB 1O2VA 2FMJA 3BTTE 2W7SA 1YM0A 2GCTB 2WPHS 4ABFA 1C1WH 1CHOF 2W6JD 2G51A 3A80A 4XOJA 1XKAC 2KCPA 1FAKH 3BTGE 5A2MH 4D7FA 4AFQA 4ZHAA 4AYYB 1TPPA 1K1NA 2XXLA 3TVJB 1F92A 5T3HA 2QE7D 3MTYA 3ZZ8A 1AZ8A 3EA7A 1Q31A 3F2GA 2ZFRH 4CRCA 4NIWA 2Z3CA 4Y8ZA 2GMTC 1Y59T 1WDIA 3CENA 3EE0B 1V2MT 4ABJA 4WXVA 2ZU5A 1GMCG 4UFFH 4KTSA 3ZZ5A 1DY8A 1IQHA 2ZFSA 4GPGA 2STAE 3LDXH 4DGJA 2FI3E 5EJ1A 4ZCNA 2VIPA 1PYTC 2OUAA
chains in the Genus database with same CATH topology
3FFGA 3GY7A 1UTLM 1O5GH 1P10A 3MMGA 1EX3A 1PPEE 2P59A 1A5IA 1XUKA 1SQOA 1O36A 2SNWA 1C1UH 2CHAC 1EPTC 1F5LA 2O9QA 3BTEE 4GCHF 1QJ7B 1TOCB 3GOVB 3LONA 1HCGA 5A8ZA 4R0IA 1FI8A 2C90B 2BD8A 1OWDA 3LJOA 1O2TA 5AF9H 1EZQA 1QBNA 3F1SB 4H4FA 3UOPA 4INKA 3MH7A 1C2LA 5DO4H 2QYIA 2ASUB 3P92A 4O97A 4KTCA 5JDUB 2ZI2H 1AO5A 2Q6DA 1AVGH 1DICA 1LPZB 1NRNH 2BMGB 2HNTC 1RTFB 1VGCB 2WINI 1C5VA 1OWIA 1VJAU 3GYLB 1MKXK 2AERH 3KGPA 3A8BA 4I8HA 1SOZA 2SGPE 4OS2A 3RXPA 1T8OA 5FXLA 3IITA 1O5BB 2WPKS 2FS8A 4LXBH 4NZLA 5E2PA 1LCYA 3CS0A 1KY9A 3RM0H 3NK8A 1IQEA 3C27B 4K3JA 2AMDA 3SV7A 1QTFA 2OINA 2QN5T 2BLQA 5LPFA 1H9LB 4OGYA 3SJIA 2ZHQH 5EODA 3UOUA 1D6WA 1J8AA 4HZHA 1NFYA 3SGAE 1LHGH 3VEQB 3UIRA 1NPMA 3FP6E 4Y71A 1W13U 2GZ8A 3ZZ9A 3PO1C 2OBOA 1P2MA 1RTKA 5DP8A 3OX7U 2J94A 3OY6U 2ODPA 5JPMH 1QJ1B 3PLKA 4DJZB 3JZ1B 2CHAB 3MOCA 3M35A 1QB9A 2PUXB 3SU5A 2O8WA 1GI5A 2OLGA 1D6RA 4BNRA 3U8TH 3VPKA 4ZHMU 1C1VH 1QRXA 2R3UA 4K5ZA 2BDHA 1V2QT 2ZDMA 4ABEA 2B0FA 1TPAE 4BTTB 1OXGA 1P2NA 2FEQH 4X1QU 1GJDB 3QWCH 4Y0YE 3SNCA 4CREA 3RXRA 3A86A 3TH3H 3H7TA 1E37B 3D65E 5B6OA 3A7TA 2O8LA 3R0FA 5GCHF 5ESBA 1O3PB 1A61H 1BTHH 1JIRA 2RG3A 1JWTA 6GCHF 3RXJA 2XRCA 3SGBE 