2ZCLP

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Prostate-specific antigen
total genus 52
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP01
1MUEB 5SGAE 1ELEE 1BDAA 3PYHA 1O2SA 3M5OA 1EPTB 1MKXK 3PO1C 2BVRH 2Y5HA 3VPKA 4NA9H 2BLOA 1INCA 2SNVA 3GYLB 3RXFA 2P3UB 3RUOA 1VCQA 1XUGA 2XC0A 3MWIU 2P59A 2CF8H 2BDGA 2VIQA 1QRZA 2FI4E 1P09A 1FY8E 1BTZA 3RXKA 2BXUH 1RS0A 1FZZA 3SJOA 3RXHA 1HB0B 1HDTH 3V13A 4WXIA 2C8WB 2D1JA 2FLRH 2ZC9H 1Z71A 2P16A 2VNTA 5FX5A 5GPIB 2PUXB 3LKWA 4MNYA 2G8TA 3S69A 1BA8B 3TK9A 3D49H 1TRYA 3SJ9A 1ANBA 4X8UH 1EAIA 1CE5A 1GGDC 1DPOA 3ESTA 1RFNA 3NK8A 1BBRH 1FAKH 1RTLA 1TONA 2DE8A 1P03A 2PHBA 2PKSB 3FZDA 5GIBA 3S7HB 2IOTA 1GCTB 4AFSA 5CMXH 3SI4H 1HIAB 4MPWA 2BHGA 3AVZA 2BY6X 4WMEA 1ELTA 2WPKS 1LHGH 5I25A 1MQ6A 4DOQA 2ZFFH 3M35A 1FPCH 3T29A 3TNTA 4X6OA 4ASHA 2VWLA 1T31A 2D8WA 3A83A 3BTDE 2OC1A 1SLWB 3MFJA 5JBTA 5T3HA 2BVSH 1GBJA 1MKXH 3MU5A 2WV4A 4IMQA 1FLEE 2XBVA 2A7CA 1ZTLA 2GMTC 3QX5H 1C5VA 3GCHC 1GI7B 1NU7B 4CREA 2OD3B 1S83A 1QFKH 1C1OA 2GCTC 2PUQH 3PWBA 1CU1A 1VITF 2Y81A 2Z6BD 2Z9JA 2XW9A 1D3PB 2O8LA 3M7UA 3TVJB 3NWUA 1C5ZB 1VZQH 1SLVB 3DFLA 5EU8A 1G2LA 2V0BA 1O2LA 2RDLA 3S9AA 3K6ZA 2A1DB 3MMGA 5ETXA 1UCYH 3UWIA 2GDDA 2OP9A 5JBCS 3PTNA 4AFQA 1O3OA 4AYYB 1PPGE 1BIOA 1ZZZA 1DLEA 5L30H 3P8NA 4FUDA 4ABJA 1VJAU 1JIMA 4YT7H 2XTTB 4ZAEA 1IHTH 2FEQH 2NU3E 2QXJA 3I29A 5DP6A 1UTPA 1C1VH 1ELAA 1P10A 2F83A 1O2OA 2Q6DA 4MNVA 1WQSA 3PLKA 4IC5A 8KME2 2FI3E 3T2NA 2FYRA 1ZPBA 1ARBA 1GI2A 2ZG0H 3A7XA 3PWCA 1C5TA 5FBIA 1XUKA 1G2MA 4ISNA 1HIAA 1IQIA 1QJ7B 1GWAA 3E0PB 2ANMH 1C2IA 2ZKSA 1AI8H 1GI6A 3A7TA 3MU1A 5EXMA 1GGDB 4E7RG 2Z9IA 2A0QB 2V3OH 1ZHPA 1P11E 1O2QA 1AFQC 1H4WA 1ZJKA 5E0GA 4Y10E 4NWKA 1QL9A 2XBXA 2AS9A 2OBOA 1V2NT 1GVLA 1JWTA 2ZGBH 5C2ZA 2R0LA 4DIHH 3VXEH 1SGFA 3A89A 3VB4A 5H4IB 5E0HA 3SNEA 2C8XB 1K1MA 1IQMA 4GHQA 4ISLA 4B74A 1W8BH 1Y3XA 3SV9A 1TGTA 4ABEA 1ZPZA 2VH0A 3E8LA 2PGBB 1F92A 1NRRH 2VGCB 2FS8A 3M36A 3KQDA 3LU9B 1EP6A 1CA0B 2QXGA 2Y5FA 4JK6A 2RA3A 4Q7XA 2VWMA 3HK3B 2Y6TA 4X1RU 4IC6A 2ANKH 3DFJA 1XKBC 4ABFA 4ABDA 1J17T 2VU8E 1S6FA 4ZHAA 1SGFG 1EAUA 1O5DH 4GUXA 2QF3A 1FAXA 3RXIA 1B0EA 2G81E 5DK1A 1HBTH 2OXSA 1BBRE 4HFPB 1UK2A 2FOBA 3V3MA 2J4IA 1YPLH 5E2PA 4MNXA 1Z8RA 2AIPA 3LGYA 5EQQA 3RU4D 2GZ7A 1TOCB 1W11U 2IJOB 4MLFB 1CHGA 5T6FA 3GISB 1FY4A 1NO9H 3P95A 1S85A 4OS7A 1Q2WA 3SJ8A 4WXVA 4WH6A 1SGEE 1Y5UT 4INLA 1O31A 2C8YB 1G36A 4PROA 2R9PA 4D8NA 3TJUA 2FO9A 5EGMA 3KIDU 2HVXA 4CHAC 1L2EA 3I77A 2UWLA 1O2UA 1GPZA 1BTHH 2B8OH 2FI5E 1LHCH 1PPHE 1PYTC 1W12U 3LGTA 3UREA 1CA0C 3QTOH 2ZFQH 3TPIZ 1MBMA 1FQ3A 1LQEA 5BRRE 3SU1A 3M7QA 3FP7E 5CHAC 3ZZ4A 4Z6AH 3TJNA 1AB9C 1JRSA 3PLPA 1EAWA 1O39A 1QL8A 1C1QA 1DITH 3FFGA 3SORA 2ZHQH 2F9BH 1TBRH 1O30A 1GHXH 3KQEA 3QK1A 4A1XA 1GMCG 1MMJN 3M3VA 1RXPA 2GKVE 2GV6A 1HAHH 1T8LA 2OUAA 3K9XB 1SPJA 1YPEH 2UUFB 3URCA 2PW8H 3QGJA 3LDXH 4E7NA 1HPGA 3A81A 3T28A 1K21H 4I8LA 1LCYA 1BHXF 4YT6H 1KXBA 2HNTC 3GCTF 1SQTA 2A4QA 3RXJA 3P70B 1L1NA 2PTNA 1KYNA 2TBSA 5EG4A 3DA9B 1NFWA 1P04A 5AVDA 1DUAA 1Z8GA 3EE0B 2BLVA 2ESTE 1O5CB 1K1PA 1O3MA 2PV9B 1Y3UA 4MVNA 1NZQH 2PFEA 2ZU1A 2TGTA 1DY9A 2TPIZ 1GBKA 3EDXB 1BOQA 3UQVA 2BXTH 4ABBA 3GDUA 2BDAA 3N7OA 4MNWA 1V6DA 1YCPH 1FI8A 1GHAF 1A7SA 2FIRH 1LVMA 1V2QT 4B76A 1THPB 5HMAA 3BTEE 1N1LA 3UPEA 3IITA 4CRAA 1ZSJA 3SU4A 3T62A 2AMQA 3ZVDA 1PYTD 1O3CA 1QJ6B 3OTJE 1GJ9B 5FPYA 4K60A 5FPTA 3VEQB 5DKMA 1YPHE 5JB8S 4X8VH 3UOUA 3AAUA 3E90B 3W95A 4X6PA 6GCHF 1EKBB 1P9UA 3GICB 5T6GA 5LGOA 1TNGA 3SU0A 3TH2H 4JZEH 3GY7A 4MTBA 2H1UA 4CRBA 4AB8A 1K1JA 4CHAB 3ZZ6A 2FX4A 1FIZA 1GDQA 2ZECA 3UOPA 1H9LB 2ZDAH 3BEFB 4K3JA 2XC5A 4NWLA 4B1TA 1GHWH 2F9VA 3UNRA 3STIA 2QA9E 1C1RA 3A82A 4VGCC 5CHAB 1G30B 3OU0A 1AMHA 1ETRH 2PWXA 2W7UA 3BEIB 5EQSA 2ODQA 1J16A 1AE5A 2A45B 1W14U 2W3IA 5B6OA 2GZ9A 1BMMH 4YTAA 1O2JA 3SQHE 3A8AA 1DWEH 2EEKA 1AIXH 1XUIA 1AN1E 9LPRA 1HJAB 1SFQB 2FPZA 1ID5H 1V2MT 2GV7A 3ATLA 4A92A 1DE7H 1ACBE 4F4OC 3OY6U 3T27A 3PV4A 2ZTZA 2FOHA 1Z7KA 2A32A 4VGCB 1DWBH 1TAWA 2P8OC 2OCVB 3LONA 4SGAE 4WMDA 1QQUA 3S9BA 1GHAG 3JZ2B 1WBGB 2UWPA 3BTHE 2AMPA 1Y3VA 3ZZCA 1GBTA 4NIXA 3MNSA 3L6PA 4Y8YA 3DHKH 4X2VA 3RXUA 2BQ6B 4Z0KA 1O2TA 2XWAA 2ASUB 1DDJA 1HGTH 1GBHA 1NFXA 3SNBA 2OINA 3RXMA 3S0NA 2C4FH 1PJPA 4ABIA 1T8MA 2Y7ZA 3A84A 3IG6B 4TYDA 1EPTA 1PQ5A 5IDKA 2FZZA 2SGQE 3Q3XA 3RM2H 2R3YA 1BRCE 2HRVA 3LGUA 1BITA 1P2NA 1PQAA 1GI5A 5HM2A 3P6ZB 2FMJA 1Q31A 1B0FA 4ZXYH 1TPOA 1OOKB 4WMFA 1UCYE 4GLYA 1SI5H 1MU6B 2VB0A 4B75A 2HPPH 1AUJA 1DUEA 5K7RA 2TGPZ 3ATWA 3FP8E 1TALA 3F9EA 1YF4A 3ZZDA 1EXFA 1TPSA 1W3CA 1F0TA 4WVPE 1PPFE 2BMGB 3D65E 1ARCA 3UY9A 1ETSH 1O5FH 1W2KH 3A8DA 1ZSLA 1O3LA 1TX6A 2BLQA 1A4WH 1C2GA 1C5XB 4UEHH 2GX4A 1VGCC 1HJ8A 4ABAA 3EQ0H 1GJ7B 3D62A 3ZZ3A 3L33A 3RDZA 2HPQH 4J1YA 3U1IB 1GBLA 1NC6A 1TOMH 4ZHMU 2J2UA 2OTVA 1OKXA 1UTNA 1HNEE 1TFXA 2HOBA 1FN8A 2AGEX 3ZZ8A 1S5SA 2Q1JA 4RSPA 4B73A 1EPTC 4XE4A 3ODFA 2BM2A 3NKKA 3VXFH 1W13U 3DUXH 3GY3A 2R2WU 1OYTH 1GI0A 1ZMNA 1GHVH 4O3UA 1RTKA 4TY6A 1W10U 1TGCA 5J4SA 1C9PA 1ELBA 1OS8A 1CSOE 