2ZCLP

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Prostate-specific antigen
total genus 52
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP01
1V2JT 4FUBA 1ZRBA 1Y3VA 5T6GA 3EA8A 4Z0KA 1ELAA 2R3UA 8LPRA 4LZ4B 1K1OA 3UQOA 1EQ9A 1QB1A 1RXPA 4TWYA 3K2UA 3ZVEA 4IN1A 4JYTA 1GVKB 5J4QA 2V0BA 3OX7U 3I78A 4ABGA 1TMUH 1FONA 1FIZA 1TRNA 4NA8A 3IITA 2XBYA 3MTYA 2J9NA 2W26A 1EJMA 5FPYA 2XC5A 2PTNA 4OS6A 3BEUA 3IWMA 1XMNB 1V6DA 3GOVB 5L2ZH 1EOLA 9ESTA 2BHGA 1O2GH 2ZI2H 2H2ZA 2OCVB 1DLKB 4D8NA 3TNTA 3QX5H 3CP7A 1MKWK 1IQKA 1BCUH 2GCHF 3OYPA 1CT2E 1MH0A 2HNTE 2Y5HA 2Z7FE 2ZFRH 1GMCF 3A80A 1UO6A 2RG3A 2OLGA 1Z6JH 2A0QB 4OS2A 2H9HA 2Y7ZA 1Y3UA 4D76A 1GJBB 2RA3A 1TMTH 1U6QA 1O0DH 1SGQE 1F5RA 1GI6A 2PKSC 2FX6A 1NFUA 5DKMA 1PQ7A 1PPEE 1TNGA 3LPRA 1Y5UT 2A2XH 1ZPCA 2A4RA 5LGOA 1MKXK 4HFPB 1UVPA 3RXLA 1NU7B 2TRMA 2O8WA 1ELTA 3CENA 1IQJA 1WOFA 1PQAA 1TA2A 1O37A 5ESBA 1KLIH 4X2VA 3GY6A 2G4TA 3RXUA 3TGJE 2QXIA 1WYKA 3SV6A 2VWOA 3RU4T 4GCHF 1ZSLA 2Q6GA 1ZMNA 1HNEE 3EYDA 1O3OA 4CBOA 2QY0B 3L33A 1AO5A 1NRRH 1Z6EA 2BD4A 4KELA 1TGTA 2ZTXA 3M5OA 1TPOA 2JH6D 1YGCH 1O2NA 2ASUB 3RXOA 2ZDNA 1O2KA 1IHSH 1FI8A 3JZ1B 3TLOA 1C4Y2 3RXEA 2GT8A 3M37A 1S6HA 3K65B 1K21H 5CHAC 1XVOA 2B8OH 5F6MA 3U1IB 3P8GA 1LVYA 5DP9A 1G36A 3A7TA 1AWFH 1IQLA 3A7WA 2NU0E 1FN6A 3LGUA 1QB9A 3MNBA 1HDTH 4NG9H 1QFKH 1CA8B 5DK1A 4DVAU 1ZJKA 2P8OC 2EI6A 1JOUB 2BD7A 4NZQA 1GBDA 3RMNH 2RA0A 1TQ0B 3RXIA 3TJNA 3A87A 5IDKA 2BDAA 1ZLRA 2TGDA 5DGJA 3SNAA 3RM0H 1TNKA 2AGGX 3FZZA 5HXFA 3T25A 1OWJA 1AN1E 3SUEA 3Q3KA 1DXPA 2QV1A 2YNBA 1ZGIA 2ZCKP 1O30A 3MNSA 1DOJA 1GHXH 1WTHD 5C1XA 1OP8A 1KDQA 1QBOA 2FYRA 1Y3YA 3TITA 1YPJH 1GBFA 1DITH 1GJ9B 1AFQC 4Z6AH 1KXFA 1C1NA 3UY9A 3ELAH 3VPKA 7ESTE 4ZUHA 3SU2A 2K1QA 4TYDA 3LGWA 2ZCHP 1LTOA 2ZPSA 3BIVH 1NESE 3OTJE 5EW1H 1O2ZA 2HOBA 4MNVA 1CA0C 1HAZB 1TRYA 1F0TA 3SGBE 1G2LA 1GMDF 3ATWA 1QR3E 3F9FA 3U8OH 1EAXA 2GV6A 1Z8IB 2PFEA 1RJXB 2GCTB 1LPKB 1DWDH 1KIGH 2WYJA 1AE8H 2J92A 2VIWA 2P59A 4UE7H 5FBIA 3V7TA 5JYIA 1LVOA 2GT7A 1TWXB 4NCYA 1QY6A 2C8WB 5GXPA 1O2QA 3SGAE 2HWLB 5I25A 4Y8YA 3M5NA 1JXPA 1F0SA 1BTYA 4JZDH 4LXBH 1GBKA 4OGYA 5C67A 1TBQH 1EPTB 1C5XB 1AQ7A 1GWAA 4GSOA 1NRQH 1WV7H 3ZZ6A 5FCRA 1P10A 1GJCB 4HTCH 1P2KA 2UWPA 2BY7X 3R3GB 1IQHA 5GCHF 1OSSA 2GX4A 1P3CA 3RLYH 3P92A 4ABAA 3LDXH 1HAIH 2A4QA 2ZU4A 1BTPA 1O2HA 1UK2A 4IBLH 4JYVH 1O5BB 3SJIA 4INHA 2P3UB 1TONA 4TY6A 1QJ1B 4CRCA 4WWYA 2ALPA 3N7OA 1ABJH 4YESB 2BOHB 3STIA 4H4FA 1VCWA 4B2AA 4VGCC 4X2XA 3A8DA 2WPMS 3LU9B 3GY7A 1ELFA 1HBTH 2FIRH 4NWKA 1ZSKA 2G81E 1YC0A 4AZ2B 2A5IA 1QJ6B 2Z3EA 2OTVA 1GMHF 3PTBA 6CHAB 4XBCA 3MH5A 4AB9A 3ATIA 4DCDA 1O3AA 2BDHA 4HZHA 1D4PB 3T28A 1O3BA 1C2LA 2F9PA 4YOGA 5TJXA 2TGAA 1AVWA 1F7ZA 4B74A 3RXFA 2G5NA 2SGAA 2QCYA 3PWCA 2VB0A 1EJNA 1GGDC 5C20A 1TLDA 3A7ZA 2FZZA 1GCDA 2BZAA 1AY6H 2ZO3H 1J8AA 4E06H 3E0NB 3MHWU 1QL8A 1XVMA 2F9OA 1P03A 4GLYA 1DM4B 3ZVDA 2ZKSA 1XXDA 1L2EA 1F0RA 3QUMP 1GHWH 1CA0B 1GBEA 1A1RA 2WPIS 4XFQA 4NSVA 1P2QA 4KTSA 1MZAA 4IMQA 1KXEA 4UDWH 1MTSA 1HAYB 4NA7A 4CR5A 4ABHA 1GI4A 2XW9A 1ZPBA 2GDDA 3GCHC 3QO6A 4BAMB 2A5KA 1MKXH 3NCLA 1NC6A 4WMDA 3D65E 2WPJS 1G30B 1ZOMA 6GCHG 4WH6A 4D9RA 4AX9H 2SGPE 5E2PA 1CT0E 1KXCA 3VEQB 2BQ6B 1F5LA 1O2RA 2BD8A 3PLPA 3VB7A 1EATA 4XE4A 4BTUB 1T32A 1K1NA 1UCYK 2D2DA 2B7DH 2F9BH 3D49H 1IQNA 1SMFE 4Y7BA 5CHAB 5HGGA 1HAVA 4NIVA 2XC4A 5EPNA 2Y82A 4NFFA 1AI8H 1GI8B 1G3BA 1LHGH 4J2YB 4AG2A 1PPZA 1O2IA 2R9PA 1NU9A 1O31A 5LPEA 3MH4A 3SN8A 2C3SA 2QA9E 2YNAA 1VJAU 3A89A 2GVFA 3HGPA 3M3SA 5A09A 2GZ8A 5EOKA 1GL1A 1N8OC 1PPHE 1O2SA 1SBWA 4H6SB 1A46H 5JBBS 1GDQA 2B5TB 2J94A 1GJ5H 1TBZH 1J16A 3MFJA 1V2WT 1TX7A 2B0FA 1VZQH 2XNIA 2BDIA 3MO9A 5K7RA 3GCTG 3U69H 5EGMA 2CF9H 1FPHH 4Y71A 1YPHC 4X8TH 4ZHAA 2ZZUH 4FUFA 6CHAC 1BA8B 2ZU3A 4Y7AA 4ZROA 4I8JA 3VB6A 1FUJA 1GBMA 4OS4A 2FTLE 5EODA 1W2KH 4Y8XA 3SNCA 1HAPH 1Y5AT 2PKAA 3K6ZA 4BXWA 4Y10E 2HRVA 1M9UA 2BD3A 1VITF 2PW8H 1FLEE 1BRCE 1A61H 4CBNA 2W5EA 1NS3A 5H4IB 1AUJA 4U01A 2PTCE 1LO6A 1O2UA 1Q3XA 4TPIZ 1TNHA 6LPRA 1Y8TA 4INKA 4I8KA 2ANWA 4ABDA 1SLUB 2XCFA 2D26C 1Z1IA 1T8MA 1GCTB 3QN7A 1XUIA 1L4ZA 4ZKSU 1BTXA 2I6SA 4AB8A 2OBOA 1MUEB 1SGDE 1RTLA 1Z8RA 2FDAA 2GTBA 3UREA 3QWCH 1G32B 1BOQA 5DG6A 4X8UH 1ARBA 1QHRB 1W0ZU 2BLOA 3MU0A 2ZHEH 1O3NA 6ESTA 1O2YA 1IQIA 1CSOE 4E05H 1C5WB 1WTGH 2C4FH 4K60A 5FBEA 1TQ7B 2BMGB 1P06A 5A0BA 2VIOA 4SGAE 2NWNA 3A82A 1ELGA 2W3IA 1V2MT 2WYGA 1OYQA 1SI5H 1ACBE 1BQYA 1O3LA 1WU1A 2BXTH 3M5MA 3E6PH 2SGDE 1GDNA 3SOSA 1P3EA 3SNBA 2NU4E 2R0LA 3A86A 4F4OC 2J34A 2BLWA 2M5TA 3PLBA 2QXJA 5JBCS 3KCGH 1H4WA 3KGPA 3RXVA 3UNQA 3F9HA 4KTUA 4FXGH 5E0HA 2J2UA 4ISNA 4BAQB 1FN8A 3GICB 4A1XA 1G3EA 3RXGA 1DY9A 1DFPA 1VR1H 1AMHA 2CGAA 2ZDVH 2ZP0H 1AE5A 1ID5H 1LHEH 2ZC9H 4AFUA 1O2MA 3E3TA 3GISB 1D3QB 3B9FH 1C1MA 3VB4A 1GDUA 1BUIA 1HV7A 1ZYOA 1A0HB 1AB9C 1C5ZB 1VCQA 5T3HA 2ODYB 1SOZA 2LPRA 5F8XA 3O8DA 2FS9A 1IOEA 4XSKU 2R2MB 2G51A 3URDA 4BTTB 1GHBG 2DE9A 1BT7A 4MNWA 