2ZCKP

Crystal structure of a ternary complex between psa, a substrat-acyl intermediate and an activating antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
237
structure length
237
Chain Sequence
b'IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zckP01
1MCVA 4UFFH 4BAKB 2BVXH 3I78A 3NPSA 2P93A 3UOPA 1TRMA 1J16A 4NCYA 3GY4A 4ESTE 1FAKH 4JYUH 5GPIB 4DVAU 1ZGVA 1IQHA 4B74A 3RDZA 1LVYA 1CA0B 2HNTC 1K1MA 4SGAE 5T3HA 1OP0A 2BQ6B 2TBSA 4K8YA 3A82A 1C5WB 1BMNH 1XUKA 2TGAA 1FN6A 3QZQA 1QY6A 1ZTJA 1C5OH 1JWTA 2YNBA 2XTTB 5DP3A 1EAIA 4XBDA 4X6PA 3P95A 2WYJA 3TGKE 4I8LA 2IN2A 2BB4A 2O8WA 3E0PB 1VR1H 3QZRA 5EXMA 3UNRA 4RN6A 1CA0C 1CQQA 1GJ9B 5LPFA 4NG9H 8GCHG 5L2YH 4FUEA 1HJ8A 4ABDA 2ZGXH 2GD4B 1QB9A 1EOJA 2AH4X 4U01A 3BTDE 3Q3XA 3P6ZB 4K5ZA 3RXSA 1SGCA 1E34B 1OS8A 1TOCB 1EP6A 2LNCA 3TNSA 4UONA 1ABJH 5K0HA 2FPZA 2PWXA 1ESAA 5DP4A 3T29A 3W94A 1PQ5A 2V3HH 4ZKOU 1IQFA 1THRH 3VPKA 5SGAE 5E0HA 1AZ8A 3MMGA 1FY4A 3NWUA 1NN6A 1CHOF 2OC0A 1Z1IA 4M7GA 1EOLA 2CJIA 2D2DA 2OP9A 3TGJE 2A7CA 1PYTD 3KHVA 1UK3A 1UTLM 2VIPA 4OS5A 3SU1A 5L2ZH 3V0XA 2GCHG 3JZ1B 4JYVH 1F92A 1SFIA 3DUXH 4Y8YA 2BX4A 5JBBS 3UPEA 3ODDA 3RXAA 7ESTE 3M5LA 2OXSA 1A5IA 1OWHA 4AFSA 1TNIA 2ZTXA 4X8SH 1Y3YA 1BMLA 1GHBF 1DS2E 3UR6A 2EI6A 5FBEA 1IQIA 1JBUH 2VVCA 4WF8A 2H9HA 1XXDA 1SVPA 1BHXF 2HOBA 2AMPA 3I29A 9ESTA 2OC1A 5EQRA 4OS1A 1C9PA 1PPCE 1V6DA 5ESBA 2W3IA 1QQ4A 4Q7YA 3MTYA 1LO6A 2ZHWH 3SV8A 2QAAA 2ZFQH 2UUYA 1V3XA 4X1RU 4LZ4B 1BA8B 1IOEA 2WV4A 3SU4A 2QYIA 1A61H 2CXVA 3H7TA 2W3KA 1JIRA 1SI5H 2ULLA 1EB1H 4YZUA 2G81E 3RXFA 5L30H 2BX3A 3QTOH 2AIPA 1MZDA 2STBE 2UUFB 4GCHF 4X8TH 1F5LA 2OC7A 1WU1A 2G5VA 1MQ5A 6LPRA 5A09A 2BY6X 1P57B 1GDQA 2EC9H 1LKBA 2W5EA 3MWIU 1O2HA 1PFXC 4D7GA 1SGYE 2OTVA 1W10U 2F9OA 2P59A 1FN8A 1G30B 4AG1A 3S0NA 4BANB 2ZPRA 4E06H 1DWEH 1DITH 1AY6H 1IQMA 1UVPA 1IAUA 3TH4H 3KL6A 1LVOA 1ZHPA 3EA9A 1ACBE 3MU4A 3RXCA 1TE0A 4UDWH 2ZDVH 2FS8A 2ANWA 1B0FA 1T7CA 3K65B 3MO3A 4BTTB 3TJUA 3KQCA 1LKAA 1UTPA 4ZUHA 2TGPZ 4FUDA 4DJZB 1HGTH 3AW1A 3PMBB 4E7NA 5HXFA 1O2RA 3C27B 1K1OA 3AAVA 4D7FA 5GCHG 4FUJA 1IQEA 1XKAC 4UE7H 3HKIB 1X7AC 1H9HE 3M61U 1DY9A 4ABHA 5GJ4B 1SQAA 3H7OA 3T28A 2P3UB 5HM9A 1LHFH 3HK3B 2Z9KA 2QY0B 1GDNA 4UFEH 4Q7ZA 3P17H 2ZPSA 4Q2KA 2D26C 1AKSB 1WCZA 1H1BA 3BTHE 1UK4A 1SGFG 5DJ7A 1V2QT 2ZCHP 4THNH 2VIWA 3BF6H 1EJAA 1NRPH 3DD2H 1C4U2 2AMQA 2UWLA 1EPTA 1C1QA 2ZNKH 1ZYOA 1TNGA 3MU5A 8GCHF 3B23B 3EQ0H 2A4OA 2ZP0H 3LIWA 4I8GA 1GHXH 2H1UA 1SMFE 1O3AA 1MZAA 1O3IA 4OS2A 1VJ9U 1O31A 1LPGB 1HV7A 3RXDA 5EU8A 4LZ1H 1BJUA 1FQ3A 2AMDA 1O0DH 2KAIB 4CR9A 2BM2A 4J1YA 2FX6A 3RXRA 2QXHA 2FOGA 3RLWH 2XWBI 3TK5A 3PLPA 1AFQB 1P2NA 4MPUA 5F03A 5C20A 1CE5A 3TPIZ 1PYTC 2PSXA 4AFZA 2LPRA 2P94A 4U32A 4AGJA 3A8DA 2BDBA 1ZTKA 2Z7FE 1L1JA 3SHCH 3SHAH 3PLBA 1QB1A 3RXOA 2C8YB 1B0EA 2GCHF 1FV9A 2ZDMA 3LGWA 2ZHEH 2ZQ2A 1W12U 1P3CA 2ZU1A 1QBVH 1AFQC 1FY1A 1UVOA 1GBBA 2A5IA 4CRDA 1NFUA 2QF0A 1NU7B 3C1KA 2WPIS 3P8FA 1ID5H 1BIOA 4Y11E 2WPLS 2V35A 4IN1A 1YC0A 3NXPA 1GBHA 2HVXA 3CENA 2QA9E 2G52A 1Q3XA 4DGJA 2XBYA 4X1QU 2G8TA 3UIRA 2C8XB 3RC5A 1E0FD 1TRYA 4NFFA 2XC0A 2G4UA 1N8OB 2BLQA 1AGJA 2ZI2H 3QTVH 1C2HA 4XBCA 1UTQA 5FHTA 1CT0E 2PUQH 1FY3A 2ALVA 5A2MH 2A7HA 3SQHE 1ZPBA 6ESTA 4NFEA 1E35B 5A8ZA 1VJAU 1TPSA 1XM1A 2GVFA 3MNXA 4OS4A 3SU6A 1DSTA 3GCTF 1TPAE 1T8OA 4JK6A 1GHAG 4MNVA 1S84A 2VINA 1P8VC 1YKTA 1GBEA 1VITG 1J9CH 1N8OC 2Z3EA 3ZVDA 3A80A 4NIWA 2VGCB 1SLWB 3D62A 1AUTC 1GBTA 1LHCH 2VB0A 3M5OA 1GI7B 1YCPK 3P8NA 2BD3A 3M35A 2CGAA 1P3EA 1PPEE 2ANYA 1LTOA 2OD3B 3MNSA 4UFGH 4E05H 3RM0H 4X8UH 1HFDA 1HAIH 1O3LA 1THPB 5JDUB 5F6MA 1HCGA 4JZ1A 3V7TA 4Y7AA 3M3TA 1C5UA 1C1RA 1JIMA 4Y7BA 3FVFB 4I7YH 4HFPB 2VGCC 1O33A 3QLPH 2H5CA 2RCEA 4DOQA 4Y8XA 2HWLB 3ZZ8A 1XX9A 1ARCA 3WY8A 3OY5U 3EA7A 3GISB 1HAZB 4X2YA 4MG3A 5FXLA 3KNXA 3AW0A 1C2JA 1PQ8A 3H5CB 3PO1B 3LJOA 3U98H 5GCHF 3BTGE 1OWKA 4YO9A 3EDXB 1J14A 3BTQE 1EZUC 4QT8C 1O2IA 1O2WA 5C67A 4IS5A 1B7XB 1C5SA 2GDEH 1T8LA 2A5AA 6CHAB 2XNIA 1EAXA 1P2IA 4JZIA 2PGBB 3Q00A 1SGRE 2C90B 5EPNA 2BD5A 1GJDB 1QBOA 3ESTA 3PO1C 3RXTA 4WXVA 1EQ9A 1L1GA 1J17T 1GI9B 4UD9H 1L4DA 1A1RA 3VFEA 4BOHA 2QXIA 4ZHAA 5DP9A 3T5FH 2NU0E 1O2MA 3QGJA 1C2LA 3TH3H 4YOIA 1QB6A 3S69A 3U1JB 5CMXH 3RXKA 1QL7A 2A0QB 3OYPA 6CHAC 1P10A 1Q31A 2ZPQA 1O2VA 4R8TB 1KXFA 1FAXA 5EGMA 3DFJA 2XBWA 1F7ZA 4YLUA 2ZA5A 2ZTZA 2ZFPH 3SO3A 1OWDA 3P92A 6GCHG 1HAXB 5GWZA 2OLGA 2C4FH 4JZDH 5FX5A 3L6PA 1EPTB 1C2DA 1W0YH 2Z3CA 1B5GH 3A81A 1YCPH 1O5AB 1T8NA 2AERH 2PKSB 1HAVB 1YPLH 2XBVA 1AWHB 2ZF0H 1V2VT 1QURH 4DW2U 1QNJA 1A0HB 2BTCE 5B6OA 3RM2H 1ETTH 5DP5A 1D9IA 2TGDA 2UWOA 1PPBH 3S9AA 3ATLA 2AGIX 1Z1JA 2FOEA 1EPTC 1O2KA 3DA9B 2A2XH 2BD4A 2H9TH 1NRQH 2RDLA 3Q3YA 1P01A 1VITH 1NESE 1C5TA 2PKSC 2R2WU 1IHSH 1GJ8B 1HXEH 1BMMH 3KCGH 1F0SA 1XUHA 1TALA 2PTNA 4TWWA 2Q1JA 1DWBH 1NTPA 1BRBE 4X1PU 1ANCA 2FOBA 1D6RA 1U6QA 1SB1H 1S82A 2A4QA 1V2MT 5H4IB 2ZQ1A 1FUJA 5FAHA 1MTNB 4WY3A 3P8GA 3TITA 1WTGH 4ZXXH 4HTCH 1BDAA 4ISHH 1HB0B 1G3BA 1GHYH 1GJAB 3QGNB 1SL3A 1P2KA 1NFYA 1C1UH 5ABWA 1GBAA 1G9IE 1O3CA 1BTZA 