2ZCKP

Crystal structure of a ternary complex between psa, a substrat-acyl intermediate and an activating antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Prostate-specific antigen
total genus 53
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP01
4WWYA 1JIMA 3SZNA 4KGAA 3KGPA 3GICB 1TPPA 2Y82A 2F3CE 2OC0A 1K1LA 1WTHD 3OX7U 1DM4B 2PSXA 1UVOA 2RCEA 4D7GA 3VB3A 2M5TA 2PKAA 5I25A 1ETTH 1S0RA 4CH2B 1Z71A 2G81E 4Y11E 5C5OA 3AAUA 3ZZ6A 1IQMA 1GHXH 1WCZA 3E90B 4IS5A 2ZTZA 2H5DA 1O3KA 1K1OA 4BAOB 3BTTE 1HAHH 1QJ1B 2NU4E 2OCVB 4Z0KA 4TPYA 1C5SA 2SGAA 1O5BB 3RMMH 1QURH 1NRNH 4ZKRU 1AE8H 1NZQH 1SC8U 1O3AA 1P02A 2TPIZ 1NFUA 1O2JA 3BTWE 1OXGA 2EA3A 3K6ZA 4U30A 1MQ5A 3E6PH 1TWXB 2UUKB 4INLA 1T4UH 2UUFB 1BTZA 1O3MA 1TABE 3ODFA 4JYVH 1RTLA 1ELDE 3GYMA 1HAVA 2ZDMA 1MTNB 2PGQB 2ZFQH 1ARCA 2FOMB 4ABGA 3ENSB 2BYAX 2SGPE 2CHAC 4X1RU 1GJ8B 3UPEA 7LPRA 2ZCHP 1AVXA 3ZZAA 5EGMA 1W0ZU 1C2HA 5T6GA 2Q6FA 3GCHC 3LC5A 1KDQA 1BZXE 2FO9A 2BQ7B 4WMDA 1ZTLA 4MPWA 2Y7ZA 3F1SB 2ZFRH 1PFXC 2TBSA 2ZF0H 1IQKA 5DP9A 1DWCH 3SJ9A 1B0EA 1CGHA 4LXBH 5EQSA 1GWAA 3W94A 2BD2A 5DPAA 4SGBE 2AFQB 2ZGJA 4ABBA 4NSVA 3A8BA 1O36A 3MNSA 2W7UA 1NT1A 2TGDA 1ZJDA 2BHGA 1MBMA 3KF2A 4MTBA 1VITF 2AYWA 2HNTF 1K21H 1EOLA 4AX9H 1TNKA 1C5TA 1UTKA 2VU8E 1S85A 1HAGE 3O8BA 1FXYA 5GIBA 1O30A 1DOJA 4YOGA 1LHCH 1BMAA 1QBVH 1SMFE 2VINA 1X7AC 5EXMA 4K69A 4I7YH 2RA0A 2XBVA 1UK4A 5C1YA 3MU0A 1SG8B 3F68H 1GVLA 1AGJA 3A86A 2P3TB 1E36B 2W5EA 1YPHE 1G2MA 1ESBA 1L1NA 2P59A 2ZA5A 3MU1A 4HFPB 5IDKA 3E0PB 1O3EA 3CS0A 5DP7A 1FIZA 4D76A 1BBRE 2VJ1A 1QB1A 3QN7A 1XM1A 2FOCA 5TJXA 2VNTA 1Y3WA 5FCKA 3HATH 4ZKSU 1TALA 1O0DH 1FJSA 3P17H 1WQVH 5A8XA 5EW2H 1IQIA 1C5NH 2GZ9A 2QV1A 5GCHG 1UCYH 1P8VC 1BRCE 1CT0E 1DSTA 1O31A 1PQAA 1GJ4H 5CMXH 1E38B 2HVXA 2Z9GA 4YT7H 1WQSA 5F8ZA 4E06H 2PUXB 1Q31A 1PQ8A 5FBEA 3TPIZ 2G5VA 2I6SA 3GCHB 1AUJA 1BRAA 1OS8A 1DUAA 1O5FH 1T4VH 1H8DH 2G8TA 3RLYH 1LVOA 1B0FA 3DUXH 1O2XA 1TBRH 4K2YA 3RDZA 1A0LA 1S81A 4R0IA 3B23B 2D1JA 1BTYA 1KLIH 5JB9S 4Q80A 4TY7A 4I8JA 1FONA 3P6ZB 1UTLM 1VITH 1O2TA 4XE4A 1GBFA 1TOMH 1YCPK 4AORA 2UUJB 1A5GH 1Q2WA 2C4FH 3ZZ3A 1KDQB 1UTPA 3SNCA 3SHAH 1S83A 1P12E 2P94A 3HKIB 1ZZZA 1JOUB 5JYIA 3U98H 3ZYDA 3ZZDA 2OC1A 4NIYA 2QXGA 1GL1A 3N7OA 3A7YA 3PMBB 8LPRA 1ZHRA 1QL8A 2R2MB 2Y81A 4ZHLU 2WUBA 3A7XA 3MO9A 2SNWA 2PKAB 4ABFA 3TNTA 2VIQA 3P8NA 3RXLA 2SGDE 3OY6U 3UREA 2AEIH 3KHVA 3RMNH 1O2OA 1T7CA 1XKAC 4YESB 1GHBF 3VXFH 3QGNB 1D3TB 4UFFH 1O39A 4UD9H 4Y6DA 3SU1A 5F8TA 3TK5A 1OP8A 2ZHDA 1DE7H 3FP7E 4O97A 5K0HA 1NPMA 1ABIH 4Y71A 1BOQA 5DO4H 1RXPA 5A0CA 2Z9KA 5A09A 6CHAC 2R3UA 2SGFE 1FUJA 3ZYEA 4A7IB 1FN8A 4MNYA 1K1JA 2KAIA 2Z9LA 4YZUA 5EQQA 3V12A 3GY6A 2PSYA 1T8OA 2QXHA 1KYNA 1S6FA 2ZECA 1O2QA 1LPGB 4FUDA 1HUTH 3QK1A 1EZQA 2J38A 4FU8A 3TGKE 3ZVEA 1C5MD 1UTQA 1TGTA 2GCTC 5GPIB 4AYYB 1SLXB 5FHTA 1UMAH 4RSPA 1LHFH 1S5SA 1UCYE 3ZZ4A 1FN6A 1EJAA 1QBOA 2ZPQA 5EPNA 1AFQB 3K65B 1TNHA 1ZPBA 3S69A 1V2NT 1ZPZA 3BN9A 3RXFA 3RXAA 4LZ4B 2A4QA 1K1MA 3RXDA 2A5AA 5JPMH 1VR1H 1Y3UA 3RMLH 2PKSB 1LPZB 1W13U 2WPKS 1QB9A 2XYAA 4DCDA 1OPHB 2ZIQH 4CREA 3BTGE 1HV7A 2OC7A 3QZQA 4A5TS 5JDUB 1OP2A 4A6LA 1YC0A 4ISNA 1VCWA 1HGTH 1TQ7B 1A3BH 4UFDH 5AVDA 1LO6A 1HDTH 1N1LA 2BQWB 4IMQA 1TE0A 1SFIA 3A82A 1SGPE 2FOGA 1GJCB 3LGYA 4UEHH 1DUEA 1F7ZA 1O5EH 5DGJA 4H6TA 2Y6TA 2GZ7A 3VB6A 3C1KA 4RKOB 2BM2A 2ANWA 1SBWA 4LOYH 1CQQA 2QF0A 3BTQE 4K60A 1C5YB 2HOBA 3GCNA 4MPVA 3QWCH 1MQ6A 3S7HB 3A7VA 3URCA 4ZMAH 3P8FA 1EUFA 1C2JA 1QCPA 4ASHA 3I77A 1L4ZA 1XUFA 1GJ9B 4O03A 4BAHB 1FAKH 1MAXA 1FLEE 1HCGA 1W0YH 1HBTH 4K1EA 1XXDA 3UWJH 1OWHA 3MH7A 3PTBA 3DFLA 5HM2A 1NFXA 4WJG2 1A0HB 3O8RA 5GXPA 3KQDA 1OWIA 1QIXB 3VPKA 1Y3XA 2NU3E 1TQ0B 2CGAA 5BPEA 5TCCA 1JXPA 1TX8A 4IN2A 3UNQA 2F9UA 1ZTKA 3SOSA 3UUZA 5FX5A 1THPB 2A7CA 3LH3A 2H9TH 3S9CA 2GDDA 3GDUA 1IAUA 4X2XA 5FX6A 4I8HA 2PWXA 1F2SE 3TJVA 1GI0A 5E0HA 1AHTH 2G55A 3M7TA 1NRRH 3ZVCA 1GJAB 2PUQH 1LCYA 1F0RA 4X1NU 3K9XB 4YLQH 1D9IA 1ZSLA 3BIVH 3QZRA 1ELFA 2P8OC 1ELVA 1FY8E 1ACBE 4JZIA 3NWUA 1GI6A 2AIPA 2F9VA 1DANH 4B73A 3T62A 4GVUA 2XC0A 2FESH 4WXVA 2G00A 1KIGH 2GMTB 4AGKA 2QN5T 3KL6A 3TLOA 1YPEH 1Z8JB 2TIOA 1C4U2 1GJ7B 1PQ7A 3L33A 1F0SA 1EAUA 1GBDA 1OKXA 4BXSA 5C1UA 3ZVAA 1MCVA 2IPHA 1BUIA 3M3TA 4NA8A 1DDJA 3U8TH 3U9AH 1AD8H 2FIRH 1DXPA 1MU6B 3RUOA 2BOHB 1GBIA 4Y7AA 3RC4A 1O3CA 2AMQA 3UTUH 2BD4A 2FLBH 3OYPA 1HAZB 2ZGXH 3TGIE 1S82A 1Z1IA 4BXWA 2QIQA 1L2EA 3STJA 1O2HA 3ODDA 3RC5A 2NU2E 4I33A 4FUJA 1QL7A 1T31A 4Y0ZE 1GHWH 1SGEE 1KXAA 2BY8X 1O32A 3KQCA 5I46H 1VGCB 1F5RA 1XVOA 2QGRA 1O3DA 4DIIH 1SLVB 1ANBA 1AVWA 1YPLH 3FFGA 2VWMA 1GCDA 1XUGA 2BVSH 3A88A 1TBZH 2A4RA 1O3FA 1SSXA 2A4OA 4M7GA 3Q00A 4DIHH 5JBTA 3M36A 4HGCA 3ZZCA 3RXHA 3SW2B 2A5KA 1MTSA 3SJIA 2C3SA 1EAIA 4X6MA 3EE0B 1AB9C 1LQDB 3PROA 1C1RA 4XBDA 1ZHPA 5AFZH 4ZKNU 2F91A 2AS9A 1T8NA 2QAAA 2BD8A 1GCTC 1TONA 1MUEB 1V2OT 1IQGA 2XBYA 1SQTA 4Q7YA 4ZROA 5FAHA 2ZGHA 1TNJA 1C1UH 2W26A 3A85A 4NWKA 2ZDNA 1BQYA 2BVRH 1OSSA 2Y80A 3SGAE 3VB4A 4GCHF 4TWWA 3E0NB 4CBOA 3UWIA 2CMYA 1FNIA 1P3CA 3SV7A 1VZQH 5ESTE 