3HPTB 1K22H 2NU2E 1SFQB 3LT3A 1V2LT 2J38A 2FOBA 1G2MA 2TPIZ 1RTKA 1PPBH 2Q6FA 4Y8ZA 2BXUH 2V6NA 1CGHA 3BTTE 4Q7ZA 1OPHB 2OD3B 2ANKH 1V2RT 4KKDA 5T6FA 1FPCH 4MPXA 4TY7A 3UOUA 2FOGA 2Z9KA 2Z9IA 3TGIE 4YOIA 1PFXC 1THPB 2CMYA 5T6DA 1AKSB 3BG8A 3STJA 5C2ZA 1QURH 1O2JA 3EE0B 3QTVH 1V2UT 2F9NA 3SU0A 3O8CA 4K3JA 1MAYA 1GBBA 1GJ4H 1VJ9U 2ZDKA 1EASA 1LVMA 1NFWA 3MMGA 5DJ7A 4X6OA 4RKOB 3LONA 4JZ1A 1A5HA 4NWLA 3UNSA 3T5FH 1MBMA 1O3HA 2C8YB 3T26A 3RXSA 3BG4C 3RXQA 3U8RH 1QGFA 4MVNA 3P70B 1KDQB 2G55A 2EA3A 3MYWA 1C2DA 1MAXA 1P2JA 3SNEA 2P94A 3QTOH 1GBLA 1P9SA 3M3VA 2IN2A 1P12E 1DVAH 3RC4A 4QT8C 5L30H 4CRFA 4FU9A 4WXVA 2Y5GA 1W11U 2A4GA 1ZTJA 3TPIZ 2Z6BD 1B0EA 4JZEH 2FOHA 2A7HA 1BHXB 1PQ5A 4PROA 3Q77A 1O5AB 2BLVA 4YLQH 1TNLA 7GCHG 4A1VA 1GL0E 1VCPA 3ATMA 1C2IA 1QNJA 1ZHPA 1O3GA 1Q31A 4JYUH 2BQWB 1W12U 4UFEH 3RXHA 4BTIB 1HGTH 1S82A 1S81A 1C9PA 1GJ7B 3VFEA 5A2MH 1MTNB 1ANDA 5B6OA 1C1VH 2P16A 2FS8A 4RN6A 1X7AC 3A8AA 3C1KA 4A6LA 1SGTA 1CE5A 4DOQA 2FESH 3MU4A 1HRTH 3PMBB 1BMAA 2ZPQA 2CN0H 1DUAA 1WUNH 1XKBC 4YM9A 3DFJA 1GMDG 3AW0A 2GGVB 2VINA 3LC5A 3GDSA 1Z7KA 1YP9A 3ENSB 2FOEA 3I77A 2THFB 1MTNC 3T62A 2FOMB 3PROA 2VVVA 1TPPA 1AGJA 2UUKB 2HLCA 3HK6B 1BTZA 2A32A 1BRAA 4INLA 1TYNA 4U2WA 3U8TH 2AMQA 5TCCA 1O3PB 5G4BA 4Y76A 1EZSC 1T4VH 1TMBH 1ANEA 3HKIB 2ZGJA 3F68H 4ABIA 1DX5M 3BSQA 2STBE 1HJAB 2BDCA 5L6NH 3T29A 1NTPA 2WPLS 2AEIH 1C5TA 3SU5A 1ARCA 5L2YH 1GHYH 1T8NA 3U1JB 4ABBA 1PJPA 2PLXA 1SSXA 4OS5A 3VB3A 5FCKA 4ZKNU 1FNIA 2FWWA 4AFQA 1WSSH 4GAWA 3L6PA 1EPTA 1GVZA 3ZV8A 1L4DA 1SPJA 2D1JA 3ZZ9A 1O32A 2ZA5A 2PSYA 1JRTA 1O5DH 3FP7E 5E0GA 3MH7A 1NRPH 4JMYA 5BRRE 3ODDA 3LH1A 2H1UA 1SQTA 1SGFA 4IC6A 1O2PA 5DP5A 4IC5A 4UEHH 3GCHB 1SGEE 1OWKA 1W14U 2BTCE 3WY8A 1QTFA 4B2BA 2OC0A 4AFZA 2ZGBH 2VGCB 3MNXA 2ULLA 1GVLA 2BY8X 5GJ4B 1NROH 3F1SB 1EP6A 5C1UA 2OUAA 1VGCC 1EXFA 4VGCB 6GCHF 1AZZA 2ZHQH 1Z1JA 4I8GA 4CRGA 2ZEBA 3ZZBA 1C5UA 3PO1C 5LPFA 1C5NH 3RXKA 5IYTA 3ITIA 3QZQA 1MQ6A 4E7RG 2NU3E 1ZHMA 1LHFH 1C1OA 2TBSA 2RCEA 3GY8A 3S9CA 1ORFA 3LH3A 2FMJA 2SFAA 1G37A 2VGCC 3NXPA 2A1DB 1AFEH 2BM2A 2VIPA 5A0AE 2R2WU 5A0CA 1HAGE 1BTHH 5PTPA 3TU7H 2GP9B 1JBUH 2UUYA 1PYTC 4J1YA 1VGCB 1UCYE 2BY5X 1KXDA 3RMLH 1HB0B 1QBNA 2VU8E 1SQOA 1SG8B 2EEKA 3GY3A 2CXVA 1H8DH 4B73A 4Y11E 3ZZAA 1T31A 3P17H 1GMCG 1T7CA 1UTKA 1RIWC 3SV7A 4DGJA 2HPPH 2FEQH 4MG3A 5E2OA 1DPOA 4NZLA 1YF4A 1AB9B 1ELCA 2PHBA 2WV5A 3SJ9A 3OSYA 1TAWA 2BDBA 1O3KA 2FI4E 1QRXA 5FX6A 1YYY1 1DXWA 4MTBA 1YLCA 1A3BH 4ISIH 3UOPA 1MMJN 4NSYA 2Z9LA 1YPHE 3RMOH 4ISLA 2QYIA 4DT7B 4X8SH 1TX6A 3H7TA 5ABWA 1T8OA 3RXRA 1YPLH 3W94A 8GCHG 3DHKH 4B75A 3AW1A 2O8UA 3H7OA 1KTSB 4MQAA 2Y6TA 5J4SA 1EB1H 2XRCA 2VJ1A 1JRSA 3NK8A 4ZXYH 3L3TA 4MLFB 1OWEA 2O8LA 1CHOG 1SOTA 4Y79A 3NZIA 1UTLM 3P8FA 1ESBA 1FY1A 2W7UA 3SUFA 5HMAA 1KY9A 1P2NA 3RC6A 3TJVA 4DW2U 1VITG 5C5NA 3GDVA 1V2TT 1XUFA 2PUQH 3TNSA 3HGNA 5FXLA 2SNVA 2P3FH 3E1XB 3OU0A 1GJ8B 4ISOA 5SGAE 2P8OB 3UFAA 4MDSA 1C1RA 1NM6A 5I46H 2AMPA 1FIWA 5E8EH 1MD8A 3A7VA 4ZH8A 1XUKA 1QB6A 1LVBA 3A83A 1O3IA 3V12A 1IAUA 4MNXA 1DSUA 5AHGH 1HAHH 3CS0A 4X6NA 1ELBA 1ABIH 1GBJA 5EPYA 3SORA 1N1LA 1FAKH 2BY9X 1OP0A 3A84A 4ABEA 1NRSH 3E90B 2OINA 1W8BH 2F91A 1S83A 1THSH 4X2WA 1QA7A 3RDZA 4BOHA 3PO1B 1QCPA 1KLTA 1O5GH 1OWDA 5GDSH 4FUJA 1B0FA 4B71A 4RKJB 4CHAB 3TH3H 3MNCA 1DUEA 2ZPRA 5K0HA 1GHAF 1GI7B 1UTMA 1O38A 1BJUA 4Q7XA 1SGPE 2Y80A 2ODQA 1OWHA 4ZHMU 4AG1A 1C5VA 1S0RA 4A1TA 3SNDA 4YT7H 1F2SE 1HIAA 5BPEA 4D7FA 1MKWH 1HXEH 1F92A 3G01A 1V2NT 1YCPH 3OY5U 1LKAA 3UR6A 1ANBA 2Q1JA 2RDLA 1ETRH 1DLEA 1RS0A 1G9IE 2ANMH 2ZTZA 3AVZA 1YM0A 4ZKRU 2ZG0H 3BTWE 4R0IA 3TGKE 3LC3A 3FAOA 1ETSH 4ASHA 1QQUA 2JH0D 3PB1E 2J4IA 1MTWA 2AH4X 1EPTC 3EDXB 1GI9B 2AMDA 2GMTC 2I6QA 5AFYH 3TK6A 3E16B 4O3UA 3RXBA 4SGBE 1VITH 3RU4E 4TPYA 3MH6A 1FZZA 2CV3A 3ZYEA 1GBIA 2OC1A 4TWWA 1EJAA 1BMNH 5FPSA 3RXTA 4I8LA 1D3DB 1DDJA 1GJDB 1FV9A 1C5PA 2FI5E 4UFDH 3IG6B 3SI3H 4FVBA 2BQ7B 1RGQA 4XBBA 2ANYA 4NA9H 1TOMH 1GCTC 1WAYB 3BN9A 4XDEA 2AERH 1C2GA 1UTPA 1XX9A 5ETXA 3BTKE 1V2KT 3QDZB 1S5SA 1OS8A 1IQGA 1O5EH 2C90B 3ATLA 3SU3A 1FJSA 2QXGA 4O03A 1MCVA 1UHBA 3ESTA 1AFQB 2ZDLA 2ZNKH 1ZTKA 1SR5C 4YO9A 1H1BA 1RRKA 4I31A 3KNXA 2FOFA 4X1RU 4BAHB 3HK3B 1V2PT 7LPRA 4NIYA 5EXNA 3TIUA 3SU6A 2JKHA 1BBRE 1OX1A 3ATKA 1DT2A 3AASA 3ZVGA 3ZVBA 1SLVB 3Q3YA 1LPZB 1C4V2 3LGIA 4GHTA 4A92A 1UMAH 2A31A 1HCGA 1O3EA 1TGSZ 4AOQA 1E34B 1JIMA 1UTOA 1G3DA 2C93B 2WPKS 4M7GA 1D6WA 1AUTC 2QXHA 7GCHF 1K28D 1JWTA 3P6ZB 4A7IB 4Q80A 1GHVH 1Y5BT 2XBXA 3BTHE 1FDPA 2FP7B 3PV4A 2P95A 5DP6A 1HXFH 1YKTA 2HNTF 1EAIA 5EQRA 2FLBH 4K2YA 4HI3A 3QGNB 1V2ST 1N6YA 2AGIX 3BEFB 2WPHS 3DT0H 5A8XA 1IQEA 2AYWA 1ELDE 3NUMA 1AVXA 2JETB 1UK3A 4CRDA 1QL9A 3ZV9A 3ZYDA 1N6XA 1SGNE 4JK6A 3BIUH 3P95A 1AD8H 2ZU2A 2ZFSA 2V3HH 3RC5A 3GDUA 2PWXA 4AYVB 2H5DA 1TRMA 2ZQ1A 1A7SA 1BDAA 3PMHB 4ZKOU 1O5CB 3FFGA 8GCHF 1IHTH 3A7YA 1KLJH 1P09A 1E35B 3QK1A 1B5GH 3LGVA 4BXSA 4X8VH 3ZVAA 4ZAEA 3DA9B 1AZ8A 