3KIDU 4X2VA 2FEQH 3ZZDA 4KKDA 4FUCA 3O8BA 1GG6B 1K1JA 1ELVA 1KLTA 1GHAF 3A7WA 2HALA 1XUFA 1MTNC 3L3TA 1GGDB 1W13U 2BY7X 1C5QA 1K22H 2FOCA 5EODA 2ZFTA 3GCNA 1PJPA 1ELTA 1ETRH 1VITF 3PMJA 1MKWH 4OS7A 3UUZA 2IOTA 1D6WA 4O3TA 3UY9A 1EZQA 3O8DA 4X6NA 2R9PA 1AZZA 1FMGA 3GY2A 2JH5D 1GG6C 1NROH 4I33A 3S9CA 4BAHB 1GPZA 5FBIA 3RMOH 4XDEA 2AGEX 2OC8A 3ZZ7A 1HIAB 1OX1A 1GGDC 3SUGA 1CGHA 3EAJA 1SFQB 4D76A 1BTUA 5A8XA 3RLYH 1G37A 3SI4H 2Z94A 2SGDE 2ZFSA 1D3DB 5C1XA 2R3YA 2SGEE 1AO5A 1FIZA 1O3BA 1O2QA 1TMTH 1UVSH 2FOFA 2QN5T 3E90B 4MNXA 2DUCA 2OQUA 2HPPH 1HYLA 1SHHB 2SGAA 5GIBA 2KAIA 1NO9H 3D65E 2QV1A 4I32A 1MTSA 2OINA 3SV2H 3UQOA 3DHKH 3AASA 4KGAA 5EOKA 1C2IA 2B5TB 4FVBA 4B73A 1V2ST 3U1IB 1C1NA 1V2NT 3A7YA 4BAMB 1ZSLA 3ZVBA 1MBQA 2K1QA 4BTIB 2O9QA 3W95A 1GMDG 1S85A 3D49H 5DO4H 1XMNB 2OBQA 2Q6DA 2F9UA 4YTAA 3BEUA 1HAPH 1OPHB 1F0TA 3ZZ5A 4X8VH 1L2EA 1HBTH 3A84A 2F9VA 4K2YA 1ETSH 1Z8RA 2PUXB 2FTLE 1CO7E 1V2RT 1MTVA 1TGSZ 4NZQA 1BTYA 5F8XA 1V2KT 2A7JA 4Y0ZE 4K3JA 3BEFB 2PFEA 3BV9B 3MU8A 2BMGB 2BD9A 1O2XA 3SV6A 1W14U 1C2GA 1D3TB 2NU4E 2XCNA 5JBCS 2GX4A 5IYTA 1LHEH 1OSSA 2Y80A 1GL1A 3OSYA 2B7DH 1GJ4H 2BD2A 3SV7A 2H9EH 1ESBA 1QQUA 1W0ZU 6GCHF 3F68H 3RXHA 1EXFA 3SU5A 1O3FA 3LGTA 1FI8A 2BDCA 3SI3H 2Y5GA 1C2EA 2BVSH 3RXIA 2G00A 1C5VA 1EP5A 3QX5H 1MD7A 3DT0H 1KY9A 3PMAB 1PPZA 1WBGB 2BDGA 4MDSA 4INHA 1Y3XA 3M3SA 1T31A 2NU2E 2BDHA 1BQYA 1K1IA 1ZSKA 2FI5E 2GTBA 1C5LH 1GHZA 2R3UA 3VXEH 3K9XB 4INKA 3ZZ4A 1GBJA 2BDIA 1SG8B 4DY7B 4E7RG 2VVUA 1N1LA 1AVXA 5LH8A 2VIQA 3IWMA 2QC2A 1H4WA 1O2SA 3GDUA 4A1VA 1K1LA 2XYAA 3RU4E 3GCTG 1YPJH 4XSKU 1ABIH 1ZTLA 3PWBA 2O8UA 3DFLA 4MPWA 3OX7U 1G36A 2G55A 2JH0D 3SUFA 2XW9A 4HGCA 2UUKB 5EQSA 1O3KA 1BHXB 1QA0A 3PYHA 5LPEA 1K21H 1ZGIA 3GYLB 2OCVB 1VGCB 2VWLA 4X1SU 3E0NB 1YCPM 4CRBA 1C5RA 5BPEA 4FUHA 3T27A 1QL9A 2A5KA 4AN7A 5FPSA 1HAHH 1GDUA 4D9RA 4ZKNU 1RTLA 1OYTH 2ODYB 1GMHG 7LPRA 1PQ7A 1GJ5H 3RXQA 1QHRB 2F9PA 3NUMA 5A0AE 1Z8JB 3A87A 1CSOE 1YP9A 2DE8A 2FTMA 4AX9H 1VGCC 1TX6A 3B8JA 1O2OA 1C4Y2 3ODFA 1SGDE 1KXDA 3UFAA 4AB8A 2FODA 3ELAH 3SGQE 4HI3A 3MH4A 1LDTT 3BTWE 3RMLH 4VGCB 3RC4A 2ZU4A 4AFUA 4K60A 4DIIH 3LU9B 1GHWH 1UCYK 1Y5UT 1AIXH 3GY3A 1Z7KA 1OWEA 5EW1H 2TGTA 1ELDE 3M7UA 5G4BA 2HGTH 3TK6A 1HUTH 2Y6TA 2BOKA 2NU1E 2BLVA 3FANA 3R3GB 4D8NA 2Y81A 1P2OA 1K2I1 4DCDA 1F0RA 5F8ZA 1W7GH 2EA3A 4X0WU 3A7VA 1CT4E 1ZPCA 4VGCC 4O03A 3V13A 1OP2A 2A31A 4ABIA 2G5NA 2ZTYA 3T2NA 3KEEA 2ZCKP 1VCWA 1GVKB 1O2UA 5DGJA 2WPHS 4ZH8A 1C5MD 1CBWB 5BRRE 1BTWA 1HAVA 1O2GH 2SGQE 4Y79A 2CF8H 5T6GA 3TVJB 4OGYA 3U8RH 1GI6A 1GMDF 1GBLA 3A83A 1C2FA 1TGTA 1OOKB 1YPHE 4BXSA 2ZIQH 1TQ7B 4X2XA 3EYDA 3F6UH 4F4OC 2VVVA 4CRCA 1BB0B 2GDDA 1MTUA 1TB6H 3GYMA 4K1SA 3ZYEA 2SNWA 3TNTA 4GPGA 1SLUB 1DM4B 2ILNA 1SGNE 4O9VA 2AYWA 2BD8A 4IW4E 2C93B 5DP7A 3GDVA 4CRGA 3OTJE 1GBFA 2RA3A 1CBWC 1KDQB 1WAYB 3KF2A 3BG8A 1SC8U 1TA6A 4FUIA 4NIXA 1DWDH 2ZGHA 1J8AA 1LQEA 1YBWA 1IQGA 1O30A 3QK1A 4TYDA 1ELAA 4H6TA 1UHBA 1NZQH 1XUJA 4NWLA 1H8DH 1P9UA 5C2ZA 1Z8GA 2BLWA 1E38B 2SFAA 1ZMNA 4Y71A 1IQNA 1SGIB 1SPJA 1QGFA 1FNIA 3CS7A 4B2BA 2M5TA 1GVLA 3QWCH 1AU8A 2ZDAH 3CP7A 1BBRK 1HXFH 2V0BA 2V3OH 2EI7A 1DXPA 1NT1A 1KIGH 2W26A 3GY7A 2FO9A 1GJBB 3MNCA 1XKBC 1XUGA 2XWAA 2FYQA 1N6YA 3BTFE 3M7TA 2GT7A 4X6MA 3LGIA 3GY6A 3SV9A 1P02A 3BTEE 4IBLH 2FI4E 3D23A 5E0GA 1D3PB 3SJ9A 2QGRA 2CN0H 4R0IA 2HLCA 1P12E 3ENSB 1PPHE 3HATH 4Z0KA 3U9AH 1AQ7A 1P2QA 5FX6A 3RMNH 3MFJA 3UQVA 1NFWA 3NK8A 4NWKA 1ZLRA 4K8BA 3E6PH 2ZZUH 1HIAA 3ZZCA 3ATWA 1A2CH 5I25A 2J95A 3B9FH 1EB2A 3LGVA 1ORFA 2A4GA 1P2MA 3F9FA 2ZCLP 1EJNA 1LMWB 3EGKH 1SLVB 4FU7A 1JOUB 3ZVAA 5C1UA 3BTKE 3LPRA 2EI8A 1BOQA 1NFXA 3SOSA 1G3CA 3KGPA 1GBIA 3P8OA 1RTFB 3ITIA 3RMMH 1SOZA 4ABJA 5FCRA 3RXVA 4FUFA 3FP6E 4CRAA 3VB4A 4IGDA 2O8LA 1AE8H 3ZV8A 1GMHF 1L4ZA 1E36B 2ZFFH 2FI3E 4X2WA 4Y8ZA 5A8YA 5HM2A 2YNAA 1DUEA 1AMHA 3VGCB 5DP8A 3FP7E 2OUAA 1BRCE 1DFPA 2XRCA 4ISIH 3PMHB 1ZMJA 4ZKRU 1O2LA 1GJ6A 2A4RA 1ZRKA 4NIYA 2PTCE 8KME2 3BEIB 3A8AA 2ZHFH 2O8MA 2R2MB 4MQAA 4UFDH 2J34A 4MPVA 2WINI 5J4QA 1VCQA 3KQDA 3MYWA 1O3JA 1YYY1 3NZIA 2RA0A 3VGCC 4K1EA 4YT6H 1O5EH 1V2PT 2BLOA 4B71A 5J4SA 5EW2H 2Y5HA 1AN1E 3QN7A 4KTCA 4O97A 4AOQA 1TGCA 1BTHH 7KMEH 3SGAE 4A7IB 4CH2B 4YM9A 1O5GH 3UNQA 3BN9A 1XVMA 1FLEE 1UTOA 1QRXA 1C5PA 2Z6BD 1YGCH 1T4VH 3RXUA 1A4WH 5DK1A 1LCYA 1Z8IB 1MMJN 1K9OE 2FMJA 4J2YB 2BXTH 3STJA 1A0JA 4GHQA 1O5BB 4A92A 1WSSH 1AD8H 1AVGH 4AYVB 3LC5A 1C2KA 4GLYA 1MD8A 5AFYH 5T6DA 2P8OB 1HAGE 2Z9GA 1BITA 1C1VH 3VXFH 4LOYH 1DT2A 1Z71A 1DANH 1W11U 3ZZ6A 3LT3A 1FXYA 1KXAA 1SQOA 1FPCH 4ASHA 1DY8A 3JZ2B 5C1YA 1GMCG 3GY5A 4NA9H 5JBTA 1JXPA 1FY5A 3LH1A 3QO6A 2WPMS 3A86A 1S0RA 1ZMLA 1G32B 2P8OC 1RIWB 2C8WB 1HNEE 3A7ZA 1W3CA 4GVUA 2BZAA 1C5YB 2FOMB 2GZ9A 3HGNA 1QIXB 1TABE 4DG4A 1TGNA 3ATKA 3MO6A 1DOJA 1KXBA 5DKMA 1Y5AT 1Z6EA 2A2QH 1S5SA 2D1JA 2FOHA 3VB6A 2HNTE 2NU3E 1UO6A 1C1OA 3T25A 3SZNA 1O3HA 1WUNH 4CBOA 5FPTA 1MQ6A 3UNSA 1DLKB 1HAYB 1S0QA 5FPYA 3LONA 1IQKA 1DLEA 1OYQA 1RIWC 1A46H 4ABBA 2FIRH 1TA2A 1NS3A 1IQJA 4NIVA 2XBXA 4K69A 1UK2A 1UHBB 3AVZA 2H5DA 