2AGIX 2ZHWH 3PWBA 1GI8B 1GHAG 3EDXB 1W10U 3S7KB 2BY9X 2FEQH 1ZMJA 3BTHE 5EXNA 1JRTA 1O2GH 2G4TA 1QR3E 1O3NA 2Q1JA 1H9IE 1TOCB 3SQEE 3R3GB 2THFB 4MPUA 2BY5X 2Z3CA 4OS7A 5DJ7A 2BB4A 1OWJA 1CGIE 2P93A 1LDTT 3RU4E 2PV9B 2P16A 3ATMA 1G3CA 1RFNA 1BIOA 3AAVA 4JK6A 2XWBI 4BTTB 3Q3YA 3L6PA 1PYTD 5EPYA 1SOTA 3RM2H 3BEIB 4ESTE 2CF8H 1P2JA 2AH4X 2J34A 3TJUA 3V0XA 2CV3A 2STAE 2ZTYA 1UJ1A 1GVKB 2ZO3H 3LGIA 4F4OC 1O2NA 2VH0A 1SGYE 2WPIS 3SHCH 3GOVB 4YM9A 1BT7A 3ZZ8A 2OINA 2A31A 5A0BA 2W3IA 2D8WA 1GBHA 3ZV8A 2HNTC 3Q3KA 1GBJA 4O9VA 4XBBA 3BG4C 9LPRA 1QRZA 1NM6A 2O8UA 4RKJB 1IHTH 1EZSC 3RU4T 5H4IB 4INKA 2BDAA 2J95A 1W7XH 2TRMA 3ESTA 2CF9H 1K1IA 3PV4A 3SU0A 2PKSC 3VB7A 2IJOB 2NU1E 2ZP0H 4ZH8A 4NA9H 1SGNE 1GHZA 1CA0C 4MNXA 3CP7A 1TAWA 8GCHF 1GGDB 2ZKSA 3P8OA 5DP4A 2ZEBA 2A1DB 2F9NA 2XC5A 3R0FA 3SU6A 1SGTA 2ZU1A 4JYTA 4NSYA 1T8LA 2AMDA 2P8OB 1C2MA 4MNVA 3RMOH 2STBE 3BV9B 1GHBG 1C1QA 4FUIA 4JZ1A 3QUMP 2NWNA 3T5FH 3MNCA 3HGPA 1GCTB 1TNLA 1UHBA 1P9UA 4D9QA 2ZC9H 3S9AA 1EXFA 3RXQA 3E16B 3ZZ9A 1LVYA 1HRTH 2BX4A 1BTUA 1MTVA 4KP0A 1WUNH 2F83A 2Z6BD 3SGQE 2XW9A 4TPIZ 4BAKB 4DVAU 3IWMA 3SJOA 4BNRA 3TJNA 4ZKOU 1GMHG 5HGGA 1W2KH 1GI5A 3QGJA 1Y5BT 3SBKA 1SGQE 4J1YA 2HPPH 1O3LA 4MLFB 2R0KA 1DLEA 1ZRKA 4U32A 1N8OC 1LVMA 2BTCE 1B7XB 1BTWA 4PROA 1QRWA 2F9BH 3TJOA 3TVJB 2A5IA 1OX1A 3M3VA 2J94A 2KAIB 1TRYA 3GY8A 1CT4E 2HNTE 1QY6A 2CJIA 4E7NA 1XKBC 1HIAA 4IC6A 1BRUP 2ZPRA 4DG4A 3IG6B 2QA9E 4UE7H 1BTPA 2BDGA 4LK4A 2V35A 1QA7A 1C2GA 1GMDF 1YGCH 1C5UA 2BDBA 3LONA 1HJAC 1V2QT 5DG6A 3PB1E 4Y76A 3LGUA 4NGAH 1L1GA 5FCRA 3EA9A 1NO9H 1N6YA 1PPCE 1FPCH 1QRXA 1A2CH 2ZDAH 4KELA 3U1IB 4ZUHA 4JCNA 3SNEA 1RD3B 3SI4H 4AG1A 1MU8B 1TPOA 1SI5H 2B5TB 1FQ3A 1SGIB 2O8WA 5GCHF 2FMJA 4ABEA 2GT7A 5FPSA 1BJVA 1KTTB 4J2YB 2BD5A 8GCHG 1HB0B 4X6OA 1IQLA 1KXCA 2GP9B 2C8WB 2FP7B 4WMFA 1K2I1 3PYHA 4CRFA 1M9UA 2Y5GA 1EP5A 5L2YH 1W12U 2FPZA 3EAJA 4IMZA 2FX4A 1Z8IB 4D7FA 2AGGX 1GBTA 1UVUH 2R3YA 1MAYA 1MD7A 1AO5A 4TYDA 1C5WB 4Y8XA 3E8LA 1OYTH 2VVVA 3MNXA 1EP6A 2BLVA 4UONA 2VWOA 1GL0E 4Y7BA 1E0FD 2BOKA 2Z3DA 1ZLRA 3UQOA 2AGEX 3MYWA 3LJJA 1DPOA 1BJUA 1NN6A 5AHGH 4YLUA 1E34B 2OP9A 2BLOA 1MZDA 4BAQB 3C27B 3EA7A 3T25A 1MTWA 1BTHH 2H2ZA 2FI3E 1EPTC 4YT6H 3MU5A 3RXBA 3HGNA 3NUMA 1HAYB 1GG6B 1J8AA 1V2TT 1ETSH 4BTIB 2FS8A 3SU2A 2ZHEH 4KKDA 1D3PB 1P2OA 2ODPA 5E8EH 1BTXA 1V2MT 3ITIA 1SB1H 4THNH 1O33A 4I32A 2A32A 5F03A 2SGQE 1YF4A 1PQ5A 1YCPM 4QT8C 1YLCA 1C1NA 1C5RA 1Z6EA 3ZZ5A 3DHKH 2J9NA 1YPKH 2W3KA 3DD2H 4AYVB 2UWPA 1SGRE 5C1XA 1AZ8A 4KTCA 2BMGB 3JZ1B 8ESTE 1ORFA 1DWDH 1TRNA 4X8SH 1D3DB 1O3GA 1SGCA 3V7TA 4CH8B 1YLDA 1W11U 4FVDA 4H6SB 3S0NA 2LNCA 1O2MA 4INHA 2BDIA 4Q7ZA 2OQ5A 3BG4B 3UR6A 3EA8A 2NU0E 4MDSA 4OS6A 1TRMA 1ELGA 1G3DA 2WPMS 3BF6H 4IBLH 1TPSA 2BD3A 1VCPA 3PO1C 4CR5A 3SNBA 4Y0YE 2FOAA 2J2UA 4OS4A 5FPTA 3BTFE 1QHRB 2D26C 1KLTA 1THSH 2RG3A 1BHXF 1VJAU 1EJNA 1YP9A 3HKJB 1JBUH 1LHEH 1AUTC 1GVZA 3KIDU 1TGNA 4JMYA 3NK8A 4H4FA 4NZQA 3RXOA 1TGSZ 3F9FA 1HJ8A 3A8CA 3U69H 3UNRA 1O35A 1BMMH 1ZMLA 1F0UA 1F5LA 4XFQA 1GBBA 1K1NA 3SN8A 1CSOE 1EZUC 4CRDA 3VB5A 1RTFB 3GYLB 3PLBA 4NZLA 1QA0A 5EU8A 3UY9A 5AF9H 4DW2U 2H5CA 1C5OH 4Y79A 3PLPA 2HLCA 2ZWLH 3L3TA 3RU4D 2SNVA 1C2LA 5L30H 4MNWA 1VITG 2ZFPH 4AN7A 1SHHB 2GMTC 3KNXA 1G9IE 3E1XB 5JBAS 1D4PB 4CHAB 2ZDKA 6LPRA 5LPRA 4CRGA 1C9TA 2Z94A 1O2UA 1PPFE 3BTDE 5JBCS 1N6XA 1NFYA 4X1SU 5A8ZA 1P10A 3E91A 4A92A 1CHGA 1QFKH 2ANKH 1CBWB 3OU0A 1GI9B 1GBKA 5ABWA 1UVSH 1MKWK 1MTUA 3OY5U 3RXRA 6CHAB 4B75A 5F8XA 1V2UT 1HXFH 1OOKB 5LGOA 4CBNA 2BXTH 1O2VA 1RRKA 1BA8B 2XBXA 1TNIA 1LKAA 1NC6A 2FTLE 2VWNA 4I8GA 4A1VA 2FYQA 2OC8A 3Q3XA 4HZHA 2VVCA 4K8BA 1AU8A 1AKSB 2ZG0H 1SGFA 1J16A 1QJ7B 3FZZA 2FM2A 4IN1A 4Y8ZA 1DLKB 5L2ZH 2ALVA 4FUGA 1UK3A 2GV6A 5CHAB 5IYTA 2PFEA 3RXCA 1A7SA 3P95A 1XVMA 1GJBB 2PHBA 1SOZA 4X2WA 1LKBA 2BDHA 2GGVB 2XXLA 1KY9A 4B74A 6GCHF 1BBRK 1BMNH 2UWLA 4WH8A 3GY7A 3GCTF 4ABAA 2IN2A 2O8LA 2BY7X 2K1QA 7ESTE 1BCUH 2WINI 3QO6A 2ZCKP 2AIQA 1DXWA 1GPZA 1O5AB 1O2PA 1IOEA 2B7DH 2FZZA 1MCTA 4U01A 3BEUA 2BD7A 1QGFA 1ZGIA 4I8KA 1O3BA 3ZVDA 1WTGH 2H9EH 2JH6D 4ZHMU 1AY6H 3A8AA 3RXGA 1P2QA 4Q7XA 2A0QB 3A83A 1RIWB 4B2BA 1DICA 1HLTH 3SU5A 3SV8A 1NS3A 3MH6A 3RM0H 5TCAA 1P01A 1C4V2 5T6DA 1ID5H 1SGFG 3SUEA 1P0SH 1O2IA 4ISHH 2ZU5A 2WYJA 3MFJA 4X6PA 2BZAA 1ZPCA 1O37A 1O3OA 2VWLA 1G3EA 1ZR0A 2XTTB 3QLPH 1GI1A 3RXTA 1H4WA 1L1JA 5LH8A 1NESE 3K6YA 4X6NA 3TNSA 2P95A 2F9PA 1O34A 1GDUA 3NKKA 2BQ6B 1JWTA 1AWHB 2CHAB 1EPTA 1PPHE 4K1TA 4YO9A 1ESAA 1O5CB 2BDYA 2GT8A 3AW0A 1RGQA 3TGJE 4ISIH 4A1TA 3O8CA 4WVPE 3Q77A 2ZCLP 4GHTA 1C2EA 4UFEH 1ELEE 1QQ4A 2GCHG 3SQHE 1EOJA 1N8OB 1XUKA 1TX7A 2R2WU 1HXEH 1C1TA 1C9PA 1DSUA 4OS2A 1A4WH 4B2AA 1EJMA 3T2NA 2B9LA 5EXLA 1NY22 4ABJA 1UHBB 2UWOA 1XUHA 3UOPA 1C5VA 2W7SA 1FY1A 3GY3A 1S84A 1BHXB 4X1QU 2FTMA 1HAIH 1SQAA 1IQFA 4U2WA 2FYRA 4MQAA 4D8NA 3Q76A 1YPGH 2ZQ1A 2RA3A 1WYKA 1GBEA 1AKSA 4NFFA 1L4DA 3TITA 5B6OA 3SJ8A 5FPYA 1VCQA 2Z9JA 2C8XB 4NIVA 3SV6A 3PMHB 4XDEA 1HYLA 4BANB 1UTMA 2SFAA 2FODA 2GCHF 1EX3A 1WOFA 4ISOA 1VGCC 2HRVA 1ESTA 4AOQA 1C1PA 