2BLQA 3BG4B 5GIBA 2XC0A 3UR9A 1L1JA 1LDTT 3LKWA 3W95A 5FAHA 2XBWA 5DP7A 1XUGA 1ZHRA 2A7JA 3NWUA 4MNYA 1DICA 1C1TA 2ZDAH 1C1WH 3DD2H 1NY22 1O33A 2GDEH 5LPRA 1CHGA 4FU7A 1NO9H 1O39A 1SHHB 2VIDA 2BZ6H 4WH8A 2ZF0H 1W7GH 3UWJH 5HM9A 3GYMA 2WINI 3GY5A 4D7GA 1Z71A 1C2JA 2QAAA 3VXFH 3FP6E 2VWLA 1UK4A 4JZIA 1EX3A 1BBRK 1EZXC 4I33A 1CBWB 1PPFE 1GI1A 1WBGB 1RTFB 2KAIB 2FX4A 3M7TA 1BTUA 3UNRA 3S9AA 2AS9A 1V2QT 2SGFE 3MU8A 1UVOA 1SVPA 3E0PB 1DS2E 1B7XB 2YOLA 4X6MA 3ZVFA 1C5LH 2QIQA 2BX4A 1NRNH 1KXBA 2UUJB 1O35A 5HYOA 1SLXB 1UVUH 2FOCA 2W3KA 3ZZ7A 1UVTH 2AIPA 3LGTA 1P2MA 1C1QA 4CRBA 1SGFG 1YPKH 2ZDMA 4WXIA 1C5MD 3EA9A 3NPSA 2R3YA 4OGXA 3TK5A 4AN7A 1C5RA 2GZ9A 1CBWC 2ODPA 1GBTA 1K1JA 1GJAB 5EXLA 4NGAH 1GI0A 1HAXB 1EAWA 1OXGA 4Y6DA 4K1TA 4GPGA 4YLUA 2Q6DA 3KQDA 5HM2A 3D23A 1NN6A 2BVXH 2VWMA 3KN2A 1C2FA 2ZQ2A 1JMOH 4Q7YA 1HAVB 2ZFQH 4IGDA 4O9VA 3GYLB 1WCZA 2QGRA 3RXJA 3K6YA 2BX3A 2ZU5A 1KXAA 4GCHG 4X2YA 1O3MA 3BTQE 1SHYA 5GWZA 5DP8A 1HYLA 1O3JA 1YCPM 3HATH 3R0FA 4AYYB 4IW4E 2O8TA 1HJ9A 1CQQA 1GBHA 1MQ5A 3FP8E 3VXEH 4NIWA 3PMJA 3GCNA 2BDYA 2FODA 2Z9JA 3UWIA 1V2OT 5FHTA 2A7CA 2AIQA 3MO3A 4U32A 1A5IA 1P8VC 1ELVA 2C8XB 2GKVE 2G5VA 2XTTB 3FANA 1SC8U 2F9VA 4BNRA 3RXPA 1TFXA 1QRZA 1DWEH 5JB8S 4DIIH 3SV9A 3A8CA 1EZQA 3GCTF 2PUXB 4X1SU 4UD9H 2ZCLP 5C1YA 5JB9S 1CT4E 2GCHG 3SQHE 5CMXH 3EGKH 2PKAB 5DP3A 1O2OA 2Z9GA 3M36A 4FUIA 1BJVA 4B1TA 1TA6A 1T8LA 3RMMH 3RXDA 4K5ZA 1SGIB 3Q3XA 1O2LA 3BTEE 1LMWB 2BYAX 1AIXH 2BVRH 4BAOB 1GPZA 1GHZA 1O3DA 2KAIA 2SNWA 2VH6A 1IQFA 4O3TA 1H8IH 3DUXH 5GCHG 1LPGB 1TGCA 4ZXXH 3S9BA 1S84A 4CHAC 4ZMAH 4DURA 3TH2H 2Z94A 1J15A 1C4U2 2OBQA 1P02A 1Z8JB 2O8MA 1NPMA 2HVXA 1O34A 1O3FA 4IS5A 2G00A 4JZFH 3RXAA 3S7KB 5A8YA 1MCTA 4FVDA 1DY8A 2G52A 1C5OH 3GY2A 3UUZA 5ESTE 1SB1H 4F49A 1G3CA 1HIAB 1Q2WA 4E7NA 2Y5FA 1EKBB 1EOJA 1MBQA 1SLWB 2A2QH 4HGCA 1AHTH 1OKXA 3PMAB 3BTME 1DANH 2BY6X 1AU8A 3UTUH 2AGEX 3ODFA 3AAUA 3LIWA 5E0JA 1BITA 3Q76A 2OP9A 2HNTC 3MU5A 1ELEE 5AVDA 4FUCA 2F9UA 3PLKA 3SU4A 4BANB 2ZGCA 1YPGH 2PSXA 1K1PA 1P05A 1KSNA 2GMTB 1BMMH 4WF8A 1FMGA 1O2TA 1D6RA 3PM3A 3SBKA 3KEEA 1BB0B 4X6PA 2G4UA 1H9HE 3S0NA 4I8HA 4CR9A 1UCYH 1TE0A 4FUEA 3UQVA 3LJJA 1CGJE 1C5SA 1S6FA 2FYQA 1D9IA 3V3MA 3MO6A 2IPHA 2UWOA 4YOJA 2V35A 4ISHH 3DFLA 2BB4A 1E37B 2OC8A 1EZUC 2AFQB 5F03A 8ESTE 5EG4A 3KF2A 1P0SH 3U98H 3BTGE 3SJ8A 2VIVA 1CVWH 1ZRKA 5DPAA 2Z3DA 1UTNA 4B2CA 3TH4H 3SHAH 1IQMA 1V2VT 2A45B 4LOYH 4FUHA 1CU1A 4ABFA 1JIRA 4X1QU 1W7XH 2PGQB 3EQ0H 4XOJA 1KYNA 5TCAA 2UUFB 5FX5A 2CF8H 5JBAS 3SZNA 2TIOA 1O3CA 3ZZ3A 1WQVH 3GY4A 3QZRA 1P01A 4CREA 2HPQH 3K9XB 3VGCB 1AKSA 1K1LA 1ZMJA 2ZU1A 1YLDA 3ZZ8A 5EXMA 1W13U 1E0FD 1OP2A 3KIDU 2PR3A 2WV4A 1W0YH 1WQSA 2C8ZB 2FXRA 4Q2KA 1W3CA 3EA7A 4ESTE 8KME2 4KP0A 1V3XA 5DP4A 1GI3A 3M5LA 4X1NU 1LCYA 1NFYA 1C2EA 1YBWA 1K2I1 1AVGH 1FY5A 3RU4D 1SGYE 1LHDH 1H9LB 2PGBB 3SO3A 1TABE 5EQQA 1TGBA 2ZGHA 2QC2A 1SGCA 3JZ2B 2OQ5A 1SQAA 1LHCH 3VB5A 1INCA 1HFDA 2ZWLH 7KMEH 5JDUB 4XBDA 2FI3E 1RD3B 3LGYA 4YTAA 2GCTC 5C3NA 3KQCA 1ZPZA 1MZDA 2ZIQH 3I29A 1FY8E 1THRH 5EU8A 1SGRE 1SL3A 1KTTB 1C2MA 1QIXB 2OQUA 1L0ZA 2FM2A 1BRUP 1A3EH 2XWAA 1UHBB 3SGQE 1P57B 1L1NA 2Y81A 2WUBA 3Q00A 2GV7A 3V13A 3LOXA 5EW2H 2Z3CA 1P2OA 1F5KU 4K1SA 1QRWA 1ESAA 1NZQH 2H6MA 2R0KA 1TPSA 3MOCA 1FY3A 1P04A 4CH8B 2ZFTA 1HJAC 4GUXA 3TJOA 1PYTD 2J95A 3M61U 1BIOA 1S85A 1BHXF 3M7UA 3BF6H 4THNH 2IJOB 1EB2A 1CHOF 1LQEA 1TNIA 2PKSB 1O2XA 3A7XA 4WY3A 5GPIB 4A5TS 4FUGA 1ETTH 1YCPK 3HKJB 4JCNA 3TK9A 4B76A 2G8TA 1HUTH 1QL7A 1BRBE 1QQ4A 4MPWA 4O97A 1GBAA 2XCNA 4UFGH 1HPGA 1HLTH 1P2IA 1PPGE 2VWNA 1C1PA 1ZJDA 3ZZCA 4WJG2 1NFXA 4CH2B 2DUCA 1E38B 1E36B 1T4UH 3BV9B 1F0UA 1O2WA 2XWBI 4K69A 4MPVA 5FPTA 3VGCC 3F9GA 1XUJA 4YZUA 1TALA 1ZGVA 4UFFH 1J9CH 3QLPH 1XM1A 2VVCA 3KQBA 1BMLA 2A5AA 2SGQE 1C9TA 1TIOA 2TGTA 4H6TA 5JPMH 3FVFB 4OS7A 1GG6B 1W10U 1XKAC 4IMZA 5C5OA 2F83A 1TB6H 4AFSA 4ZHLU 2ZTYA 2CJIA 4DG4A 5AF9H 2GZ7A 1TGNA 1QBVH 2JETC 1GBCA 4GHQA 1S0QA 4LK4A 1TPAE 1OOKB 1ZSJA 1CO7E 4WVPE 3BTFE 1C5QA 1PQ8A 4H42U 1TBRH 1FXYA 3MU1A 3ZZDA 3SHCH 1Y3XA 4AGJA 4BAKB 1TOCB 2QF0A 3U9AH 1P9UA 1C5YB 2OXSA 1A0LA 2ZFPH 3FZDA 1PPCE 1GG6C 1Y59T 4I32A 4IN2A 3SW2B 1J14A 3SV8A 3GCOA 1XUHA 3A88A 1EUFA 3A81A 1A0JA 4DIHH 5A8ZA 3S69A 2ILNA 2VNTA 1ESTA 1GI2A 1C1UH 2VIQA 3E91A 1D3TB 1MD7A 2LNCA 1DWCH 4RSPA 3F9EA 1ANCA 1UTQA 2EI7A 3PYHA 3SQEE 1HJ8A 1UTJA 4K8YA 1YPEH 1DSTA 2UWLA 1Z8GA 3CS7A 2P3TB 3URCA 2V3OH 1P11E 2DE8A 1DWBH 3RP2A 2ALVA 5DO4H 2XBVA 1Y3WA 3SUGA 1MTUA 1LQDB 3RLWH 3UPEA 1RIWB 1O5FH 1GJ6A 2H9EH 3O8BA 2FTMA 1UVSH 2ZHWH 1EP5A 3M3TA 2EI8A 3P8OA 1OYTH 2A4OA 1FY4A 2JH5D 1QA0A 9LPRA 4CRAA 4LZ1H 3RUOA 2WUCA 2TGPZ 3B23B 3SUDA 2IOTA 5AFZH 4JK5A 3TJUA 3ZZ5A 3OY6U 1HAOH 4FUDA 1K9OE 3C27B 3RXCA 3BEIB 5CE1A 1ZZZA 4OS1A 1MU8B 3UIRA 2FLRH 3NKKA 3QGJA 3F6UH 2O9QA 2ZGXH 4I7YH 3SI4H 3O8RA 1ZR0A 2BD5A 2W7SA 1ZMLA 2H9TH 4R8TB 3TVJB 3S7HB 2Y7XA 4NIXA 4ABJA 3E8LA 3M7QA 1GI5A 4KGAA 3M35A 4X1PU 4Y0YE 1BBRH 