1E35B 1O5AB 5H4IB 4DY7B 3GICB 2PKSC 1W10U 1NY22 1BT7A 1HAHH 1O0DH 1C1RA 1W0YH 1S6FA 3MH5A 2Z9KA 4YTAA 2QGRA 1ABJH 4YOGA 3ATWA 5EGMA 5CE1A 2OC0A 1S6HA 1QR3E 2TGPZ 1PYTD 2AGEX 1UCYE 1YBWA 4K2YA 1KXDA 1FY5A 2WPJS 1GJ5H 4ISOA 1NO9H 2J2UA 2PUQH 1IQFA 3DT0H 1QCPA 2IJOB 1EAWA 1ACBE 1EZSC 1NESE 4NG9H 4UONA 3GY3A 5GXPA 1VJ9U 2A1DB 1TWXB 2D8WA 1HRTH 1K1MA 4X6NA 2BXTH 3V3MA 1HFDA 3ZVEA 1TAWA 2ZTZA 1BJVA 1A3BH 3L3TA 5FBIA 2ZDNA 3BN9A 3SV9A 4JZEH 4JMYA 1NT1A 4ABDA 1XUJA 3SUGA 3GY2A 2OCVB 4IC5A 3RMLH 1SC8U 3VB6A 3SI3H 4I8JA 1J16A 1SLXB 3SHAH 5HYOA 3OU0A 1AWHB 2ZFFH 1L1NA 1E38B 2PHBA 3PLPA 1GMHF 1YYY1 5A8XA 1Z8JB 1MTNB 1EJMA 1T8MA 1RTLA 1BDAA 3VGCC 2ZHDA 1ELTA 4ZKNU 4X2XA 3ZV9A 3DD2H 2DUCA 2J38A 2NU1E 4LK4A 1TNJA 2CN0H 1HPGA 1QL7A 1S0RA 1O2SA 2OBQA 2OC1A 2FOAA 1MAXA 2WV5A 3UY9A 3M3SA 1KXFA 4ZH8A 4E05H 1JRTA 1GJ9B 2IN2A 5DP3A 4O3UA 1GMDF 3STIA 4NFEA 3V13A 1TE0A 4BTUB 1FIWA 4NIYA 3SNAA 1J17T 2VB0A 5A09A 1QNJA 3EA9A 4XSKU 1LTOA 1C1OA 3SN8A 2J92A 1DPOA 1VITF 1T7CA 1KSNA 5DPAA 2THFB 1A5GH 3BEIB 1ARCA 2GCHG 2XYAA 1ELFA 1E0FD 4BAKB 2Z9GA 4YO9A 1UTMA 1GJBB 4YOIA 1GWAA 1LVBA 2UUKB 2B7DH 1Y5UT 1GI4A 2HVXA 4MNVA 1P04A 3MWIU 4MNYA 5FBEA 4DOQA 1AY6H 1GMHG 2QA9E 1O2JA 1K2I1 2J95A 4SGAE 2QXJA 3QUMP 3SUDA 1BB0B 1GBHA 1SVPA 4ZUHA 1BBRK 5FCKA 4RKJB 1BMAA 3SZNA 1RD3B 1BHXF 4FUEA 4AG1A 1HIAA 2CF8H 1ELAA 1W2KH 2JH0D 3BTDE 2QXGA 2A45B 1TMUH 1EP5A 3TH2H 3DFLA 4YLQH 1V2WT 1A2CH 2G52A 1ETRH 1OP0A 1HDTH 2ZU4A 3BTME 5AFZH 1O2HA 4XBBA 1ESBA 4AYVB 1Z8IB 3D49H 3MNSA 7GCHG 5C20A 1TQ0B 2ALPA 1VITG 2A32A 1O3HA 2UUYA 5C2ZA 3BIVH 3F9HA 1CHOG 4B2CA 1ZMNA 4Y79A 1JRSA 1BBRE 2Y6TA 3TJUA 1G32B 1B0FA 1EOJA 3MO3A 1Y8TA 1SR5C 