3VB3A 1SSXA 2VWNA 4A1XA 1LPZB 4XFQA 1F5KU 2FZZA 4GHTA 4XE4A 5A0CA 2HNTF 2VJ1A 1FIWA 1MCTA 1TX7A 1UJ1A 2F9NA 1KTSB 3MH5A 1F0UA 1ANBA 3GICB 1QCPA 2OQ5A 1EKBB 1TLDA 1OKXA 1K1NA 4SGBE 4TPYA 1JMOH 4Q7XA 1ELFA 1O5DH 3N7OA 3R0FA 4NSYA 4F49A 2Q6FA 3LOXA 1V2OT 1FY8E 3FP8E 3O8RA 2Y7ZA 1NRSH 1O2PA 1SOTA 1TBZH 1ZHMA 4BAQB 1NY22 3VEQB 4I8HA 2VH6A 4OS6A 1GCDA 3BTTE 3A89A 3M37A 8ESTE 2BY9X 1MKXK 1OP8A 3Q76A 1CT2E 2R0LA 5HYOA 2VWOA 3RXEA 1ELCA 2FLRH 3V3MA 2ASUB 2R0KA 1O3OA 2ZC9H 1EAWA 5FCKA 1FPHH 2QIQA 2OBOA 1OWJA 1P05A 4WJG2 4JMYA 1P04A 3ZZ9A 2JKHA 1MAYA 1C1WH 2B0FA 1GBMA 1ZZZA 2P3FH 2HPQH 1QBNA 1O37A 3Q3KA 1EX3A 3PROA 2PKAA 1NPMA 4WMEA 5EXLA 3ATMA 1KDQA 1Y3WA 4FU9A 2CF9H 2RG3A 4KTSA 4B2CA 2J2UA 2IPHA 3SUEA 1CVWH 4B1TA 2QXJA 1KLJH 1QRWA 3HPTB 1OWIA 4Y0YE 1ZRBA 3RU4D 3SN8A 1V2UT 4D9QA 1W7XH 4WMDA 3F9HA 1CA8B 1UTKA 2J94A 1RGQA 1DVAH 4WH8A 2XC5A 2H2ZA 4IC6A 2GGVB 1QRZA 4XBBA 4NA7A 1GI8B 1WYKA 5E8EH 4YT7H 1O36A 1LVMA 4HZHA 1SLXB 1ZJKA 4JCNA 2G51A 3UTUH 2BZ6H 3Q77A 2ZEBA 3SJIA 1C5ZB 1MBMA 2QCYA 7GCHG 3S7KB 5JBAS 2XXLA 1LPKB 5F8TA 5GDSH 2VWMA 5AF9H 4ZHMU 3SW2B 4ZKSU 3E3TA 3RP2A 1MAXA 4TY6A 4GAWA 4ISNA 4MPXA 4X6OA 2ZWLH 4CHAB 1ZOMA 1O5CB 3I77A 1HJ9A 2FXRA 3MH6A 3U8TH 1TWXB 3F9GA 2I6SA 4TY7A 1MTWA 1HDTH 1GVZA 1GMCF 2BD7A 4FVDA 3S7HB 1VCPA 1MKXH 1UMAH 1ZSJA 2PR3A 1DSUA 1YLCA 1T32A 4BNRA 1ZR0A 1DWCH 1L0ZA 1S83A 4IC5A 1QJ1B 2GZ7A 4OGXA 3SNAA 3UR9A 2F3CE 4CHAC 1DE7H 1G2LA 5C5NA 1O38A 1YM0A 4GUXA 4KP0A 3TK9A 1K28D 1ANDA 4Y10E 1GBCA 1A7SA 1H9LB 3MOCA 2ZFRH 2FS9A 1YPGH 4CREA 1IQLA 3G01A 3UREA 2ZDNA 2QF3A 1NM6A 2AS9A 5AHGH 3A85A 2FM2A 1TFXA 3M36A 4H6SB 1A5GH 1HLTH 4MNYA 1QA7A 1TONA 5IDKA 1C2MA 2YOLA 3M5MA 1O39A 2ZDLA 1ZJDA 2Z9IA 3SGBE 3S9BA 1O2YA 5EXNA 1SGPE 5K7RA 3TH2H 3FZDA 2TRMA 3HK6B 1M9UA 1GI5A 2QXGA 4XOJA 3STIA 1ARBA 2H6MA 1XVOA 1PPFE 1RS0A 1GBDA 3M3VA 4MTBA 2C8ZB 3F9EA 1GBKA 2P3TB 3E16B 3U69H 3A8CA 1GI1A 1BMAA 5JB8S 1TOMH 4NGAH 3ZVFA 2VIVA 4A5TS 2ZHDA 1BJVA 1TNLA 5AVDA 2FWWA 1GI2A 5PTPA 1TNKA 1AB9B 2B9LA 3GY8A 2GKVE 3RUOA 4BXWA 3SU2A 1EASA 2V6NA 1BUIA 2G4TA 2ZKSA 1P03A 2BHGA 4I8JA 3GCOA 1QR3E 4RSPA 4B2AA 3T62A 3FAOA 1QL8A 1J15A 5GXPA 1TIOA 1VZQH 3MHWU 3SU0A 2GV7A 3RU4T 3NKKA 2ODPA 3A8BA 4I31A 4WXIA 1LHGH 3RXPA 3RXLA 1RTKA 3LH3A 4JZFH 2VIDA 4CBNA 1F2SE 2CV3A 1AB9C 2F83A 4IMQA 4MLFB 2ODQA 2Y5FA 2BOHB 1DICA 2BQWB 1YPMH 3TLOA 3GCHB 1TGBA 3PM3A 1O32A 4U2WA 1Y59T 3SBKA 1MU8B 1TYNA 3TJVA 1TNHA 1SHYA 4AYYB 3K6ZA 1YLDA 3SNBA 3TJNA 1SGFA 2BDYA 1GCTB 3BSQA 4TWYA 2FDAA 2O8TA 1CU1A 2Q6GA 1S6FA 2BY8X 3OY6U 3URDA 5A0BA 1FDPA 2Z3DA 2SGPE 5E2PA 1RXPA 1TMUH 2GV6A 1V2JT 1GI3A 2BVRH 2BQ7B 2ZO3H 3FZZA 3UWJH 3GCHC 4Z6AH 2STAE 1IHTH 1O5FH 1AFEH 1FJSA 3PWCA 5DP6A 1O3NA 4RKOB 2J4IA 4KELA 1BT7A 3V12A 5DPAA 3RC6A 1C1PA 4IN2A 2ANKH 4ZMAH 4TPIZ 1GCTC 4ZHLU 1ZPZA 3T26A 3E1XB 2SNVA 2PKAB 1WQVH 1AVWA 4X1NU 2W7SA 3NCLA 2ZU3A 1XXFA 1YPKH 3E91A 8LPRA 2THFB 2UUJB 1GJCB 3ZZAA 1FONA 2BY5X 3VB7A 2BXUH 5C3NA 2ZDKA 1HJAB 5JPMH 5TCCA 1RD3B 4FXGH 7GCHF 1S81A 3TU7H 3UOUA 5JYIA 1UTNA 4YLQH 1GWAA 1TMBH 3EE0B 1KTTB 1UTJA 2D8WA 4INLA 2B8OH 3PB1E 2VU8E 3SNDA 1P2JA 2SGFE 3SORA 1KYNA 1O2ZA 1O3EA 1ESTA 2GT8A 4ISLA 2ANMH 1DDJA 3BTME 2HRVA 1NRRH 1O3DA 1SQTA 1AUJA 2Z9JA 4NZLA 1HJAC 4ABAA 1C9TA 3K2UA 3TIUA 2P95A 4NA8A 1DUAA 1O34A 2IJOB 4O3UA 1TBQH 1UCYH 3ZVEA 3QDZB 1AWFH 3BIUH 1E37B 2A32A 3MH7A 2TPIZ 5CHAB 1A5HA 3PTBA 1NC6A 3ZYDA 4ZXYH 1LVBA 2FOAA 1WQSA 3E8LA 3RXJA 2Z9LA 3FFGA 3A7XA 3HGPA 1UVUH 5TJXA 3SNCA 1UCYE 3SNEA 5T6FA 4WWYA 5LGOA 3K6YA 1O3MA 3SJOA 3LJJA 1QJ6B 1SBWA 1EZXC 1N6XA 4FUBA 2ZGBH 3RXBA 3VB5A 1G3DA 4DURA 2JH6D 5CHAC 1GI0A 2GCTB 2JETB 4ABEA 1YPHC 4JK5A 1CGJE 1H8IH 9LPRA 1JRSA 3MI4A 4CRFA 4CR5A 3TJOA 5C5OA 3ATIA 1AI8H 2ZU2A 2FLBH 1TQ0B 5E0JA 3KN2A 1UVTH 4H4FA 2PHBA 3RXMA 1GL0E 1SGEE 4WH6A 4B76A 2GCTC 2JETC 1CHGA 2XCFA 2I6QA 1GI4A 3MO9A 4ZROA 1INCA 3U8OH 1JRTA 1AE5A 4Q80A 5JB9S 1ANEA 4AFQA 1T4UH 4FUGA 3F1SB 1HAOH 1W2KH 4Y6DA 3ZZBA 1GJ7B 1KXEA 3TGIE 1C5NH 1G2MA 5TCAA 1P06A 1F5RA 1EJMA 3LGYA 1TPPA 2A1DB 1RJXB 1L1NA 4AG2A 2PLXA 4A1TA 1H9IE 2AEIH 1KSNA 1P11E 5HGGA 3M7QA 2P16A 4H42U 4U30A 2VIOA 2Y82A 5HMAA 1ZHRA 3UWIA 1D3QB 1ELGA 3O8CA 2ESTE 4ABGA 2AIQA 1T8MA 4ABFA 4WVPE 1BBRH 1MH0A 4MNWA 1V2WT 4K1TA 1P9SA 2BYAX 1DXWA 2TIOA 4I8KA 1UTMA 1RRKA 4DT7B 1C1SA 1BRAA 3BIVH 5EPYA 5ETXA 3LGUA 3RXGA 3IITA 1EUFA 2WPKS 3OU0A 4MVNA 2ZHQH 1A0LA 1Z6JH 1BZXE 2ZGJA 1BBRE 1Y3VA 2CHAB 4YESB 2W7UA 2WV5A 1A3EH 1MUEB 1YPEH 2NWNA 1NRNH 2J9NA 2ZG0H 1P09A 3PTNA 3BG4B 1TBRH 1BTXA 1HPGA 2PSYA 2CMYA 1DPOA 1QTFA 2PGQB 3SU3A 1C1TA 5CE1A 1AHTH 2FX4A 3URCA 2CHAC 1MKWK 1BTPA 4WMFA 4Y76A 3PLKA 1EZSC 3EA8A 2VNTA 2AGGX 4ISOA 3BG4C 4AB9A 1XUIA 2WUBA 1D4PB 1QJ7B 1CHOG 4BAOB 5LPRA 3GDSA 1SGQE 1WTHD 2FP7B 1EAUA 3AAUA 3IG6B 1WOFA 2EEKA 4LXBH 5DG6A 3ZVGA 3MU1A 1TPOA 1GHVH 3SJ8A 5E2OA 1P0SH 4AGKA 4AORA 3PV4A 4NSVA 5EG4A 5EQQA 1Y8TA 2PW8H 2GZ8A 3SQEE 2C3SA 2XC4A 1GHBG 3LDXH 3ZV9A 5ESTE 4BTUB 3ZZ3A 4UEHH 2Y7XA 4AZ2B 4A6LA 3SJKA 1KLIH 1QFKH 3MNBA 1THSH 1W8BH 1TAWA 1Y3UA 2F91A 1O2JA 3A7TA 1CGIE 1SGTA 4GSOA 2ZGCA 3LC3A 1BRUP 1C5XB 1KXCA 1K1PA 2UWPA 1C4V2 3KQEA 1O3GA 1O35A 4CH8B 1V2TT 2AFQB 4RKJB 1PPGE 1FZZA 1HRTH 1Q2WA 4IMZA 1NU9A 1YF4A 1TNJA 2FESH 2GMTB 1ELEE 5AFZH 1TRNA 2A45B 3GOVB 4PROA 4ZAEA 1RFNA 1WV7H 4GCHG 4JZEH 2PV9B 2ZECA 1Y5BT 3MU0A 4LK4A 3QUMP 3HKJB 1LQDB 3P70B 3ZVCA 1ELBA 1TX8A 1DX5M 4YOJA 3SUDA 1OXGA 4KTUA 1O2NA 4DIHH 3CS0A 1O2TA 3L33A 4FU8A 3LKWA 1C1MA 2GMTC 2F9BH 4B75A 3A88A 1O3PB 2BDAA 5L6NH 1LHDH 2ZU5A 2DE9A 1S6HA 3KQBA 1V2LT 2ALPA 3M5NA 2WPJS 2J38A 1BCUH 2WYGA 5I46H 2J92A 2GP9B 4YOGA 1AKSA 1A3BH 1PQAA 4JYTA 2WUCA 1EATA 2FYRA 2VH0A 1MU6B 1SR5C 1G3EA