2STAE 1H9IE 1J17T 2XYAA 4AORA 4NFEA 1C2HA 2NU1E 2HALA 2ZHFH 1K1IA 4X0WU 1O36A 5F8TA 1O2VA 3T2NA 1BZXE 2BDGA 3B8JA 2QF3A 2D8WA 2ESTE 1LKBA 3KHVA 2FOAA 3V0XA 1ZTLA 3PTNA 4DY7B 1BTWA 3EAJA 3KL6A 3MI4A 3LJOA 4YT6H 3BTDE 5EQSA 2BOKA 3PWBA 2VVUA 3SJOA 3D62A 5F8ZA 2BD9A 1OWIA 2EC9H 4MPUA 1L1GA 4DJZB 1QJ7B 3AAVA 1TX8A 2CHAC 3A8BA 4K8BA 1YPMH 3SU1A 2VH0A 2XXLA 2HGTH 4KTCA 1DE7H 3P8NA 2QN5T 1SFIA 5JBTA 1CGIE 2ZHDA 1UJ1A 4D9QA 4UONA 3SV2H 2OC7A 2FPZA 2B9LA 4GVUA 1D3PB 4K1EA 1C1SA 1GHAG 3KQEA 1GMHG 2H5CA 1N8OB 3MWIU 2FO9A 3H5CB 1GHBF 1TNJA 2ZECA 1FQ3A 2SGEE 1AWHB 1MU6B 3ZZ4A 3A85A 4AGKA 2ZFFH 1A2CH 1GGDB 2BVSH 5LH8A 4U30A 2P93A 1C2KA 3RM2H 1RFNA 2CHAB 1FAXA 1A5GH 1EAUA 4Y0ZE 1MTVA 1K1MA 4WMEA 4FU8A 2BD2A 3T27A 2PV9B 2F3CE 4WMFA 3SJKA 2GD4B 1XXFA 1A4WH 1NT1A 3ZVCA 3RXMA
chains in the Genus database with same CATH superfamily
1V2JT 4FUBA 1ZRBA 1Y3VA 5T6GA 3EA8A 3OTPA 4Z0KA 1ELAA 2R3UA 8LPRA 4FOUC 4LZ4B 1K1OA 3UQOA 1EQ9A 1QB1A 1RXPA 4TWYA 3K2UA 3ZVEA 4IN1A 2WV9A 4JYTA 1GVKB 5J4QA 2V0BA 3OX7U 3I78A 4ABGA 1TMUH 1FONA 1FIZA 1TRNA 4NA8A 3IITA 2XBYA 3MTYA 2J9NA 2W26A 1EJMA 5FPYA 2XC5A 2PTNA 4OS6A 3BEUA 3IWMA 1XMNB 1V6DA 3GOVB 5L2ZH 1EOLA 9ESTA 2BHGA 1O2GH 2ZI2H 2H2ZA 2OCVB 1DLKB 4D8NA 5HKKD 3TNTA 3QX5H 3CP7A 1MKWK 1IQKA 1BCUH 2GCHF 3OYPA 1CT2E 1MH0A 2HNTE 2Y5HA 2Z7FE 2ZFRH 1GMCF 3A80A 1UO6A 2RG3A 2OLGA 1Z6JH 2A0QB 4OS2A 2H9HA 2Y7ZA 3OEED 1Y3UA 4D76A 1GJBB 2RA3A 1TMTH 1U6QA 1O0DH 1SGQE 1F5RA 1GI6A 2PKSC 2FX6A 1NFUA 5DKMA 1PQ7A 5EJ1A 1PPEE 3N7EA 1TNGA 3LPRA 1Y5UT 2A2XH 1ZPCA 2A4RA 2AHME 5LGOA 1MKXK 4HFPB 1UVPA 3WW7A 3RXLA 1NU7B 2TRMA 2O8WA 1ELTA 3CENA 2HVYB 1IQJA 4F48B 1WOFA 1PQAA 1TA2A 1O37A 5ESBA 1KLIH 3H09A 3PRDA 4X2VA 3GY6A 2G4TA 3RXUA 3TGJE 2QXIA 1WYKA 3SV6A 2VWOA 3RU4T 4GCHF 1ZSLA 2Q6GA 2K8IA 1ZMNA 1HNEE 3EYDA 1O3OA 4CBOA 5KECA 1YLNA 2QY0B 3L33A 1AO5A 1NRRH 1Z6EA 2BD4A 4KELA 1TGTA 2ZTXA 3M5OA 1TPOA 2JH6D 1YGCH 1O2NA 2ASUB 3RXOA 2ZDNA 1O2KA 1IHSH 1FI8A 3JZ1B 3TLOA 1C4Y2 3RXEA 2GT8A 4Z1MD 3M37A 2XOKD 1S6HA 3K65B 1K21H 5CHAC 1XVOA 2B8OH 5F6MA 3U1IB 3P8GA 1LVYA 5DP9A 1G36A 3A7TA 1AWFH 1IQLA 3A7WA 2NU0E 1FN6A 3LGUA 1QB9A 3MNBA 1HDTH 4NG9H 1QFKH 1CA8B 5DK1A 4DVAU 1ZJKA 2P8OC 2EI6A 1JOUB 2BD7A 4NZQA 1GBDA 3RMNH 2RA0A 1TQ0B 3RXIA 3TJNA 3A87A 5IDKA 2BDAA 1ZLRA 2TGDA 5DGJA 3SNAA 3RM0H 2JDID 1TNKA 2AGGX 3NRLA 3FZZA 5HXFA 3T25A 1OWJA 1AN1E 3SUEA 3Q3KA 1DXPA 2QV1A 2YNBA 1ZGIA 2ZCKP 1O30A 3MNSA 1DOJA 1GHXH 5T1VA 1WTHD 5C1XA 1OP8A 1KDQA 1QBOA 2FYRA 1Y3YA 3TITA 1YPJH 1GBFA 1DITH 1GJ9B 1AFQC 4Z6AH 1KXFA 1C1NA 3UY9A 3ELAH 3VPKA 7ESTE 4ZUHA 3SU2A 2K1QA 4TYDA 3LGWA 2ZCHP 1LTOA 2ZPSA 3BIVH 1NESE 3OTJE 5EW1H 1O2ZA 2HOBA 4MNVA 1CA0C 1HAZB 1TRYA 1F0TA 3SGBE 1G2LA 1GMDF 3ATWA 1QR3E 3F9FA 3U8OH 1EAXA 2GV6A 1Z8IB 2PFEA 1RJXB 2GCTB 1LPKB 1DWDH 4RT0A 1KIGH 2WYJA 1AE8H 2J92A 2VIWA 2P59A 4UE7H 5FBIA 3V7TA 5JYIA 1LVOA 2GT7A 1TWXB 4NCYA 1QY6A 2C8WB 5GXPA 1O2QA 3SGAE 2HWLB 5I25A 4Y8YA 3M5NA 1JXPA 1F0SA 1BTYA 4JZDH 4LXBH 1GBKA 4OGYA 5C67A 1TBQH 1EPTB 1C5XB 1AQ7A 1GWAA 4GSOA 1NRQH 1WV7H 3ZZ6A 5FCRA 1P10A 1GJCB 5IK2D 4HTCH 1P2KA 2UWPA 2BY7X 3R3GB 1IQHA 5GCHF 1OSSA 2GX4A 1P3CA 3RLYH 3P92A 4ABAA 3LDXH 1HAIH 2A4QA 2ZU4A 1BTPA 1O2HA 1UK2A 4IBLH 4JYVH 1O5BB 3SJIA 4INHA 2IPQX 2P3UB 1TONA 2V7QD 1QJ1B 4TY6A 4CRCA 1COWD 3EE7A 4WWYA 2ALPA 3N7OA 1ABJH 4YESB 2BOHB 3STIA 4H4FA 1VCWA 4B2AA 4VGCC 4X2XA 3AK5A 3A8DA 2WPMS 3LU9B 3GY7A 1ELFA 1HBTH 2FIRH 4NWKA 1ZSKA 2G81E 1YC0A 4AZ2B 2A5IA 1QJ6B 2Z3EA 2OTVA 1GMHF 3PTBA 6CHAB 4XBCA 3MH5A 4AB9A 3ATIA 4DCDA 1O3AA 2BDHA 4HZHA 1D4PB 3T28A 1O3BA 3DSPA 1C2LA 2F9PA 4YOGA 5TJXA 2TGAA 1AVWA 4M9FA 1F7ZA 4B74A 3RXFA 4Q4LA 2G5NA 2SGAA 2QCYA 3PWCA 2VB0A 1EJNA 1GGDC 5C20A 1TLDA 3A7ZA 2FZZA 1GCDA 2BZAA 1AY6H 2ZO3H 1J8AA 2YMSB 3E0NB 4E06H 3MHWU 1QL8A 1XVMA 2F9OA 1P03A 4GLYA 1DM4B 3ZVDA 2ZKSA 1XXDA 1L2EA 1F0RA 3QUMP 1GHWH 1CA0B 1GBEA 1A1RA 2WPIS 4XFQA 4XD7D 4NSVA 1P2QA 4KTSA 1MZAA 4YXWD 4IMQA 1KXEA 4UDWH 1MTSA 1HAYB 4NA7A 4CR5A 4ABHA 1GI4A 2XW9A 1ZPBA 2GDDA 3GCHC 3QO6A 4BAMB 2A5KA 1MKXH 1E1RD 3NCLA 1NC6A 2K0QA 3D65E 4WMDA 2WPJS 1G30B 1ZOMA 5F53A 2KCOA 6GCHG 4WH6A 4D9RA 4AX9H 2SGPE 5E2PA 1CT0E 1KXCA 3VEQB 2BQ6B 1F5LA 1O2RA 2BD8A 3PLPA 3PV5A 3VB7A 1EATA 4XE4A 4BTUB 1T32A 1K1NA 1UCYK 2D2DA 2B7DH 2F9BH 3D49H 1IQNA 1SMFE 4Y7BA 5CHAB 5HGGA 1HAVA 4NIVA 2XC4A 5EPNA 2Y82A 4NFFA 1AI8H 1GI8B 1G3BA 1LHGH 4J2YB 4AG2A 1PPZA 1O2IA 2R9PA 1NU9A 1O31A 5LPEA 3MH4A 3SN8A 2C3SA 4Q63A 2QA9E 2YNAA 1E1QD 1VJAU 3A89A 2GVFA 2KCYA 3HGPA 3M3SA 5A09A 2GZ8A 2YMSD 1GL1A 1N8OC 1PPHE 1O2SA 1SBWA 4H6SB 5EOKA 1A46H 1YY3A 5C0TA 5JBBS 1GDQA 2B5TB 2J94A 1GJ5H 1TBZH 1J16A 3MFJA 1V2WT 1TX7A 2B0FA 1VZQH 2XNIA 2BDIA 3MO9A 3PV2A 5K7RA 3GCTG 2EY4C 3U69H 5EGMA 2CF9H 1FPHH 4Y71A 1YPHC 4X8TH 4ZHAA 2ZZUH 4FUFA 6CHAC 1BA8B 2ZU3A 4Y7AA 4ZROA 4I8JA 3VB6A 5CHBA 1FUJA 1GBMA 4OS4A 2FTLE 5EODA 1W2KH 4Y8XA 1VKYA 3SNCA 1HAPH 1Y5AT 2PKAA 2GJGA 3K6ZA 4BXWA 4Y10E 2OK5A 2HRVA 1M9UA 2BD3A 1VITF 