4GCHG 2PKAA 3SI3H 1QB6A 1F5KU 2I6SA 2EI6A 1SGPE 2SFAA 1SG8B 2CV3A 2Z3DA 5C5OA 3F1SB 5A0CA 5A8XA 3M37A 3LJJA 2FXRA 3RP2A 1LKBA 1MU8B 1UHBB 2QXHA 3O8RA 1JMOH 3GCNA 1O3PB 4I31A 5FAHA 2BTCE 3K65B 1ZYOA 4LZ1H 3ZZBA 2GTBA 4NSVA 2EA3A 3BTQE 1H1BA 1SMFE 1XXFA 4X8TH 5JDUB 3LOXA 2VVVA 3W94A 2ZDKA 1AZZA 2CHAC 2XBYA 1Y8TA 4YOGA 5JB9S 1THSH 1E36B 3PMBB 2BDCA 3HK6B 1EUFA 3FP6E 1FNIA 4D7FA 5ESTE 5E0JA 1GCTC 3U69H 1NFYA 3RXRA 2WUBA 4GHTA 1G37A 4K8YA 3SBKA 3ZVGA 1UK4A 1A3EH 4NFEA 2OC0A 1V2KT 4K5ZA 2NWNA 2UUKB 2TGDA 3MO9A 2AEIH 4X1SU 4X1NU 3BTTE 1RTFB 1YLDA 1C5NH 1C5RA 3I78A 1WTHD 1BJUA 1NM6A 3A8CA 1LKAA 4NSYA 1ELFA 1P9SA 1O2XA 1ELDE 2J34A 3B23B 1NTPA 1P8VC 4HZHA 3UNSA 2F3CE 1LPGB 5DP8A 1LDTT 4ISOA 1HAGE 4XBCA 1AWFH 3F6UH 3M7TA 4AG1A 2WINI 1FDPA 2IN2A 3MO3A 4OGYA 1C5OH 1DX5M 3E91A 2Y80A 4JZ1A 1C4Y2 4H4FA 1W7GH 3LGWA 1DWCH 3SHCH 4D9RA 1Y59T 1OXGA 1Y5AT 1C5SA 4CRFA 2H9TH 1JBUH 3SJKA 4ZXXH 1CVWH 3MH5A 5CE1A 1O2RA 1VR1H 1BTYA 2BDYA 1DT2A 1E38B 1IQGA 1LMWB 1ZJDA 1P2IA 1KXAA 4K69A 2G5VA 2P93A 4AFZA 1JOUB 3KGPA 2OQ5A 1Y5BT 3TLOA 3E6PH 5FPSA 4DCDA 1MTUA 4YESB 1KTTB 1EZUC 1S0QA 1AVGH 1G9IE 2EI8A 4FUGA 4OS4A 3PMAB 1CT0E 5LPEA 1Z1JA 1ELCA 1J14A 1O2PA 4FUHA 2LPRA 3HKJB 1IHSH 5F8TA 1GBEA 3G01A 3RXGA 2A7HA 2B7DH 3STJA 3CENA 3LC5A 1GI3A 1FPHH 2WPLS 3PO1B 3LJOA 1ZMLA 2OC8A 1C1MA 4FU9A 3FZZA 2SGPE 4X2XA 2CMYA 3SHAH 1O2MA 2ODYB 2BDBA 2FS9A 2H9HA 1O3FA 1LHFH 1AY6H 1O5EH 1DSTA 3QN7A 5AF9H 4Y7AA 1O32A 2JETC 1O3IA 3SUDA 3A87A 1GCDA 2WUCA 4I8JA 3U8RH 5C1YA 1GDUA 4UDWH 5TCAA 4R8TB 2Z9GA 3F68H 1O3DA 4CBOA 1A0JA 5HM9A 1PPBH 1MKWK 1S0RA 1NRNH 1KXCA 1SB1H 3RXBA 1TRMA 1WUNH 2GMTB 1C9TA 1MBQA 1KDQA 1Z6EA 1TGSZ 3JZ1B 3RXPA 2ZTXA 3MU0A 1QA7A 1WCZA 2SGEE 3RXCA 3RXSA 3KF2A 1JXPA 1F7ZA 4O97A 1OWJA 3SUGA 4WJG2 4NA8A 5A8YA 1QTFA 4O9VA 5DP7A 2WPHS 1GJ8B 1FONA 4ZKSU 1GMCF 1AHTH 3RC6A 5G4BA 2K1QA 2ZPQA 2ZGXH 3GYMA 2J95A 2A7JA 3E1XB 2WYJA 3ZZ9A 4YOIA 2PKSC 1CGHA 1CGJE 4DT7B 3KQBA 3P8FA 1M9UA 1SGCA 1RD3B 1K1OA 1W7XH 3OYPA 4ISIH 2PTCE 1P2QA 1GBAA 2Z3EA 1DS2E 2W7SA 3MNBA 4THNH 1KIGH 1TQ0B 3GY8A 4TY7A 4XBBA 2J92A 3T26A 4AG2A 3EYDA 5EW1H 2G52A 3HPTB 2F9NA 1ELVA 2XRCA 1F5RA 4LXBH 1LHDH 1THRH 1MKWH 1GMHF 4D9QA 2QN5T 2VIVA 1IQKA 4U01A 1QGFA 4K1EA 4Q2KA 3R0FA 1GHZA 3M61U 4Q80A 3SNAA 1QR3E 2ODPA 3LGIA 1A0LA 2C90B 3RLYH 3GCTG 1O2NA 4ESTE 2RCEA 1G3CA 2GT7A 4F49A 5GCHF 1AD8H 1IQLA 3SU5A 2STBE 4U2WA 1GJ6A 1BRBE 3P92A 3ZYDA 2HWLB 1DSUA 5GXPA 1UMAH 4SGBE 2JH0D 2Q6FA 1NY22 1ESTA 4DG4A 3VB6A 2QXIA 2BY9X 2PGQB 1CA8B 1MTNB 5K0HA 4YZUA 4AFUA 2PKAB 2R3UA 1TBQH 1EJNA 3E3TA 1Z1IA 5J4QA 2B9LA 2Y7XA 2ZGCA 1BMLA 1AUTC 3MHWU 4NIWA 5F03A 2YNAA 3SQEE 1MQ5A 3BIUH 2G00A 1GI4A 4CH8B 1E0FD 4I7YH 3S9CA 1X7AC 2H5DA 1AZ8A 1DM4B 1GJ5H 2ZU2A 1G3EA 4FU8A 1KY9A 1AGJA 1BB0B 1TIOA 3GCOA 4Y7BA 1P01A 2ZI2H 5DG6A 3M5NA 3MYWA 2ZDVH 3ZVEA 1TNJA 2QIQA 3UR9A 1QRWA 1C5WB 3MTYA 5E8EH 1C1WH 1J15A 2ANWA 1UTLM 3NCLA 3SV2H 3L3TA 1RIWC 3UR6A 1EZQA 4A6LA 2XCNA 2OQUA 1D9IA 1MZAA 4BTUB 4ZH8A 1GBBA 2A2XH 1MD8A 1V2JT 1N8OC 1LHEH 2A4OA 1V2LT 2HALA 3AASA 5LH8A 1E34B 1FUJA 2TGAA 2FTLE 4A1TA 1AFEH 4JMYA 1QB1A 5I46H 4ZHLU 2ZDNA 3RXAA 3LPRA 2AYWA 1SSXA 5C1UA 1O3BA 3TH4H 2BYAX 2VJ1A 1HAIH 1EAXA 3VB5A 2ZZUH 3S7KB 3ZZ5A 3H7OA 4KTCA 2VIOA 3FANA 2G4TA 2VIDA 2CXVA 2D2DA 5DP5A 1ZRKA 2UUYA 4XDEA 2BVXH 1E35B 3GDSA 2ZDMA 3CS7A 4DURA 1HAOH 1C2KA 3HATH 2O9QA 1AU8A 2WPJS 4JZIA 4X1QU 1BJVA 1TNHA 1CQQA 2NU1E 1DOJA 5AHGH 3K2UA 4ZKNU 3SU2A 8ESTE 2BOKA 1C5UA 1BRUP 3OSYA 4TWYA 4XBDA 1SL3A 2VWOA 1A5GH 1F0RA 2G51A 1F0UA 1P2MA 2PLXA 3SV6A 1Z8IB 2V35A 1HYLA 3ATIA 1TLDA 2TIOA 3E16B 1RGQA 2CN0H 1CT4E 1O3GA 2ZGHA 3HKIB 3A7VA 2OBQA 3T25A 2BD3A 2BLWA 7LPRA 1C2LA 1D3DB 4RKJB 3BV9B 2ZPSA 3MOCA 1GG6C 3LIWA 1QBOA 3BTKE 3VB3A 4NIVA 2BDHA 1SHHB 1GL0E 1GBFA 1UHBA 4KTUA 1FIWA 1MD7A 1A0HB 5AFZH 4AGJA 1TB6H 1BTWA 3BSQA 1HXEH 2STAE 1SR5C 3P8OA 5GCHG 2VGCC 2FYQA 1QIXB 1YC0A 3RLWH 4BANB 4Y76A 5TCCA 2ZHFH 1OP0A 1L0ZA 1GI8B 3UIRA 3A7WA 5JBAS 3EA8A 4HTCH 4TPIZ 2BX4A 1OWKA 1HJ9A 1GJCB 1PFXC 1V2WT 2O8UA 1AVXA 1SVPA 3RXEA 4ABHA 1QNJA 2W26A 3PMHB 4FUFA 2EI7A 3RMOH 1GDNA 1O2VA 4Q7YA 1P2JA 3A85A 2GCHF 3MH4A 3M3TA 5ABWA 2AGGX 1YPGH 3BTGE 4ZROA 2OLGA 4LZ4B 1QRXA 3QLPH 4FVDA 2F9OA 4ISHH 2P3FH 3LT3A 4BTIB 1FXYA 3KHVA 2WPIS 4U32A 5EXNA 2BZ6H 1U6QA 2BB4A 4CH2B 2GVFA 2ZWLH 5C20A 1QQ4A 4OGXA 3TJOA 4BTTB 1P0SH 1N8OB 1DLKB 2ZIQH 1O33A 3PM3A 2VIPA 2QGRA 1FJSA 2HNTE 2BY7X 5JPMH 3KN2A 4D7GA 1BQYA 2P95A 1S81A 1TMUH 1W0ZU 3ITIA 2VINA 2XYAA 1C2EA 4AX9H 1D3QB 3ZZ7A 2PR3A 2XCFA 1HUTH 1K9OE 1L1GA 2A5AA 5C67A 3HGPA 1EOLA 1NPMA 3A80A 1O2ZA 5FXLA 1EASA 2FOCA 2FDAA 3UTUH 1KLJH 1TPAE 2QAAA 5DP3A 3SO3A 1CGIE 2QCYA 4YM9A 1L1JA 1SGIB 4X6NA 2ZU3A 1O2GH 2XBWA 1ZGIA 1OWHA 4JCNA 4ZKOU 3ZVBA 1P57B 5A2MH 1LQDB 1LTOA 2R2MB 5DP4A 2B0FA 1IAUA 3RM0H 4DY7B 2ZFPH 1YPJH 5F8ZA 1O2WA 2FOGA 3PB1E 3BTME 3BTFE 1TNKA 2SGDE 1MTNC 1TRNA 2BD8A 3MU4A 1KLIH 1GVKB 1ANDA 1C2MA 1GMDG 1BHXB 4QT8C 1YLCA 4Y71A 1T8NA 2BZAA 2ZO3H 1TX8A 2FESH 2HLCA 3KEEA 1C4U2 2Z9KA 1HAPH 2ZU4A 2TRMA 1A5IA 1RJXB 3M3SA 4MPUA 2NU2E 