chains in the Genus database with same CATH superfamily
1MCVA 4UFFH 4BAKB 5CDFE 2BVXH 3I78A 3NPSA 2P93A 3UOPA 1TRMA 1J16A 4NCYA 3GY4A 4ESTE 1FAKH 4JYUH 5GPIB 4DVAU 1ZGVA 1IQHA 4B74A 3RDZA 1LVYA 1CA0B 2HNTC 1K1MA 4SGAE 5T3HA 1OP0A 2BQ6B 2TBSA 5DSFA 4K8YA 3A82A 1C5WB 1BMNH 1XUKA 2TGAA 1FN6A 3QZQA 1QY6A 1ZTJA 1C5OH 1JWTA 2YNBA 2XTTB 5DP3A 1EAIA 4XBDA 4X6PA 3P95A 2WYJA 3TGKE 4I8LA 2IN2A 2BB4A 2O8WA 3E0PB 4XD7D 1VR1H 3QZRA 5EXMA 3UNRA 4RN6A 1CA0C 1CQQA 1GJ9B 5EIYA 5LPFA 4NG9H 8GCHG 5L2YH 4FUEA 1HJ8A 4ABDA 2ZGXH 2GD4B 1QB9A 1EOJA 2AH4X 4U01A 3BTDE 3Q3XA 3P6ZB 4K5ZA 3RXSA 1SGCA 1E34B 1OS8A 1TOCB 3FKSD 1EP6A 4FETA 2LNCA 3TNSA 4UONA 1ABJH 5K0HA 4I86A 2FPZA 2JDID 2PWXA 1ESAA 5DP4A 3T29A 3W94A 1PQ5A 2V3HH 4ZKOU 1IQFA 1THRH 3VPKA 5SGAE 5E0HA 1AZ8A 3MMGA 4RI0A 1FY4A 3NWUA 1NN6A 1CHOF 2OC0A 1Z1IA 3UAIC 1YLNA 4M7GA 1EOLA 2CJIA 2D2DA 2OP9A 3TGJE 2A7CA 1PYTD 3KHVA 1UK3A 1UTLM 2VIPA 4OS5A 3SU1A 5L2ZH 3V0XA 2GCHG 3JZ1B 3OEED 1F92A 4JYVH 3OE7D 4ACAA 1SFIA 3DUXH 4Y8YA 2BX4A 5JBBS 3UPEA 3ODDA 3RXAA 7ESTE 3M5LA 2OXSA 1A5IA 3KYFA 1OWHA 4AFSA 1TNIA 2ZTXA 4X8SH 1Y3YA 1BMLA 1GHBF 1DS2E 3UR6A 2EI6A 5FBEA 3PV5A 1IQIA 1JBUH 2VVCA 4WF8A 2H9HA 1XXDA 1SVPA 1BHXF 2HOBA 2AMPA 2IPQX 3I29A 2OC1A 9ESTA 5EQRA 3N99A 4OS1A 1C9PA 1PPCE 1V6DA 5ESBA 2W3IA 1QQ4A 4Q7YA 3MTYA 1LO6A 2ZHWH 3SV8A 2QAAA 2ZFQH 2UUYA 1V3XA 4X1RU 4LZ4B 1BA8B 1IOEA 2WV4A 3SU4A 2QYIA 1A61H 2CXVA 3H7TA 2W3KA 1JIRA 1SI5H 2ULLA 1EB1H 4YZUA 2G81E 3RXFA 5L30H 2BX3A 3QTOH 2AIPA 1MZDA 2STBE 2UUFB 4GCHF 4X8TH 1F5LA 2OC7A 1WU1A 2G5VA 1MQ5A 6LPRA 5A09A 2BY6X 1P57B 1GDQA 2EC9H 1LKBA 2W5EA 3MWIU 1O2HA 1PFXC 4D7GA 1SGYE 2OTVA 1W10U 2F9OA 2P59A 3UB0A 1FN8A 1G30B 4AG1A 3S0NA 2J5UA 4BANB 2ZPRA 4E06H 1DWEH 1DITH 1AY6H 1IQMA 1UVPA 5C17A 1IAUA 3TH4H 2F43B 3KL6A 1LVOA 1ZHPA 3EA9A 1ACBE 3MU4A 3RXCA 1EFRD 1TE0A 3VG8A 4UDWH 2ZDVH 2FS8A 2ANWA 1B0FA 1T7CA 3K65B 3MO3A 4BTTB 3TJUA 2V3MA 3KQCA 1LKAA 1UTPA 4ZUHA 2TGPZ 4FUDA 4DJZB 1HGTH 3AW1A 3PMBB 4E7NA 5HXFA 1O2RA 3C27B 1K1OA 3AAVA 4D7FA 5GCHG 4FUJA 1IQEA 1XKAC 4UE7H 3HKIB 1X7AC 2KCOA 4Q63A 1H9HE 3M61U 1DY9A 4ABHA 5GJ4B 1SQAA 3H7OA 3T28A 2P3UB 5HM9A 1LHFH 2HLDD 3HK3B 2Z9KA 2QY0B 1GDNA 4UFEH 4Q7ZA 3P17H 2ZPSA 4Q2KA 2D26C 2GJGA 1AKSB 2K8IA 1WCZA 1H1BA 3BTHE 1UK4A 1SGFG 5DJ7A 1V2QT 2ZCHP 4THNH 2VIWA 3BF6H 3PRBA 1EJAA 1NRPH 3DD2H 1C4U2 2AMQA 2UWLA 1EPTA 1C1QA 2ZNKH 1ZYOA 1TNGA 3MU5A 1QZ8A 8GCHF 3B23B 3EQ0H 2A4OA 2ZP0H 3LIWA 4I8GA 1GHXH 2H1UA 1SMFE 1O3AA 1MZAA 1O3IA 4OS2A 1VJ9U 1O31A 1LPGB 1HV7A 3RXDA 5EU8A 4LZ1H 1BJUA 1FQ3A 2AMDA 1O0DH 2KAIB 4CR9A 2BM2A 4J1YA 4ACBA 2FX6A 3RXRA 2QXHA 2FOGA 3RLWH 2XWBI 1WDIA 3TK5A 3PLPA 1AFQB 1P2NA 4MPUA 5F03A 5C20A 4XRNA 1CE5A 3TPIZ 1PYTC 2PSXA 4AFZA 2LPRA 2P94A 4U32A 4AGJA 3A8DA 2BDBA 1ZTKA 2Z7FE 1L1JA 3SHCH 3SHAH 1NBMD 3FN8A 1QB1A 3PLBA 2C8YB 3RXOA 1B0EA 2GCHF 1FV9A 2ZDMA 3LGWA 2ZHEH 2ZQ2A 1W12U 1P3CA 5EJLA 2ZU1A 1QBVH 1AFQC 1FY1A 1UVOA 1GBBA 2A5IA 4CRDA 1NFUA 2QF0A 1NU7B 3C1KA 2WPIS 3P8FA 1ID5H 1BIOA 4Y11E 2WPLS 2V35A 4IN1A 1YC0A 3NXPA 1GBHA 2HVXA 3CENA 2QA9E 2G52A 1Q3XA 4DGJA 2XBYA 4X1QU 2G8TA 3UIRA 2C8XB 3RC5A 1E0FD 1TRYA 4NFFA 2XC0A 2G4UA 5C0TA 1N8OB 2BLQA 1AGJA 2ZI2H 3QTVH 1C2HA 4XBCA 1UTQA 5FHTA 1CT0E 2PUQH 1FY3A 2ALVA 5A2MH 4DT4A 2A7HA 3SQHE 1ZPBA 6ESTA 4NFEA 1E35B 5A8ZA 1VJAU 3U28C 1TPSA 1XM1A 2GVFA 3MNXA 4OS4A 3SU6A 1DSTA 3GCTF 1TPAE 1T8OA 4JK6A 1GHAG 4MNVA 1S84A 2VINA 1P8VC 1YKTA 1GBEA 1VITG 1J9CH 1N8OC 2Z3EA 3ZVDA 3A80A 4NIWA 2VGCB 1SLWB 3D62A 1AUTC 1GBTA 1LHCH 2VB0A 3M5OA 3F0OA 1GI7B 1YCPK 3P8NA 2BD3A 3M35A 2CGAA 1P3EA 1PPEE 2ANYA 1LTOA 2OD3B 3MNSA 4UFGH 4E05H 3MQKC 5B6LA 3RM0H 4X8UH 1HFDA 1HAIH 1O3LA 1THPB 5JDUB 5F6MA 1HCGA 4JZ1A 3V7TA 4Y7AA 3M3TA 1C5UA 1C1RA 1JIMA 4Y7BA 4ZCNA 3FVFB 4I7YH 4HFPB 2VGCC 1O33A 3QLPH 2H5CA 2RCEA 4DOQA 4Y8XA 2F4LA 2HWLB 1XX9A 3ZZ8A 1ARCA 3WY8A 3OY5U 4TT3D 3EA7A 3GISB 2AHME 1HAZB 4X2YA 4MG3A 5FXLA 3KNXA 3AW0A 1C2JA 1PQ8A 3H5CB 3PO1B 3LJOA 3U98H 2K0QA 5GCHF 3BTGE 1OWKA 4YO9A 3EDXB 1J14A 3BTQE 1EZUC 4QT8C 1O2IA 1O2WA 5C67A 4IS5A 1B7XB 1C5SA 2GDEH 1T8LA 2A5AA 6CHAB 2XNIA 1EAXA 1P2IA 4JZIA 2PGBB 3Q00A 1SGRE 2C90B 5EPNA 2BD5A 1GJDB 1QBOA 3ESTA 3PO1C 3RXTA 4WXVA 1EQ9A 1L1GA 1J17T 1GI9B 4UD9H 1L4DA 1A1RA 3VFEA 4BOHA 2QXIA 4ZHAA 5DP9A 3T5FH 2NU0E 1O2MA 3QGJA 1C2LA 3TH3H 4YOIA 1QB6A 3S69A 3U1JB 5CMXH 3RXKA 1QL7A 2A0QB 3OYPA 6CHAC 1P10A 1Q31A 2ZPQA 1O2VA 4R8TB 1KXFA 1FAXA 5EJZA 5EGMA 3DFJA 2XBWA 1F7ZA 4YLUA 2ZA5A 2ZTZA 2ZFPH 3SO3A 1OWDA 