2PW8H 1FLEE 1BRCE 1A61H 4CBNA 2W5EA 1NS3A 5H4IB 1AUJA 4U01A 2PTCE 1LO6A 1O2UA 1Q3XA 4TPIZ 1TNHA 6LPRA 1Y8TA 4INKA 4I8KA 2ANWA 4ABDA 1SLUB 2XCFA 2D26C 1Z1IA 1T8MA 1GCTB 3QN7A 4TT3D 1XUIA 1L4ZA 1NBMD 1WXRA 4ZKSU 1BTXA 2I6SA 4AB8A 2OBOA 1MUEB 1SGDE 1RTLA 1Z8RA 2FDAA 2GTBA 3UREA 2J98B 3QWCH 1G32B 1BOQA 5DG6A 4X8UH 1ARBA 1QHRB 1QZ8A 1W0ZU 2BLOA 3MU0A 2ZHEH 4OM9A 1O3NA 6ESTA 1O2YA 1IQIA 1CSOE 4E05H 1C5WB 3UB0A 1WTGH 2C4FH 4K60A 5FBEA 1TQ7B 4F55A 3F2FA 2BMGB 1P06A 5A0BA 2VIOA 4SGAE 2NWNA 3A82A 1ELGA 4B6FA 2W3IA 1V2MT 2W6ID 2WYGA 1OYQA 1SI5H 1ACBE 1BQYA 1O3LA 1WU1A 2BXTH 3M5MA 3E6PH 2SGDE 1GDNA 3SOSA 1P3EA 3SNBA 2NU4E 2R0LA 3A86A 4F4OC 2J34A 2BLWA 2M5TA 3PLBA 2QXJA 5JBCS 3KCGH 1H4WA 3KGPA 2RFKC 3RXVA 3UNQA 2M2AA 3F9HA 4KTUA 4FXGH 5E0HA 3CNRA 2J2UA 4ISNA 4BAQB 1FN8A 3GICB 4A1XA 1G3EA 3RXGA 1DY9A 1DFPA 1VR1H 1AMHA 2CGAA 2ZDVH 2ZP0H 1AE5A 1ID5H 1LHEH 2ZC9H 4AFUA 1O2MA 3E3TA 3GISB 1D3QB 3B9FH 1C1MA 3VB4A 1GDUA 1BUIA 1HV7A 1ZYOA 1A0HB 1AB9C 1C5ZB 1VCQA 5T3HA 2ODYB 1SOZA 2KR7A 2LPRA 5F8XA 3O8DA 2FS9A 1IOEA 4XSKU 2R2MB 2G51A 3URDA 4BTTB 1GHBG 2DE9A 1BT7A 4MNWA 3HPTB 1K22H 2NU2E 1SFQB 3LT3A 1V2LT 2J38A 2FOBA 1G2MA 2TPIZ 1RTKA 1PPBH 2Q6FA 4Y8ZA 2BXUH 2V6NA 1CGHA 3BTTE 4Q7ZA 1OPHB 2OD3B 2ANKH 1V2RT 4KKDA 5T6FA 1FPCH 4MPXA 4TY7A 3UOUA 2FOGA 1BMFD 2Z9KA 2Z9IA 3TGIE 4YOIA 1PFXC 1THPB 2CMYA 5T6DA 1AKSB 3BG8A 3STJA 5C2ZA 1QURH 1O2JA 3EE0B 3QTVH 1V2UT 2F9NA 3SU0A 3O8CA 4K3JA 2QF5A 1MAYA 1GBBA 1GJ4H 1VJ9U 2ZDKA 1EASA 1LVMA 1NFWA 3MMGA 3OAAD 5DJ7A 4X6OA 4RKOB 3LONA 4JZ1A 1A5HA 4NWLA 3UNSA 3T5FH 1MBMA 1O3HA 2C8YB 3T26A 3RXSA 3BG4C 3RXQA 2W6JD 3U8RH 1QGFA 4MVNA 3P70B 1KDQB 2G55A 2EA3A 3MYWA 1C2DA 1MAXA 1P2JA 3SNEA 2P94A 3QTOH 1GBLA 1P9SA 3M3VA 2IN2A 1P12E 1DVAH 3RC4A 4QT8C 5L30H 4CRFA 4FU9A 4WXVA 2Y5GA 1W11U 2A4GA 1ZTJA 3TPIZ 2Z6BD 1B0EA 4JZEH 2FOHA 2A7HA 1BHXB 1PQ5A 4PROA 3Q77A 1O5AB 2BLVA 4YLQH 1TNLA 7GCHG 4A1VA 1GL0E 1VCPA 3ATMA 1C2IA 1QNJA 1ZHPA 1O3GA 1Q31A 4JYUH 2BQWB 1W12U 4UFEH 3RXHA 4BTIB 1HGTH 1S82A 1S81A 4AC9A 3VG8A 1C9PA 1GJ7B 3VFEA 5A2MH 1MTNB 1ANDA 5B6OA 1C1VH 2P16A 2FS8A 4RN6A 1X7AC 3A8AA 3C1KA 4A6LA 1SGTA 1CE5A 4DOQA 2FESH 3MU4A 1HRTH 3PMBB 1BMAA 2ZPQA 2CN0H 1DUAA 1WUNH 1XKBC 4YM9A 3DFJA 1GMDG 3AW0A 2GGVB 2VINA 3F0PA 3GDSA 1Z7KA 1YP9A 3LC5A 3ENSB 2FOEA 3I77A 2THFB 1MTNC 3T62A 2FOMB 3PROA 2VVVA 1TPPA 1AGJA 4XRNA 2UUKB 2HLCA 3HK6B 1BTZA 2A32A 1BRAA 4INLA 1TYNA 4U2WA 3U8TH 2AMQA 5TCCA 5C94A 1O3PB 5G4BA 4Y76A 1EZSC 1T4VH 1TMBH 1ANEA 3HKIB 3FOAA 2ZGJA 3F68H 4ABIA 1DX5M 3BSQA 2STBE 1HJAB 2BDCA 5L6NH 3T29A 1NTPA 2WPLS 2AEIH 1C5TA 3SU5A 1ARCA 5L2YH 1GHYH 1T8NA 3U1JB 4ABBA 1PJPA 2PLXA 1SSXA 4OS5A 3VB3A 5FCKA 4ZKNU 1FNIA 2FWWA 4AFQA 1WSSH 4GAWA 3L6PA 1EPTA 1GVZA 3ZV8A 1L4DA 1SPJA 2D1JA 3ZZ9A 1O32A 2ZA5A 2PSYA 1JRTA 1O5DH 3FP7E 5E0GA 3MH7A 1NRPH 4JMYA 5BRRE 3ODDA 3LH1A 2H1UA 1SQTA 1SGFA 4IC6A 1O2PA 5DP5A 4IC5A 4UEHH 3GCHB 1SGEE 1OWKA 1W14U 2BTCE 3WY8A 1QTFA 4B2BA 2OC0A 4AFZA 2ZGBH 2VGCB 3MNXA 2ULLA 1GVLA 2BY8X 5GJ4B 1NROH 3F1SB 5EJZA 1EP6A 5C1UA 2OUAA 1VGCC 1EXFA 4VGCB 6GCHF 1AZZA 2ZHQH 1Z1JA 4I8GA 4CRGA 4P02A 2ZEBA 3ZZBA 1C5UA 3PO1C 5LPFA 1C5NH 3RXKA 5IYTA 3ITIA 3QZQA 1MQ6A 4E7RG 2NU3E 1ZHMA 1LHFH 1C1OA 2TBSA 2RCEA 3GY8A 3S9CA 1ORFA 3LH3A 2FMJA 2SFAA 1G37A 2VGCC 3NXPA 2A1DB 1AFEH 2BM2A 2VIPA 5A0AE 2R2WU 5A0CA 1HAGE 1BTHH 5PTPA 3TU7H 2GP9B 1JBUH 2UUYA 1PYTC 4J1YA 1VGCB 1UCYE 2BY5X 1KXDA 3RMLH 1HB0B 1QBNA 2VU8E 1SQOA 1SG8B 2EEKA 3GY3A 2CXVA 1H8DH 4B73A 4Y11E 3ZZAA 1T31A 3P17H 1GMCG 1T7CA 1UTKA 1RIWC 3SV7A 4DGJA 2HPPH 2FEQH 4MG3A 5E2OA 2V3MA 1DPOA 4NZLA 1YF4A 1AB9B 1ELCA 2PHBA 2WV5A 3SJ9A 3FO8D 3OSYA 1TAWA 2BDBA 1O3KA 2FI4E 1QRXA 5FX6A 1YYY1 1DXWA 4MTBA 1YLCA 3FKSD 1A3BH 4ISIH 3UOPA 1MMJN 3WWBA 4NSYA 2Z9LA 1YPHE 3RMOH 4ISLA 2QYIA 4DT7B 4X8SH 1TX6A 3H7TA 5ABWA 1T8OA 3RXRA 1YPLH 3W94A 8GCHG 3DHKH 3F2GA 4B75A 3AW1A 5EJLA 2O8UA 3H7OA 1KTSB 1SQRA 4MQAA 2Y6TA 5J4SA 1EB1H 2XRCA 2VJ1A 1JRSA 3NK8A 4ZXYH 3L3TA 4MLFB 1OWEA 2O8LA 1CHOG 1SOTA 4Y79A 3NZIA 1UTLM 3P8FA 1ESBA 2PP6A 1FY1A 2W7UA 3SUFA 5HMAA 1KY9A 1P2NA 3RC6A 3TJVA 4DW2U 1VITG 5C5NA 3GDVA 1V2TT 1XUFA 2PUQH 3TNSA 3HGNA 5FXLA 2SNVA 2P3FH 3E1XB 3OU0A 1GJ8B 4ISOA 5SGAE 2P8OB 3UFAA 4MDSA 1C1RA 1NM6A 5I46H 2AMPA 2F4LA 1FIWA 5E8EH 1MD8A 3A7VA 4ZH8A 1XUKA 1QB6A 1LVBA 3A83A 1O3IA 3V12A 1IAUA 4MNXA 1DSUA 2LP6A 5AHGH 1HAHH 3CS0A 4X6NA 1ELBA 2L74A 1ABIH 1GBJA 5EPYA 3SORA 1N1LA 1FAKH 2BY9X 1OP0A 3A84A 4ABEA 1NRSH 3E90B 2OINA 1W8BH 2F91A 1S83A 1THSH 4X2WA 1QA7A 2WSSD 3RDZA 4BOHA 3PO1B 1QCPA 1KLTA 1O5GH 2VBCA 1OWDA 5GDSH 4FUJA 1B0FA 4B71A 4RKJB 4CHAB 3TH3H 3MNCA 1DUEA 2ZPRA 5K0HA 1GHAF 1GI7B 1UTMA 1O38A 1BJUA 4Q7XA 4DT4A 1SGPE 2Y80A 2ODQA 1OWHA 4ZHMU 4AG1A 1C5VA 1S0RA 4A1TA 3SNDA 4YT7H 1F2SE 1HIAA 5BPEA 4D7FA 1MKWH 1HXEH 1F92A 2JJ2D 3G01A 1V2NT 3GS9A 1YCPH 3OY5U 4RT1A 1LKAA 3UR6A 1ANBA 2KM0A 2Q1JA 1H8ED 1ETRH 1DLEA 1RS0A 2RDLA 1G9IE 2ANMH 2ZTZA 3AVZA 1YM0A 4ZKRU 2ZG0H 3BTWE 4R0IA 3TGKE 