2ZP0H 1NS3A 2YOLA 2PSYA 1WAYB 1XM1A 1ZR0A 3O8CA 1O3EA 4CR9A 2FOAA 2GGVB 3MNXA 4X1PU 4ZKRU 1LVBA 3ZVAA 2FODA 3ZZAA 1B5GH 3RMNH 1O36A 3ZYEA 5GWZA 4UONA 1P05A 3OY5U 1OP8A 4KELA 3QDZB 1AB9B 1YP9A 1SFIA 1CBWC 2FX6A 4IN1A 1MAXA 1UTQA 2H2ZA 3SJIA 1C1NA 4BXWA 1BTXA 1K1NA 3VB7A 4HGCA 1AVWA 1EZSC 2P3TB 3BTWE 4NG9H 4IMZA 3ATMA 3SGBE 2C3SA 1WV7H 1Z6JH 1K1LA 3QWCH 3MNCA 3MH7A 3UQOA 1T8OA 1GI1A 2BDIA 2A5IA 4WH8A 3GY5A 1YGCH 3V7TA 1KXEA 1TMTH 3PROA 3MI4A 4KTSA 1CHOF 1V2RT 1YCPM 3CS0A 4HI3A 1ESBA 5JBBS 3SW2B 5EPNA 2Z7FE 2R0KA 1WTGH 1MCTA 3LH3A 1UTMA 1IQNA 1XUFA 3U98H 1O0DH 2ZQ1A 1MTSA 3TK5A 3Q76A 3NXPA 1Q3XA 2NU4E 1IOEA 4I8KA 2DUCA 3SNDA 4FUJA 1NRPH 1UVOA 3KL6A 2O8MA 4MDSA 1XVMA 2D26C 3RC5A 3DD2H 4CRCA 1D6WA 1TX7A 2G5NA 2AMDA 3SU3A 3P17H 3A86A 4UD9H 1C2FA 1NN6A 1ZTKA 2CF9H 4B71A 6CHAC 1C1TA 1NRSH 3CP7A 2H6MA 1LVYA 1A5HA 4ZUHA 2ULLA 2FOFA 3UFAA 5C3NA 3RU4E 9ESTA 1BZXE 4H6TA 5L2ZH 1TBZH 2XNIA 4DVAU 2SGAA 3U9AH 1V2TT 4X8SH 1TABE 1EQ9A 1F5LA 5DGJA 1VCPA 2Q6GA 4KGAA 2BD5A 1SGNE 4X0WU 1Y3WA 1J8AA 3V0XA 1TA6A 4D76A 1UVPA 1OWDA 3SGAE 3RC4A 1C2DA 5EOKA 1HAZB 1SHYA 4Y0YE 2VVCA 4ABGA 5GDSH 3GOVB 4MPXA 4OS2A 2ZPRA 4E06H 1XKAC 1GI9B 1XMNB 5FBEA 1HAXB 1O2YA 1BUIA 1OPHB 1OWIA 2ZHEH 2BD4A 1H8IH 4FUCA 4ZMAH 1QY6A 1K1IA 4JZFH 4K1TA 3RXLA 2Z9LA 5A0AE 1AKSB 1D4PB 1TNIA 3TGKE 1JRTA 1NROH 3NZIA 1TMBH 1GJAB 4X2WA 1LVOA 1QHRB 1VCWA 2CJIA 4YLQH 1ANCA 3Q00A 1FN6A 4NZQA 3U1JB 1S84A 1E37B 2I6QA 1UJ1A 1UVSH 1GJ4H 2YNBA 1ZHRA 2Z94A 1V2VT 4IW4E 1F2SE 2RG3A 4J2YB 1SC8U 3NPSA 1XXDA 4GSOA 4LK4A 1WYKA 2BD7A 3A7YA 1FY5A 1EX3A 2B5TB 1ELGA 1P02A 2A2QH 1LO6A 3OX7U 4DJZB 3SUFA 4CBNA 2WYGA 1ZSKA 1O3KA 4AYVB 1MAYA 3RXQA 5L2YH 3H5CB 1GVZA 3RXTA 1P12E 3MU8A 1G3BA 4FXGH 4WY3A 2THFB 2XXLA 1MCVA 1C1SA 3EGKH 4FUIA 5C5NA 4FVBA 4BOHA 3MO6A 3RXOA 1O3NA 1SGYE 2J9NA 4JYVH 3TH3H 4MG3A 2PSXA 1EJMA 3QTVH 1QBVH 3RU4T 2G4UA 6LPRA 4B2CA 1HFDA 2BD9A 4X6MA 5FX6A 1SGDE 2KAIB 3BG4C 2UWOA 1GL1A 3M5MA 4IGDA 1HAVA 3V12A 1NRQH 1XX9A 3EAJA 2O8TA 2ILNA 1YKTA 4Q7ZA 2ZDLA 2AH4X 1J9CH 1K22H 1EOJA 1LPKB 2CGAA 1EP5A 2CHAB 4TWWA 1D6RA 3BN9A 5LPRA 5EXLA 2BQ7B 5F8XA 2P8OB 4DW2U 2QY0B 3NUMA 2Y82A 4BAOB 4U30A 5FHTA 4XFQA 1V2ST 1SOTA 1GBMA 3LH1A 2ZCHP 5EPYA 1WU1A 4BXSA 4GVUA 3B8JA 5HGGA 4AN7A 1IQFA 1MH0A 1S6HA 1YBWA 2O8WA 2WPMS 3E0NB 7GCHG 3PTBA 1C1PA 3R3GB 4LOYH 1ABJH 1O5BB 2QC2A 3GDVA 5DPAA 2GCTB 1NU9A 2BY8X 3UUZA 1BCUH 3RMLH 5L6NH 5T6DA 2F9PA 1A46H 1FY1A 1GBIA 3ELAH 4I33A 4JK5A 2H9EH 2VWNA 2ZEBA 3Q77A 4YO9A 4IBLH 4WF8A 4O03A 1BBRK 4BAMB 2GP9B 1ZHMA 1QL7A 3PMJA 2AERH 3VFEA 2UUJB 1KXFA 1YYY1 2W5EA 1AE8H 1C5YB 2ZFRH 1GHBF 3M5LA 4JZDH 1D3TB 1L4ZA 1AFQB 1ZLRA 3KCGH 1N6XA 4NA7A 1HLTH 1QA0A 3GY2A 3QZRA 5IYTA 3H7TA 1C5PA 3HGNA 4Y8ZA 1WOFA 1B7XB 4CRGA 4FUBA 1SGRE 4BAKB 2ZTYA 4Y6DA 4E05H 1L4DA 5DP9A 5FCKA 2QYIA 5JYIA 4M7GA 1GG6B 3VGCC 1OWEA 3TK6A 1UTJA 4Y8XA 1AWHB 2GD4B 1O2HA 2ZA5A 3SOSA 1HAVB 1UVTH 5LPFA 3URDA 4OS6A 4NFFA 1EB2A 1NT1A 3SNCA 5GJ4B 2KAIA 1HV7A 4BNRA 1T32A 1UCYK 1FY3A 3F9FA 3TNSA 2V6NA 3TIUA 2J94A 3ZV8A 3BG4B 1OP2A 4AZ2B 1WQVH 3K6YA 1IQJA 1DWDH 1O5GH 2P94A 3RXDA 1A1RA 1ANEA 2J38A 1ESAA 1KSNA 3ODDA 4X2YA 5C1XA 1IQEA 1MTVA 1GBCA 4CR5A 1TA2A 1SGTA 2XWBI 5FCRA 5EW2H 1PPEE 4NZLA 1H8DH 4XSKU 5ESBA 1NESE 1DY8A 2ZFTA 1F0SA 1EB1H 3RMMH 3SV7A 2ZF0H 1DVAH 1P3EA 3PLBA 2AGIX 3TU7H 1ZPCA 2OC7A 2BX3A 2HNTF 1MTWA 3A7ZA 1FMGA 4K1SA 1UTOA 1CBWB 1K28D 1O3JA 2Y5GA 2Z3CA 3B9FH 4GAWA 4OS5A 3UNQA 2ZHWH 6ESTA 1HJAC 5HXFA 4FUEA 4AORA 3F9HA 4KKDA 4UFEH 1RRKA 2SGFE 2ZQ2A 4O3TA 3SV8A 2C8ZB 1ZTJA 2BY5X 4INHA 1V2UT 2BQWB 1Y3YA 3SU6A 2ZGJA 4MQAA 1OX1A 1H9HE 1YM0A 3Q3YA 1K2I1 1C2JA 1C2HA 3ATKA 1ETTH 1O3HA 5A0BA 4I8GA 1RIWB 3KNXA 4A1VA 1C5MD 1HRTH 2JETB 2IPHA 3LGVA 4NGAH 5EODA 2ZHDA 3U8OH 2FLBH 1SBWA 4B2BA 4UFFH 2FM2A 1ZGVA 4CRDA 1AKSA 7GCHF 2SNWA 5A8ZA 1EZXC 3KQCA 3ZVCA 8GCHF 2WV5A 2GCHG 1VITH 3T5FH 1ZOMA 1JIRA 1CO7E 3AAVA 7KMEH 1BMNH 1G3DA 1UK3A 1O5AB 3TITA 2ZCLP 4AOQA 3O8DA 5E2OA 1YPHC 1BMAA 4GPGA 1HAYB 1PPZA 1TNLA 8LPRA 1C5LH 1T7CA 3GY4A 2JH5D 1WSSH 4YLUA 3P8GA 1T4UH 1C1UH 2VIWA 1O35A 7ESTE 3BG8A 3C27B 3UWJH 1V3XA 1ORFA 1TGBA 2A5KA 3BF6H 4AB9A 1CT2E 2GT8A 4WWYA 5F6MA 4A7IB 1O34A 1MZDA 5BPEA 2RA0A 1GHYH 2DE9A 2A4GA 2JKHA 1QB9A 1SLXB 2GDEH 1P06A 1QBNA 4RN6A 4BAQB 1VJ9U 1AQ7A 2NU0E 1P3CA 5PTPA 1OSSA 1SLUB 1QURH 2FP7B 1FV9A 3FVFB 1SQOA 1XVOA 1KDQB 3EA7A 3IWMA 1XUJA 6CHAB 4I8HA 1PPCE 2ZU5A 1P2OA 4H6SB 1BTUA 3TJVA 1V2PT 4JYUH 2A4RA 2FTMA 3QO6A 2ALVA 3QZQA 1KTSB 2BOHB 1KLTA 5DO4H 1BRAA 1VITG 4IN2A 2A31A 3GY6A 4B2AA 4UFGH 3SGQE 5DJ7A 4A5TS 2F91A 3FAOA 4K8BA 4H42U 1VGCB 2GZ8A 1S82A 4NIYA 1O2KA 4RKOB 1T4VH 2VVUA 4K2YA 1HCGA 2QF0A 2HGTH 1V2OT 3LC3A 4Y11E 3U8TH 1GJDB 2G55A 3ZVFA 1UO6A 2M5TA 1P2KA 2ZFSA 2C93B 1YCPK 3Q3KA 1O37A 3TGIE 1PQ8A 4IS5A 1C4V2 3A88A 2ZCKP 4DIIH 4YOJA 4UE7H 1YPMH 2LNCA 4GCHF 2F9UA 3AW1A 2ANYA 1IQHA 1GBDA 1GMDF 1O2IA 4DGJA 3QGNB 3O8BA 4Y0ZE 4TPYA 4JYTA 1TWXB 2XC4A 1CHOG 1ZRBA 2AIQA 6GCHG 5AFYH 1TE0A 1UVUH 1SQAA 4UFDH 2FOEA 4OS1A 1TGNA 1BTPA 1AO5A 4XOJA 2ALPA 2BD2A 3QUMP 4Y79A 1TYNA 4I32A 3AW0A 3GCHB 4INKA 3VGCB 1QCPA 4MPVA 4KP0A 1H9IE 1TPPA 1O3AA 3MH6A 4NCYA 1TQ7B 3SZNA 1LPZB 3F9GA 8GCHG 1NFUA 1W0YH 5EQRA 1A2CH 3TGJE 1OYQA 1UTKA 1KXDA 2ZNKH 2QV1A 3EA9A 1DICA 1GHBG 3A8BA 1ABIH 3C1KA 1BT7A 2AFQB 2VH6A 3DT0H 1C5QA 1N6YA 3BIVH 3BEUA 2W3KA 1DANH 1EJAA 1SOZA 1G32B 1Z8JB 3WY8A 3D23A 1GMHG 1ZMJA 2EC9H 1XUHA 2V3HH 3ENSB 2FWWA 5A09A 2FOMB 1A61H 4R0IA 1O38A 4FU7A 5HYOA 1QJ1B 1DFPA 1SGQE 1DXPA 2JH6D 4AGKA 3RXVA 3SN8A 1GJBB 3SUEA 1YPKH 1A3BH 1EATA 5TJXA 4BAHB 1DXWA 1PQ7A 3ZV9A 1HXFH 2H5CA