3P92A 6GCHG 2L6OA 1HAXB 5GWZA 2OLGA 2C4FH 4JZDH 5FX5A 3L6PA 1EPTB 1C2DA 1W0YH 2Z3CA 1B5GH 3A81A 1YCPH 1O5AB 1T8NA 2AERH 2PKSB 1HAVB 1YPLH 2XBVA 1AWHB 2ZF0H 1V2VT 1QURH 4DW2U 1QNJA 1A0HB 2BTCE 5B6OA 3RM2H 1ETTH 5DP5A 1D9IA 2TGDA 3F2HA 2UWOA 1PPBH 3S9AA 3ATLA 2AGIX 1Z1JA 2FOEA 1EPTC 1O2KA 3DA9B 2A2XH 2BD4A 2H9TH 1NRQH 2RDLA 3AK5A 3Q3YA 1P01A 1VITH 1NESE 1C5TA 2PKSC 2R2WU 1IHSH 1GJ8B 1HXEH 1BMMH 3KCGH 1F0SA 1XUHA 1TALA 2PTNA 4TWWA 2Q1JA 1DWBH 1NTPA 1BRBE 4X1PU 1ANCA 2FOBA 1D6RA 1U6QA 1SB1H 1S82A 2IJD1 2A4QA 3DSGA 1V2MT 5H4IB 2ZQ1A 1FUJA 5FAHA 1MTNB 4WY3A 3P8GA 3TITA 1WTGH 4ZXXH 4HTCH 1BDAA 4ISHH 1HB0B 1G3BA 1GHYH 2YMSD 1GJAB 3QGNB 1SL3A 1P2KA 1NFYA 1C1UH 5ABWA 1GBAA 1G9IE 1O3CA 1BTZA 3KIDU 4X2VA 2FEQH 3ZZDA 4KKDA 4FUCA 3O8BA 1GG6B 1K1JA 1ELVA 1KLTA 1GHAF 3SZEA 3A7WA 2HALA 1XUFA 1MTNC 5FL7D 3L3TA 1GGDB 1W13U 2BY7X 1C5QA 1K22H 2FOCA 5EODA 2ZFTA 3GCNA 1PJPA 1ELTA 1ETRH 1VITF 3PMJA 1MKWH 4OS7A 2JIZD 3UUZA 2IOTA 1D6WA 4O3TA 3UY9A 1EZQA 3O8DA 1FX0B 4X6NA 2R9PA 1AZZA 1FMGA 3GY2A 2JH5D 1GG6C 1NROH 4I33A 3S9CA 4BAHB 1GPZA 5FBIA 3RMOH 4XDEA 2AGEX 2L74A 2OC8A 3ZZ7A 1HIAB 1OX1A 1GGDC 3SUGA 1CGHA 3EAJA 1SFQB 4D76A 1BTUA 5A8XA 3RLYH 1G37A 3SI4H 2Z94A 2SGDE 2ZFSA 1D3DB 5C1XA 2R3YA 2SGEE 1AO5A 1FIZA 1O3BA 1O2QA 1TMTH 1UVSH 2FOFA 2QN5T 3E90B 4MNXA 2DUCA 2OQUA 2HPPH 1HYLA 1SHHB 2SGAA 5GIBA 2EY4C 2KAIA 1NO9H 3D65E 2QV1A 4I32A 1MTSA 2OINA 3SV2H 3UQOA 3DHKH 3AASA 4KGAA 4OM9A 5EOKA 1C2IA 2B5TB 4FVBA 4B73A 1V2ST 3U1IB 1C1NA 1V2NT 3A7YA 4BAMB 1ZSLA 3ZVBA 1MBQA 2K1QA 4BTIB 2O9QA 3W95A 1GMDG 1S85A 3D49H 5DO4H 1XMNB 2OBQA 2Q6DA 2F9UA 4YTAA 3BEUA 1HAPH 1OPHB 1F0TA 3ZZ5A 4X8VH 1L2EA 1HBTH 3A84A 2F9VA 4K2YA 1ETSH 1Z8RA 2PUXB 2FTLE 3CNRA 1CO7E 1V2RT 1MTVA 1TGSZ 4NZQA 1BTYA 5F8XA 1V2KT 2A7JA 4Y0ZE 4K3JA 3BEFB 2PFEA 3BV9B 3MU8A 2WHXA 2BMGB 2BD9A 1O2XA 3SV6A 1W14U 1C2GA 1D3TB 2NU4E 2XCNA 5JBCS 2GX4A 5IYTA 1LHEH 1OSSA 2Y80A 1GL1A 3OSYA 2B7DH 1GJ4H 2BD2A 2LELA 3SV7A 2H9EH 1ESBA 1QQUA 1W0ZU 3GS9A 6GCHF 3F68H 3RXHA 1EXFA 3SU5A 1O3FA 3LGTA 1FI8A 2BDCA 3SI3H 2Y5GA 1C2EA 2WZQA 2BVSH 3RXIA 2G00A 1C5VA 1EP5A 3QX5H 1MD7A 2KCPA 3DT0H 1KY9A 3PMAB 1PPZA 1WBGB 2BDGA 4MDSA 4INHA 1KMHB 2YMSB 1Y3XA 1H8ED 3M3SA 1T31A 2NU2E 2BDHA 4RT0A 1BQYA 1K1IA 1ZSKA 2FI5E 2GTBA 1C5LH 1GHZA 2R3UA 3VXEH 3K9XB 4INKA 3ZZ4A 1GBJA 2BDIA 1SG8B 4DY7B 4E7RG 2VVUA 1N1LA 1AVXA 1OHHD 5LH8A 2VIQA 3IWMA 2QC2A 1H4WA 1O2SA 3GDUA 4A1VA 1K1LA 2CK3D 2XYAA 3RU4E 3GCTG 1YPJH 4XSKU 1ABIH 1ZTLA 3PWBA 2YMSC 2O8UA 4B6EA 3DFLA 4MPWA 3OX7U 1G36A 2G55A 2JH0D 3SUFA 2XW9A 4HGCA 2UUKB 5EQSA 1O3KA 1BHXB 1QA0A 3PYHA 5LPEA 1K21H 1ZGIA 3GYLB 2OCVB 1VGCB 2VWLA 4X1SU 3E0NB 1YCPM 4CRBA 1C5RA 5BPEA 4FUHA 3T27A 1QL9A 2A5KA 4AN7A 5FPSA 1HAHH 1GDUA 4D9RA 4ZKNU 1RTLA 1OYTH 2ODYB 1GMHG 7LPRA 1PQ7A 1GJ5H 3RXQA 1QHRB 2F9PA 3NUMA 5A0AE 1Z8JB 3A87A 1CSOE 1YP9A 2DE8A 2FTMA 4AX9H 1VGCC 1TX6A 3B8JA 1O2OA 1C4Y2 3ODFA 1SGDE 1KXDA 3F2FA 3UFAA 4AC9A 4AB8A 2FODA 3ELAH 3SGQE 4HI3A 3MH4A 1LDTT 2KCYA 3BTWE 3RMLH 4VGCB 3RC4A 2ZU4A 4AFUA 4K60A 4DIIH 3LU9B 1GHWH 1UCYK 1Y5UT 1AIXH 3GY3A 1Z7KA 1OWEA 5EW1H 2TGTA 1ELDE 2J97A 3M7UA 5G4BA 2HGTH 3TK6A 1HUTH 2Y6TA 2BOKA 2NU1E 2BLVA 3FANA 3R3GB 4D8NA 2Y81A 1P2OA 1K2I1 4DCDA 1F0RA 5F8ZA 1W7GH 2EA3A 4X0WU 3A7VA 1CT4E 1ZPCA 4VGCC 1E1QD 4O03A 3V13A 1OP2A 2A31A 4ABIA 2QE7D 2G5NA 2ZTYA 3T2NA 3KEEA 2ZCKP 1VCWA 1GVKB 1O2UA 5DGJA 2WPHS 4ZH8A 1C5MD 1CBWB 5BRRE 1BTWA 1HAVA 1O2GH 2SGQE 4Y79A 2CF8H 5T6GA 3TVJB 4OGYA 3U8RH 1GI6A 1GMDF 1GBLA 3A83A 4RT1A 1C2FA 1TGTA 1OOKB 1YPHE 4BXSA 2ZIQH 1TQ7B 4X2XA 3EYDA 3F6UH 4F4OC 2VVVA 4CRCA 1BB0B 2GDDA 1MTUA 1TB6H 3GYMA 4K1SA 3ZYEA 2SNWA 3TNTA 4GPGA 1SLUB 1DM4B 2ILNA 1SGNE 4O9VA 2AYWA 2BD8A 4IW4E 2C93B 5DP7A 3GDVA 4CRGA 3OTJE 1GBFA 2RA3A 1CBWC 1KDQB 1WAYB 3KF2A 3BG8A 1SC8U 1TA6A 4FUIA 4NIXA 1DWDH 2W6ID 2ZGHA 1J8AA 1LQEA 1YBWA 1IQGA 1O30A 3QK1A 4TYDA 1ELAA 4H6TA 1UHBA 2KX4A 1NZQH 1XUJA 4NWLA 1H8DH 1P9UA 3DSPA 5C2ZA 1Z8GA 2BLWA 1E38B 2SFAA 1ZMNA 4Y71A 1IQNA 1SGIB 1SPJA 1QGFA 1FNIA 3CS7A 4B2BA 2M5TA 1GVLA 3QWCH 1AU8A 1K0HA 2ZDAH 3CP7A 1BBRK 1HXFH 2V0BA 2V3OH 2EI7A 1DXPA 1NT1A 1KIGH 2W26A 3GY7A 2FO9A 1GJBB 3MNCA 1XKBC 1XUGA 2XWAA 2FYQA 1N6YA 3BTFE 3M7TA 2GT7A 4X6MA 3LGIA 3GY6A 3SV9A 1P02A 3BTEE 2W6JD 4IBLH 2FI4E 3D23A 5E0GA 1D3PB 3SJ9A 3F2GA 2QGRA 2CN0H 4Q4LA 4R0IA 2HLCA 1P12E 3ENSB 1PPHE 3HATH 4Z0KA 3U9AH 1AQ7A 1P2QA 3EE7A 5FX6A 3RMNH 3MFJA 3UQVA 3H09A 1NFWA 3NK8A 4NWKA 1ZLRA 4K8BA 3E6PH 2ZZUH 1HIAA 3ZZCA 3ATWA 1A2CH 5I25A 2J95A 3B9FH 1EB2A 3LGVA 1ORFA 2A4GA 1P2MA 3F9FA 2ZCLP 1EJNA 1LMWB 4F48B 3EGKH 1SLVB 4FU7A 1JOUB 3ZVAA 5C1UA 3BTKE 3LPRA 2EI8A 1BOQA 1NFXA 3SOSA 1G3CA 3KGPA 1GBIA 3P8OA 1RTFB 3ITIA 3RMMH 1SOZA 4ABJA 5FCRA 3RXVA 4FUFA 3FP6E 4CRAA 3VB4A 4IGDA 2O8LA 1AE8H 3ZV8A 1GMHF 1L4ZA 1E36B 2ZFFH 2FI3E 4X2WA 3ZIAD 4Y8ZA 5A8YA 2M2AA 5HM2A 2YNAA 1DUEA 1AMHA 3VGCB 5DP8A 3FP7E 3F0PA 2OUAA 1BRCE 1DFPA 2XRCA 4ISIH 3PMHB 1ZMJA 4ZKRU 1O2LA 1GJ6A 2A4RA 1ZRKA 4NIYA 2PTCE 8KME2 3BEIB 3A8AA 4B6FA 2ZHFH 2O8MA 2R2MB 4MQAA 4UFDH 2J34A 4MPVA 2WINI 5J4QA 1VCQA 3KQDA 3MYWA 1O3JA 1YYY1 