5BRRE 2BLQA 3RXUA 1IQEA 1CGJE 1MD8A 1XUJA 2BDCA 3M37A 3UR9A 4ZXYH 1YKTA 1F92A 1K1PA 1HNEE 2YOLA 2DE8A 1HJ9A 3QDZB 1EQ9A 1UK2A 2EI6A 2JETC 2JH0D 2GZ8A 1Y8TA 3I78A 3SUGA 1QBNA 1GJ6A 1JMOH 3LPRA 4I8LA 3SNAA 2QYIA 3PWCA 1V2JT 1UCYK 3A87A 4B71A 2BVXH 3B9FH 4VGCB 4FUHA 1Z7KA 3MHWU 3STIA 1V6DA 1ANCA 4AGJA 2I6QA 5LPFA 1HJAB 4WF8A 1D3QB 4O3UA 2ZU4A 1DITH 1V2RT 2FS9A 1O5DH 1LTOA 1YCPH 1W3CA 3RXPA 2OQUA 1MZAA 1CE5A 1QB6A 2PLXA 3RXKA 3OTJE 1P05A 3M5OA 2VIWA 5DP3A 1IHSH 4IC5A 2V3OH 4GPGA 1A46H 4ABIA 1KTSB 2LPRA 2PGBB 1RIWC 1O3JA 5A0AE 2VIVA 4X2VA 1YPMH 4FUBA 3KN2A 5T3HA 2FWWA 1GI4A 3BG8A 4GCHG 1SQOA 4YOJA 5HYOA 3MU8A 2V3HH 1FDPA 1V2WT 1O2WA 1SPJA 3EGKH 2ZGBH 1UTNA 2J92A 7GCHF 3CS7A 1K22H 2F9OA 2J4IA 1C5XB 2HWLB 1INCA 1YPJH 5F6MA 3SORA 1V2LT 3I29A 1OWEA 2ESTE 1WU1A 3U1JB 3T29A 1KXBA 1G36A 3FVFB 1GDNA 1C2KA 1E37B 2ZI2H 2ILNA 1C1MA 4XOJA 1S0QA 2A2XH 2GX4A 5HMAA 2PTCE 4NA7A 1E35B 4DURA 4X8UH 5CHAC 3G01A 2CN0H 1J17T 3ATLA 3URDA 1MBQA 4TWYA 4NIWA 4X8VH 4DJZB 2VIOA 4R8TB 1NFWA 3TK9A 1NTPA 4SGAE 4AG2A 1ABJH 1ARBA 4AFUA 4CHAC 1GJDB 2XC4A 5ETXA 2ZDVH 2Z3EA 3FZDA 1F0TA 4OGYA 1A1RA 3M3SA 3OSYA 5E0GA 2ZGCA 3M7QA 3GDSA 1NU9A 4GSOA 1D6WA 2VGCB 1QQUA 4OS5A 1GJ5H 4ZAEA 2ZDLA 3SJKA 1GGDC 3VFEA 3ATIA 2Q6GA 1K28D 1P3EA 1Y59T 4NIXA 1MKXK 4JYUH 3V13A 6GCHG 5L6NH 5GDSH 3BEFB 3F6UH 3EYDA 3B8JA 1C2DA 3AW1A 1YBWA 3GY5A 2OXSA 5A8YA 1WAYB 2ZFTA 4B1TA 5C67A 1J14A 4WXIA 1P11E 2VIDA 1YYY1 1C1SA 3BTEE 2VIPA 1BBRH 1H8IH 1ZTJA 2ANMH 2FDAA 3TU7H 1THRH 4F49A 4UFGH 1TB6H 3PM3A 3TH2H 4XBCA 1UVPA 2G52A 1TGBA 1H9HE 1Y3VA 3SUFA 3UQVA 3QX5H 2P3UB 3GDVA 4AB8A 4GUXA 1HAPH 1GMCG 3RXJA 1LMWB 1OP0A 5J4QA 1V2VT 1LHDH 2WUCA 3ELAH 3MH4A 1J15A 1SGDE 2H9HA 3SU3A 2PR3A 4NCYA 1G3BA 1V2KT 3UFAA 4NWLA 5C5NA 4FU9A 2GKVE 3T26A 1C2FA 5EG4A 3MMGA 1P03A 4O3TA 4VGCC 1Z8RA 3A8DA 2XNIA 4BTUB 1O3IA 3PO1B 2FLRH 1T8MA 1TA6A 3RXSA 2EC9H 1GDQA 2AERH 1BB0B 2ZFSA 1SLWB 1UO6A 2Y5HA 4Y8YA 1PPEE 1Z6JH 1AE5A 1EKBB 1SVPA 2QCYA 4X2YA 4CRAA 1CO7E 1AI8H 1AN1E 1OYQA 4A1XA 1AWFH 1DS2E 4X1PU 4Q2KA 5J4SA 4YTAA 1NRPH 1P04A 3ZZ7A 1MKXH 2R9PA 5K7RA 1C5LH 1G2LA 5DP6A 4UDWH 2EEKA 2ODQA 1TPAE 8KME2 4ISLA 1GHVH 1V2PT 4GHQA 1RS0A 3RXIA 1SR5C 2C8ZB 2FXRA 1C1OA 1CVWH 2A4GA 1AIXH 2UUYA 4GAWA 3U8OH 1TBQH 2FOFA 4AFSA 3SGBE 1BMLA 1GI2A 3JZ2B 1PPBH 2TGTA 5EQRA 2QY0B 4NG9H 3PMAB 4FXGH 2YNBA 3LH1A 2QXIA 5CE1A 9ESTA 3RXEA 3LKWA 3V3MA 2B8OH 3MO3A 1AB9B 3M61U 1IQNA 1KXEA 4FUEA 3LC3A 3SI3H 1QTFA 3HK3B 5C20A 1TLDA 3H7TA 5AFYH 3HPTB 3K2UA 4E05H 1WV7H 1GBLA 3RC6A 1ZYOA 4B2CA 1ZGVA 5E2PA 3LIWA 4FU7A 1TGCA 5G4BA 1QJ6B 3BIUH 3LDXH 2O8TA 3IITA 2FX6A 1TIOA 2HALA 1ZRBA 1C4Y2 3UIRA 1CT2E 2BD9A 2R0LA 2DUCA 3DT0H 1TX6A 2OD3B 1P09A 3AASA 1A5IA 1Y5AT 3LJOA 5DP8A 1MMJN 3W95A 4DT7B 1ANEA 3S9BA 1XUIA 1XX9A 5FXLA 1UTJA 1DWEH 2HPQH 2ZQ2A 3HK6B 1O2YA 3SV9A 3M5MA 3QTOH 2EI8A 2ULLA 2O8MA 1Z8GA 2GD4B 1ANDA 2QXJA 4DOQA 4HTCH 4K5ZA 1DY9A 3A80A 1LHGH 3LU9B 2HGTH 3H5CB 5LPEA 3TK6A 1AFQC 5C2ZA 1GMCF 4HI3A 3TH3H 3MO6A 1EB2A 1O2RA 1GMDG 1DWBH 1H9LB 3M5NA 1ZSJA 1G37A 3A7WA 3ZZBA 2XCFA 1IQHA 4JZFH 3GY4A 4E7RG 3PTNA 1ELBA 4AFQA 3SNDA 2DE9A 3KQBA 1FI8A 1KXDA 4ZXXH 3SO3A 2O9QA 2WPLS 1BITA 3CENA 3D49H 3PMJA 4KTSA 2ZNKH 5DK1A 3A84A 3O8DA 3F9GA 4K1SA 4Y10E 3ZVGA 2GCTB 3M5LA 1GBMA 3MU4A 3VEQB 1LVBA 3UOUA 3VGCB 3NPSA 1W8BH 4AFZA 1HIAB 1SLUB 2ZZUH 1ELCA 1T32A 4H42U 3ZVBA 1O3HA 1GBCA 1GMHF 5C3NA 2P3FH 1JIRA 2OBOA 2GV7A 2VGCC 2ZHFH 1TNGA 1ELAA 1FV9A 2EI7A 1C1VH 4ZHAA 3D62A 4AZ2B 4DY7B 1KLJH 1KXFA 1O38A 2JKHA 2Y5FA 2XCNA 1GG6C 1ZOMA 7GCHG 1OWDA 1Y5UT 3SV2H 2OTVA 1HAVB 3T28A 3A89A 2ZFFH 3ATWA 1PPGE 4BAMB 2OLGA 3DFJA 1H1BA 2Z9IA 3D23A 1AZZA 1G30B 5ESBA 4FUCA 3FANA 2ODYB 1FY3A 3MTYA 1FZZA 1ETRH 4DGJA 2FOEA 4K8YA 1UVTH 1P2NA 4TY6A 3VXEH 4FVBA 2FOHA 6ESTA 1EATA 2FOBA 2ZTXA 3MOCA 2ANYA 3P70B 1S6HA 1O2ZA 1C1WH 4WY3A 2B0FA 1PPZA 1PJPA 1C5ZB 1SFQB 3D65E 1CBWC 1PYTC 3FP8E 3LGTA 4ABHA 3RXVA 2ALPA 1TYNA 1MKWH 5DP5A 1O2LA 1TMBH 2ZU3A 1MTNC 3MH5A 5T6FA 2WV4A 1OWKA 4CR9A 3ZVFA 2YNAA 3SU4A 3T27A 1TMTH 2XRCA 1LPKB 1ZHMA 2A45B 5PTPA 2Z7FE 2A2QH 4LZ1H 4XSKU 1CHOF 1CU1A 4X8TH 1P2IA 1UTOA 1TA2A 5GWZA 4MVNA 1HAXB 3H7OA 2GTBA 2BX3A 3BTKE 3TH4H 1Z1JA 1AVGH 4JZEH 1ZJKA 2C93B 2BZ6H 2TGAA 4B76A 1GBAA 1F5KU 3MNBA 3KCGH 3NXPA 2ZU2A 1IQJA 1FIWA 1BDAA 1FAXA 2JETB 3A81A 1ZMNA 3KQEA 3SUDA 3M35A 5E0JA 1WSSH 3RLWH 2QF3A 1JRSA 3P92A 4MG3A 5SGAE 1GHAF 3LT3A 4BOHA 3ATKA 1BRBE 3ZV9A 2WPJS 1Q3XA 1DT2A 5JB8S 2IOTA 4MPXA 1L0ZA 2PW8H 1EAWA 2XBWA 3F9EA 4OS1A 1U6QA 1A0JA 2G51A 2ZPSA 3U8RH 1DVAH 5FBIA 1FY5A 1O2SA 4D9RA 3P8GA 3MWIU 3LOXA 3FP6E 2BY6X 1FY4A 1XXFA 2A7HA 3TIUA 1O3PB 1RTKA 1YPHC 3RXMA 1P9SA 5EOKA 5EW1H 1DY8A 2FI5E 4KTUA 3FAOA 5EODA 4RN6A 3UNSA 1EASA 1DFPA 2G4UA 1AQ7A 2RDLA 2V0BA 1C5QA 1O2KA 1CA0B 3LGWA 1P2KA 1MH0A 3AVZA 4IW4E 1EPTB 1CHOG 4JK5A 2SGEE 1V3XA 1HAOH 2H1UA 1EAXA 3WY8A 2G5NA 1J9CH 2C8YB 1A3EH 1FMGA 2BLWA 4CRCA 1D6RA 2TGPZ 1W14U 1G32B 3MI4A 4IGDA 1YM0A 1SHYA 2VH6A 1TMUH 3BSQA 4ABDA 1K9OE 3VGCC 3GY2A 1WBGB 3NZIA 4WMEA 2BXUH 3E3TA 2WV5A 1NU7B 2PTNA 3GCTG 4FUFA 1GI3A 4K3JA 1LQEA 2AMPA 1GI7B 4AB9A 1P06A 2V6NA 1DX5M 3KEEA 4WH6A 2CXVA 2GDEH 2GVFA 1P57B 1AMHA 1AFEH 2H6MA 2VB0A 1ELTA 1NRSH 3QTVH 3A7TA 3BTME 5E2OA 3NCLA 1P2MA 1XMNB 2A7JA 2ASUB 1A61H 3A7ZA 2OUAA 3RP2A 1QNJA 2FI4E 3M7UA 2JH5D 1RJXB 2Q6DA 2WPHS 4GLYA 2ZHQH 4CRBA 1C5PA 1V2ST 1QL9A 1CA8B 1A5HA 1EZXC 1NROH 5JBBS 1TFXA 3PLKA 3GISB 7KMEH 2D2DA 4I31A 1W7GH 1HFDA 1EB1H 1HPGA 2WYGA 2C90B 2Y7XA 5HM9A 1O5GH 5DKMA 2XWAA 1KSNA 3GCOA 1SL3A 1C2IA 4X0WU 1NRQH 2QC2A 1B5GH 1ZSKA 1FPHH 4Z6AH 5GJ4B 3LGVA 4NFEA 1Y3YA 2VVUA 4JZDH 2OBQA 4YOIA 4OGXA 3EQ0H 1VJ9U 5HXFA 3F9HA 3DA9B 5A2MH 1GHYH