3LC3A 3FAOA 1ETSH 4ASHA 1QQUA 2JH0D 3PB1E 2J4IA 1MTWA 2AH4X 1EPTC 3EDXB 1GI9B 2AMDA 2GMTC 2I6QA 3FN8A 5AFYH 3TK6A 3E16B 4O3UA 3RXBA 4SGBE 1VITH 3RU4E 4TPYA 3MH6A 1FZZA 2CV3A 3ZYEA 4FETA 1GBIA 2OC1A 4TWWA 1EJAA 1BMNH 5FPSA 3RXTA 4I8LA 1D3DB 1DDJA 1GJDB 1FV9A 1C5PA 2FI5E 4UFDH 3IG6B 3SI3H 4FVBA 2BQ7B 1RGQA 4XBBA 2ANYA 4NA9H 1TOMH 1GCTC 1WAYB 3BN9A 4XDEA 2AERH 1C2GA 1UTPA 1XX9A 5ETXA 3BTKE 1V2KT 3QDZB 1S5SA 1OS8A 1IQGA 1O5EH 2C90B 3ATLA 3SU3A 1FJSA 2QXGA 1YWUA 4O03A 1MCVA 1UHBA 3ESTA 1AFQB 2ZDLA 2ZNKH 1ZTKA 1SR5C 4YO9A 1H1BA 1RRKA 4I31A 3KNXA 2FOFA 4X1RU 4BAHB 1OHHD 3HK3B 1V2PT 7LPRA 4NIYA 5EXNA 3TIUA 3SU6A 2JKHA 1BBRE 1OX1A 3ATKA 1DT2A 3AASA 3ZVGA 3ZVBA 1SLVB 3Q3YA 1LPZB 1C4V2 3LGIA 4GHTA 4A92A 1UMAH 2A31A 1HCGA 1O3EA 1TGSZ 4AOQA 1E34B 1JIMA 1UTOA 1G3DA 2C93B 2WPKS 4M7GA 1D6WA 1AUTC 2QXHA 7GCHF 1K28D 1JWTA 3P6ZB 4A7IB 4Q80A 1GHVH 5HIZA 1Y5BT 2XBXA 3BTHE 1FDPA 2FP7B 3PV4A 2P95A 3DSOA 1HXFH 1YKTA 5DP6A 2HNTF 1EAIA 5EQRA 2FLBH 4K2YA 4HI3A 3QGNB 1V2ST 1N6YA 2AGIX 3BEFB 3F0OA 2WPHS 3DT0H 5A8XA 1IQEA 2AYWA 1ELDE 3NUMA 1AVXA 2JETB 1UK3A 4CRDA 1QL9A 3ZV9A 3ZYDA 1N6XA 1SGNE 4JK6A 3BIUH 3P95A 1AD8H 2ZU2A 2ZFSA 2V3HH 3RC5A 3GDUA 2PWXA 4AYVB 2H5DA 1TRMA 2ZQ1A 1A7SA 1BDAA 3PMHB 4ZKOU 1O5CB 3FFGA 8GCHF 1IHTH 3A7YA 1KLJH 1P09A 1E35B 3QK1A 3OFND 1B5GH 3LGVA 4BXSA 4X8VH 3SZEA 3ZVAA 4ZAEA 3DA9B 1AZ8A 2BLQA 3BG4B 5GIBA 5HIYA 2IJD1 2XC0A 3UR9A 1L1JA 1LDTT 3LKWA 3W95A 5FAHA 2XBWA 5DP7A 1XUGA 1SKYE 1ZHRA 2A7JA 3NWUA 4MNYA 5GNDA 1DICA 1C1TA 2ZDAH 1C1WH 3DD2H 1NY22 1K0HA 1O33A 2GDEH 5LPRA 1CHGA 4FU7A 1NO9H 1O39A 1SHHB 3F2HA 2VIDA 2BZ6H 4WH8A 2ZF0H 1W7GH 3UWJH 5HM9A 3GYMA 2WINI 3GY5A 4D7GA 1Z71A 3OEHD 1C2JA 2QAAA 3VXFH 3FP6E 2VWLA 1UK4A 4JZIA 1EX3A 1BBRK 1EZXC 4I33A 1CBWB 1PPFE 1GI1A 1WBGB 1RTFB 2KAIB 2FX4A 3M7TA 1BTUA 3UNRA 2WZQA 3S9AA 2AS9A 1V2QT 2SGFE 3MU8A 1UVOA 1SVPA 3E0PB 1DS2E 1B7XB 2YOLA 4X6MA 3ZVFA 1C5LH 2QIQA 2BX4A 5CDFE 1NRNH 1KXBA 2UUJB 1O35A 5HYOA 1SLXB 1UVUH 2FOCA 2W3KA 2J5UA 3ZZ7A 1UVTH 2AIPA 2EQNA 3LGTA 1P2MA 1C1QA 4CRBA 1SGFG 1YPKH 2ZDMA 4WXIA 1C5MD 3EA9A 3NPSA 2R3YA 4OGXA 3TK5A 4AN7A 1C5RA 2GZ9A 1CBWC 2ODPA 1GBTA 1K1JA 1GJAB 5EXLA 4NGAH 1GI0A 2QF4A 1HAXB 1EAWA 1OXGA 4Y6DA 4K1TA 4GPGA 4YLUA 2Q6DA 3KQDA 5HM2A 3D23A 1NN6A 2BVXH 2VWMA 3KN2A 1C2FA 2ZQ2A 1JMOH 4Q7YA 1HAVB 2ZFQH 4IGDA 4O9VA 5FL7D 3GYLB 1WCZA 2QGRA 3RXJA 3K6YA 2BX3A 2ZU5A 1KXAA 4GCHG 4X2YA 1O3MA 2KFWA 3BTQE 1SHYA 5GWZA 5DP8A 1HYLA 1O3JA 1YCPM 3HATH 3R0FA 4AYYB 4IW4E 2O8TA 1HJ9A 1CQQA 1GBHA 2LELA 1MQ5A 3FP8E 3VXEH 4NIWA 3WWFA 3PMJA 3GCNA 2BDYA 2FODA 2Z9JA 3UWIA 1V2OT 5FHTA 2A7CA 2AIQA 3MO3A 4U32A 5DSFA 1A5IA 1P8VC 1FX0B 1ELVA 2C8XB 2GKVE 2G5VA 2XTTB 3FANA 1W0KD 1SC8U 2F9VA 4BNRA 2JJ1D 3RXPA 1TFXA 1QRZA 1DWEH 5JB8S 4DIIH 3SV9A 3A8CA 1EZQA 3GCTF 2PUXB 4X1SU 4UD9H 2ZCLP 5C1YA 5JB9S 1CT4E 2GCHG 5B6LA 3SQHE 5CMXH 3EGKH 2PKAB 5DP3A 1O2OA 2Z9GA 3M36A 4FUIA 1BJVA 4B1TA 1TA6A 1T8LA 2J97A 3RMMH 3RXDA 4K5ZA 1SGIB 3Q3XA 1O2LA 3BTEE 1MABB 3W1EA 1LMWB 2BYAX 1AIXH 2BVRH 4BAOB 1GPZA 1GHZA 1O3DA 2KAIA 2SNWA 2VH6A 1IQFA 4O3TA 1H8IH 3DUXH 5GCHG 1LPGB 1TGCA 4ZXXH 3S9BA 1S84A 4CHAC 4ZMAH 4DURA 3TH2H 2Z94A 1J15A 1C4U2 2OBQA 1P02A 1Z8JB 2O8MA 1NPMA 2HVXA 2KCAA 1O34A 1O3FA 4IS5A 2G00A 4JZFH 3RXAA 3S7KB 5A8YA 1MCTA 4FVDA 1WDIA 1DY8A 2G52A 1C5OH 3GY2A 3UUZA 5ESTE 1SB1H 4F49A 1G3CA 1HIAB 1Q2WA 4E7NA 1E79D 2Y5FA 1EKBB 1EOJA 1MBQA 1SLWB 2A2QH 4HGCA 2KCPA 1AHTH 1OKXA 3PMAB 3BTME 1DANH 2BY6X 1AU8A 2L6OA 3UTUH 2AGEX 3ODFA 3AAUA 3LIWA 5E0JA 1BITA 3Q76A 4I86A 3DSGA 2OP9A 5DN6D 2HNTC 3MU5A 1ELEE 3F3BA 5AVDA 4FUCA 2F9UA 3PLKA 3SU4A 4BANB 2ZGCA 1YPGH 2PSXA 3N7DA 1K1PA 1P05A 1KSNA 2GMTB 1BMMH 4WF8A 4ACAA 1FMGA 1O2TA 1D6RA 3PM3A 3SBKA 3KEEA 1BB0B 4X6PA 2G4UA 1H9HE 3S0NA 4I8HA 4CR9A 1EFRD 1UCYH 1TE0A 4FUEA 3UQVA 3LJJA 1CGJE 1C5SA 1S6FA 2FYQA 1D9IA 4ZCNA 3V3MA 3MO6A 2IPHA 2YMSC 2UWOA 4YOJA 2V35A 4ISHH 3DFLA 2BB4A 1E37B 2OC8A 1EZUC 2AFQB 5F03A 8ESTE 5EG4A 3KF2A 1P0SH 3U98H 3BTGE 3SJ8A 2VIVA 1KMHB 5KGOA 1CVWH 1ZRKA 5DPAA 2Z3DA 1UTNA 4B2CA 3TH4H 2WHXA 3SHAH 1IQMA 1V2VT 2A45B 4LOYH 4FUHA 1CU1A 4ABFA 1JIRA 4X1QU 1W7XH 2QE7D 2PGQB 3EQ0H 5C0UA 4XOJA 1KYNA 4P00A 2UUFB 5FX5A 2CF8H 5TCAA 5JBAS 3SZNA 2KZ4A 2TIOA 1O3CA 3ZZ3A 1WQVH 3GY4A 3QZRA 3KYFA 1P01A 4CREA 2HPQH 3K9XB 3VGCB 1AKSA 1K1LA 1ZMJA 2ZU1A 1YLDA 3ZZ8A 5EXMA 1W13U 2JIZD 1E0FD 1OP2A 3KIDU 2PR3A 4ASUD 2WV4A 1W0YH 1WQSA 2C8ZB 2FXRA 4Q2KA 1W3CA 3EA7A 4ESTE 8KME2 4KP0A 1V3XA 5DP4A 1GI3A 3M5LA 4X1NU 1LCYA 1NFYA 1C2EA 1YBWA 1K2I1 1AVGH 2F43B 1FY5A 3RU4D 1SGYE 1LHDH 1H9LB 2PGBB 3SO3A 1TABE 5EQQA 1TGBA 2ZGHA 5C17A 2QC2A 1SGCA 3JZ2B 2OQ5A 1SQAA 1LHCH 3VB5A 1INCA 1HFDA 2ZWLH 7KMEH 5JDUB 4XBDA 2FI3E 1RD3B 3LGYA 4YTAA 2GCTC 5C3NA 3KQCA 1ZPZA 1MZDA 2ZIQH 3I29A 3UAIC 1FY8E 1THRH 5EU8A 1SGRE 1SL3A 1KTTB 1C2MA 1QIXB 2OQUA 2KX4A 1L0ZA 2FM2A 1BRUP 1A3EH 2XWAA 1UHBB 3SGQE 1P57B 1H8HD 1L1NA 2Y81A 2WUBA 3Q00A 2GV7A 3V13A 3LOXA 5EW2H 2Z3CA 1P2OA 1F5KU 4K1SA 1QRWA 