3NZIA 2RA0A 3VGCC 4K1EA 4YT6H 1O5EH 1V2PT 2BLOA 4B71A 5J4SA 5EW2H 2Y5HA 1AN1E 3QN7A 4KTCA 4O97A 4AOQA 1TGCA 1BTHH 2WV9A 7KMEH 3SGAE 4A7IB 4CH2B 4YM9A 1O5GH 3UNQA 3BN9A 1XVMA 1FLEE 1UTOA 1QRXA 1C5PA 2Z6BD 1YGCH 1T4VH 3RXUA 1A4WH 5DK1A 1LCYA 1Z8IB 2J98A 1MMJN 1K9OE 2FMJA 4J2YB 2BXTH 3STJA 1A0JA 4GHQA 1O5BB 4A92A 1WSSH 1AD8H 1AVGH 4AYVB 3LC5A 1C2KA 4GLYA 1MD8A 5AFYH 2V7QD 5T6DA 2P8OB 1HAGE 2Z9GA 1BITA 1C1VH 2KFWA 3VXFH 5HIZA 4LOYH 1DT2A 1Z71A 1DANH 1W11U 3ZZ6A 3LT3A 1FXYA 1KXAA 1SQOA 1FPCH 3F3BA 4ASHA 1YY3A 1DY8A 3JZ2B 5IK2D 5C1YA 1GMCG 3GY5A 4NA9H 3KYGA 5JBTA 1JXPA 1FY5A 3LH1A 3QO6A 2WPMS 3A86A 1S0RA 1ZMLA 1G32B 2P8OC 1RIWB 2C8WB 1HNEE 3A7ZA 1W3CA 4GVUA 2BZAA 1C5YB 2FOMB 2GZ9A 3HGNA 1QIXB 1TABE 4DG4A 1TGNA 3ATKA 3MO6A 1DOJA 1KXBA 1SQRA 3FOAA 5DKMA 1Y5AT 1COWD 1Z6EA 2A2QH 1S5SA 2D1JA 2FOHA 2PP6A 3VB6A 2HNTE 2NU3E 1UO6A 3WWBA 1C1OA 3T25A 3SZNA 1O3HA 1WUNH 4CBOA 5FPTA 1MQ6A 3UNSA 1DLKB 1HAYB 1S0QA 5FPYA 3LONA 1IQKA 1DLEA 1OYQA 1RIWC 1A46H 1UW7A 4ABBA 2FIRH 1S6LA 1NS3A 1TA2A 1IQJA 4NIVA 2XBXA 4K69A 1UK2A 1UHBB 3AVZA 2H5DA 3VB3A 1SSXA 2VWNA 4A1XA 1LPZB 4XFQA 1F5KU 2FZZA 4GHTA 4XE4A 5A0CA 2HNTF 2VJ1A 1FIWA 1MCTA 2RDEA 1TX7A 1UJ1A 2F9NA 1KTSB 3MH5A 1F0UA 1ANBA 3GICB 1QCPA 2OQ5A 1EKBB 1TLDA 1OKXA 1K1NA 4SGBE 4TPYA 2JJ2D 1JMOH 4Q7XA 1ELFA 1O5DH 3N7OA 3R0FA 4NSYA 4F49A 2Q6FA 3LOXA 1V2OT 1FY8E 3FP8E 3O8RA 2Y7ZA 1NRSH 1O2PA 1SOTA 1TBZH 1ZHMA 4BAQB 1NY22 3VEQB 4I8HA 2VH6A 4OS6A 1GCDA 3BTTE 3A89A 3M37A 8ESTE 2BY9X 3NRLA 1MKXK 1OP8A 1W0KD 3Q76A 1CT2E 2R0LA 1BMFD 5HYOA 2VWOA 3RXEA 1ELCA 2FLRH 3V3MA 2ASUB 2R0KA 1O3OA 2ZC9H 1EAWA 3OTPA 5FCKA 1FPHH 2QIQA 2OBOA 1OWJA 1P05A 4WJG2 4JMYA 1P04A 2QF5A 2JKHA 3ZZ9A 1MABB 1MAYA 1C1WH 2B0FA 1GBMA 1ZZZA 2P3FH 2HPQH 1QBNA 1O37A 3Q3KA 1EX3A 3PROA 2PKAA 2XNDD 1NPMA 4WMEA 5EXLA 3ATMA 1KDQA 1Y3WA 4FU9A 2CF9H 2KM0A 2RG3A 4KTSA 4P02A 4B2CA 2J2UA 2IPHA 3SUEA 1CVWH 4B1TA 2QXJA 1KLJH 1QRWA 3HPTB 1OWIA 4F55A 4Y0YE 1ZRBA 3RU4D 3SN8A 1V2UT 4D9QA 1W7XH 4WMDA 2QF4A 3F9HA 1CA8B 1UTKA 2J94A 1RGQA 1DVAH 3DCLA 4WH8A 5DN6D 1W0JD 2XC5A 2H2ZA 4IC6A 2GGVB 1QRZA 4XBBA 4NA7A 1GI8B 1WYKA 5E8EH 4YT7H 1O36A 1LVMA 4HZHA 1SLXB 1ZJKA 4JCNA 2G51A 3UTUH 2BZ6H 3Q77A 2ZEBA 5HKKD 3SJIA 1C5ZB 1MBMA 2QCYA 7GCHG 3S7KB 5JBAS 5EJ1A 2XXLA 3SYJA 1LPKB 5F8TA 5GDSH 2VWMA 3W1EA 5AF9H 4ZHMU 3SW2B 4ZKSU 3E3TA 2JJ1D 3RP2A 1MAXA 4TY6A 4GAWA 4ISNA 4MPXA 4X6OA 2ZWLH 5GNDA 4CHAB 1ZOMA 1O5CB 3I77A 1HJ9A 2FXRA 3MH6A 1E1RD 2J98B 3U8TH 1TWXB 3F9GA 2I6SA 4TY7A 1MTWA 1HDTH 1GVZA 1GMCF 2BD7A 4FVDA 3S7HB 1VCPA 1MKXH 1UMAH 1ZSJA 2PR3A 1DSUA 1YLCA 1T32A 4BNRA 1ZR0A 1DWCH 1L0ZA 1S83A 4IC5A 1QJ1B 2GZ7A 4OGXA 3SNAA 3UR9A 2F3CE 4CHAC 1DE7H 1G2LA 5C5NA 1O38A 1YM0A 4GUXA 4KP0A 5HIYA 1K28D 1ANDA 3TK9A 4Y10E 1GBCA 1A7SA 1H9LB 3MOCA 2ZFRH 2FS9A 1YPGH 4CREA 1IQLA 3G01A 3UREA 2ZDNA 2QF3A 1NM6A 2AS9A 5AHGH 3A85A 2FM2A 1TFXA 3M36A 4H6SB 1A5GH 1HLTH 4MNYA 1QA7A 1TONA 5IDKA 1C2MA 2YOLA 3M5MA 1O39A 2ZDLA 1ZJDA 2Z9IA 3SGBE 3S9BA 1O2YA 5EXNA 1SGPE 5K7RA 3TH2H 4P00A 3FZDA 2TRMA 3HK6B 1M9UA 1GI5A 2QXGA 4XOJA 3STIA 1ARBA 2H6MA 1XVOA 1PPFE 1RS0A 1GBDA 4TSFD 3M3VA 4MTBA 3FO8D 2C8ZB 3WWFA 3F9EA 1GBKA 2P3TB 3E16B 2XOKD 3U69H 3A8CA 1GI1A 1BMAA 5JB8S 1TOMH 4NGAH 3ZVFA 2VIVA 4A5TS 1E79D 2ZHDA 1BJVA 1TNLA 5AVDA 2FWWA 1GI2A 5PTPA 1TNKA 1AB9B 2B9LA 3GY8A 2GKVE 3RUOA 4BXWA 3SU2A 1EASA 2V6NA 1BUIA 4Z1MD 2G4TA 2ZKSA 1P03A 2BHGA 4I8JA 3GCOA 1QR3E 3PRDA 4RSPA 2RFKC 2EQNA 4B2AA 3T62A 3FAOA 1QL8A 1J15A 5GXPA 1TIOA 1VZQH 3MHWU 3SU0A 2GV7A 3RU4T 3NKKA 2ODPA 3A8BA 1YWUA 4I31A 1LHGH 4WXIA 3RXPA 3RXLA 1RTKA 3LH3A 4JZFH 2VIDA 4CBNA 1F2SE 2CV3A 1AB9C 2F83A 4IMQA 4MLFB 2ODQA 2Y5FA 2BOHB 1DICA 2BQWB 1YPMH 3TLOA 3GCHB 1TGBA 3PM3A 1O32A 4U2WA 1Y59T 3SBKA 1MU8B 1TYNA 3TJVA 1TNHA 1SHYA 4AYYB 3K6ZA 1YLDA 3SNBA 3TJNA 1SGFA 2BDYA 1GCTB 3BSQA 4FOUC 4TWYA 2FDAA 2O8TA 1CU1A 2Q6GA 1S6FA 2BY8X 1H8HD 3OY6U 3URDA 5A0BA 1FDPA 2Z3DA 2SGPE 5E2PA 1RXPA 1TMUH 2GV6A 1V2JT 1GI3A 2BVRH 2BQ7B 2ZO3H 3FZZA 3UWJH 3GCHC 4Z6AH 2STAE 1IHTH 1O5FH 1AFEH 1FJSA 3PWCA 5DP6A 1O3NA 4RKOB 2J4IA 4KELA 3OFND 1BT7A 3V12A 5DPAA 3RC6A 1C1PA 4IN2A 2ANKH 4ZMAH 4TPIZ 1GCTC 4ZHLU 3PV2A 1ZPZA 3T26A 3E1XB 2SNVA 2PKAB 1WQVH 1AVWA 4X1NU 2W7SA 3NCLA 2ZU3A 1XXFA 1YPKH 3E91A 8LPRA 2THFB 2UUJB 1GJCB 3ZZAA 1FONA 2BY5X 3VB7A 2BXUH 5C3NA 2ZDKA 1HJAB 5JPMH 5TCCA 1RD3B 4FXGH 7GCHF 1S81A 3TU7H 3UOUA 5CHBA 5JYIA 1UTNA 4YLQH 1GWAA 1TMBH 3EE0B 5C0UA 1KTTB 1UTJA 2D8WA 4INLA 2B8OH 3PB1E 2VU8E 3SNDA 1P2JA 2SGFE 3SORA 1KYNA 1O2ZA 1O3EA 1ESTA 2GT8A 4ISLA 2ANMH 1DDJA 3BTME 2HRVA 1NRRH 1O3DA 1SQTA 1AUJA 2Z9JA 4NZLA 1HJAC 4ABAA 1C9TA 3K2UA 3TIUA 2P95A 4NA8A 5KGOA 1DUAA 1O34A 2IJOB 4O3UA 1TBQH 2HVYB 1UCYH 3ZVEA 3QDZB 1AWFH 3BIUH 1E37B 2A32A 3MH7A 4HG6A 2TPIZ 5CHAB 1A5HA 3PTBA 1NC6A 3ZYDA 4ZXYH 1LVBA 2FOAA 1WQSA 3E8LA 3RXJA 2Z9LA 3FFGA 3A7XA 3HGPA 1UVUH 5TJXA 3SNCA 1UCYE 3SNEA 5T6FA 4WWYA 5LGOA 3K6YA 1O3MA 3SJOA 4YXWD 3LJJA 1QJ6B 1SBWA 1EZXC 1N6XA 4FUBA 2ZGBH 3RXBA 3VB5A 3N7DA 1G3DA 4DURA 2JH6D 5CHAC 1GI0A 2GCTB 2JETB 4ABEA 1YPHC 4JK5A 1CGJE 1H8IH 9LPRA 1JRSA 