chains in the Genus database with same CATH superfamily
4WWYA 1JIMA 3SZNA 4KGAA 3KGPA 3GICB 1TPPA 2Y82A 2F3CE 2OC0A 1K1LA 1WTHD 3OX7U 2GJGA 1DM4B 2PSXA 1UVOA 2RCEA 5HIYA 4D7GA 3VB3A 2M5TA 2PKAA 5I25A 1ETTH 1S0RA 4CH2B 1Z71A 2G81E 4Y11E 5C5OA 3AAUA 3ZZ6A 1IQMA 1GHXH 1WCZA 3WWBA 3E90B 4IS5A 2ZTZA 2H5DA 1O3KA 1K1OA 4BAOB 3BTTE 1HAHH 1QJ1B 2NU4E 2OCVB 4Z0KA 4TPYA 1C5SA 2SGAA 1O5BB 3RMMH 1QURH 1NRNH 4ZKRU 1AE8H 1NZQH 1SC8U 1O3AA 5GNDA 1P02A 2TPIZ 1NFUA 1O2JA 3BTWE 1OXGA 2EA3A 3K6ZA 4U30A 1MQ5A 3E6PH 1TWXB 2UUKB 4INLA 1T4UH 2UUFB 4YXWD 1BTZA 1O3MA 1TABE 3ODFA 4JYVH 1RTLA 1ELDE 3F2FA 3GYMA 1HAVA 2ZDMA 1MTNB 2PGQB 2ZFQH 1ARCA 2FOMB 4ABGA 3ENSB 2BYAX 2SGPE 2CHAC 4X1RU 1GJ8B 3UPEA 7LPRA 2ZCHP 1AVXA 3ZZAA 5EGMA 1W0ZU 1C2HA 5T6GA 2Q6FA 3GCHC 3LC5A 1KDQA 4B6FA 1BZXE 2FO9A 2BQ7B 4WMDA 1ZTLA 4MPWA 2Y7ZA 3F1SB 2ZFRH 1PFXC 2TBSA 2ZF0H 1IQKA 5DP9A 1DWCH 3SJ9A 1B0EA 1CGHA 4LXBH 5EQSA 1GWAA 3W94A 2BD2A 5DPAA 4SGBE 2AFQB 2ZGJA 4ABBA 4NSVA 3A8BA 1O36A 3MNSA 2W7UA 1NT1A 2TGDA 1ZJDA 2BHGA 1MBMA 3KF2A 4MTBA 1VITF 2AYWA 2HNTF 1K21H 3N7EA 1EOLA 4AX9H 1TNKA 1C5TA 1UTKA 2VU8E 1S85A 1HAGE 3O8BA 1FXYA 3OEED 5GIBA 1O30A 1DOJA 4YOGA 1LHCH 1BMAA 1QBVH 4RT1A 4Q63A 1SMFE 2VINA 1X7AC 5EXMA 4K69A 3PRBA 4I7YH 2RA0A 2XBVA 1UK4A 5C1YA 3MU0A 1SG8B 3F68H 1GVLA 1AGJA 3A86A 2P3TB 1E36B 2W5EA 1YPHE 3KYFA 4B6EA 1G2MA 1ESBA 1L1NA 2P59A 2ZA5A 3MU1A 4HFPB 5IDKA 3E0PB 1O3EA 3CS0A 5DP7A 1FIZA 4D76A 1BBRE 5EJZA 2VJ1A 1QB1A 3QN7A 1XM1A 2FOCA 5TJXA 2VNTA 1Y3WA 2KR7A 3PRDA 5FCKA 3HATH 4ZKSU 1TALA 1O0DH 1FJSA 2YMSD 3P17H 1WQVH 3FOAA 5A8XA 5EW2H 1IQIA 1C5NH 2GZ9A 2QV1A 5GCHG 3SZEA 1UCYH 1P8VC 3F2HA 1BRCE 1CT0E 1DSTA 1O31A 1PQAA 1GJ4H 5CMXH 1E38B 2HVXA 2Z9GA 4YT7H 1WQSA 5C0UA 5F8ZA 4E06H 2PUXB 1Q31A 1PQ8A 5KECA 5FBEA 3TPIZ 2G5VA 2I6SA 3GCHB 1AUJA 1BRAA 1OS8A 1DUAA 1O5FH 1T4VH 1H8DH 2G8TA 3RLYH 1LVOA 1B0FA 3DUXH 1O2XA 1TBRH 4K2YA 3RDZA 1A0LA 1S81A 4R0IA 3B23B 2D1JA 5FL7D 1BTYA 1KLIH 5JB9S 4Q80A 4TY7A 4I8JA 1FONA 3P6ZB 1UTLM 1VITH 1O2TA 4XE4A 1GBFA 1TOMH 1YCPK 4AORA 2UUJB 1A5GH 1Q2WA 2C4FH 3ZZ3A 1KDQB 1UTPA 3SNCA 3SHAH 1S83A 1P12E 2P94A 3HKIB 1ZZZA 1JOUB 5JYIA 3U98H 3ZYDA 3ZZDA 2OC1A 4NIYA 2QXGA 1GL1A 3N7OA 3A7YA 3PMBB 8LPRA 1ZHRA 3NRLA 1QL8A 2R2MB 2Y81A 4ZHLU 2WUBA 3A7XA 3MO9A 2SNWA 2PKAB 4ABFA 3TNTA 2VIQA 3P8NA 3RXLA 2SGDE 3OY6U 3UREA 2KCYA 2AEIH 3KHVA 3RMNH 1O2OA 3N99A 1T7CA 1XKAC 4YESB 1GHBF 3PV5A 3VXFH 3QGNB 1D3TB 4UFFH 1O39A 4UD9H 4Y6DA 3SU1A 5F8TA 3TK5A 1OP8A 2ZHDA 1DE7H 3FP7E 3WWFA 4O97A 5K0HA 1NPMA 1ABIH 4Y71A 1BOQA 5DO4H 1RXPA 5A0CA 2Z9KA 5A09A 6CHAC 2R3UA 2SGFE 1FUJA 3KQ5A 3ZYEA 4A7IB 1FN8A 4MNYA 1K1JA 2KAIA 2Z9LA 2KZ4A 4YZUA 5EQQA 3V12A 3GY6A 2PSYA 1T8OA 2QXHA 1KYNA 1S6FA 2ZECA 1E79D 1LPGB 1O2QA 4FUDA 3QK1A 1HUTH 1EZQA 2J38A 4FU8A 3TGKE 3ZVEA 1C5MD 1UTQA 1TGTA 2GCTC 5GPIB 2KM0A 4AYYB 1SLXB 5FHTA 1UMAH 4RSPA 1LHFH 1S5SA 1UCYE 3ZZ4A 3FN8A 1FN6A 1EJAA 2HLDD 1QBOA 2ZPQA 5EPNA 1AFQB 3K65B 1TNHA 1ZPBA 3S69A 1V2NT 1ZPZA 3BN9A 3RXFA 3RXAA 4LZ4B 2A4QA 1K1MA 3RXDA 2A5AA 5JPMH 1VR1H 1Y3UA 3RMLH 2PKSB 1LPZB 1W13U 2KX4A 2WPKS 1QB9A 2XYAA 4DCDA 1OPHB 2ZIQH 4CREA 3BTGE 1HV7A 2OC7A 3QZQA 4A5TS 3F0PA 1WDIA 5JDUB 1OP2A 4A6LA 1YC0A 4ISNA 1VCWA 1HGTH 1TQ7B 1A3BH 4FOUC 4UFDH 5AVDA 1LO6A 1HDTH 1N1LA 2BQWB 4IMQA 1TE0A 2XNDD 1SFIA 1MABB 3A82A 1SGPE 2FOGA 1GJCB 3LGYA 4UEHH 4F48B 1DUEA 2CK3D 1F7ZA 1O5EH 5DGJA 4H6TA 2Y6TA 2GZ7A 3VB6A 3C1KA 4RKOB 2BM2A 3DSGA 2ANWA 1SBWA 4LOYH 1CQQA 1E1RD 2QF0A 3BTQE 4K60A 1C5YB 2HOBA 3GCNA 4MPVA 3QWCH 1MQ6A 3S7HB 3A7VA 3URCA 4ZMAH 3P8FA 1EUFA 1C2JA 1QCPA 4ASHA 3I77A 1L4ZA 1XUFA 1GJ9B 4O03A 4BAHB 1FAKH 1MAXA 1FLEE 1HCGA 1W0YH 1HBTH 4K1EA 1XXDA 3UWJH 1OWHA 3MH7A 3PTBA 3DFLA 5HM2A 1NFXA 4WJG2 1A0HB 3O8RA 5GXPA 3KQDA 1OWIA 1QIXB 3VPKA 1Y3XA 2NU3E 1TQ0B 2CGAA 5BPEA 5TCCA 1JXPA 1TX8A 4IN2A 3UNQA 2F9UA 1ZTKA 3SOSA 3UUZA 5FX5A 1THPB 2A7CA 3LH3A 2H9TH 3S9CA 2GDDA 3GDUA 1IAUA 2QE7D 4X2XA 5FX6A 4I8HA 2PWXA 1F2SE 3TJVA 1GI0A 5E0HA 1AHTH 2G55A 3M7TA 1NRRH 3ZVCA 1GJAB 2PUQH 1LCYA 1F0RA 4X1NU 3K9XB 4YLQH 1D9IA 2KCPA 1ZSLA 3BIVH 3QZRA 1ELFA 2P8OC 1ELVA 1FY8E 1ACBE 4JZIA 3NWUA 1GI6A 2AIPA 2F9VA 1DANH 4B73A 3T62A 4GVUA 2XC0A 2FESH 4WXVA 2G00A 1KIGH 2GMTB 4AGKA 2QN5T 3KL6A 3TLOA 1YPEH 1Z8JB 2TIOA 1C4U2 1E1QD 1GJ7B 1PQ7A 3L33A 1F0SA 1EAUA 1GBDA 1OKXA 4BXSA 5C1UA 3ZVAA 1MCVA 2IPHA 1BUIA 3M3TA 4NA8A 1DDJA 3U8TH 3U9AH 1AD8H 2FIRH 1DXPA 1MU6B 3RUOA 2BOHB 1GBIA 4Y7AA 3RC4A 1O3CA 2AMQA 3UTUH 2BD4A 2FLBH 3OYPA 1HAZB 2ZGXH 