chains in the Genus database with same CATH superfamily
1MUEB 5SGAE 1ELEE 2VBCA 1BDAA 3PYHA 1O2SA 3M5OA 1EPTB 1MKXK 3PO1C 2BVRH 2Y5HA 3VPKA 4NA9H 2BLOA 1INCA 2SNVA 3GYLB 3RXFA 2P3UB 3RUOA 1VCQA 1XUGA 2XC0A 3MWIU 2P59A 2CF8H 2BDGA 2VIQA 1QRZA 2FI4E 1P09A 1FY8E 3FO8D 1BTZA 3RXKA 2BXUH 1RS0A 1FZZA 3SJOA 3RXHA 1HB0B 1HDTH 3V13A 4WXIA 2C8WB 2D1JA 2FLRH 2ZC9H 1Z71A 2P16A 2VNTA 5FX5A 2CK3D 5GPIB 4M9FA 2PUXB 3LKWA 3OAAD 4MNYA 2G8TA 3S69A 1BA8B 3TK9A 3D49H 1TRYA 3SJ9A 1ANBA 4X8UH 1EAIA 1CE5A 1GGDC 1DPOA 3ESTA 1RFNA 3NK8A 3PRDA 1BBRH 1FAKH 1RTLA 1TONA 2DE8A 1P03A 2PHBA 2PKSB 3FZDA 5GIBA 3S7HB 2IOTA 1GCTB 4AFSA 5CMXH 3SI4H 1HIAB 4MPWA 2BHGA 3AVZA 2BY6X 4WMEA 1ELTA 2WPKS 5EIYA 1LHGH 5I25A 1MQ6A 4DOQA 2ZFFH 3M35A 1FPCH 3T29A 3TNTA 4X6OA 4ASHA 2VWLA 1T31A 2D8WA 3A83A 3BTDE 2OC1A 1SLWB 3MFJA 5JBTA 5T3HA 2J5UA 2BVSH 1GBJA 1MKXH 3MU5A 2WV4A 4IMQA 1FLEE 2XBVA 2A7CA 1ZTLA 2GMTC 3QX5H 1C5VA 3GCHC 1GI7B 1NU7B 4CREA 2OD3B 1S83A 1QFKH 1C1OA 2GCTC 2PUQH 3PWBA 1CU1A 1VITF 2Y81A 2Z6BD 2Z9JA 1MABB 2XW9A 1D3PB 2O8LA 3M7UA 3TVJB 3NWUA 1C5ZB 1VZQH 1SLVB 3DFLA 3F2FA 5EU8A 1G2LA 2V0BA 1O2LA 2RDLA 3S9AA 3K6ZA 2A1DB 3MMGA 2KCAA 5ETXA 1UCYH 2KCYA 3UWIA 2GDDA 2OP9A 5JBCS 3PTNA 4AFQA 1O3OA 4AYYB 1PPGE 1BIOA 1ZZZA 1DLEA 5L30H 3P8NA 4FUDA 4ABJA 1BMFD 1VJAU 1JIMA 4YT7H 2XTTB 1W0JD 4ZAEA 1IHTH 2FEQH 2NU3E 2QXJA 3I29A 5DP6A 1UTPA 1C1VH 1ELAA 1P10A 2F83A 1O2OA 2Q6DA 4MNVA 1WQSA 3PLKA 4IC5A 8KME2 2FI3E 3T2NA 2FYRA 1ZPBA 1ARBA 1GI2A 2ZG0H 3A7XA 3PWCA 1C5TA 5FBIA 3SYJA 1XUKA 1G2MA 4ISNA 1HIAA 1IQIA 3OEHD 1COWD 1QJ7B 3PRBA 1GWAA 3E0PB 2ANMH 1C2IA 2ZKSA 1AI8H 2W6JD 1GI6A 3A7TA 3MU1A 5EXMA 1GGDB 4E7RG 2Z9IA 4Q4LA 2A0QB 2V3OH 1ZHPA 1P11E 1O2QA 1AFQC 2RDEA 1H4WA 1ZJKA 5E0GA 4Y10E 4NWKA 1QL9A 2V7QD 2XBXA 2AS9A 2OBOA 1V2NT 1GVLA 1JWTA 2ZGBH 5C2ZA 2R0LA 4DIHH 3VXEH 1SGFA 3A89A 3VB4A 5H4IB 5E0HA 3F3BA 3SNEA 2C8XB 1K1MA 1IQMA 4GHQA 4ISLA 4B74A 1W8BH 1Y3XA 3SV9A 1TGTA 4ABEA 1ZPZA 2VH0A 3E8LA 2PGBB 1F92A 1NRRH 2VGCB 1EFRD 2FS8A 3M36A 3KQDA 3LU9B 1EP6A 1CA0B 2QXGA 2Y5FA 4JK6A 2RA3A 4Q7XA 2VWMA 3HK3B 2Y6TA 3H09A 4X1RU 4IC6A 2ANKH 3DFJA 1XKBC 4ABFA 4ABDA 1J17T 4AC9A 2VU8E 1S6FA 4ZHAA 1SGFG 1EAUA 1O5DH 4GUXA 2QF3A 1FAXA 3RXIA 1B0EA 3WWFA 2G81E 5DK1A 1HBTH 2OXSA 2KFWA 1BBRE 4HFPB 1UK2A 2FOBA 5C94A 3V3MA 2J4IA 1YPLH 5E2PA 4MNXA 1Z8RA 2AIPA 3LGYA 5EQQA 3RU4D 2GZ7A 1TOCB 2IJOB 1W11U 4MLFB 1CHGA 5KECA 1H8ED 2WZQA 5T6FA 3GISB 1FY4A 1NO9H 3P95A 1S85A 4OS7A 1Q2WA 3SJ8A 4WXVA 4WH6A 1SGEE 1Y5UT 4INLA 1O31A 2C8YB 1G36A 4PROA 2R9PA 4D8NA 3TJUA 2FO9A 5EGMA 2QF5A 3KIDU 2HVXA 4CHAC 1L2EA 3I77A 2UWLA 1O2UA 1GPZA 1BTHH 2B8OH 2FI5E 1LHCH 1PPHE 1PYTC 1W12U 3LGTA 3UREA 1CA0C 3QTOH 2GJGA 2ZFQH 3TPIZ 1MBMA 1FQ3A 1LQEA 5BRRE 3SU1A 3AK5A 3M7QA 2OK5A 3FP7E 5CHAC 3ZZ4A 4Z6AH 3TJNA 1AB9C 1JRSA 3PLPA 1EAWA 1O39A 1QL8A 1C1QA 1DITH 3FFGA 3SORA 2ZHQH 2F9BH 1TBRH 1O30A 1GHXH 3KQEA 3QK1A 4A1XA 1GMCG 1MMJN 3M3VA 1RXPA 2GKVE 2GV6A 1HAHH 1T8LA 2OUAA 3K9XB 1SPJA 1YPEH 2UUFB 2F4LA 2PW8H 3URCA 3QGJA 3LDXH 4E7NA 1HPGA 3A81A 3T28A 1K21H 4I8LA 1LCYA 1BHXF 4YT6H 1KXBA 2HNTC 3GCTF 1SQTA 2A4QA 3RXJA 3P70B 1L1NA 2PTNA 1KYNA 2TBSA 5EG4A 3DA9B 1NFWA 1P04A 5AVDA 1DUAA 1Z8GA 4P00A 3EE0B 2BLVA 2ESTE 1O5CB 1K1PA 1O3MA 2PV9B 1Y3UA 4MVNA 1NZQH 2PFEA 2ZU1A 2TGTA 1DY9A 2TPIZ 1GBKA 3EDXB 1BOQA 3UQVA 2BXTH 4ABBA 3GDUA 2BDAA 3N7OA 4MNWA 1V6DA 1YCPH 1FI8A 1GHAF 1A7SA 2FIRH 3FOAA 1LVMA 1V2QT 4B76A 1THPB 5HMAA 3BTEE 1N1LA 3UPEA 3IITA 4CRAA 1ZSJA 3SU4A 3T62A 2AMQA 5FL7D 1PYTD 3ZVDA 1O3CA 1QJ6B 3OTJE 1GJ9B 5FPYA 4K60A 5FPTA 3VEQB 5DKMA 1YPHE 5JB8S 4X8VH 3UOUA 4ACBA 3AAUA 3E90B 3W95A 4X6PA 6GCHF 1EKBB 1P9UA 3GICB 5T6GA 5LGOA 2QE7D 1TNGA 3SU0A 3TH2H 4JZEH 3GY7A 4MTBA 2H1UA 4CRBA 4AB8A 1K1JA 4CHAB 3ZZ6A 2FX4A 1FIZA 1GDQA 2ZECA 5EJLA 3UOPA 1H9LB 2KR7A 2ZDAH 3BEFB 2JJ1D 4K3JA 2XC5A 4NWLA 4B1TA 1GHWH 1FX0B 2F9VA 3UNRA 3STIA 2QA9E 1C1RA 3A82A 4VGCC 5CHAB 1G30B 3OU0A 1AMHA 1ETRH 2PWXA 2W7UA 3BEIB 5C17A 5EQSA 2ODQA 1J16A 1AE5A 2A45B 1W14U 2W3IA 5B6OA 2GZ9A 1BMMH 4YTAA 1O2JA 3SQHE 3DSOA 3A8AA 1DWEH 2EEKA 1AIXH 1XUIA 1AN1E 9LPRA 1HJAB 1SFQB 2FPZA 1ID5H 1V2MT 2GV7A 3ATLA 4A92A 1DE7H 1NBMD 1ACBE 4F4OC 3OY6U 3T27A 3PV4A 2ZTZA 2FOHA 1Z7KA 2A32A 4VGCB 1DWBH 1TAWA 2P8OC 2OCVB 3LONA 4SGAE 4WMDA 1QQUA 3S9BA 1GHAG 3JZ2B 1WBGB 2UWPA 1UW7A 3BTHE 2AMPA 2QF4A 1Y3VA 3ZZCA 1GBTA 4NIXA 3MNSA 3L6PA 4Y8YA 3DHKH 4X2VA 3W1EA 3RXUA 2BQ6B 4Z0KA 1O2TA 2XWAA 2ASUB 1DDJA 1HGTH 1GBHA 1NFXA 3SNBA 2OINA 3RXMA 3S0NA 2C4FH 2JIZD 1PJPA 4ABIA 1T8MA 2Y7ZA 3A84A 3IG6B 4TYDA 