3MI4A 4CRFA 4CR5A 3TJOA 5C5OA 5C94A 3ATIA 1AI8H 2LP6A 2ZU2A 2FLBH 3N7EA 1TQ0B 5E0JA 3KN2A 1UVTH 4H4FA 2PHBA 3RXMA 1GL0E 1SGEE 4WH6A 4B76A 5T1VA 2GCTC 2JETC 1CHGA 2XCFA 2I6QA 1GI4A 3MO9A 4ZROA 1INCA 3U8OH 1JRTA 1AE5A 4Q80A 5JB9S 1ANEA 4AFQA 1T4UH 4FUGA 3F1SB 1HAOH 1W2KH 4Y6DA 3ZZBA 1GJ7B 1KXEA 3TGIE 1C5NH 1G2MA 5TCAA 1P06A 1F5RA 1EJMA 3LGYA 1TPPA 2A1DB 1RJXB 1L1NA 4AG2A 1NBME 2PLXA 4A1TA 2KZ4A 1H9IE 2AEIH 1KSNA 1P11E 5HGGA 3M7QA 2P16A 4H42U 4U30A 2VIOA 2Y82A 5HMAA 1ZHRA 3UWIA 1D3QB 1ELGA 3O8CA 2ESTE 4ABGA 2VBCA 2AIQA 1T8MA 4ABFA 4WVPE 1BBRH 1MH0A 4MNWA 1V2WT 4K1TA 4ASUD 1P9SA 2BYAX 1DXWA 2TIOA 4I8KA 1UTMA 1RRKA 4DT7B 1C1SA 1BRAA 3BIVH 5EPYA 3KQ5A 5ETXA 3LGUA 3RXGA 3IITA 1EUFA 2WPKS 3OU0A 4MVNA 2ZHQH 1A0LA 1Z6JH 1BZXE 2ZGJA 1BBRE 1Y3VA 2CHAB 4YESB 2W7UA 2WV5A 1A3EH 1MUEB 1YPEH 2NWNA 1NRNH 2J9NA 2ZG0H 1P09A 3PTNA 3BG4B 1TBRH 1BTXA 1HPGA 2PSYA 2CMYA 1DPOA 1QTFA 2PGQB 3SU3A 1C1TA 5CE1A 1AHTH 2FX4A 3URCA 2CHAC 1VKYA 1MKWK 1BTPA 4WMFA 4Y76A 3PLKA 1EZSC 3EA8A 2VNTA 2AGGX 4ISOA 3BG4C 4AB9A 1XUIA 2WUBA 1D4PB 1QJ7B 1CHOG 4BAOB 5LPRA 3GDSA 1SGQE 1WTHD 2FP7B 2KR7A 1EAUA 3AAUA 3IG6B 1WOFA 2EEKA 3DSOA 4LXBH 5DG6A 2WSSD 3ZVGA 3MU1A 1TPOA 1GHVH 3SJ8A 5E2OA 1P0SH 4AGKA 5F53A 3PV4A 4NSVA 5EG4A 4AORA 5EQQA 1Y8TA 2PW8H 2GZ8A 3SQEE 2C3SA 2XC4A 1GHBG 3LDXH 3ZV9A 5ESTE 4BTUB 2KCAA 3ZZ3A 4UEHH 2Y7XA 4AZ2B 4A6LA 3SJKA 1KLIH 1QFKH 5KEDA 3MNBA 1THSH 1W8BH 1TAWA 1Y3UA 2F91A 1O2JA 3A7TA 1CGIE 1SGTA 4GSOA 3OAAD 2ZGCA 3LC3A 1BRUP 1C5XB 1KXCA 1K1PA 2UWPA 1C4V2 3KQEA 1O3GA 1O35A 4CH8B 1V2TT 2AFQB 4RKJB 1PPGE 1FZZA 1HRTH 1SKYE 1Q2WA 4IMZA 1NU9A 1YF4A 1TNJA 2FESH 2GMTB 1ELEE 5AFZH 1TRNA 2A45B 4M9FA 3GOVB 4PROA 4ZAEA 1RFNA 1WV7H 4GCHG 2WPDD 4JZEH 2PV9B 2ZECA 1Y5BT 3MU0A 4LK4A 3QUMP 3HKJB 1LQDB 3P70B 1WXRA 3ZVCA 1ELBA 1TX8A 1DX5M 4YOJA 3SUDA 1OXGA 4KTUA 1O2NA 4DIHH 3WW7A 3CS0A 1O2TA 3L33A 4FU8A 3LKWA 1C1MA 2GMTC 2F9BH 4B75A 5KECA 3A88A 1O3PB 2BDAA 5L6NH 1LHDH 2ZU5A 2DE9A 1S6HA 3KQBA 1V2LT 2OK5A 2ALPA 3M5NA 2WPJS 2J38A 1BCUH 2WYGA 3OEHD 5I46H 2J92A 2GP9B 4YOGA 1AKSA 1A3BH 1PQAA 4JYTA 2WUCA 1EATA 2FYRA 2VH0A 1MU6B 1SR5C 1G3EA
chains in the Genus database with same CATH topology
1MCVA 4UFFH 4BAKB 2BVXH 3I78A 3NPSA 2P93A 3UOPA 1TRMA 1J16A 4NCYA 3GY4A 4ESTE 1FAKH 4JYUH 5GPIB 4DVAU 1ZGVA 1IQHA 4B74A 3RDZA 1LVYA 1CA0B 2HNTC 1K1MA 4SGAE 5T3HA 1OP0A 2BQ6B 2TBSA 4K8YA 3A82A 1C5WB 1BMNH 1XUKA 2TGAA 1FN6A 3QZQA 1QY6A 1ZTJA 1C5OH 1JWTA 2YNBA 2XTTB 5DP3A 1EAIA 4XBDA 4X6PA 3P95A 2WYJA 3TGKE 4I8LA 2IN2A 2BB4A 2O8WA 3E0PB 1VR1H 3QZRA 5EXMA 3UNRA 4RN6A 1CA0C 1CQQA 1GJ9B 5LPFA 4NG9H 8GCHG 5L2YH 4FUEA 1HJ8A 4ABDA 2ZGXH 2GD4B 1QB9A 1EOJA 2AH4X 4U01A 3BTDE 3Q3XA 3P6ZB 4K5ZA 3RXSA 1SGCA 1E34B 1OS8A 1TOCB 1EP6A 2LNCA 3TNSA 4UONA 1ABJH 5K0HA 2FPZA 2PWXA 1ESAA 5DP4A 3T29A 3W94A 1PQ5A 2V3HH 4ZKOU 1IQFA 1THRH 3VPKA 5SGAE 5E0HA 1AZ8A 3MMGA 1FY4A 3NWUA 1NN6A 1CHOF 2OC0A 1Z1IA 4M7GA 1EOLA 2CJIA 2D2DA 2OP9A 3TGJE 2A7CA 1PYTD 3KHVA 1UK3A 1UTLM 2VIPA 4OS5A 3SU1A 5L2ZH 3V0XA 2GCHG 3JZ1B 4JYVH 1F92A 1SFIA 3DUXH 4Y8YA 2BX4A 5JBBS 3UPEA 3ODDA 3RXAA 7ESTE 3M5LA 2OXSA 1A5IA 1OWHA 4AFSA 1TNIA 2ZTXA 4X8SH 1Y3YA 1BMLA 1GHBF 1DS2E 3UR6A 2EI6A 5FBEA 1IQIA 1JBUH 2VVCA 4WF8A 2H9HA 1XXDA 1SVPA 1BHXF 2HOBA 2AMPA 3I29A 9ESTA 2OC1A 5EQRA 4OS1A 1C9PA 1PPCE 1V6DA 5ESBA 2W3IA 1QQ4A 4Q7YA 3MTYA 1LO6A 2ZHWH 3SV8A 2QAAA 2ZFQH 2UUYA 1V3XA 4X1RU 4LZ4B 1BA8B 1IOEA 2WV4A 3SU4A 2QYIA 1A61H 2CXVA 3H7TA 2W3KA 1JIRA 1SI5H 2ULLA 1EB1H 4YZUA 2G81E 3RXFA 5L30H 2BX3A 3QTOH 2AIPA 1MZDA 2STBE 2UUFB 4GCHF 4X8TH 1F5LA 2OC7A 1WU1A 2G5VA 1MQ5A 6LPRA 5A09A 2BY6X 1P57B 1GDQA 2EC9H 1LKBA 2W5EA 3MWIU 1O2HA 1PFXC 4D7GA 1SGYE 2OTVA 1W10U 2F9OA 2P59A 1FN8A 1G30B 4AG1A 3S0NA 4BANB 2ZPRA 4E06H 1DWEH 1DITH 1AY6H 1IQMA 1UVPA 1IAUA 3TH4H 3KL6A 1LVOA 1ZHPA 3EA9A 1ACBE 3MU4A 3RXCA 1TE0A 4UDWH 2ZDVH 2FS8A 2ANWA 1B0FA 1T7CA 3K65B 3MO3A 4BTTB 3TJUA 3KQCA 1LKAA 1UTPA 4ZUHA 2TGPZ 4FUDA 4DJZB 1HGTH 3AW1A 3PMBB 4E7NA 5HXFA 1O2RA 3C27B 1K1OA 3AAVA 4D7FA 5GCHG 4FUJA 1IQEA 1XKAC 4UE7H 3HKIB 1X7AC 1H9HE 3M61U 1DY9A 4ABHA 5GJ4B 1SQAA 3H7OA 3T28A 2P3UB 5HM9A 1LHFH 3HK3B 2Z9KA 2QY0B 1GDNA 4UFEH 4Q7ZA 3P17H 2ZPSA 4Q2KA 2D26C 1AKSB 1WCZA 1H1BA 3BTHE 1UK4A 1SGFG 5DJ7A 1V2QT 2ZCHP 4THNH 2VIWA 3BF6H 1EJAA 1NRPH 3DD2H 1C4U2 2AMQA 2UWLA 1EPTA 1C1QA 2ZNKH 1ZYOA 1TNGA 3MU5A 8GCHF 3B23B 3EQ0H 2A4OA 2ZP0H 3LIWA 4I8GA 1GHXH 2H1UA 1SMFE 1O3AA 1MZAA 1O3IA 4OS2A 1VJ9U 1O31A 1LPGB 1HV7A 3RXDA 5EU8A 4LZ1H 1BJUA 1FQ3A 2AMDA 1O0DH 2KAIB 4CR9A 2BM2A 4J1YA 2FX6A 3RXRA 2QXHA 2FOGA 3RLWH 2XWBI 3TK5A 3PLPA 1AFQB 1P2NA 4MPUA 5F03A 5C20A 1CE5A 3TPIZ 1PYTC 2PSXA 4AFZA 2LPRA 2P94A 4U32A 4AGJA 3A8DA 2BDBA 1ZTKA 2Z7FE 1L1JA 3SHCH 3SHAH 3PLBA 1QB1A 3RXOA 2C8YB 1B0EA 2GCHF 1FV9A 2ZDMA 3LGWA 2ZHEH 2ZQ2A 1W12U 1P3CA 2ZU1A 1QBVH 1AFQC 1FY1A 1UVOA 1GBBA 2A5IA 4CRDA 1NFUA 2QF0A 1NU7B 3C1KA 2WPIS 3P8FA 1ID5H 1BIOA 4Y11E 2WPLS 2V35A 4IN1A 1YC0A 3NXPA 1GBHA 2HVXA 3CENA 2QA9E 2G52A 1Q3XA 4DGJA 2XBYA 4X1QU 2G8TA 3UIRA 2C8XB 3RC5A 1E0FD 1TRYA 4NFFA 2XC0A 2G4UA 1N8OB 2BLQA 1AGJA 