3TGIE 2K8IA 1S82A 1Z1IA 4BXWA 2QIQA 1L2EA 3STJA 1O2HA 3ODDA 3RC5A 2NU2E 4I33A 4FUJA 1QL7A 1T31A 4Y0ZE 1GHWH 1SGEE 1KXAA 2VBCA 2BY8X 1O32A 3KQCA 5I46H 1VGCB 1F5RA 1XVOA 2QGRA 1O3DA 4DIIH 1SLVB 1ANBA 1AVWA 1YPLH 3FFGA 3WW7A 2VWMA 1GCDA 1XUGA 2BVSH 3A88A 1COWD 1TBZH 2A4RA 1O3FA 1SSXA 2A4OA 4M7GA 3Q00A 4DIHH 5JBTA 3M36A 4HGCA 3ZZCA 3RXHA 3SW2B 2A5KA 1MTSA 3SJIA 2C3SA 1EAIA 4X6MA 3EE0B 1AB9C 1LQDB 3PROA 1C1RA 4XBDA 1ZHPA 5AFZH 4ZKNU 2F91A 2AS9A 1T8NA 2QAAA 2BD8A 1GCTC 1TONA 2QF4A 1MUEB 2L74A 1V2OT 1IQGA 2XBYA 1SQTA 4Q7YA 4ZROA 5FAHA 2ZGHA 1TNJA 1C1UH 2W26A 3A85A 4NWKA 2ZDNA 1BQYA 2BVRH 1OSSA 2Y80A 3SGAE 3VB4A 4GCHF 4TWWA 3E0NB 4CBOA 3UWIA 3UAIC 2CMYA 1FNIA 1P3CA 3SV7A 1VZQH 5ESTE 2AGIX 2ZHWH 3PWBA 1GI8B 1GHAG 3EDXB 1W10U 3GS9A 3S7KB 3U28C 2BY9X 2FEQH 1ZMJA 3BTHE 5EXNA 1JRTA 1O2GH 2G4TA 1QR3E 1O3NA 2Q1JA 1H9IE 1TOCB 3SQEE 3R3GB 2THFB 4MPUA 2BY5X 2Z3CA 4OS7A 5DJ7A 2BB4A 1OWJA 1CGIE 2P93A 1LDTT 4Q4LA 3RU4E 2PV9B 2P16A 3ATMA 1G3CA 1RFNA 4AC9A 1BIOA 3AAVA 4JK6A 2XWBI 4BTTB 3Q3YA 3L6PA 1PYTD 5EPYA 1SOTA 3RM2H 3BEIB 4ESTE 2CF8H 1P2JA 2AH4X 2XOKD 2J34A 3TJUA 3V0XA 2CV3A 5T1VA 2STAE 5DN6D 2ZTYA 1UJ1A 1GVKB 2ZO3H 3LGIA 4F4OC 4ASUD 1O2NA 2VH0A 1SGYE 3DCLA 2WPIS 3SHCH 3GOVB 4YM9A 1BT7A 3ZZ8A 2OINA 2A31A 5A0BA 2W3IA 2D8WA 1GBHA 3ZV8A 2HNTC 3Q3KA 1GBJA 4O9VA 4XBBA 3BG4C 9LPRA 1QRZA 1NM6A 2O8UA 4RKJB 1IHTH 1EZSC 3RU4T 5H4IB 4INKA 2BDAA 2J95A 1W7XH 2TRMA 3ESTA 2CF9H 1K1IA 3PV4A 3SU0A 2PKSC 3VB7A 2IJOB 2NU1E 2ZP0H 4ZH8A 4NA9H 1SGNE 5C94A 1GHZA 1CA0C 4MNXA 3CP7A 1TAWA 8GCHF 1GGDB 2ZKSA 3P8OA 5DP4A 2ZEBA 2A1DB 2F9NA 2XC5A 3R0FA 3SU6A 1SGTA 2ZU1A 4JYTA 4NSYA 1T8LA 2AMDA 2P8OB 1C2MA 4MNVA 3RMOH 2STBE 3BV9B 1GHBG 1C1QA 4FUIA 4JZ1A 3QUMP 2NWNA 3T5FH 3MNCA 3HGPA 1GCTB 1TNLA 3OAAD 1UHBA 1P9UA 1W0KD 4D9QA 2ZC9H 3S9AA 1EXFA 3RXQA 3E16B 3ZZ9A 1LVYA 1HRTH 4XRNA 2BX4A 1BTUA 1MTVA 4KP0A 1WUNH 2F83A 2Z6BD 3SGQE 2XW9A 4TPIZ 1NBMD 4BAKB 4DVAU 3IWMA 3SJOA 4BNRA 3TJNA 4ZKOU 4TT3D 1GMHG 5HGGA 1W2KH 1GI5A 3F3BA 3QGJA 1Y5BT 3SBKA 1SGQE 4J1YA 2HPPH 1O3LA 2WV9A 4MLFB 2R0KA 5B6LA 1DLEA 1ZRKA 4U32A 1N8OC 1LVMA 2BTCE 1B7XB 1BTWA 4PROA 1QRWA 2F9BH 3TJOA 3TVJB 2A5IA 1OX1A 3M3VA 2J94A 1SKYE 2KAIB 1TRYA 3GY8A 1WXRA 1CT4E 2HNTE 1QY6A 2CJIA 4E7NA 1XKBC 1HIAA 4IC6A 1BRUP 2ZPRA 4P00A 3IG6B 2QA9E 4UE7H 4DG4A 1BTPA 2BDGA 4LK4A 2V35A 1QA7A 1C2GA 5CDFE 1GMDF 1YGCH 1C5UA 2BDBA 3LONA 1HJAC 1V2QT 1FX0B 5DG6A 3PB1E 4Y76A 3LGUA 4NGAH 1L1GA 5FCRA 3EA9A 1NO9H 1N6YA 1PPCE 2JIZD 1FPCH 1QRXA 1A2CH 2ZDAH 4KELA 3U1IB 4ZUHA 4JCNA 3SNEA 1RD3B 3SI4H 4AG1A 1MU8B 1TPOA 2OK5A 1SI5H 2B5TB 1FQ3A 1SGIB 2O8WA 5GCHF 2FMJA 3OTPA 4ABEA 2GT7A 5FPSA 1BJVA 1KTTB 4J2YB 2BD5A 8GCHG 1HB0B 3MQKC 4X6OA 1IQLA 1KXCA 2GP9B 2C8WB 2FP7B 4WMFA 1K2I1 3PYHA 4CRFA 1M9UA 2Y5GA 1EP5A 5L2YH 1W12U 2FPZA 3EAJA 4IMZA 2FX4A 1Z8IB 2JJ2D 4D7FA 2AGGX 1GBTA 3ZIAD 1UVUH 2R3YA 2W6JD 1MAYA 1MD7A 1AO5A 4TYDA 1C5WB 4Y8XA 3E8LA 1OYTH 2VVVA 3MNXA 1EP6A 2BLVA 4UONA 2VWOA 1GL0E 4Y7BA 1E0FD 2BOKA 2Z3DA 1ZLRA 3UQOA 2AGEX 3MYWA 3LJJA 1DPOA 1BJUA 1NN6A 5AHGH 4YLUA 1E34B 2OP9A 2BLOA 1MZDA 4BAQB 3C27B 3EA7A 3T25A 1MTWA 1BTHH 2H2ZA 2FI3E 1EPTC 4YT6H 3MU5A 3RXBA 3HGNA 3NUMA 2KCAA 1HAYB 1GG6B 2KFWA 1J8AA 1V2TT 1ETSH 4BTIB 2FS8A 3SU2A 2ZHEH 4P02A 4KKDA 1D3PB 1P2OA 2ODPA 5E8EH 1BTXA 1V2MT 3ITIA 1SB1H 4THNH 1O33A 4I32A 2A32A 5F03A 2SGQE 1YF4A 1PQ5A 1YCPM 4QT8C 1YLCA 1C1NA 1C5RA 1Z6EA 3ZZ5A 3DHKH 2J9NA 1YPKH 3OE7D 2W3KA 3DD2H 4AYVB 2UWPA 1SGRE 5C1XA 1AZ8A 4KTCA 2BMGB 3JZ1B 8ESTE 1ORFA 1DWDH 1TRNA 4X8SH 1D3DB 2WZQA 4DT4A 1O3GA 1SGCA 3V7TA 4CH8B 1YLDA 1W11U 4FVDA 4H6SB 3S0NA 2LNCA 1O2MA 4INHA 2BDIA 4Q7ZA 2OQ5A 3BG4B 3UR6A 3EA8A 2NU0E 4MDSA 4OS6A 1TRMA 1ELGA 1G3DA 2WPMS 3BF6H 4IBLH 1TPSA 2BD3A 1VCPA 3PO1C 4CR5A 3SNBA 4Y0YE 5HKKD 2FOAA 2J2UA 4OS4A 5FPTA 3BTFE 1QHRB 3AK5A 2D26C 1KLTA 1THSH 3N7DA 2RG3A 1BHXF 1VJAU 1EJNA 1YP9A 3HKJB 1JBUH 1LHEH 1AUTC 1GVZA 3KIDU 1TGNA 4JMYA 3NK8A 4H4FA 4NZQA 3RXOA 1TGSZ 3F9FA 1HJ8A 3A8CA 3U69H 3UNRA 1O35A 1BMMH 1ZMLA 1F0UA 1F5LA 4XFQA 1GBBA 1K1NA 3SN8A 1CSOE 1EZUC 4CRDA 3VB5A 1RTFB 3GYLB 3PLBA 4NZLA 1QA0A 5EU8A 3UY9A 5AF9H 4DW2U 2H5CA 1C5OH 4Y79A 3PLPA 2HLCA 2ZWLH 1W0JD 3L3TA 3RU4D 2SNVA 1C2LA 5L30H 4MNWA 1VITG 2ZFPH 3PV2A 4AN7A 1SHHB 2GMTC 3KNXA 1G9IE 3E1XB 5JBAS 1D4PB 4CHAB 2ZDKA 6LPRA 5LPRA 4CRGA 1C9TA 2Z94A 1O2UA 1PPFE 3BTDE 5JBCS 1N6XA 1NFYA 4X1SU 5A8ZA 1P10A 3E91A 4A92A 1CHGA 1QFKH 2ANKH 1CBWB 3OU0A 1GI9B 1GBKA 5ABWA 1UVSH 1MKWK 1MTUA 3OY5U 3RXRA 6CHAB 4B75A 5F8XA 1V2UT 1HXFH 1OOKB 5LGOA 4CBNA 2BXTH 1O2VA 1RRKA 1BA8B 1YLNA 2XBXA 1TNIA 1LKAA 1NC6A 2FTLE 1UW7A 2VWNA 4I8GA 4A1VA 2FYQA 4XD7D 2OC8A 3Q3XA 4HZHA 2VVCA 2LP6A 1AU8A 4K8BA 1AKSB 2ZG0H 1SGFA 1J16A 1QJ7B 3FZZA 2FM2A 4IN1A 4Y8ZA 1DLKB 5L2ZH 2ALVA 4FUGA 1UK3A 2GV6A 5CHAB 5IYTA 2PFEA 3RXCA 1A7SA 3P95A 1XVMA 1GJBB 2PHBA 1SOZA 4X2WA 1LKBA 2BDHA 2GGVB 2XXLA 1KY9A 4B74A 6GCHF 1BBRK 1BMNH 2UWLA 4WH8A 3GY7A 3GCTF 4ABAA 2IN2A 2O8LA 2BY7X 2K1QA 7ESTE 1BCUH 2WINI 3CNRA 3QO6A 2ZCKP 2AIQA 1DXWA 1GPZA 1O5AB 1O2PA 1IOEA 2B7DH 2FZZA 1MCTA 4U01A 3BEUA 2BD7A 1QGFA 1ZGIA 