1EPTA 1PQ5A 5IDKA 2FZZA 2SGQE 3Q3XA 3RM2H 2R3YA 1BRCE 2HRVA 2YMSB 3LGUA 1BITA 1P2NA 1PQAA 1GI5A 5HM2A 3P6ZB 3VG8A 2FMJA 1Q31A 1B0FA 4ZXYH 4ACAA 1TPOA 1OOKB 4WMFA 1UCYE 4GLYA 1SI5H 1MU6B 2VB0A 4B75A 2HPPH 1AUJA 1DUEA 5K7RA 2TGPZ 3ATWA 3FP8E 1TALA 3F9EA 1YF4A 3ZZDA 1EXFA 1TPSA 1W3CA 1F0TA 4WVPE 1PPFE 2BMGB 3D65E 1ARCA 3UY9A 1ETSH 1O5FH 1W2KH 3A8DA 1ZSLA 4P02A 1O3LA 1TX6A 2BLQA 1A4WH 1C2GA 1C5XB 4UEHH 2GX4A 1VGCC 1HJ8A 4ABAA 3EQ0H 1GJ7B 3D62A 3ZZ3A 3L33A 3RDZA 2HPQH 4J1YA 3U1IB 1GBLA 1NC6A 1TOMH 4ZHMU 2J2UA 2OTVA 1OKXA 1UTNA 1HNEE 1TFXA 2HOBA 1FN8A 2AGEX 3ZZ8A 1S5SA 4F55A 2Q1JA 4RSPA 4B73A 1EPTC 4XE4A 5T1VA 3ODFA 2BM2A 3NKKA 3VXFH 1W13U 3DUXH 3GY3A 2R2WU 1OYTH 1GI0A 1ZMNA 1WDIA 2HVYB 1GHVH 4O3UA 1RTKA 4TY6A 1W10U 1TGCA 5J4SA 1C9PA 1ELBA 1OS8A 1CSOE 4GCHG 2PKAA 3SI3H 1QB6A 1F5KU 2I6SA 2EI6A 1SGPE 2SFAA 1SG8B 2CV3A 2Z3DA 5C5OA 3F1SB 4FETA 5A0CA 5A8XA 3M37A 3LJJA 2FXRA 3RP2A 1LKBA 1MU8B 1UHBB 2QXHA 3O8RA 1JMOH 3GCNA 2W6ID 1O3PB 4I31A 5FAHA 2BTCE 3K65B 1ZYOA 4LZ1H 3F2HA 3ZZBA 2GTBA 4NSVA 5IK2D 2EA3A 3BTQE 1H1BA 1SMFE 1XXFA 4X8TH 3DSGA 5JDUB 3LOXA 2VVVA 3W94A 2ZDKA 1AZZA 2CHAC 2XBYA 1Y8TA 4YOGA 5JB9S 1THSH 1E36B 3PMBB 2BDCA 3HK6B 1EUFA 3FP6E 1FNIA 4D7FA 5ESTE 5E0JA 1GCTC 3U69H 1NFYA 4HG6A 3RXRA 2WUBA 4GHTA 1G37A 4K8YA 3SBKA 3ZVGA 1UK4A 1A3EH 4NFEA 2OC0A 1V2KT 4K5ZA 2NWNA 2UUKB 2TGDA 3MO9A 2AEIH 4X1SU 4X1NU 3BTTE 1RTFB 1YLDA 1C5NH 1C5RA 3I78A 1WTHD 1BJUA 1NM6A 3A8CA 1LKAA 4NSYA 1ELFA 2J34A 1O2XA 1ELDE 1P9SA 1YY3A 3B23B 1NTPA 1P8VC 4HZHA 3UNSA 2F3CE 1LPGB 5DP8A 1LDTT 4ISOA 1HAGE 4XBCA 1AWFH 3F6UH 3M7TA 4AG1A 2WINI 1FDPA 2IN2A 3MO3A 4OGYA 1C5OH 1DX5M 3E91A 2Y80A 4JZ1A 1C4Y2 4H4FA 1W7GH 3LGWA 1DWCH 3SHCH 4D9RA 1Y59T 1OXGA 1Y5AT 1C5SA 4CRFA 2H9TH 1JBUH 3SJKA 4ZXXH 1CVWH 3MH5A 5CE1A 4B6FA 1O2RA 1VR1H 1BTYA 2BDYA 1DT2A 1E38B 2J98B 1IQGA 1LMWB 1ZJDA 1P2IA 1KXAA 4K69A 2G5VA 2P93A 4AFZA 1JOUB 3KGPA 2OQ5A 1Y5BT 3TLOA 3EE7A 2M2AA 3E6PH 5FPSA 4DCDA 1MTUA 4YESB 1KTTB 1EZUC 1S0QA 1AVGH 1G9IE 2EI8A 4FUGA 4OS4A 3PMAB 1CT0E 2XOKD 5LPEA 1Z1JA 1ELCA 1J14A 1O2PA 1OHHD 3UAIC 4FUHA 2LPRA 3HKJB 1IHSH 5F8TA 1GBEA 3G01A 3RXGA 2A7HA 2B7DH 3STJA 3CENA 3LC5A 1GI3A 1FPHH 2WPLS 3PO1B 3LJOA 1ZMLA 2OC8A 1C1MA 4FU9A 3WWBA 3FZZA 2SGPE 4X2XA 2CMYA 3SHAH 1O2MA 2ODYB 2BDBA 2FS9A 2H9HA 1O3FA 1LHFH 1AY6H 1O5EH 3KYFA 1DSTA 3QN7A 5AF9H 4Y7AA 1O32A 2JETC 1O3IA 3SUDA 1WXRA 3A87A 1GCDA 2WUCA 4I8JA 3U8RH 5C1YA 1GDUA 4UDWH 5TCAA 4R8TB 2Z9GA 3WW7A 4ASUD 3F68H 4OM9A 1O3DA 4CBOA 1A0JA 5HM9A 3OEED 1PPBH 1MKWK 1S0RA 1NRNH 1KXCA 1SB1H 3RXBA 1TRMA 1WUNH 2GMTB 1C9TA 1MBQA 1KDQA 1Z6EA 1TGSZ 3JZ1B 3RXPA 2ZTXA 3MU0A 1QA7A 1WCZA 2SGEE 3RXCA 3RXSA 3KF2A 1JXPA 1F7ZA 4O97A 1OWJA 3SUGA 4WJG2 5F53A 4NA8A 5A8YA 1QTFA 4O9VA 5DP7A 2WPHS 1GJ8B 1FONA 4ZKSU 1GMCF 1AHTH 3RC6A 5G4BA 2K1QA 2ZPQA 2ZGXH 3GYMA 2J95A 2A7JA 3E1XB 2WYJA 3PV5A 3ZZ9A 3F0OA 4YOIA 2PKSC 1CGHA 1CGJE 3N99A 4DT7B 3KQBA 3P8FA 1M9UA 1SGCA 1RD3B 1K1OA 1W7XH 3OYPA 4ISIH 2PTCE 1P2QA 1GBAA 2Z3EA 1DS2E 2W7SA 3MNBA 4THNH 2EY4C 1KIGH 1TQ0B 3GY8A 4TY7A 4XBBA 2J92A 3T26A 4AG2A 3EYDA 5EW1H 2G52A 3HPTB 2F9NA 1ELVA 2XRCA 1F5RA 4LXBH 3CNRA 1LHDH 1THRH 1MKWH 1GMHF 4D9QA 2QN5T 2VIVA 1IQKA 4U01A 1QGFA 4K1EA 4Q2KA 3R0FA 1GHZA 3M61U 4Q80A 3SNAA 2K8IA 1QR3E 2KCOA 2ODPA 3LGIA 1A0LA 2C90B 3RLYH 3GCTG 1O2NA 4ESTE 2RCEA 2L74A 1G3CA 2GT7A 5GNDA 4F49A 5GCHF 1AD8H 1IQLA 3SU5A 2STBE 4U2WA 5EJ1A 1GJ6A 1BRBE 3P92A 3ZYDA 2HWLB 1DSUA 5GXPA 1UMAH 4SGBE 2JH0D 2Q6FA 1NY22 1ESTA 4DG4A 3VB6A 2QXIA 2BY9X 2PGQB 1CA8B 1MTNB 5K0HA 4YZUA 2XNDD 4AFUA 2PKAB 2R3UA 1TBQH 1EJNA 3E3TA 1Z1IA 5J4QA 2B9LA 2Y7XA 2ZGCA 1BMLA 1AUTC 4RT0A 3MHWU 4NIWA 5F03A 2YNAA 3SQEE 1MQ5A 3BIUH 2G00A 1GI4A 4CH8B 1E0FD 4I7YH 3S9CA 1X7AC 2H5DA 1AZ8A 1DM4B 1GJ5H 2ZU2A 1G3EA 4FU8A 1KY9A 1AGJA 1BB0B 1TIOA 3GCOA 4Y7BA 1P01A 2ZI2H 5DG6A 3M5NA 3MYWA 2ZDVH 3ZVEA 1TNJA 2QIQA 3UR9A 1QRWA 1C5WB 3MTYA 5E8EH 1C1WH 1J15A 2ANWA 1UTLM 3NCLA 3SV2H 3L3TA 1RIWC 3UR6A 1EZQA 4A6LA 2XCNA 2OQUA 1D9IA 1MZAA 4BTUB 3FKSD 1GBBA 4ZH8A 2A2XH 1MD8A 1V2JT 1N8OC 3UB0A 1LHEH 2A4OA 1V2LT 2HALA 3AASA 4I86A 5LH8A 1E34B 1FUJA 2TGAA 2FTLE 4A1TA 1AFEH 4JMYA 1QB1A 5I46H 4ZHLU 2ZDNA 3RXAA 3LPRA 2AYWA 1SSXA 5C1UA 1O3BA 1YWUA 3TH4H 2BYAX 1HAIH 2VJ1A 1EAXA 3VB5A 2ZZUH 3S7KB 3ZZ5A 3H7OA 4KTCA 2VIOA 3FANA 2G4TA 2VIDA 2CXVA 5KEDA 2D2DA 5DP5A 1ZRKA 4ZCNA 2UUYA 4XDEA 2J97A 2BVXH 1E35B 3GDSA 3GS9A 2ZDMA 3CS7A 4DURA 1HAOH 1C2KA 3HATH 2O9QA 1AU8A 2WPJS 4JZIA 4X1QU 1BJVA 1TNHA 1CQQA 2LP6A 2NU1E 2WHXA 1DOJA 5AHGH 3K2UA 4ZKNU 2IJD1 2HLDD 3SU2A 2BOKA 8ESTE 1C5UA 1BRUP 3OSYA 4TWYA 4XBDA 1SL3A 2VWOA 1A5GH 1F0RA 2G51A 1F0UA 2YMSC 1P2MA 2PLXA 3SV6A 1Z8IB 2V35A 1HYLA 3ATIA 3NRLA 1TLDA 2TIOA 3E16B 1RGQA 4TT3D 2CN0H 3F0PA 1CT4E 1O3GA 2F43B 2ZGHA 3HKIB 3A7VA 2OBQA 3T25A 2BD3A 2BLWA 2KM0A 7LPRA 1C2LA 1D3DB 4RKJB 3BV9B 2ZPSA 3MOCA 1GG6C 3LIWA 1QBOA 3BTKE 3VB3A 4NIVA 2BDHA 1SHHB 1GL0E 1GBFA 1UHBA 4KTUA 1YLNA 1FIWA 1MD7A 1A0HB 5AFZH 4AGJA 1TB6H 1BTWA 3BSQA 1HXEH 2STAE 1SR5C 3P8OA 5GCHG 2VGCC 2FYQA 1QIXB 1YC0A 3RLWH 4BANB 4Y76A 5TCCA 