1LPGB 3VGCB 4A1TA 3HGPA 1SQTA 1VCPA 3A83A 4U32A 4DIIH 1UVUH 5GPIB 4I8KA 4BAQB 3SU6A 5JYIA 1THPB 1O3AA 4HTCH 3SV6A 4Y76A 2BOKA 1L1GA 2BD5A 1HAVB 1UTJA 4XE4A 3BTQE 3ATKA 1TIOA 1AIXH 1O30A 2A4QA 4GHTA 3M5NA 3F68H 2PTCE 1V3XA 1ABIH 1TNKA 2HPQH 2BX4A 1RS0A 3GCNA 2ZIQH 3T5FH 4CH2B 1FPHH 1ZYOA 1GPZA 1ZSJA 3ELAH 1JXPA 3A88A 3H7OA 1DXPA 1NU9A 2P95A 4KTUA 3K2UA 3GCOA 1CT4E 1OS8A 1K28D 1Q3XA 2BDGA 1FY3A 2ZPRA 1O5DH 3LC3A 4M7GA 2A4GA 1O3GA 4TWWA 4Y10E 2ZECA 2R2MB 2O8TA 1NFUA 2ZQ1A 3P6ZB 4FU8A 1AKSA 4XDEA 1P57B 4IN2A 1GJ7B 3QX5H 2BQ7B 2H9TH 2VIOA 4GCHG 1ELEE 1GBJA 1O3OA 3S9CA 2F83A 1C1NA 1FZZA 2BY6X 1O2RA 1EAUA 3EDXB 1SGPE 1Z6EA 4X6OA 3T2NA 1ZHPA 1IQNA 1LPKB 5IYTA 1CBWC 3A7WA 4ABBA 2GD4B 1HAZB 4YT6H 1BHXB 3UR6A 2VH0A 3GDSA 4E7NA 1CGIE 1C1TA 1DY9A 1P2IA 4FVDA 3D23A 3MNXA 3U8RH 1P3EA 3STJA 4FUBA 1GBIA 4K1EA 1LVMA 1LO6A 4WMDA 1BRCE 1SGQE 2GTBA 1S85A 1SGCA 1FIZA 2BVRH 2ZDKA 3UWJH 3A87A 2BLVA 4JYTA 1GJCB 1N6YA 2TRMA 1V2ST 3RXLA 2P16A 3Q3XA 1O3MA 5HM2A 2BLWA 1Z1JA 3QTVH 1YLDA 1T8NA 5TCCA 4KP0A 1P2QA 3MHWU 4CR9A 2GP9B 3ODDA 1YF4A 3GYMA 1TRYA 3KEEA 1SMFE 4VGCB 1VITH 3MO9A 1UVPA 1O2MA 5L30H 1DS2E 1ELCA 4NWLA 1F5RA 1HB0B 3FANA 2C8ZB 3TH4H 1P01A 3KN2A 1CU1A 1CT0E 1YPLH 1MTUA 1MQ6A 2BD3A 1QA0A 4FUHA 1LKAA 1W7GH 1SLWB 4X8SH 1J14A 1L2EA 2V3HH 2A2QH 2DE9A 1GGDB 1FAXA 2ANMH 3ZZCA 1HIAB 1HXFH 1PQ7A 4D76A 1AWFH 5AVDA 4IMZA 3NXPA 2CMYA 2RDLA 1Q2WA 4K8YA 1G37A 2WPLS 2WPMS 4NA7A 4E7RG 2NU4E 1VR1H 2C93B 1DM4B 1G3EA 2LPRA 2FOFA 1GJ6A 4Q2KA 2F3CE 1Y3XA 2ZDVH 1IHTH 1IQLA 5F8ZA 2XWAA 3AAVA 2AH4X 1VGCC 2D2DA 1NS3A 2BDAA 2C3SA 4ZXXH 5JB9S 1KXCA 1T4UH 3RDZA 1SGRE 1N8OC 2A7CA 9ESTA 5L2ZH 4ASHA 6GCHG 2AGIX 