4I8KA 1O3BA 3ZVDA 1WTGH 2H9EH 2JH6D 4ZHMU 1AY6H 3A8AA 3RXGA 1P2QA 1BMFD 2A0QB 3A83A 4Q7XA 1RIWB 4B2BA 1DICA 1HLTH 3SU5A 3SV8A 1NS3A 3MH6A 3RM0H 5TCAA 1P01A 1C4V2 5T6DA 1ID5H 1SGFG 3SUEA 1P0SH 1O2IA 4ISHH 2ZU5A 2KCOA 2WYJA 3MFJA 4X6PA 2BZAA 1ZPCA 1O37A 1O3OA 2VWLA 1G3EA 1ZR0A 2WHXA 2XTTB 3QLPH 1GI1A 3RXTA 1H4WA 1L1JA 5LH8A 1NESE 3K6YA 4X6NA 3TNSA 2P95A 2F9PA 1O34A 1GDUA 3NKKA 2BQ6B 1JWTA 1AWHB 2CHAB 1EPTA 1PPHE 4K1TA 2PP6A 2BDYA 2IPQX 1ESAA 1O5CB 2GT8A 1RGQA 3AW0A 4ISIH 4YO9A 4A1TA 3TGJE 3O8CA 4WVPE 3Q77A 2ZCLP 4GHTA 1C2EA 4UFEH 1ELEE 1QQ4A 2GCHG 3SQHE 1EOJA 1N8OB 1XUKA 1TX7A 2JJ1D 2R2WU 1HXEH 1C1TA 1C9PA 1DSUA 4OS2A 1A4WH 2QF5A 4B2AA 1EJMA 3T2NA 2B9LA 1QZ8A 5EXLA 1NY22 4ABJA 2YMSB 3EE7A 1UHBB 4F55A 2UWOA 1XUHA 3UOPA 1YY3A 1C5VA 2W7SA 1FY1A 3GY3A 1S84A 1BHXB 4X1QU 2FTMA 1HAIH 1SQAA 1IQFA 4U2WA 2FYRA 4MQAA 4D8NA 3Q76A 1YPGH 2ZQ1A 2RA3A 1WYKA 2YMSC 1GBEA 1AKSA 4NFFA 1L4DA 3TITA 5B6OA 5EIYA 3SJ8A 1NBME 5FPYA 1VCQA 2Z9JA 2C8XB 4NIVA 3SV6A 3PMHB 4XDEA 1HYLA 4BANB 1UTMA 2SFAA 2FODA 2GCHF 1EX3A 1WOFA 4ISOA 1VGCC 2HRVA 1ESTA 4AOQA 1C1PA 5BRRE 2BLQA 3RXUA 1IQEA 1CGJE 1MD8A 1XUJA 2BDCA 3M37A 3UR9A 4ZXYH 1YKTA 1F92A 1K1PA 1HNEE 2YOLA 2DE8A 1HJ9A 3QDZB 1EQ9A 1UK2A 1H8ED 2EI6A 2JETC 3KYGA 2JH0D 2GZ8A 1Y8TA 3I78A 3SUGA 1QBNA 1GJ6A 1JMOH 3LPRA 4I8LA 3SNAA 2M2AA 2QYIA 3PWCA 1V2JT 1UCYK 3A87A 4B71A 2BVXH 3B9FH 4VGCB 4FUHA 1Z7KA 3MHWU 3STIA 1V6DA 1ANCA 4AGJA 2I6QA 5LPFA 1HJAB 4WF8A 1D3QB 4O3UA 2ZU4A 1DITH 1V2RT 2FS9A 1O5DH 1LTOA 1YCPH 4ACAA 1W3CA 3RXPA 2OQUA 1MZAA 1CE5A 1QB6A 2PLXA 3RXKA 3OTJE 1P05A 3M5OA 2J98A 2VIWA 5DP3A 1IHSH 4IC5A 2V3OH 4GPGA 1A46H 4ABIA 1KTSB 2PGBB 2LPRA 1RIWC 1O3JA 5A0AE 2J98B 2VIVA 4X2VA 1YPMH 4FUBA 3KN2A 5T3HA 2FWWA 1GI4A 3BG8A 4GCHG 1SQOA 4YOJA 5HYOA 4ACBA 3MU8A 2V3HH 1FDPA 1V2WT 1O2WA 1SPJA 3EGKH 2ZGBH 1UTNA 2J92A 7GCHF 3CS7A 1K22H 2F9OA 2J4IA 1C5XB 2HWLB 1INCA 1YPJH 5F6MA 3SORA 1V2LT 3I29A 1OWEA 2ESTE 1WU1A 3U1JB 3T29A 1KXBA 1G36A 3FVFB 1GDNA 1C2KA 1E37B 2ZI2H 2ILNA 3OFND 1C1MA 4XOJA 1S0QA 2A2XH 2GX4A 5HMAA 2PTCE 4NA7A 1E35B 4DURA 4X8UH 5CHAC 3G01A 2CN0H 1J17T 3ATLA 3URDA 1MBQA 4TWYA 4NIWA 4X8VH 4DJZB 1OHHD 2VIOA 4R8TB 1NFWA 3TK9A 1NTPA 4SGAE 4AG2A 1ABJH 1ARBA 4AFUA 4CHAC 1GJDB 2XC4A 5ETXA 2ZDVH 2Z3EA 3FZDA 1F0TA 4OGYA 1A1RA 3M3SA 3OSYA 5E0GA 2ZGCA 3M7QA 3GDSA 3W1EA 1NU9A 4GSOA 1D6WA 2VGCB 1QQUA 4OS5A 1GJ5H 4ZAEA 2ZDLA 3SJKA 1GGDC 3VFEA 3ATIA 2Q6GA 1K28D 1P3EA 1Y59T 4NIXA 1MKXK 3H09A 4JYUH 3V13A 6GCHG 5L6NH 5GDSH 3BEFB 3F6UH 3EYDA 3B8JA 1C2DA 3AW1A 1YBWA 2JDID 3GY5A 2OXSA 5A8YA 1WAYB 2ZFTA 4B1TA 5C67A 1J14A 4WXIA 1P11E 2VIDA 1YYY1 1C1SA 3BTEE 2VIPA 1BBRH 1H8IH 1ZTJA 2ANMH 2FDAA 3TU7H 2RFKC 1THRH 4F49A 4UFGH 1TB6H 3PM3A 3TH2H 4XBCA 1UVPA 2G52A 1TGBA 1H9HE 2LELA 1Y3VA 3SUFA 3UQVA 3QX5H 1EFRD 2P3UB 3GDVA 4AB8A 4GUXA 1HAPH 1GMCG 3RXJA 1LMWB 1OP0A 1H8HD 5J4QA 1V2VT 1LHDH 2WUCA 3ELAH 3MH4A 1J15A 1SGDE 2H9HA 3SU3A 2PR3A 4NCYA 1G3BA 1V2KT 3UFAA 4NWLA 5EJ1A 5C5NA 5C0TA 4FU9A 2GKVE 3T26A 1C2FA 5EG4A 3MMGA 1P03A 4O3TA 4VGCC 1Z8RA 3A8DA 2XNIA 4BTUB 1O3IA 3PO1B 2FLRH 1T8MA 1TA6A 3RXSA 2EC9H 2EQNA 1GDQA 3FO8D 2F43B 2AERH 1BB0B 2ZFSA 1SLWB 1UO6A 2Y5HA 4Y8YA 1PPEE 1Z6JH 1AE5A 1EKBB 1SVPA 2J5UA 2QCYA 3F2GA 4X2YA 4CRAA 1CO7E 1AI8H 1AN1E 1OYQA 4A1XA 1AWFH 1DS2E 4X1PU 4Q2KA 5J4SA 4YTAA 1NRPH 1P04A 3ZZ7A 1MKXH 2R9PA 5K7RA 1C5LH 1G2LA 5DP6A 4UDWH 2EEKA 2ODQA 1TPAE 8KME2 4ISLA 1GHVH 1V2PT 4GHQA 1RS0A 3RXIA 1SR5C 2C8ZB 2FXRA 1C1OA 1CVWH 2A4GA 1AIXH 2UUYA 4GAWA 3SYJA 3U8OH 1TBQH 2FOFA 2W6ID 5CHBA 4AFSA 3SGBE 1BMLA 1GI2A 3JZ2B 1PPBH 2TGTA 5EQRA 2QY0B 4NG9H 4ZCNA 3PMAB 4FXGH 2YNBA 3LH1A 3DSPA 2QXIA 5CE1A 9ESTA 3RXEA 3LKWA 3V3MA 2B8OH 1VKYA 3MO3A 1AB9B 3M61U 1IQNA 1KXEA 4FUEA 3LC3A 3SI3H 1QTFA 3HK3B 2K0QA 5C20A 1TLDA 3H7TA 5AFYH 3HPTB 3K2UA 4E05H 1WV7H 1GBLA 3RC6A 1ZYOA 4B2CA 1ZGVA 5E2PA 3LIWA 4FU7A 1TGCA 5G4BA 1QJ6B 2HVYB 3BIUH 3LDXH 2O8TA 3IITA 2L6OA 2FX6A 1TIOA 3OEHD 2HALA 2WPDD 1ZRBA 1C4Y2 2V3MA 3UIRA 1CT2E 2BD9A 2R0LA 2DUCA 3DT0H 1TX6A 2OD3B 1P09A 3AASA 1A5IA 1Y5AT 3LJOA 5DP8A 1MMJN 3W95A 4DT7B 1ANEA 3S9BA 1XUIA 1XX9A 5FXLA 1UTJA 1DWEH 2HPQH 2ZQ2A 3HK6B 1O2YA 3SV9A 3M5MA 3QTOH 2EI8A 2ULLA 2O8MA 1Z8GA 2GD4B 1ANDA 2QXJA 4DOQA 4HTCH 4K5ZA 1DY9A 3A80A 1LHGH 1S6LA 3LU9B 2HGTH 3H5CB 5LPEA 3TK6A 5DSFA 1AFQC 5C2ZA 1GMCF 4HI3A 3TH3H 3MO6A 2IJD1 1EB2A 1O2RA 1GMDG 1DWBH 1H9LB 3M5NA 1ZSJA 1G37A 3A7WA 3ZZBA 2XCFA 1IQHA 4JZFH 3GY4A 4E7RG 3PTNA 5HIZA 1ELBA 3F0OA 4AFQA 4RT0A 3SNDA 2DE9A 3KQBA 1FI8A 1KXDA 4ZXXH 3SO3A 2O9QA 2WPLS 1BITA 3CENA 3D49H 3PMJA 3DSOA 4KTSA 2ZNKH 5DK1A 3A84A 3O8DA 3F9GA 4K1SA 4Y10E 3ZVGA 2GCTB 3M5LA 1GBMA 3MU4A 3VEQB 1LVBA 4OM9A 3UOUA 3VGCB 3NPSA 1W8BH 4AFZA 1HIAB 2F4LA 1SLUB 2ZZUH 1ELCA 1T32A 4H42U 3ZVBA 1O3HA 1GBCA 1GMHF 5C3NA 2P3FH 1JIRA 2OBOA 2GV7A 2VGCC 2ZHFH 1TNGA 1ELAA 1FV9A 2EI7A 1C1VH 4ZHAA 3D62A 4AZ2B 4DY7B 1KLJH 1KXFA 1O38A 2JKHA 2XCNA 2Y5FA 1GG6C 1ZOMA 7GCHG 1KMHB 1OWDA 1Y5UT 3SV2H 2OTVA 1HAVB 3T28A 3A89A 2ZFFH 3ATWA 1PPGE 4BAMB 2OLGA 3DFJA 1H1BA 2Z9IA 3D23A 1AZZA 1G30B 5ESBA 4FUCA 3FANA 4I86A 