2ZHFH 1OP0A 1L0ZA 1GI8B 3UIRA 3A7WA 5JBAS 3EA8A 4HTCH 4TPIZ 2BX4A 1OWKA 1HJ9A 1GJCB 1PFXC 1V2WT 2O8UA 1AVXA 1SVPA 3RXEA 4ABHA 1QNJA 2W26A 3PMHB 4FUFA 2AHME 2EI7A 1QZ8A 3RMOH 1GDNA 1O2VA 4Q7YA 1P2JA 3A85A 2GCHF 3MH4A 3M3TA 5ABWA 2AGGX 1YPGH 3BTGE 4ZROA 2OLGA 4LZ4B 1QRXA 3QLPH 4FVDA 2K0QA 2F9OA 4ISHH 2P3FH 3LT3A 4BTIB 1FXYA 3KHVA 2WPIS 2YMSD 4U32A 5EXNA 2BZ6H 1U6QA 2BB4A 4CH2B 2GVFA 2ZWLH 5C20A 1QQ4A 4OGXA 3TJOA 4BTTB 1P0SH 1N8OB 1DLKB 2ZIQH 1O33A 3PM3A 2VIPA 2QGRA 1FJSA 2HNTE 2BY7X 5JPMH 2KZ4A 3KN2A 4D7GA 1BQYA 2JDID 2P95A 1S81A 1TMUH 1W0ZU 3ITIA 2VINA 2XYAA 1C2EA 4AX9H 1D3QB 3ZZ7A 2PR3A 2XCFA 1HUTH 1K9OE 1L1GA 2A5AA 5C67A 3HGPA 1EOLA 1NPMA 3A80A 1O2ZA 5FXLA 1EASA 2FOCA 2FDAA 3UTUH 1KLJH 1TPAE 2QAAA 5DP3A 3SO3A 1CGIE 2QCYA 4YM9A 1L1JA 1SGIB 4X6NA 2ZU3A 1O2GH 2XBWA 1ZGIA 1OWHA 4JCNA 4ZKOU 3ZVBA 1P57B 5A2MH 3DCLA 4Q63A 1LQDB 1LTOA 2R2MB 5DP4A 2B0FA 1IAUA 3RM0H 4DY7B 2ZFPH 1YPJH 5F8ZA 1O2WA 2FOGA 3PB1E 3BTME 3BTFE 1TNKA 2SGDE 1MTNC 1TRNA 2BD8A 3MU4A 1KLIH 1GVKB 1ANDA 1C2MA 1GMDG 1BHXB 4QT8C 1YLCA 4Y71A 1T8NA 2BZAA 2ZO3H 1TX8A 2FESH 2HLCA 3KEEA 1C4U2 2Z9KA 1HAPH 2ZU4A 2TRMA 1A5IA 1RJXB 3M3SA 4MPUA 2NU2E 2ZP0H 1NS3A 2YOLA 2PSYA 1WAYB 1XM1A 1ZR0A 3O8CA 1O3EA 5HKKD 4CR9A 2FOAA 2GGVB 3MNXA 4X1PU 4ZKRU 1LVBA 3ZVAA 2FODA 3ZZAA 1B5GH 3RMNH 1O36A 3ZYEA 5GWZA 4UONA 1P05A 3OY5U 1OP8A 3F2GA 4KELA 3QDZB 1AB9B 1YP9A 1SFIA 1CBWC 2FX6A 4IN1A 1MAXA 1UTQA 2H2ZA 3SJIA 1C1NA 4BXWA 2PP6A 1BTXA 2J98A 1K1NA 3VB7A 4HGCA 1AVWA 1EZSC 2P3TB 3BTWE 1SKYE 4NG9H 4IMZA 3ATMA 3SGBE 2C3SA 1WV7H 1Z6JH 1K1LA 3QWCH 1H8HD 3MNCA 3MH7A 3UQOA 1T8OA 1GI1A 2BDIA 2A5IA 4WH8A 3GY5A 1YGCH 3V7TA 1KXEA 1TMTH 3PROA 3MI4A 4KTSA 1CHOF 1V2RT 1YCPM 3CS0A 4HI3A 1ESBA 5JBBS 3SW2B 5EPNA 2Z7FE 2R0KA 1WTGH 1MCTA 3LH3A 1UTMA 1IQNA 1XUFA 3U98H 1O0DH 2ZQ1A 1MTSA 3TK5A 3Q76A 3NXPA 1Q3XA 2NU4E 1IOEA 4I8KA 2DUCA 3SNDA 4FUJA 1NRPH 1UVOA 3KL6A 2O8MA 4RI0A 2RFKC 4MDSA 1XVMA 2D26C 3RC5A 3DD2H 4CRCA 1D6WA 1TX7A 2G5NA 2AMDA 3SU3A 3P17H 3A86A 4UD9H 1C2FA 1NN6A 1ZTKA 2CF9H 4B71A 6CHAC 1C1TA 1NRSH 3CP7A 2H6MA 1LVYA 1A5HA 4ZUHA 2ULLA 2FOFA 3UFAA 5C3NA 3RU4E 9ESTA 1BZXE 4H6TA 5L2ZH 1TBZH 2XNIA 3KQ5A 4DVAU 2SGAA 3U9AH 1V2TT 4X8SH 1TABE 1EQ9A 1F5LA 5DGJA 1VCPA 2Q6GA 4KGAA 2BD5A 1SGNE 4X0WU 1Y3WA 1J8AA 3V0XA 1TA6A 4D76A 1UVPA 1OWDA 4XD7D 3SGAE 5KGOA 3RC4A 1C2DA 5EOKA 5CDFE 1HAZB 4F48B 1SHYA 4Y0YE 2VVCA 4ABGA 5GDSH 3GOVB 4MPXA 4OS2A 2ZPRA 4E06H 1XKAC 1GI9B 1XMNB 1SQRA 1K0HA 5FBEA 1HAXB 1O2YA 1BUIA 1OPHB 1OWIA 2ZHEH 2BD4A 1H8IH 4FUCA 4ZMAH 1QY6A 1K1IA 4JZFH 4K1TA 3RXLA 2Z9LA 5A0AE 1AKSB 1D4PB 1TNIA 3TGKE 1JRTA 1NROH 4XRNA 3NZIA 1TMBH 1GJAB 4X2WA 1LVOA 1QHRB 1VCWA 2CJIA 4YLQH 1ANCA 4Z1MD 3Q00A 1FN6A 4NZQA 3U1JB 1S84A 1E37B 2I6QA 1UJ1A 1UVSH 1GJ4H 2YNBA 1ZHRA 2Z94A 1V2VT 4IW4E 1F2SE 2RG3A 4J2YB 1SC8U 3NPSA 1XXDA 4GSOA 4LK4A 1WYKA 2BD7A 3A7YA 1FY5A 1EX3A 2B5TB 1ELGA 1P02A 2A2QH 1LO6A 3OX7U 4DJZB 3SUFA 2V3MA 4CBNA 2WYGA 1ZSKA 1O3KA 4AYVB 1MAYA 3RXQA 5L2YH 3H5CB 1GVZA 3RXTA 1P12E 3MU8A 1G3BA 4FXGH 4WY3A 2THFB 2XXLA 1MCVA 1C1SA 3EGKH 4FUIA 5C5NA 4FVBA 4BOHA 3MO6A 3RXOA 1O3NA 1SGYE 2J9NA 4JYVH 3TH3H 4MG3A 2PSXA 1EJMA 3QTVH 1QBVH 3RU4T 2G4UA 6LPRA 4B2CA 2WV9A 1HFDA 2BD9A 4X6MA 5FX6A 1SGDE 2KAIB 3BG4C 2UWOA 1GL1A 3M5MA 4IGDA 1HAVA 3V12A 1NRQH 1XX9A 3EAJA 2O8TA 2ILNA 1YKTA 4Q7ZA 2ZDLA 2AH4X 1J9CH 1K22H 1EOJA 1LPKB 2CGAA 1EP5A 2CHAB 4TWWA 3KYGA 1D6RA 3BN9A 5LPRA 5EXLA 2BQ7B 5F8XA 2P8OB 4DT4A 4DW2U 2QY0B 3NUMA 2Y82A 4BAOB 4U30A 5FHTA 4XFQA 1V2ST 1SOTA 1GBMA 5DN6D 3LH1A 2ZCHP 4B6EA 5EPYA 1WU1A 4BXSA 4GVUA 3B8JA 5HGGA 4AN7A 1IQFA 1MH0A 1S6HA 1YBWA 2O8WA 2WPMS 3E0NB 7GCHG 3PTBA 1C1PA 3R3GB 4LOYH 1ABJH 1O5BB 2QC2A 3GDVA 5DPAA 2GCTB 1NU9A 2BY8X 3UUZA 1BCUH 3RMLH 5L6NH 5T6DA 2F9PA 1A46H 1FY1A 1GBIA 3ELAH 4I33A 4JK5A 2H9EH 2VWNA 2ZEBA 3Q77A 4YO9A 4IBLH 3OE7D 4WF8A 4O03A 1BBRK 4BAMB 2GP9B 1ZHMA 1QL7A 3PMJA 2AERH 3VFEA 2UUJB 1KXFA 1YYY1 2W5EA 1AE8H 1C5YB 2ZFRH 1GHBF 3M5LA 4JZDH 1D3TB 1L4ZA 1AFQB 1ZLRA 3KCGH 1N6XA 4NA7A 1HLTH 1QA0A 3GY2A 3QZRA 5IYTA 3H7TA 1C5PA 3U28C 3HGNA 4Y8ZA 1WOFA 1B7XB 5DSFA 4CRGA 4FUBA 1SGRE 4BAKB 2ZTYA 4Y6DA 4E05H 1L4DA 5DP9A 5FCKA 2QYIA 5JYIA 4M7GA 1GG6B 3VGCC 1OWEA 3TK6A 1UTJA 4Y8XA 1AWHB 2GD4B 1O2HA 2ZA5A 3SOSA 1HAVB 1UVTH 5LPFA 5CHBA 3URDA 4OS6A 4NFFA 1EB2A 1NT1A 3SNCA 5GJ4B 2KAIA 1HV7A 4BNRA 1T32A 1UCYK 1FY3A 3F9FA 3TNSA 4YXWD 2V6NA 1VKYA 3TIUA 2J94A 3ZV8A 3BG4B 1OP2A 4AZ2B 1WQVH 3K6YA 1IQJA 1DWDH 1O5GH 2P94A 3RXDA 1A1RA 1ANEA 2J38A 1ESAA 1KSNA 3ODDA 4X2YA 5C1XA 1IQEA 1E79D 1MTVA 1GBCA 4CR5A 1TA2A 1SGTA 2XWBI 5FCRA 5EW2H 1PPEE 4NZLA 1H8DH 4XSKU 5ESBA 1NESE 1DY8A 2ZFTA 5HIZA 1F0SA 1EB1H 3RMMH 3SV7A 2ZF0H 1DVAH 5EJZA 1P3EA 3PLBA 2AGIX 3PV2A 1ZPCA 2OC7A 3TU7H 2BX3A 2HNTF 1MTWA 2L6OA 1FMGA 3A7ZA 1UTOA 1CBWB 1K28D 1O3JA 2Y5GA 2Z3CA 3B9FH 4GAWA 4K1SA 4OS5A 2ZHWH 3UNQA 1HJAC 6ESTA 4FUEA 5HXFA 4AORA 3F9HA 4KKDA 2LELA 4UFEH 1RRKA 2SGFE 2ZQ2A 4O3TA 3SV8A 2C8ZB 1ZTJA 2BY5X 4INHA 1V2UT 2BQWB 1Y3YA 3SU6A 2ZGJA 4MQAA 1OX1A 1H9HE 3FN8A 2EQNA 1YM0A 3Q3YA 1K2I1 1C2JA 1C2HA 3ATKA 