5KEDA 1ESAA 1NZQH 2H6MA 2R0KA 1TPSA 3MOCA 1FY3A 1P04A 4CH8B 2ZFTA 1HJAC 4GUXA 3TJOA 1PYTD 2J95A 3M61U 3KQ5A 1BIOA 1S85A 1BHXF 3M7UA 3BF6H 4THNH 2IJOB 1EB2A 1CHOF 1LQEA 1TNIA 2PKSB 1O2XA 3A7XA 4WY3A 5GPIB 4A5TS 4FUGA 1ETTH 4ACBA 1YCPK 3HKJB 4JCNA 3TK9A 4B76A 1NBME 2G8TA 1HUTH 1QL7A 1BRBE 1QQ4A 4MPWA 4O97A 1GBAA 2XCNA 4UFGH 1HPGA 1HLTH 1P2IA 1PPGE 2VWNA 1C1PA 1ZJDA 3ZZCA 4WJG2 1NFXA 4CH2B 2DUCA 1E38B 1E36B 1T4UH 3BV9B 1F0UA 1O2WA 2XWBI 4K69A 4MPVA 5FPTA 3VGCC 3F9GA 1XUJA 4YZUA 1TALA 1ZGVA 4UFFH 1J9CH 3QLPH 1XM1A 2VVCA 3KQBA 1BMLA 5EIYA 2A5AA 2SGQE 1C9TA 1TIOA 2TGTA 4H6TA 5JPMH 3FVFB 4OS7A 1GG6B 1W10U 1XKAC 4IMZA 5C5OA 2F83A 1TB6H 4AFSA 4ZHLU 2ZTYA 2CJIA 4DG4A 5AF9H 2GZ7A 1TGNA 1QBVH 2JETC 1GBCA 4GHQA 1S0QA 4LK4A 1TPAE 1OOKB 1ZSJA 1CO7E 4WVPE 3BTFE 1C5QA 1PQ8A 4H42U 1TBRH 1FXYA 2XNDD 3MU1A 3ZZDA 3SHCH 1Y3XA 4AGJA 4BAKB 1TOCB 2QF0A 3U9AH 1P9UA 1C5YB 2OXSA 1A0LA 2ZFPH 3FZDA 1PPCE 1GG6C 1Y59T 4I32A 4IN2A 3SW2B 1J14A 2WPDD 3GCOA 3SV8A 1XUHA 3A88A 1EUFA 3A81A 4B6EA 1A0JA 4DIHH 5A8ZA 3S69A 2ILNA 2VNTA 1ESTA 1GI2A 1C1UH 2VIQA 3E91A 1D3TB 1MD7A 2CK3D 2LNCA 1DWCH 4RSPA 3F9EA 1ANCA 1UTQA 2EI7A 3PYHA 3SQEE 1HJ8A 1UTJA 4K8YA 1YPEH 1DSTA 2UWLA 1Z8GA 3CS7A 2P3TB 3URCA 2V3OH 1P11E 2DE8A 1DWBH 3RP2A 2ALVA 5DO4H 2XBVA 1Y3WA 1W0JD 3SUGA 1MTUA 1LQDB 3RLWH 3UPEA 1RIWB 1O5FH 1GJ6A 2H9EH 3O8BA 2FTMA 3KYGA 1UVSH 2ZHWH 1EP5A 3M3TA 2EI8A 3P8OA 1OYTH 2A4OA 1FY4A 2JH5D 1QA0A 9LPRA 4CRAA 4LZ1H 3RUOA 3SYJA 2WUCA 2TGPZ 3B23B 3SUDA 2IOTA 5AFZH 4JK5A 4HG6A 3TJUA 3ZZ5A 3OY6U 1HAOH 4FUDA 1K9OE 3C27B 2HLDD 3RXCA 3BEIB 3ZIAD 5CE1A 1ZZZA 4OS1A 1MU8B 3UIRA 2FLRH 3NKKA 3QGJA 3F6UH 2O9QA 2J98A 2ZGXH 4I7YH 3PRBA 3SI4H 3O8RA 1ZR0A 2BD5A 2W7SA 4TSFD 1ZMLA 2H9TH 4R8TB 3TVJB 3S7HB 2Y7XA 4NIXA 1S6LA 4ABJA 1UW7A 3E8LA 3M7QA 1GI5A 4KGAA 3M35A 4X1PU 4Y0YE 1BBRH 2STAE 3N99A 1H9IE 1J17T 2XYAA 4AORA 4NFEA 1C2HA 2NU1E 2HALA 2ZHFH 1K1IA 4X0WU 1O36A 5F8TA 3MQKC 1O2VA 3T2NA 1BZXE 2BDGA 3B8JA 2QF3A 2D8WA 2ESTE 1LKBA 3KHVA 2FOAA 3V0XA 1ZTLA 3PTNA 4RI0A 4DY7B 1BTWA 3EAJA 3KL6A 3MI4A 3LJOA 4YT6H 3BTDE 5EQSA 2BOKA 3PWBA 3DCLA 2VVUA 3SJOA 3D62A 5F8ZA 2BD9A 1OWIA 2EC9H 4MPUA 1L1GA 4DJZB 1QJ7B 3AAVA 1TX8A 2CHAC 3A8BA 4K8BA 1YPMH 3SU1A 2VH0A 2XXLA 2HGTH 4KTCA 1DE7H 3P8NA 2QN5T 1SFIA 5JBTA 1CGIE 2ZHDA 1UJ1A 4D9QA 4UONA 3SV2H 2OC7A 2FPZA 2RDEA 2B9LA 4GVUA 1D3PB 4K1EA 1C1SA 1GHAG 3KQEA 1GMHG 2H5CA 1N8OB 3MWIU 2FO9A 3H5CB 1GHBF 1TNJA 2ZECA 1FQ3A 2SGEE 1AWHB 1MU6B 3ZZ4A 3A85A 4AGKA 2ZFFH 1A2CH 1GGDB 2BVSH 5LH8A 4U30A 2P93A 1C2KA 3RM2H 1RFNA 2CHAB 1FAXA 1A5GH 1EAUA 4Y0ZE 1MTVA 1K1MA 4WMEA 4FU8A 2BD2A 3T27A 2PV9B 2F3CE 3OE7D 4WMFA 3SJKA 2GD4B 1XXFA 1A4WH 3U28C 1NT1A 3ZVCA 3RXMA
chains in the Genus database with same CATH topology
1V2JT 4FUBA 1ZRBA 1Y3VA 5T6GA 3EA8A 4Z0KA 1ELAA 2R3UA 8LPRA 4LZ4B 1K1OA 3UQOA 1EQ9A 1QB1A 1RXPA 4TWYA 3K2UA 3ZVEA 4IN1A 4JYTA 1GVKB 5J4QA 2V0BA 3OX7U 3I78A 4ABGA 1TMUH 1FONA 1FIZA 1TRNA 4NA8A 3IITA 2XBYA 3MTYA 2J9NA 2W26A 1EJMA 5FPYA 2XC5A 2PTNA 4OS6A 3BEUA 3IWMA 1XMNB 1V6DA 3GOVB 5L2ZH 1EOLA 9ESTA 2BHGA 1O2GH 2ZI2H 2H2ZA 2OCVB 1DLKB 4D8NA 3TNTA 3QX5H 3CP7A 1MKWK 1IQKA 1BCUH 2GCHF 3OYPA 1CT2E 1MH0A 2HNTE 2Y5HA 2Z7FE 2ZFRH 1GMCF 3A80A 1UO6A 2RG3A 2OLGA 1Z6JH 2A0QB 4OS2A 2H9HA 2Y7ZA 1Y3UA 4D76A 1GJBB 2RA3A 1TMTH 1U6QA 1O0DH 1SGQE 1F5RA 1GI6A 2PKSC 2FX6A 1NFUA 5DKMA 1PQ7A 1PPEE 1TNGA 3LPRA 1Y5UT 2A2XH 1ZPCA 2A4RA 5LGOA 1MKXK 4HFPB 1UVPA 3RXLA 1NU7B 2TRMA 2O8WA 1ELTA 3CENA 1IQJA 1WOFA 1PQAA 1TA2A 1O37A 5ESBA 1KLIH 4X2VA 3GY6A 2G4TA 3RXUA 3TGJE 2QXIA 1WYKA 3SV6A 2VWOA 3RU4T 4GCHF 1ZSLA 2Q6GA 1ZMNA 1HNEE 3EYDA 1O3OA 4CBOA 2QY0B 3L33A 1AO5A 1NRRH 1Z6EA 2BD4A 4KELA 1TGTA 2ZTXA 3M5OA 1TPOA 2JH6D 1YGCH 1O2NA 2ASUB 3RXOA 2ZDNA 1O2KA 1IHSH 1FI8A 3JZ1B 3TLOA 1C4Y2 3RXEA 2GT8A 3M37A 1S6HA 3K65B 1K21H 5CHAC 1XVOA 2B8OH 5F6MA 3U1IB 3P8GA 1LVYA 5DP9A 1G36A 3A7TA 1AWFH 1IQLA 3A7WA 2NU0E 1FN6A 3LGUA 1QB9A 3MNBA 1HDTH 4NG9H 1QFKH 1CA8B 5DK1A 4DVAU 1ZJKA 2P8OC 2EI6A 1JOUB 2BD7A 4NZQA 1GBDA 3RMNH 2RA0A 1TQ0B 3RXIA 3TJNA 3A87A 5IDKA 2BDAA 1ZLRA 2TGDA 5DGJA 3SNAA 3RM0H 1TNKA 2AGGX 3FZZA 5HXFA 3T25A 1OWJA 1AN1E 3SUEA 3Q3KA 1DXPA 2QV1A 2YNBA 1ZGIA 2ZCKP 1O30A 3MNSA 1DOJA 1GHXH 1WTHD 5C1XA 1OP8A 1KDQA 1QBOA 2FYRA 1Y3YA 3TITA 1YPJH 1GBFA 1DITH 1GJ9B 1AFQC 4Z6AH 1KXFA 1C1NA 3UY9A 3ELAH 3VPKA 7ESTE 4ZUHA 3SU2A 2K1QA 4TYDA 3LGWA 2ZCHP 1LTOA 2ZPSA 3BIVH 1NESE 3OTJE 5EW1H 1O2ZA 2HOBA 4MNVA 1CA0C 1HAZB 1TRYA 1F0TA 3SGBE 1G2LA 1GMDF 3ATWA 1QR3E 3F9FA 3U8OH 1EAXA 2GV6A 1Z8IB 2PFEA 1RJXB 2GCTB 1LPKB 1DWDH 1KIGH 2WYJA 1AE8H 2J92A 2VIWA 2P59A 4UE7H 5FBIA 3V7TA 5JYIA 1LVOA 2GT7A 1TWXB 4NCYA 1QY6A 2C8WB 5GXPA 1O2QA 3SGAE 2HWLB 5I25A 4Y8YA 3M5NA 1JXPA 1F0SA 1BTYA 4JZDH 4LXBH 1GBKA 4OGYA 5C67A 1TBQH 1EPTB 1C5XB 1AQ7A 1GWAA 4GSOA 1NRQH 1WV7H 3ZZ6A 5FCRA 1P10A 1GJCB 4HTCH 1P2KA 2UWPA 2BY7X 3R3GB 1IQHA 5GCHF 1OSSA 2GX4A 1P3CA 3RLYH 3P92A 4ABAA 3LDXH 1HAIH 2A4QA 2ZU4A 1BTPA 1O2HA 1UK2A 