2ZI2H 3QTVH 1C2HA 4XBCA 1UTQA 5FHTA 1CT0E 2PUQH 1FY3A 2ALVA 5A2MH 2A7HA 3SQHE 1ZPBA 6ESTA 4NFEA 1E35B 5A8ZA 1VJAU 1TPSA 1XM1A 2GVFA 3MNXA 4OS4A 3SU6A 1DSTA 3GCTF 1TPAE 1T8OA 4JK6A 1GHAG 4MNVA 1S84A 2VINA 1P8VC 1YKTA 1GBEA 1VITG 1J9CH 1N8OC 2Z3EA 3ZVDA 3A80A 4NIWA 2VGCB 1SLWB 3D62A 1AUTC 1GBTA 1LHCH 2VB0A 3M5OA 1GI7B 1YCPK 3P8NA 2BD3A 3M35A 2CGAA 1P3EA 1PPEE 2ANYA 1LTOA 2OD3B 3MNSA 4UFGH 4E05H 3RM0H 4X8UH 1HFDA 1HAIH 1O3LA 1THPB 5JDUB 5F6MA 1HCGA 4JZ1A 3V7TA 4Y7AA 3M3TA 1C5UA 1C1RA 1JIMA 4Y7BA 3FVFB 4I7YH 4HFPB 2VGCC 1O33A 3QLPH 2H5CA 2RCEA 4DOQA 4Y8XA 2HWLB 3ZZ8A 1XX9A 1ARCA 3WY8A 3OY5U 3EA7A 3GISB 1HAZB 4X2YA 4MG3A 5FXLA 3KNXA 3AW0A 1C2JA 1PQ8A 3H5CB 3PO1B 3LJOA 3U98H 5GCHF 3BTGE 1OWKA 4YO9A 3EDXB 1J14A 3BTQE 1EZUC 4QT8C 1O2IA 1O2WA 5C67A 4IS5A 1B7XB 1C5SA 2GDEH 1T8LA 2A5AA 6CHAB 2XNIA 1EAXA 1P2IA 4JZIA 2PGBB 3Q00A 1SGRE 2C90B 5EPNA 2BD5A 1GJDB 1QBOA 3ESTA 3PO1C 3RXTA 4WXVA 1EQ9A 1L1GA 1J17T 1GI9B 4UD9H 1L4DA 1A1RA 3VFEA 4BOHA 2QXIA 4ZHAA 5DP9A 3T5FH 2NU0E 1O2MA 3QGJA 1C2LA 3TH3H 4YOIA 1QB6A 3S69A 3U1JB 5CMXH 3RXKA 1QL7A 2A0QB 3OYPA 6CHAC 1P10A 1Q31A 2ZPQA 1O2VA 4R8TB 1KXFA 1FAXA 5EGMA 3DFJA 2XBWA 1F7ZA 4YLUA 2ZA5A 2ZTZA 2ZFPH 3SO3A 1OWDA 3P92A 6GCHG 1HAXB 5GWZA 2OLGA 2C4FH 4JZDH 5FX5A 3L6PA 1EPTB 1C2DA 1W0YH 2Z3CA 1B5GH 3A81A 1YCPH 1O5AB 1T8NA 2AERH 2PKSB 1HAVB 1YPLH 2XBVA 1AWHB 2ZF0H 1V2VT 1QURH 4DW2U 1QNJA 1A0HB 2BTCE 5B6OA 3RM2H 1ETTH 5DP5A 1D9IA 2TGDA 2UWOA 1PPBH 3S9AA 3ATLA 2AGIX 1Z1JA 2FOEA 1EPTC 1O2KA 3DA9B 2A2XH 2BD4A 2H9TH 1NRQH 2RDLA 3Q3YA 1P01A 1VITH 1NESE 1C5TA 2PKSC 2R2WU 1IHSH 1GJ8B 1HXEH 1BMMH 3KCGH 1F0SA 1XUHA 1TALA 2PTNA 4TWWA 2Q1JA 1DWBH 1NTPA 1BRBE 4X1PU 1ANCA 2FOBA 1D6RA 1U6QA 1SB1H 1S82A 2A4QA 1V2MT 5H4IB 2ZQ1A 1FUJA 5FAHA 1MTNB 4WY3A 3P8GA 3TITA 1WTGH 4ZXXH 4HTCH 1BDAA 4ISHH 1HB0B 1G3BA 1GHYH 1GJAB 3QGNB 1SL3A 1P2KA 1NFYA 1C1UH 5ABWA 1GBAA 1G9IE 1O3CA 1BTZA 3KIDU 4X2VA 2FEQH 3ZZDA 4KKDA 4FUCA 3O8BA 1GG6B 1K1JA 1ELVA 1KLTA 1GHAF 3A7WA 2HALA 1XUFA 1MTNC 3L3TA 1GGDB 1W13U 2BY7X 1C5QA 1K22H 2FOCA 5EODA 2ZFTA 3GCNA 1PJPA 1ELTA 1ETRH 1VITF 3PMJA 1MKWH 4OS7A 3UUZA 2IOTA 1D6WA 4O3TA 3UY9A 1EZQA 3O8DA 4X6NA 2R9PA 1AZZA 1FMGA 3GY2A 2JH5D 1GG6C 1NROH 4I33A 3S9CA 4BAHB 1GPZA 5FBIA 3RMOH 4XDEA 2AGEX 2OC8A 3ZZ7A 1HIAB 1OX1A 1GGDC 3SUGA 1CGHA 3EAJA 1SFQB 4D76A 1BTUA 5A8XA 3RLYH 1G37A 3SI4H 2Z94A 2SGDE 2ZFSA 1D3DB 5C1XA 2R3YA 2SGEE 1AO5A 1FIZA 1O3BA 1O2QA 1TMTH 1UVSH 2FOFA 2QN5T 3E90B 4MNXA 2DUCA 2OQUA 2HPPH 1HYLA 1SHHB 2SGAA 5GIBA 2KAIA 1NO9H 3D65E 2QV1A 4I32A 1MTSA 2OINA 3SV2H 3UQOA 3DHKH 3AASA 4KGAA 5EOKA 1C2IA 2B5TB 4FVBA 4B73A 1V2ST 3U1IB 1C1NA 1V2NT 3A7YA 4BAMB 1ZSLA 3ZVBA 1MBQA 2K1QA 4BTIB 2O9QA 3W95A 1GMDG 1S85A 3D49H 5DO4H 1XMNB 2OBQA 2Q6DA 2F9UA 4YTAA 3BEUA 1HAPH 1OPHB 1F0TA 3ZZ5A 4X8VH 1L2EA 1HBTH 3A84A 2F9VA 4K2YA 1ETSH 1Z8RA 2PUXB 2FTLE 1CO7E 1V2RT 1MTVA 1TGSZ 4NZQA 1BTYA 5F8XA 1V2KT 2A7JA 4Y0ZE 4K3JA 3BEFB 2PFEA 3BV9B 3MU8A 2BMGB 2BD9A 1O2XA 3SV6A 1W14U 1C2GA 1D3TB 2NU4E 2XCNA 5JBCS 2GX4A 5IYTA 1LHEH 1OSSA 2Y80A 1GL1A 3OSYA 2B7DH 1GJ4H 2BD2A 3SV7A 2H9EH 1ESBA 1QQUA 1W0ZU 6GCHF 3F68H 3RXHA 1EXFA 3SU5A 1O3FA 3LGTA 1FI8A 2BDCA 3SI3H 2Y5GA 1C2EA 2BVSH 3RXIA 2G00A 1C5VA 1EP5A 3QX5H 1MD7A 3DT0H 1KY9A 3PMAB 1PPZA 1WBGB 2BDGA 4MDSA 4INHA 1Y3XA 3M3SA 1T31A 2NU2E 2BDHA 1BQYA 1K1IA 1ZSKA 2FI5E 2GTBA 1C5LH 1GHZA 2R3UA 3VXEH 3K9XB 4INKA 3ZZ4A 1GBJA 2BDIA 1SG8B 4DY7B 4E7RG 2VVUA 1N1LA 1AVXA 5LH8A 2VIQA 3IWMA 2QC2A 1H4WA 1O2SA 3GDUA 4A1VA 1K1LA 2XYAA 3RU4E 3GCTG 1YPJH 4XSKU 1ABIH 1ZTLA 3PWBA 2O8UA 3DFLA 4MPWA 3OX7U 1G36A 2G55A 2JH0D 3SUFA 2XW9A 4HGCA 2UUKB 5EQSA 1O3KA 1BHXB 1QA0A 3PYHA 5LPEA 1K21H 1ZGIA 3GYLB 2OCVB 1VGCB 2VWLA 4X1SU 3E0NB 1YCPM 4CRBA 1C5RA 5BPEA 4FUHA 3T27A 1QL9A 2A5KA 4AN7A 5FPSA 1HAHH 1GDUA 4D9RA 4ZKNU 1RTLA 1OYTH 2ODYB 1GMHG 7LPRA 1PQ7A 1GJ5H 3RXQA 1QHRB 2F9PA 3NUMA 5A0AE 1Z8JB 3A87A 1CSOE 1YP9A 2DE8A 2FTMA 4AX9H 1VGCC 1TX6A 3B8JA 1O2OA 1C4Y2 3ODFA 1SGDE 1KXDA 3UFAA 4AB8A 2FODA 3ELAH 3SGQE 4HI3A 3MH4A 1LDTT 3BTWE 3RMLH 4VGCB 3RC4A 2ZU4A 4AFUA 4K60A 4DIIH 3LU9B 1GHWH 1UCYK 1Y5UT 1AIXH 3GY3A 1Z7KA 1OWEA 5EW1H 2TGTA 1ELDE 3M7UA 5G4BA 2HGTH 3TK6A 1HUTH 2Y6TA 2BOKA 2NU1E 2BLVA 3FANA 3R3GB 4D8NA 2Y81A 1P2OA 1K2I1 4DCDA 1F0RA 5F8ZA 1W7GH 2EA3A 4X0WU 3A7VA 1CT4E 1ZPCA 4VGCC 4O03A 3V13A 1OP2A 2A31A 4ABIA 2G5NA 2ZTYA 3T2NA 3KEEA 2ZCKP 1VCWA 1GVKB 1O2UA 5DGJA 2WPHS 4ZH8A 1C5MD 1CBWB 5BRRE 1BTWA 1HAVA 1O2GH 2SGQE 4Y79A 2CF8H 5T6GA 3TVJB 4OGYA 3U8RH 1GI6A 1GMDF 1GBLA 3A83A 1C2FA 1TGTA 1OOKB 1YPHE 4BXSA 2ZIQH 1TQ7B 4X2XA 3EYDA 3F6UH 4F4OC 2VVVA 4CRCA 1BB0B 2GDDA 1MTUA 1TB6H 3GYMA 4K1SA 3ZYEA 2SNWA 3TNTA 4GPGA 1SLUB 1DM4B 2ILNA 1SGNE 4O9VA 2AYWA 2BD8A 4IW4E 2C93B 5DP7A 3GDVA 4CRGA 3OTJE 1GBFA 2RA3A 1CBWC 1KDQB 1WAYB 3KF2A 3BG8A 1SC8U 1TA6A 4FUIA 4NIXA 1DWDH 2ZGHA 1J8AA 1LQEA 1YBWA 1IQGA 1O30A 3QK1A 4TYDA 1ELAA 4H6TA 1UHBA 1NZQH 1XUJA 4NWLA 1H8DH 1P9UA 5C2ZA 1Z8GA 2BLWA 1E38B 2SFAA 1ZMNA 4Y71A 1IQNA 1SGIB 1SPJA 1QGFA 1FNIA 3CS7A 4B2BA 2M5TA 1GVLA 3QWCH 1AU8A 2ZDAH 3CP7A 1BBRK 1HXFH 2V0BA