1ETTH 1O3HA 2IPQX 5A0BA 4I8GA 1RIWB 3KNXA 4A1VA 5B6LA 1C5MD 1HRTH 2JETB 2IPHA 3LGVA 4NGAH 5EODA 2ZHDA 3U8OH 2FLBH 1SBWA 4B2BA 4UFFH 2FM2A 1ZGVA 4CRDA 1AKSA 7GCHF 2SNWA 5A8ZA 1EZXC 3KQCA 3ZVCA 8GCHF 2WV5A 2GCHG 1VITH 3T5FH 1W0KD 1ZOMA 1JIRA 1CO7E 3AAVA 7KMEH 1BMNH 1G3DA 1UK3A 1O5AB 2JJ2D 3TITA 2ZCLP 4AOQA 3O8DA 5E2OA 1YPHC 1BMAA 4GPGA 1HAYB 1PPZA 1TNLA 8LPRA 1C5LH 1T7CA 3GY4A 2JH5D 1WSSH 2WSSD 4YLUA 3P8GA 1T4UH 1E1RD 1C1UH 2VIWA 1O35A 7ESTE 3BG8A 3C27B 3UWJH 3OFND 1V3XA 1ORFA 1TGBA 2A5KA 3BF6H 4AB9A 1CT2E 2GT8A 4WWYA 5F6MA 4A7IB 1O34A 1MZDA 5BPEA 2RA0A 1GHYH 2DE9A 2A4GA 2JKHA 1QB9A 1SLXB 2GDEH 1P06A 1QBNA 4RN6A 4BAQB 1VJ9U 1AQ7A 2NU0E 1P3CA 5PTPA 1OSSA 1SLUB 1QURH 2FP7B 1FV9A 3FVFB 1SQOA 1XVOA 1KDQB 3EA7A 3IWMA 1XUJA 6CHAB 4I8HA 1PPCE 2ZU5A 1P2OA 4H6SB 4FOUC 1BTUA 3TJVA 5C0UA 1V2PT 4JYUH 2A4RA 2FTMA 5C0TA 3QO6A 2ALVA 3QZQA 1KTSB 2BOHB 1KLTA 5DO4H 1BRAA 1VITG 5HIYA 4IN2A 2A31A 3GY6A 4B2AA 3OTPA 4UFGH 3DSPA 3SGQE 5DJ7A 4A5TS 3MQKC 2F91A 1KMHB 3FAOA 4K8BA 4H42U 3SZEA 1VGCB 2GZ8A 1S82A 4NIYA 1O2KA 4RKOB 1T4VH 2VVUA 4K2YA 1HCGA 1E1QD 2QF0A 2HGTH 1V2OT 3LC3A 4Y11E 3U8TH 2KX4A 1GJDB 2G55A 3ZVFA 1UO6A 2M5TA 1P2KA 2ZFSA 2C93B 1YCPK 3Q3KA 1O37A 3TGIE 1PQ8A 4IS5A 1C4V2 3A88A 2ZCKP 4DIIH 4YOJA 4UE7H 1YPMH 2LNCA 3N7DA 2KCPA 4GCHF 2F9UA 3AW1A 3ZIAD 2ANYA 1IQHA 1GBDA 1GMDF 1O2IA 4DGJA 3QGNB 3O8BA 4Y0ZE 4TPYA 4JYTA 1TWXB 2XC4A 1CHOG 1ZRBA 2AIQA 6GCHG 1S6LA 3N7EA 5AFYH 1TE0A 1UVUH 1SQAA 4UFDH 2FOEA 4OS1A 1TGNA 1BTPA 1AO5A 4XOJA 2ALPA 2BD2A 2WPDD 4TSFD 3QUMP 4Y79A 1TYNA 4I32A 3AW0A 3GCHB 4INKA 3VGCB 1QCPA 4MPVA 4KP0A 1H9IE 1TPPA 1O3AA 3MH6A 4NCYA 1TQ7B 3SZNA 1LPZB 3F9GA 8GCHG 1NFUA 1W0YH 5EQRA 1A2CH 3TGJE 1OYQA 1UTKA 1KXDA 2ZNKH 2QV1A 3EA9A 1DICA 1GHBG 3A8BA 1ABIH 3C1KA 1BT7A 2AFQB 2VH6A 3DT0H 1C5QA 1N6YA 3BIVH 3BEUA 2W3KA 1NBME 1DANH 4RT1A 1EJAA 1SOZA 1G32B 1Z8JB 3WY8A 3D23A 1GMHG 1ZMJA 2EC9H 1XUHA 2V3HH 3ENSB 2FWWA 5A09A 2FOMB 1A61H 4R0IA 1O38A 4FU7A 5HYOA 1QJ1B 1DFPA 1SGQE 1DXPA 2JH6D 4AGKA 3RXVA 3SN8A 1GJBB 3SUEA 1YPKH 1A3BH 1EATA 5TJXA 4BAHB 1DXWA 1PQ7A 3ZV9A 1HXFH 2H5CA
chains in the Genus database with same CATH topology
1MUEB 5SGAE 1ELEE 1BDAA 3PYHA 1O2SA 3M5OA 1EPTB 1MKXK 3PO1C 2BVRH 2Y5HA 3VPKA 4NA9H 2BLOA 1INCA 2SNVA 3GYLB 3RXFA 2P3UB 3RUOA 1VCQA 1XUGA 2XC0A 3MWIU 2P59A 2CF8H 2BDGA 2VIQA 1QRZA 2FI4E 1P09A 1FY8E 1BTZA 3RXKA 2BXUH 1RS0A 1FZZA 3SJOA 3RXHA 1HB0B 1HDTH 3V13A 4WXIA 2C8WB 2D1JA 2FLRH 2ZC9H 1Z71A 2P16A 2VNTA 5FX5A 5GPIB 2PUXB 3LKWA 4MNYA 2G8TA 3S69A 1BA8B 3TK9A 3D49H 1TRYA 3SJ9A 1ANBA 4X8UH 1EAIA 1CE5A 1GGDC 1DPOA 3ESTA 1RFNA 3NK8A 1BBRH 1FAKH 1RTLA 1TONA 2DE8A 1P03A 2PHBA 2PKSB 3FZDA 5GIBA 3S7HB 2IOTA 1GCTB 4AFSA 5CMXH 3SI4H 1HIAB 4MPWA 2BHGA 3AVZA 2BY6X 4WMEA 1ELTA 2WPKS 1LHGH 5I25A 1MQ6A 4DOQA 2ZFFH 3M35A 1FPCH 3T29A 3TNTA 4X6OA 4ASHA 2VWLA 1T31A 2D8WA 3A83A 3BTDE 2OC1A 1SLWB 3MFJA 5JBTA 5T3HA 2BVSH 1GBJA 1MKXH 3MU5A 2WV4A 4IMQA 1FLEE 2XBVA 2A7CA 1ZTLA 2GMTC 3QX5H 1C5VA 3GCHC 1GI7B 1NU7B 4CREA 2OD3B 1S83A 1QFKH 1C1OA 2GCTC 2PUQH 3PWBA 1CU1A 1VITF 2Y81A 2Z6BD 2Z9JA 2XW9A 1D3PB 2O8LA 3M7UA 3TVJB 3NWUA 1C5ZB 1VZQH 1SLVB 3DFLA 5EU8A 1G2LA 2V0BA 1O2LA 2RDLA 3S9AA 3K6ZA 2A1DB 3MMGA 5ETXA 1UCYH 3UWIA 2GDDA 2OP9A 5JBCS 3PTNA 4AFQA 1O3OA 4AYYB 1PPGE 1BIOA 1ZZZA 1DLEA 5L30H 3P8NA 4FUDA 4ABJA 1VJAU 1JIMA 4YT7H 2XTTB 4ZAEA 1IHTH 2FEQH 2NU3E 2QXJA 3I29A 5DP6A 1UTPA 1C1VH 1ELAA 1P10A 2F83A 1O2OA 2Q6DA 4MNVA 1WQSA 3PLKA 4IC5A 8KME2 2FI3E 3T2NA 2FYRA 1ZPBA 1ARBA 1GI2A 2ZG0H 3A7XA 3PWCA 1C5TA 5FBIA 1XUKA 1G2MA 4ISNA 1HIAA 1IQIA 1QJ7B 1GWAA 3E0PB 2ANMH 1C2IA 2ZKSA 1AI8H 1GI6A 3A7TA 3MU1A 5EXMA 1GGDB 4E7RG 2Z9IA 2A0QB 2V3OH 1ZHPA 1P11E 1O2QA 1AFQC 1H4WA 1ZJKA 5E0GA 4Y10E 4NWKA 1QL9A 2XBXA 2AS9A 2OBOA 1V2NT 1GVLA 1JWTA 2ZGBH 5C2ZA 2R0LA 4DIHH 3VXEH 1SGFA 3A89A 3VB4A 5H4IB 5E0HA 3SNEA 2C8XB 1K1MA 1IQMA 4GHQA 4ISLA 4B74A 1W8BH 1Y3XA 3SV9A 1TGTA 4ABEA 1ZPZA 2VH0A 3E8LA 2PGBB 1F92A 1NRRH 2VGCB 2FS8A 3M36A 3KQDA 3LU9B 1EP6A 1CA0B 2QXGA 2Y5FA 4JK6A 2RA3A 4Q7XA 2VWMA 3HK3B 2Y6TA 4X1RU 4IC6A 2ANKH 3DFJA 1XKBC 4ABFA 4ABDA 1J17T 2VU8E 1S6FA 4ZHAA 1SGFG 1EAUA 1O5DH 4GUXA 2QF3A 1FAXA 3RXIA 1B0EA 2G81E 5DK1A 1HBTH 2OXSA 1BBRE 4HFPB 1UK2A 2FOBA 3V3MA 2J4IA 1YPLH 5E2PA 4MNXA 1Z8RA 2AIPA 3LGYA 5EQQA 3RU4D 2GZ7A 1TOCB 1W11U 2IJOB 4MLFB 1CHGA 5T6FA 3GISB 1FY4A 1NO9H 3P95A 1S85A 4OS7A 1Q2WA 3SJ8A 4WXVA 4WH6A 1SGEE 1Y5UT 4INLA 1O31A 2C8YB 1G36A 4PROA 2R9PA 4D8NA 3TJUA 2FO9A 5EGMA 3KIDU 2HVXA 4CHAC 1L2EA 3I77A 2UWLA 1O2UA 1GPZA 1BTHH 2B8OH 2FI5E 1LHCH 1PPHE 1PYTC 1W12U 3LGTA 3UREA 1CA0C 3QTOH 2ZFQH 3TPIZ 1MBMA 1FQ3A 1LQEA 5BRRE 3SU1A 3M7QA 3FP7E 5CHAC 3ZZ4A 4Z6AH 3TJNA 1AB9C 1JRSA 3PLPA 1EAWA 1O39A 1QL8A 1C1QA 1DITH 3FFGA 3SORA 2ZHQH 2F9BH 1TBRH 1O30A 1GHXH 3KQEA 3QK1A 4A1XA 1GMCG 1MMJN 3M3VA 1RXPA 2GKVE 2GV6A 1HAHH 1T8LA 2OUAA 3K9XB 1SPJA 1YPEH 2UUFB 3URCA 2PW8H 3QGJA 3LDXH 4E7NA 1HPGA 3A81A 3T28A 1K21H 4I8LA 1LCYA 1BHXF 4YT6H 1KXBA 2HNTC 3GCTF 1SQTA 2A4QA 3RXJA 3P70B 1L1NA 2PTNA 1KYNA 2TBSA 5EG4A 3DA9B 1NFWA 1P04A 5AVDA 