2ODYB 1FY3A 3MTYA 1FZZA 1ETRH 4DGJA 2FOEA 4K8YA 1UVTH 1P2NA 4TY6A 3VXEH 4FVBA 2RDEA 2FOHA 6ESTA 1EATA 2FOBA 2ZTXA 3MOCA 2ANYA 5EJLA 3P70B 1S6HA 1O2ZA 1C1WH 4WY3A 2B0FA 1PPZA 1PJPA 1C5ZB 1SFQB 3D65E 1CBWC 1PYTC 3FP8E 3LGTA 4ABHA 3RXVA 2ALPA 1TYNA 2AHME 1MKWH 5DP5A 1O2LA 1TMBH 2ZU3A 1MTNC 5KGOA 3MH5A 5F53A 5T6FA 2WV4A 1OWKA 4CR9A 3ZVFA 2YNAA 3SU4A 3T27A 1TMTH 2XRCA 1LPKB 1ZHMA 2A45B 5PTPA 2Z7FE 2A2QH 4LZ1H 4XSKU 4HG6A 1CHOF 1CU1A 4X8TH 5IK2D 4FETA 1P2IA 1UTOA 1TA2A 5GWZA 4MVNA 1HAXB 2J97A 4TSFD 3H7OA 2GTBA 2BX3A 3BTKE 3TH4H 1Z1JA 1AVGH 4JZEH 1ZJKA 2C93B 2BZ6H 2TGAA 4B76A 1GBAA 1F5KU 3MNBA 3KCGH 3NXPA 2ZU2A 1IQJA 1FIWA 1BDAA 1FAXA 2JETB 3A81A 1ZMNA 3KQEA 3SUDA 3M35A 5E0JA 1WSSH 3RLWH 2QF3A 1JRSA 3P92A 2EY4C 4MG3A 5SGAE 1GHAF 3LT3A 4BOHA 3ATKA 1BRBE 3ZV9A 2WPJS 1Q3XA 1DT2A 5JB8S 2IOTA 4MPXA 4Z1MD 1L0ZA 2PW8H 1EAWA 2XBWA 3F9EA 4OS1A 1SQRA 1U6QA 1A0JA 2G51A 2ZPSA 3U8RH 1DVAH 5FBIA 1FY5A 1O2SA 4RI0A 4D9RA 3P8GA 3MWIU 3LOXA 3FP6E 2BY6X 1FY4A 1XXFA 2A7HA 3TIUA 3VG8A 1O3PB 1RTKA 1YPHC 3RXMA 1P9SA 5EOKA 5EW1H 1DY8A 2FI5E 4KTUA 3FAOA 5EODA 4RN6A 1YWUA 1EASA 3UNSA 1DFPA 2G4UA 1AQ7A 2RDLA 2V0BA 1C5QA 1O2KA 1CA0B 3LGWA 1P2KA 1MH0A 3AVZA 4IW4E 1EPTB 1CHOG 2WSSD 4JK5A 2SGEE 1V3XA 1HAOH 2H1UA 1EAXA 3WY8A 5C17A 2G5NA 1J9CH 4M9FA 2C8YB 1A3EH 1FMGA 2BLWA 3UB0A 4CRCA 1D6RA 2TGPZ 1W14U 1G32B 3MI4A 4IGDA 1YM0A 1SHYA 2VH6A 1TMUH 3BSQA 4ABDA 1K9OE 3VGCC 5KEDA 3GY2A 1WBGB 3NZIA 4WMEA 2BXUH 3E3TA 2WV5A 1NU7B 2PTNA 3GCTG 2V7QD 4FUFA 1GI3A 4K3JA 1LQEA 2AMPA 1GI7B 4AB9A 1P06A 2V6NA 1DX5M 3KEEA 4WH6A 2CXVA 2GDEH 2GVFA 1P57B 1AMHA 1AFEH 2H6MA 2VB0A 1ELTA 1NRSH 3QTVH 3A7TA 3BTME 5E2OA 3NCLA 1P2MA 1XMNB 2A7JA 2ASUB 1A61H 3A7ZA 2OUAA 3RP2A 1QNJA 2FI4E 3M7UA 2JH5D 1RJXB 2Q6DA 2WPHS 4GLYA 2ZHQH 4CRBA 1C5PA 1V2ST 1QL9A 1CA8B 1A5HA 1EZXC 1NROH 5JBBS 1TFXA 3PLKA 3GISB 7KMEH 2D2DA 4I31A 1W7GH 1HFDA 1EB1H 1HPGA 2WYGA 2C90B 2Y7XA 5HM9A 1O5GH 5DKMA 2XWAA 1KSNA 3GCOA 1SL3A 1C2IA 4X0WU 1NRQH 2QC2A 1B5GH 1ZSKA 1FPHH 4Z6AH 5GJ4B 3LGVA 4NFEA 1Y3YA 2VVUA 3FKSD 4JZDH 1K0HA 2OBQA 4YOIA 4OGXA 3EQ0H 1VJ9U 5HXFA 3F9HA 3DA9B 5A2MH 1GHYH
chains in the Genus database with same CATH topology
4WWYA 1JIMA 3SZNA 4KGAA 3KGPA 3GICB 1TPPA 2Y82A 2F3CE 2OC0A 1K1LA 1WTHD 3OX7U 1DM4B 2PSXA 1UVOA 2RCEA 4D7GA 3VB3A 2M5TA 2PKAA 5I25A 1ETTH 1S0RA 4CH2B 1Z71A 2G81E 4Y11E 5C5OA 3AAUA 3ZZ6A 1IQMA 1GHXH 1WCZA 3E90B 4IS5A 2ZTZA 2H5DA 1O3KA 1K1OA 4BAOB 3BTTE 1HAHH 1QJ1B 2NU4E 2OCVB 4Z0KA 4TPYA 1C5SA 2SGAA 1O5BB 3RMMH 1QURH 1NRNH 4ZKRU 1AE8H 1NZQH 1SC8U 1O3AA 1P02A 2TPIZ 1NFUA 1O2JA 3BTWE 1OXGA 2EA3A 3K6ZA 4U30A 1MQ5A 3E6PH 1TWXB 2UUKB 4INLA 1T4UH 2UUFB 1BTZA 1O3MA 1TABE 3ODFA 4JYVH 1RTLA 1ELDE 3GYMA 1HAVA 2ZDMA 1MTNB 2PGQB 2ZFQH 1ARCA 2FOMB 4ABGA 3ENSB 2BYAX 2SGPE 2CHAC 4X1RU 1GJ8B 3UPEA 7LPRA 2ZCHP 1AVXA 3ZZAA 5EGMA 1W0ZU 1C2HA 5T6GA 2Q6FA 3GCHC 3LC5A 1KDQA 1BZXE 2FO9A 2BQ7B 4WMDA 1ZTLA 4MPWA 2Y7ZA 3F1SB 2ZFRH 1PFXC 2TBSA 2ZF0H 1IQKA 5DP9A 1DWCH 3SJ9A 1B0EA 1CGHA 4LXBH 5EQSA 1GWAA 3W94A 2BD2A 5DPAA 4SGBE 2AFQB 2ZGJA 4ABBA 4NSVA 3A8BA 1O36A 3MNSA 2W7UA 1NT1A 2TGDA 1ZJDA 2BHGA 1MBMA 3KF2A 4MTBA 1VITF 2AYWA 2HNTF 1K21H 1EOLA 4AX9H 1TNKA 1C5TA 1UTKA 2VU8E 1S85A 1HAGE 3O8BA 1FXYA 5GIBA 1O30A 1DOJA 4YOGA 1LHCH 1BMAA 1QBVH 1SMFE 2VINA 1X7AC 5EXMA 4K69A 4I7YH 2RA0A 2XBVA 1UK4A 5C1YA 3MU0A 1SG8B 3F68H 1GVLA 1AGJA 3A86A 2P3TB 1E36B 2W5EA 1YPHE 1G2MA 1ESBA 1L1NA 2P59A 2ZA5A 3MU1A 4HFPB 5IDKA 3E0PB 1O3EA 3CS0A 5DP7A 1FIZA 4D76A 1BBRE 2VJ1A 1QB1A 3QN7A 1XM1A 2FOCA 5TJXA 2VNTA 1Y3WA 5FCKA 3HATH 4ZKSU 1TALA 1O0DH 1FJSA 3P17H 1WQVH 5A8XA 5EW2H 1IQIA 1C5NH 2GZ9A 2QV1A 5GCHG 1UCYH 1P8VC 1BRCE 1CT0E 1DSTA 1O31A 1PQAA 1GJ4H 5CMXH 1E38B 2HVXA 2Z9GA 4YT7H 1WQSA 5F8ZA 4E06H 2PUXB 1Q31A 1PQ8A 5FBEA 3TPIZ 2G5VA 2I6SA 3GCHB 1AUJA 1BRAA 1OS8A 1DUAA 1O5FH 1T4VH 1H8DH 2G8TA 3RLYH 1LVOA 1B0FA 3DUXH 1O2XA 1TBRH 4K2YA 3RDZA 1A0LA 1S81A 4R0IA 3B23B 2D1JA 1BTYA 1KLIH 5JB9S 4Q80A 4TY7A 4I8JA 1FONA 3P6ZB 1UTLM 1VITH 1O2TA 4XE4A 1GBFA 1TOMH 1YCPK 4AORA 2UUJB 1A5GH 1Q2WA 2C4FH 3ZZ3A 1KDQB 1UTPA 3SNCA 3SHAH 1S83A 1P12E 2P94A 3HKIB 1ZZZA 1JOUB 5JYIA 3U98H 3ZYDA 3ZZDA 2OC1A 4NIYA 2QXGA 1GL1A 3N7OA 3A7YA 3PMBB 8LPRA 1ZHRA 1QL8A 2R2MB 2Y81A 4ZHLU 2WUBA 3A7XA 3MO9A 2SNWA 2PKAB 4ABFA 3TNTA 2VIQA 3P8NA 3RXLA 2SGDE 3OY6U 3UREA 2AEIH 3KHVA 3RMNH 1O2OA 1T7CA 1XKAC 4YESB 1GHBF 3VXFH 3QGNB 1D3TB 4UFFH 1O39A 4UD9H 4Y6DA 3SU1A 5F8TA 3TK5A 1OP8A 2ZHDA 1DE7H 3FP7E 4O97A 5K0HA 1NPMA 1ABIH 4Y71A 1BOQA 5DO4H 1RXPA 5A0CA 2Z9KA 5A09A 6CHAC 2R3UA 2SGFE 1FUJA 3ZYEA 4A7IB 1FN8A 4MNYA 1K1JA 2KAIA 2Z9LA 4YZUA 5EQQA 3V12A 3GY6A 2PSYA 1T8OA 2QXHA 1KYNA 1S6FA 2ZECA 1O2QA 1LPGB 4FUDA 1HUTH 3QK1A 1EZQA 2J38A 4FU8A 3TGKE 3ZVEA 1C5MD 1UTQA 1TGTA 2GCTC 5GPIB 4AYYB 1SLXB 5FHTA 1UMAH 4RSPA 1LHFH 1S5SA 1UCYE 3ZZ4A 1FN6A 1EJAA 1QBOA 2ZPQA 5EPNA 1AFQB 3K65B 1TNHA 1ZPBA 3S69A 1V2NT 1ZPZA 3BN9A 3RXFA 3RXAA 4LZ4B 2A4QA 1K1MA 3RXDA 2A5AA 5JPMH 1VR1H 1Y3UA 3RMLH 2PKSB 1LPZB 1W13U 2WPKS 1QB9A 2XYAA 4DCDA 1OPHB 2ZIQH 4CREA 3BTGE 1HV7A 2OC7A 3QZQA 4A5TS 5JDUB 