3RXHA 1FDPA 1VCWA 2H9HA 5JBTA 1DWCH 5DP7A 1AUJA 3E6PH 8GCHF 2YNBA 2TBSA 1BRAA 5CHAC 3RMMH 5EXLA 2J4IA 3V0XA 8KME2 1O3LA 2FX6A 1UTOA 1EASA 1FY8E 1P2JA 3U98H 4K1SA 1WV7H 5F8XA 1THRH 2Z9JA 2ZDAH 1P02A 2P3FH 4ABAA 1O39A 3HKIB 4ABHA 1CHGA 4D8NA 1RJXB 2FODA 3ZVCA 2ZKSA 1FONA 2Z7FE 1GVLA 3PWCA 4H6TA 5EPYA 3MH4A 1F0RA 2WUCA 2A5AA 1ETTH 3RXQA 1K1IA 1ZSKA 3PMHB 1OPHB 2W26A 1RRKA 1DX5M 1HV7A 2AYWA 3RC5A 5FCRA 2XBXA 5BRRE 2FTMA 2ZGHA 2FS9A 1DWDH 2F9UA 1ZTLA 1GVKB 1A3EH 2BQWB 1DT2A 1ZRKA 2TPIZ 1C2MA 4K69A 2G00A 1C9PA 1KTSB 2FTLE 1ANDA 4IMQA 4Z6AH 1GDQA 1EZXC 1INCA 8GCHG 1GI9B 2ZDLA 5C67A 2A4OA 3MNBA 5GCHG 1C2DA 1ANEA 2ZGCA 1C5RA 2P93A 2A31A 1BUIA 1GHXH 3PTNA 2Q1JA 4RSPA 1XMNB 1C5YB 2QY0B 1TOMH 1FY1A 1T32A 1BRBE 1KDQB 1N6XA 2VIQA 3AVZA 2OC8A 4WH6A 1BMNH 1CQQA 5F03A 1KTTB 1PPFE 2VGCB 1E34B 3RUOA 4X8TH 5EQQA 1OOKB 1GBEA 2QAAA 2VIWA 3S7HB 2OXSA 2BDCA 4NZQA 3S9BA 1GBDA 2FI5E 1HNEE 3RC6A 1HJAB 1AB9B 1TFXA 2XBWA 3VB3A 1GCDA 2G4TA 1MH0A 2ZPQA 4CRAA 2VWMA 4X0WU 6ESTA 3UWIA 4FUCA 1DLKB 2GCHF 1RIWB 3SO3A 3M61U 4TYDA 5C1UA 2BB4A 1O34A 4YESB 3Q00A 3SU2A 1GI8B 3VB7A 2ALVA 1C5PA 3SGQE 4A6LA 1DSTA 3TJOA 1C5WB 4OS6A 1QL8A 1OYQA 4R8TB 1NRRH 4WY3A 1GG6B 1NM6A 2BD7A 2ZP0H 1X7AC 1DITH 3BV9B 4Y6DA 2OTVA 5C5OA 1O3IA 1O37A 1SBWA 1N1LA 1UHBB 4MPWA 1GBAA 1F0TA 3HKJB 1DOJA 1TA6A 3OYPA 1CA0B 4AB8A 8ESTE 2OQ5A 1YP9A 1K9OE 2O8MA 1GJ8B 3UNRA 1P12E 1V2JT 1C9TA 1KYNA 4QT8C 4THNH 1O2PA 3GDVA 3MU1A 4ISHH 1CA0C 3M5OA 1IQJA 1D9IA 1TGSZ 4FVBA 1PPBH 3Q3KA 3LKWA 2QC2A 4D9RA 3U1JB 2Q6GA 2ZC9H 4NCYA 2GT7A 4JK6A 1V2KT 3TU7H 2ZU3A 1ID5H 4WJG2 1GDNA 1DDJA 1FN6A 1WCZA 3BTFE 1SLUB 4AORA 2W7UA 2QV1A 1O3FA 2VGCC 2VH6A 3M7TA 