1DUAA 1Z8GA 3EE0B 2BLVA 2ESTE 1O5CB 1K1PA 1O3MA 2PV9B 1Y3UA 4MVNA 1NZQH 2PFEA 2ZU1A 2TGTA 1DY9A 2TPIZ 1GBKA 3EDXB 1BOQA 3UQVA 2BXTH 4ABBA 3GDUA 2BDAA 3N7OA 4MNWA 1V6DA 1YCPH 1FI8A 1GHAF 1A7SA 2FIRH 1LVMA 1V2QT 4B76A 1THPB 5HMAA 3BTEE 1N1LA 3UPEA 3IITA 4CRAA 1ZSJA 3SU4A 3T62A 2AMQA 3ZVDA 1PYTD 1O3CA 1QJ6B 3OTJE 1GJ9B 5FPYA 4K60A 5FPTA 3VEQB 5DKMA 1YPHE 5JB8S 4X8VH 3UOUA 3AAUA 3E90B 3W95A 4X6PA 6GCHF 1EKBB 1P9UA 3GICB 5T6GA 5LGOA 1TNGA 3SU0A 3TH2H 4JZEH 3GY7A 4MTBA 2H1UA 4CRBA 4AB8A 1K1JA 4CHAB 3ZZ6A 2FX4A 1FIZA 1GDQA 2ZECA 3UOPA 1H9LB 2ZDAH 3BEFB 4K3JA 2XC5A 4NWLA 4B1TA 1GHWH 2F9VA 3UNRA 3STIA 2QA9E 1C1RA 3A82A 4VGCC 5CHAB 1G30B 3OU0A 1AMHA 1ETRH 2PWXA 2W7UA 3BEIB 5EQSA 2ODQA 1J16A 1AE5A 2A45B 1W14U 2W3IA 5B6OA 2GZ9A 1BMMH 4YTAA 1O2JA 3SQHE 3A8AA 1DWEH 2EEKA 1AIXH 1XUIA 1AN1E 9LPRA 1HJAB 1SFQB 2FPZA 1ID5H 1V2MT 2GV7A 3ATLA 4A92A 1DE7H 1ACBE 4F4OC 3OY6U 3T27A 3PV4A 2ZTZA 2FOHA 1Z7KA 2A32A 4VGCB 1DWBH 1TAWA 2P8OC 2OCVB 3LONA 4SGAE 4WMDA 1QQUA 3S9BA 1GHAG 3JZ2B 1WBGB 2UWPA 3BTHE 2AMPA 1Y3VA 3ZZCA 1GBTA 4NIXA 3MNSA 3L6PA 4Y8YA 3DHKH 4X2VA 3RXUA 2BQ6B 4Z0KA 1O2TA 2XWAA 2ASUB 1DDJA 1HGTH 1GBHA 1NFXA 3SNBA 2OINA 3RXMA 3S0NA 2C4FH 1PJPA 4ABIA 1T8MA 2Y7ZA 3A84A 3IG6B 4TYDA 1EPTA 1PQ5A 5IDKA 2FZZA 2SGQE 3Q3XA 3RM2H 2R3YA 1BRCE 2HRVA 3LGUA 1BITA 1P2NA 1PQAA 1GI5A 5HM2A 3P6ZB 2FMJA 1Q31A 1B0FA 4ZXYH 1TPOA 1OOKB 4WMFA 1UCYE 4GLYA 1SI5H 1MU6B 2VB0A 4B75A 2HPPH 1AUJA 1DUEA 5K7RA 2TGPZ 3ATWA 3FP8E 1TALA 3F9EA 1YF4A 3ZZDA 1EXFA 1TPSA 1W3CA 1F0TA 4WVPE 1PPFE 2BMGB 3D65E 1ARCA 3UY9A 1ETSH 1O5FH 1W2KH 3A8DA 1ZSLA 1O3LA 1TX6A 2BLQA 1A4WH 1C2GA 1C5XB 4UEHH 2GX4A 1VGCC 1HJ8A 4ABAA 3EQ0H 1GJ7B 3D62A 3ZZ3A 3L33A 3RDZA 2HPQH 4J1YA 3U1IB 1GBLA 1NC6A 1TOMH 4ZHMU 2J2UA 2OTVA 1OKXA 1UTNA 1HNEE 1TFXA 2HOBA 1FN8A 2AGEX 3ZZ8A 1S5SA 2Q1JA 4RSPA 4B73A 1EPTC 4XE4A 3ODFA 2BM2A 3NKKA 3VXFH 1W13U 3DUXH 3GY3A 2R2WU 1OYTH 1GI0A 1ZMNA 1GHVH 4O3UA 1RTKA 4TY6A 1W10U 1TGCA 5J4SA 1C9PA 1ELBA 1OS8A 1CSOE 4GCHG 2PKAA 3SI3H 1QB6A 1F5KU 2I6SA 2EI6A 1SGPE 2SFAA 1SG8B 2CV3A 2Z3DA 5C5OA 3F1SB 5A0CA 5A8XA 3M37A 3LJJA 2FXRA 3RP2A 1LKBA 1MU8B 1UHBB 2QXHA 3O8RA 1JMOH 3GCNA 1O3PB 4I31A 5FAHA 2BTCE 3K65B 1ZYOA 4LZ1H 3ZZBA 2GTBA 4NSVA 2EA3A 3BTQE 1H1BA 1SMFE 1XXFA 4X8TH 5JDUB 3LOXA 2VVVA 3W94A 2ZDKA 1AZZA 2CHAC 2XBYA 1Y8TA 4YOGA 5JB9S 1THSH 1E36B 3PMBB 2BDCA 3HK6B 1EUFA 3FP6E 1FNIA 4D7FA 5ESTE 5E0JA 1GCTC 3U69H 1NFYA 3RXRA 2WUBA 4GHTA 1G37A 4K8YA 3SBKA 3ZVGA 1UK4A 1A3EH 4NFEA 2OC0A 1V2KT 4K5ZA 2NWNA 2UUKB 2TGDA 3MO9A 2AEIH 4X1SU 4X1NU 3BTTE 1RTFB 1YLDA 1C5NH 1C5RA 3I78A 1WTHD 1BJUA 1NM6A 3A8CA 1LKAA 4NSYA 1ELFA 1P9SA 1O2XA 1ELDE 2J34A 3B23B 1NTPA 1P8VC 4HZHA 3UNSA 2F3CE 1LPGB 5DP8A 1LDTT 4ISOA 1HAGE 4XBCA 1AWFH 3F6UH 3M7TA 4AG1A 2WINI 1FDPA 2IN2A 3MO3A 4OGYA 1C5OH 1DX5M 3E91A 2Y80A 4JZ1A 1C4Y2 4H4FA 1W7GH 3LGWA 1DWCH 3SHCH 4D9RA 1Y59T 1OXGA 1Y5AT 1C5SA 4CRFA 2H9TH 1JBUH 3SJKA 4ZXXH 1CVWH 3MH5A 5CE1A 1O2RA 1VR1H 1BTYA 2BDYA 1DT2A 1E38B 1IQGA 1LMWB 1ZJDA 1P2IA 1KXAA 4K69A 2G5VA 2P93A 4AFZA 1JOUB 3KGPA 2OQ5A 1Y5BT 3TLOA 3E6PH 5FPSA 4DCDA 1MTUA 4YESB 1KTTB 1EZUC 1S0QA 1AVGH 1G9IE 2EI8A 4FUGA 4OS4A 3PMAB 1CT0E 5LPEA 1Z1JA 1ELCA 1J14A 1O2PA 4FUHA 2LPRA 3HKJB 1IHSH 5F8TA 1GBEA 3G01A 3RXGA 2A7HA 2B7DH 3STJA 3CENA 3LC5A 1GI3A 1FPHH 2WPLS 3PO1B 3LJOA 1ZMLA 2OC8A 1C1MA 4FU9A 3FZZA 2SGPE 4X2XA 2CMYA 3SHAH 1O2MA 2ODYB 2BDBA 2FS9A 2H9HA 1O3FA 1LHFH 1AY6H 1O5EH 1DSTA 3QN7A 5AF9H 4Y7AA 1O32A 2JETC 1O3IA 3SUDA 3A87A 1GCDA 2WUCA 4I8JA 3U8RH 5C1YA 1GDUA 4UDWH 5TCAA 4R8TB 2Z9GA 3F68H 1O3DA 4CBOA 1A0JA 5HM9A 1PPBH 1MKWK 1S0RA 1NRNH 1KXCA 1SB1H 3RXBA 1TRMA 1WUNH 2GMTB 1C9TA 1MBQA 1KDQA 1Z6EA 1TGSZ 3JZ1B 3RXPA 2ZTXA 3MU0A 1QA7A 1WCZA 2SGEE 3RXCA 3RXSA 3KF2A 1JXPA 1F7ZA 4O97A 1OWJA 3SUGA 4WJG2 4NA8A 5A8YA 1QTFA 4O9VA 5DP7A 2WPHS 1GJ8B 1FONA 4ZKSU 1GMCF 1AHTH 3RC6A 5G4BA 2K1QA 2ZPQA 2ZGXH 3GYMA 2J95A 2A7JA 3E1XB 2WYJA 3ZZ9A 4YOIA 2PKSC 1CGHA 1CGJE 4DT7B 3KQBA 3P8FA 1M9UA 1SGCA 1RD3B 1K1OA 1W7XH 3OYPA 4ISIH 2PTCE 1P2QA 1GBAA 2Z3EA 1DS2E 2W7SA 3MNBA 4THNH 1KIGH 1TQ0B 3GY8A 4TY7A 4XBBA 2J92A 3T26A 4AG2A 3EYDA 5EW1H 2G52A 3HPTB 2F9NA 1ELVA 2XRCA 1F5RA 4LXBH 1LHDH 1THRH 1MKWH 1GMHF 4D9QA 2QN5T 2VIVA 1IQKA 4U01A 1QGFA 4K1EA 4Q2KA 3R0FA 1GHZA 3M61U 4Q80A 3SNAA 1QR3E 2ODPA 3LGIA 1A0LA 2C90B 3RLYH 3GCTG 1O2NA 4ESTE 2RCEA 1G3CA 2GT7A 4F49A 5GCHF 1AD8H 1IQLA 3SU5A 2STBE 4U2WA 1GJ6A 1BRBE 3P92A 3ZYDA 2HWLB 1DSUA 5GXPA 1UMAH 4SGBE 2JH0D 2Q6FA 1NY22 1ESTA 4DG4A 3VB6A 2QXIA 2BY9X 2PGQB 1CA8B 1MTNB 5K0HA 4YZUA 4AFUA 2PKAB 2R3UA 1TBQH 1EJNA 3E3TA 1Z1IA 5J4QA 2B9LA 2Y7XA 2ZGCA 1BMLA 1AUTC 3MHWU 4NIWA 5F03A 2YNAA 3SQEE 1MQ5A 3BIUH 2G00A 1GI4A 4CH8B 1E0FD 4I7YH 3S9CA 1X7AC 2H5DA 1AZ8A 1DM4B 1GJ5H 2ZU2A 1G3EA 4FU8A 1KY9A 1AGJA 1BB0B 1TIOA 3GCOA 4Y7BA 1P01A 2ZI2H 5DG6A 3M5NA 3MYWA 2ZDVH 3ZVEA 1TNJA 2QIQA 3UR9A 1QRWA 1C5WB 3MTYA 5E8EH 1C1WH 1J15A 2ANWA 1UTLM 3NCLA 3SV2H 3L3TA 1RIWC 3UR6A 1EZQA 4A6LA 2XCNA 2OQUA 1D9IA 1MZAA 4BTUB 4ZH8A 1GBBA 2A2XH 1MD8A 1V2JT 1N8OC 1LHEH 2A4OA 1V2LT 2HALA 3AASA