1OP2A 4A6LA 1YC0A 4ISNA 1VCWA 1HGTH 1TQ7B 1A3BH 4UFDH 5AVDA 1LO6A 1HDTH 1N1LA 2BQWB 4IMQA 1TE0A 1SFIA 3A82A 1SGPE 2FOGA 1GJCB 3LGYA 4UEHH 1DUEA 1F7ZA 1O5EH 5DGJA 4H6TA 2Y6TA 2GZ7A 3VB6A 3C1KA 4RKOB 2BM2A 2ANWA 1SBWA 4LOYH 1CQQA 2QF0A 3BTQE 4K60A 1C5YB 2HOBA 3GCNA 4MPVA 3QWCH 1MQ6A 3S7HB 3A7VA 3URCA 4ZMAH 3P8FA 1EUFA 1C2JA 1QCPA 4ASHA 3I77A 1L4ZA 1XUFA 1GJ9B 4O03A 4BAHB 1FAKH 1MAXA 1FLEE 1HCGA 1W0YH 1HBTH 4K1EA 1XXDA 3UWJH 1OWHA 3MH7A 3PTBA 3DFLA 5HM2A 1NFXA 4WJG2 1A0HB 3O8RA 5GXPA 3KQDA 1OWIA 1QIXB 3VPKA 1Y3XA 2NU3E 1TQ0B 2CGAA 5BPEA 5TCCA 1JXPA 1TX8A 4IN2A 3UNQA 2F9UA 1ZTKA 3SOSA 3UUZA 5FX5A 1THPB 2A7CA 3LH3A 2H9TH 3S9CA 2GDDA 3GDUA 1IAUA 4X2XA 5FX6A 4I8HA 2PWXA 1F2SE 3TJVA 1GI0A 5E0HA 1AHTH 2G55A 3M7TA 1NRRH 3ZVCA 1GJAB 2PUQH 1LCYA 1F0RA 4X1NU 3K9XB 4YLQH 1D9IA 1ZSLA 3BIVH 3QZRA 1ELFA 2P8OC 1ELVA 1FY8E 1ACBE 4JZIA 3NWUA 1GI6A 2AIPA 2F9VA 1DANH 4B73A 3T62A 4GVUA 2XC0A 2FESH 4WXVA 2G00A 1KIGH 2GMTB 4AGKA 2QN5T 3KL6A 3TLOA 1YPEH 1Z8JB 2TIOA 1C4U2 1GJ7B 1PQ7A 3L33A 1F0SA 1EAUA 1GBDA 1OKXA 4BXSA 5C1UA 3ZVAA 1MCVA 2IPHA 1BUIA 3M3TA 4NA8A 1DDJA 3U8TH 3U9AH 1AD8H 2FIRH 1DXPA 1MU6B 3RUOA 2BOHB 1GBIA 4Y7AA 3RC4A 1O3CA 2AMQA 3UTUH 2BD4A 2FLBH 3OYPA 1HAZB 2ZGXH 3TGIE 1S82A 1Z1IA 4BXWA 2QIQA 1L2EA 3STJA 1O2HA 3ODDA 3RC5A 2NU2E 4I33A 4FUJA 1QL7A 1T31A 4Y0ZE 1GHWH 1SGEE 1KXAA 2BY8X 1O32A 3KQCA 5I46H 1VGCB 1F5RA 1XVOA 2QGRA 1O3DA 4DIIH 1SLVB 1ANBA 1AVWA 1YPLH 3FFGA 2VWMA 1GCDA 1XUGA 2BVSH 3A88A 1TBZH 2A4RA 1O3FA 1SSXA 2A4OA 4M7GA 3Q00A 4DIHH 5JBTA 3M36A 4HGCA 3ZZCA 3RXHA 3SW2B 2A5KA 1MTSA 3SJIA 2C3SA 1EAIA 4X6MA 3EE0B 1AB9C 1LQDB 3PROA 1C1RA 4XBDA 1ZHPA 5AFZH 4ZKNU 2F91A 2AS9A 1T8NA 2QAAA 2BD8A 1GCTC 1TONA 1MUEB 1V2OT 1IQGA 2XBYA 1SQTA 4Q7YA 4ZROA 5FAHA 2ZGHA 1TNJA 1C1UH 2W26A 3A85A 4NWKA 2ZDNA 1BQYA 2BVRH 1OSSA 2Y80A 3SGAE 3VB4A 4GCHF 4TWWA 3E0NB 4CBOA 3UWIA 2CMYA 1FNIA 1P3CA 3SV7A 1VZQH 5ESTE 2AGIX 2ZHWH 3PWBA 1GI8B 1GHAG 3EDXB 1W10U 3S7KB 2BY9X 2FEQH 1ZMJA 3BTHE 5EXNA 1JRTA 1O2GH 2G4TA 1QR3E 1O3NA 2Q1JA 1H9IE 1TOCB 3SQEE 3R3GB 2THFB 4MPUA 2BY5X 2Z3CA 4OS7A 5DJ7A 2BB4A 1OWJA 1CGIE 2P93A 1LDTT 3RU4E 2PV9B 2P16A 3ATMA 1G3CA 1RFNA 1BIOA 3AAVA 4JK6A 2XWBI 4BTTB 3Q3YA 3L6PA 1PYTD 5EPYA 1SOTA 3RM2H 3BEIB 4ESTE 2CF8H 1P2JA 2AH4X 2J34A 3TJUA 3V0XA 2CV3A 2STAE 2ZTYA 1UJ1A 1GVKB 2ZO3H 3LGIA 4F4OC 1O2NA 2VH0A 1SGYE 2WPIS 3SHCH 3GOVB 4YM9A 1BT7A 3ZZ8A 2OINA 2A31A 5A0BA 2W3IA 2D8WA 1GBHA 3ZV8A 2HNTC 3Q3KA 1GBJA 4O9VA 4XBBA 3BG4C 9LPRA 1QRZA 1NM6A 2O8UA 4RKJB 1IHTH 1EZSC 3RU4T 5H4IB 4INKA 2BDAA 2J95A 1W7XH 2TRMA 3ESTA 2CF9H 1K1IA 3PV4A 3SU0A 2PKSC 3VB7A 2IJOB 2NU1E 2ZP0H 4ZH8A 4NA9H 1SGNE 1GHZA 1CA0C 4MNXA 3CP7A 1TAWA 8GCHF 1GGDB 2ZKSA 3P8OA 5DP4A 2ZEBA 2A1DB 2F9NA 2XC5A 3R0FA 3SU6A 1SGTA 2ZU1A 4JYTA 4NSYA 1T8LA 2AMDA 2P8OB 1C2MA 4MNVA 3RMOH 2STBE 3BV9B 1GHBG 1C1QA 4FUIA 4JZ1A 3QUMP 2NWNA 3T5FH 3MNCA 3HGPA 1GCTB 1TNLA 1UHBA 1P9UA 4D9QA 2ZC9H 3S9AA 1EXFA 3RXQA 3E16B 3ZZ9A 1LVYA 1HRTH 2BX4A 1BTUA 1MTVA 4KP0A 1WUNH 2F83A 2Z6BD 3SGQE 2XW9A 4TPIZ 4BAKB 4DVAU 3IWMA 3SJOA 4BNRA 3TJNA 4ZKOU 1GMHG 5HGGA 1W2KH 1GI5A 3QGJA 1Y5BT 3SBKA 1SGQE 4J1YA 2HPPH 1O3LA 4MLFB 2R0KA 1DLEA 1ZRKA 4U32A 1N8OC 1LVMA 2BTCE 1B7XB 1BTWA 4PROA 1QRWA 2F9BH 3TJOA 3TVJB 2A5IA 1OX1A 3M3VA 2J94A 2KAIB 1TRYA 3GY8A 1CT4E 2HNTE 1QY6A 2CJIA 4E7NA 1XKBC 1HIAA 4IC6A 1BRUP 2ZPRA 4DG4A 3IG6B 2QA9E 4UE7H 1BTPA 2BDGA 4LK4A 2V35A 1QA7A 1C2GA 1GMDF 1YGCH 1C5UA 2BDBA 3LONA 1HJAC 1V2QT 5DG6A 3PB1E 4Y76A 3LGUA 4NGAH 1L1GA 5FCRA 3EA9A 1NO9H 1N6YA 1PPCE 1FPCH 1QRXA 1A2CH 2ZDAH 4KELA 3U1IB 4ZUHA 4JCNA 3SNEA 1RD3B 3SI4H 4AG1A 1MU8B 1TPOA 1SI5H 2B5TB 1FQ3A 1SGIB 2O8WA 5GCHF 2FMJA 4ABEA 2GT7A 5FPSA 1BJVA 1KTTB 4J2YB 2BD5A 8GCHG 1HB0B 4X6OA 1IQLA 1KXCA 2GP9B 2C8WB 2FP7B 4WMFA 1K2I1 3PYHA 4CRFA 1M9UA 2Y5GA 1EP5A 5L2YH 1W12U 2FPZA 3EAJA 4IMZA 2FX4A 1Z8IB 4D7FA 2AGGX 1GBTA 1UVUH 2R3YA 1MAYA 1MD7A 1AO5A 4TYDA 1C5WB 4Y8XA 3E8LA 1OYTH 2VVVA 3MNXA 1EP6A 2BLVA 4UONA 2VWOA 1GL0E 4Y7BA 1E0FD 2BOKA 2Z3DA 1ZLRA 3UQOA 2AGEX 3MYWA 3LJJA 1DPOA 1BJUA 1NN6A 5AHGH 4YLUA 1E34B 2OP9A 2BLOA 1MZDA 4BAQB 3C27B 3EA7A 3T25A 1MTWA 1BTHH 2H2ZA 2FI3E 1EPTC 4YT6H 3MU5A 3RXBA 3HGNA 3NUMA 1HAYB 1GG6B 1J8AA 1V2TT 1ETSH 4BTIB 2FS8A 3SU2A 2ZHEH 4KKDA 1D3PB 1P2OA 2ODPA 5E8EH 1BTXA 1V2MT 3ITIA 1SB1H 4THNH 1O33A 4I32A 2A32A 5F03A 2SGQE 1YF4A 1PQ5A 1YCPM 4QT8C 1YLCA 1C1NA 1C5RA 1Z6EA 3ZZ5A 3DHKH 2J9NA 1YPKH 2W3KA 3DD2H 4AYVB 2UWPA 1SGRE 5C1XA 1AZ8A 4KTCA 2BMGB 3JZ1B 8ESTE 1ORFA 1DWDH 1TRNA 4X8SH 1D3DB 1O3GA 1SGCA 3V7TA 4CH8B 1YLDA 1W11U 4FVDA 4H6SB 3S0NA 2LNCA 1O2MA 4INHA 2BDIA 4Q7ZA 2OQ5A 3BG4B 3UR6A 3EA8A 2NU0E 4MDSA 4OS6A 1TRMA 1ELGA 1G3DA 2WPMS 3BF6H 4IBLH 1TPSA 2BD3A 1VCPA 3PO1C 4CR5A 3SNBA 4Y0YE 2FOAA 2J2UA 4OS4A 5FPTA 3BTFE 1QHRB 2D26C 1KLTA 1THSH 2RG3A 1BHXF 1VJAU 1EJNA 1YP9A 3HKJB 1JBUH 1LHEH 1AUTC 1GVZA 3KIDU 1TGNA 4JMYA 3NK8A 4H4FA 4NZQA 3RXOA 1TGSZ 3F9FA 1HJ8A 3A8CA 3U69H 3UNRA 1O35A 1BMMH 1ZMLA 1F0UA 1F5LA 4XFQA 1GBBA 1K1NA 3SN8A 1CSOE 1EZUC 4CRDA 3VB5A 1RTFB 3GYLB 3PLBA 4NZLA 1QA0A 5EU8A 3UY9A 5AF9H 4DW2U