4X6MA 3QZRA 3BTWE 1AUTC 1SQAA 3TNTA 2BOHB 4CHAC 3VXEH 4HGCA 4IW4E 1ELGA 2IOTA 1VZQH 2XCFA 2GZ7A 2ODYB 2FO9A 1Y3UA 1C5UA 4DURA 4NSVA 1GI1A 1MQ5A 1ELBA 2FIRH 2V6NA 1XKBC 1ELVA 1QFKH 1GCTC 1O5CB 1YPHE 3FVFB 3SJ9A 5A0AE 1QQ4A 3KQDA 3S7KB 2C8WB 3U1IB 5EW2H 1UTPA 4MTBA 2HNTE 2BVSH 2CV3A 2EI8A 3BEFB 4K60A 1YC0A 1TMTH 4MDSA 1OYTH 4YLUA 5LPEA 3GCHB 2J9NA 1HAOH 1HAGE 3ZYEA 1BQYA 2ZGJA 3UPEA 5EG4A 1GHBG 3F9EA 3QDZB 3SUEA 1O2NA 1DSUA 1DANH 3OTJE 4ZKSU 4AOQA 1ZOMA 1Z71A 1BTZA 3FAOA 2NU3E 1UVTH 4ZMAH 1YPHC 1KXEA 1TPOA 1QIXB 1Y5AT 2VINA 1RXPA 3I29A 1D3QB 2JH6D 3ZZAA 1MU6B 3RXDA 1BA8B 1OSSA 2H5CA 3LGYA 3P70B 4B1TA 1BTUA 1SFIA 3RMNH 3SU3A 7ESTE 1AB9C 3GCTF 2BHGA 1SGFG 2Y7ZA 4J2YB 3VXFH 4B2AA 1MTSA 5I25A 4CBNA 1FV9A 4F4OC 3U8OH 3ESTA 1JBUH 3QZQA 3RXUA 1MU8B 3EGKH 4NIXA 5A8YA 2UWOA 3KHVA 2BLOA 3KF2A 3RLWH 1XUGA 2WUBA 3S0NA 2PSYA 1ZR0A 5F8TA 3NZIA 1F0UA 1NU7B 1NZQH 2HWLB 3SORA 2FX4A 3LC5A 4CRBA 2BDBA 4B71A 4WWYA 3FZZA 3RU4D 3C1KA 2C8XB 1CVWH 1BJUA 1ZGVA 3AW1A 4I32A 3ZVAA 3E0NB 1D3DB 2GT8A 4TY6A 3RP2A 2STBE 4WXIA 2J34A 3ZZDA 1KDQA 1GBTA 1P11E 1N8OB 3RXBA 2PR3A 4AB9A 2IPHA 2ESTE 3ZZ4A 3P8OA 1AZZA 1DFPA 1ZTKA 1NN6A 1MBMA 1HUTH 1NC6A 3KQBA 4ZKOU 1W14U 1UTKA 4AG2A 1SFQB 3RXCA 4E06H 3PMJA 4FXGH 5C5NA 1Y3YA 5FPSA 1O31A 2BD4A 1S5SA 4CR5A 3SJ8A 3ATMA 5FX5A 4GVUA 1UK3A 1P06A 3W95A 4B74A 1SB1H 2ZTYA 1LHCH 1GBKA 3GISB 8LPRA 1FMGA 2GX4A 2FYRA 2A7JA 2FOHA 2SGDE 2BTCE 1L1JA 1V2NT 1YPEH 2FM2A 3K6YA 2G55A 2GV7A 2ZO3H 3ENSB 1DLEA 1H9HE 4GAWA 1O2LA 1JIMA 1G30B 2ZG0H 2FOCA 4LZ4B 3OY5U 1QURH 4A7IB 5TJXA 2YOLA 4ZAEA 2FYQA 4NWKA 5DKMA 1F7ZA 3EA8A 2RA0A 5HMAA 4FUFA 1G2MA 3M3VA 4B73A 1BZXE 1G3DA 2CGAA 1LDTT 1KLJH