4IBLH 4JYVH 1O5BB 3SJIA 4INHA 2P3UB 1TONA 4TY6A 1QJ1B 4CRCA 4WWYA 2ALPA 3N7OA 1ABJH 4YESB 2BOHB 3STIA 4H4FA 1VCWA 4B2AA 4VGCC 4X2XA 3A8DA 2WPMS 3LU9B 3GY7A 1ELFA 1HBTH 2FIRH 4NWKA 1ZSKA 2G81E 1YC0A 4AZ2B 2A5IA 1QJ6B 2Z3EA 2OTVA 1GMHF 3PTBA 6CHAB 4XBCA 3MH5A 4AB9A 3ATIA 4DCDA 1O3AA 2BDHA 4HZHA 1D4PB 3T28A 1O3BA 1C2LA 2F9PA 4YOGA 5TJXA 2TGAA 1AVWA 1F7ZA 4B74A 3RXFA 2G5NA 2SGAA 2QCYA 3PWCA 2VB0A 1EJNA 1GGDC 5C20A 1TLDA 3A7ZA 2FZZA 1GCDA 2BZAA 1AY6H 2ZO3H 1J8AA 4E06H 3E0NB 3MHWU 1QL8A 1XVMA 2F9OA 1P03A 4GLYA 1DM4B 3ZVDA 2ZKSA 1XXDA 1L2EA 1F0RA 3QUMP 1GHWH 1CA0B 1GBEA 1A1RA 2WPIS 4XFQA 4NSVA 1P2QA 4KTSA 1MZAA 4IMQA 1KXEA 4UDWH 1MTSA 1HAYB 4NA7A 4CR5A 4ABHA 1GI4A 2XW9A 1ZPBA 2GDDA 3GCHC 3QO6A 4BAMB 2A5KA 1MKXH 3NCLA 1NC6A 4WMDA 3D65E 2WPJS 1G30B 1ZOMA 6GCHG 4WH6A 4D9RA 4AX9H 2SGPE 5E2PA 1CT0E 1KXCA 3VEQB 2BQ6B 1F5LA 1O2RA 2BD8A 3PLPA 3VB7A 1EATA 4XE4A 4BTUB 1T32A 1K1NA 1UCYK 2D2DA 2B7DH 2F9BH 3D49H 1IQNA 1SMFE 4Y7BA 5CHAB 5HGGA 1HAVA 4NIVA 2XC4A 5EPNA 2Y82A 4NFFA 1AI8H 1GI8B 1G3BA 1LHGH 4J2YB 4AG2A 1PPZA 1O2IA 2R9PA 1NU9A 1O31A 5LPEA 3MH4A 3SN8A 2C3SA 2QA9E 2YNAA 1VJAU 3A89A 2GVFA 3HGPA 3M3SA 5A09A 2GZ8A 5EOKA 1GL1A 1N8OC 1PPHE 1O2SA 1SBWA 4H6SB 1A46H 5JBBS 1GDQA 2B5TB 2J94A 1GJ5H 1TBZH 1J16A 3MFJA 1V2WT 1TX7A 2B0FA 1VZQH 2XNIA 2BDIA 3MO9A 5K7RA 3GCTG 3U69H 5EGMA 2CF9H 1FPHH 4Y71A 1YPHC 4X8TH 4ZHAA 2ZZUH 4FUFA 6CHAC 1BA8B 2ZU3A 4Y7AA 4ZROA 4I8JA 3VB6A 1FUJA 1GBMA 4OS4A 2FTLE 5EODA 1W2KH 4Y8XA 3SNCA 1HAPH 1Y5AT 2PKAA 3K6ZA 4BXWA 4Y10E 2HRVA 1M9UA 2BD3A 1VITF 2PW8H 1FLEE 1BRCE 1A61H 4CBNA 2W5EA 1NS3A 5H4IB 1AUJA 4U01A 2PTCE 1LO6A 1O2UA 1Q3XA 4TPIZ 1TNHA 6LPRA 1Y8TA 4INKA 4I8KA 2ANWA 4ABDA 1SLUB 2XCFA 2D26C 1Z1IA 1T8MA 1GCTB 3QN7A 1XUIA 1L4ZA 4ZKSU 1BTXA 2I6SA 4AB8A 2OBOA 1MUEB 1SGDE 1RTLA 1Z8RA 2FDAA 2GTBA 3UREA 3QWCH 1G32B 1BOQA 5DG6A 4X8UH 1ARBA 1QHRB 1W0ZU 2BLOA 3MU0A 2ZHEH 1O3NA 6ESTA 1O2YA 1IQIA 1CSOE 4E05H 1C5WB 1WTGH 2C4FH 4K60A 5FBEA 1TQ7B 2BMGB 1P06A 5A0BA 2VIOA 4SGAE 2NWNA 3A82A 1ELGA 2W3IA 1V2MT 2WYGA 1OYQA 1SI5H 1ACBE 1BQYA 1O3LA 1WU1A 2BXTH 3M5MA 3E6PH 2SGDE 1GDNA 3SOSA 1P3EA 3SNBA 2NU4E 2R0LA 3A86A 4F4OC 2J34A 2BLWA 2M5TA 3PLBA 2QXJA 5JBCS 3KCGH 1H4WA 3KGPA 3RXVA 3UNQA 3F9HA 4KTUA 4FXGH 5E0HA 2J2UA 4ISNA 4BAQB 1FN8A 3GICB 4A1XA 1G3EA 3RXGA 1DY9A 1DFPA 1VR1H 1AMHA 2CGAA 2ZDVH 2ZP0H 1AE5A 1ID5H 1LHEH 2ZC9H 4AFUA 1O2MA 3E3TA 3GISB 1D3QB 3B9FH 1C1MA 3VB4A 1GDUA 1BUIA 1HV7A 1ZYOA 1A0HB 1AB9C 1C5ZB 1VCQA 5T3HA 2ODYB 1SOZA 2LPRA 5F8XA 3O8DA 2FS9A 1IOEA 4XSKU 2R2MB 2G51A 3URDA 4BTTB 1GHBG 2DE9A 1BT7A 4MNWA 3HPTB 1K22H 2NU2E 1SFQB 3LT3A 1V2LT 2J38A 2FOBA 1G2MA 2TPIZ 1RTKA 1PPBH 2Q6FA 4Y8ZA 2BXUH 2V6NA 1CGHA 3BTTE 4Q7ZA 1OPHB 2OD3B 2ANKH 1V2RT 4KKDA 5T6FA 1FPCH 4MPXA 4TY7A 3UOUA 2FOGA 2Z9KA 2Z9IA 3TGIE 4YOIA 1PFXC 1THPB 2CMYA 5T6DA 1AKSB 3BG8A 3STJA 5C2ZA 1QURH 1O2JA 3EE0B 3QTVH 1V2UT 2F9NA 3SU0A 3O8CA 4K3JA 1MAYA 1GBBA 1GJ4H 1VJ9U 2ZDKA 1EASA 1LVMA 1NFWA 3MMGA 5DJ7A 4X6OA 4RKOB 3LONA 4JZ1A 1A5HA 4NWLA 3UNSA 3T5FH 1MBMA 1O3HA 2C8YB 3T26A 3RXSA 3BG4C 3RXQA 3U8RH 1QGFA 4MVNA 3P70B 1KDQB 2G55A 2EA3A 3MYWA 1C2DA 1MAXA 1P2JA 3SNEA 2P94A 3QTOH 1GBLA 1P9SA 3M3VA 2IN2A 1P12E 1DVAH 3RC4A 4QT8C 5L30H 4CRFA 4FU9A 4WXVA 2Y5GA 1W11U 2A4GA 1ZTJA 3TPIZ 2Z6BD 1B0EA 4JZEH 2FOHA 2A7HA 1BHXB 1PQ5A 4PROA 3Q77A 1O5AB 2BLVA 4YLQH 1TNLA 7GCHG 4A1VA 1GL0E 1VCPA 3ATMA 1C2IA 1QNJA 1ZHPA 1O3GA 1Q31A 4JYUH 2BQWB 1W12U 4UFEH 3RXHA 4BTIB 1HGTH 1S82A 1S81A 1C9PA 1GJ7B 3VFEA 5A2MH 1MTNB 1ANDA 5B6OA 1C1VH 2P16A 2FS8A 4RN6A 1X7AC 3A8AA 3C1KA 4A6LA 1SGTA 1CE5A 4DOQA 2FESH 3MU4A 1HRTH 3PMBB 1BMAA 2ZPQA 2CN0H 1DUAA 1WUNH 1XKBC 4YM9A 3DFJA 1GMDG 3AW0A 2GGVB 2VINA 3LC5A 3GDSA 1Z7KA 1YP9A 3ENSB 2FOEA 3I77A 2THFB 1MTNC 3T62A 2FOMB 3PROA 2VVVA 1TPPA 1AGJA 2UUKB 2HLCA 3HK6B 1BTZA 2A32A 1BRAA 4INLA 1TYNA 4U2WA 3U8TH 2AMQA 5TCCA 1O3PB 5G4BA 4Y76A 1EZSC 1T4VH 1TMBH 1ANEA 3HKIB 2ZGJA 3F68H 4ABIA 1DX5M 3BSQA 2STBE 1HJAB 2BDCA 5L6NH 3T29A 1NTPA 2WPLS 2AEIH 1C5TA 3SU5A 1ARCA 5L2YH 1GHYH 1T8NA 3U1JB 4ABBA 1PJPA 2PLXA 1SSXA 4OS5A 3VB3A 5FCKA 4ZKNU 1FNIA 2FWWA 4AFQA 1WSSH 4GAWA 3L6PA 1EPTA 1GVZA 3ZV8A 1L4DA 1SPJA 2D1JA 3ZZ9A 1O32A 2ZA5A 2PSYA 1JRTA 1O5DH 3FP7E 5E0GA 3MH7A 1NRPH 4JMYA 5BRRE 3ODDA 3LH1A 2H1UA 1SQTA 1SGFA 4IC6A 1O2PA 5DP5A 4IC5A 4UEHH 3GCHB 1SGEE 1OWKA 1W14U 2BTCE 3WY8A 1QTFA 4B2BA 2OC0A 4AFZA 2ZGBH 2VGCB 3MNXA 2ULLA 1GVLA 2BY8X 5GJ4B 1NROH 3F1SB 1EP6A 5C1UA 2OUAA 1VGCC 1EXFA 4VGCB 6GCHF 1AZZA 2ZHQH 1Z1JA 4I8GA 4CRGA 2ZEBA 3ZZBA 1C5UA 3PO1C 5LPFA 1C5NH 3RXKA 5IYTA 3ITIA 3QZQA 1MQ6A 4E7RG 2NU3E 1ZHMA 1LHFH 1C1OA 2TBSA 2RCEA 3GY8A 3S9CA 1ORFA 3LH3A 2FMJA 2SFAA 1G37A 2VGCC 3NXPA 2A1DB 1AFEH 2BM2A 2VIPA 5A0AE 2R2WU 5A0CA 1HAGE 1BTHH 5PTPA 3TU7H 2GP9B 1JBUH 2UUYA 1PYTC 4J1YA 1VGCB 1UCYE 2BY5X 1KXDA 3RMLH 1HB0B 1QBNA 2VU8E 1SQOA 1SG8B 2EEKA 3GY3A 2CXVA 1H8DH 4B73A 4Y11E 3ZZAA 1T31A 3P17H 1GMCG 1T7CA 1UTKA 1RIWC 3SV7A 4DGJA 2HPPH 2FEQH 4MG3A 5E2OA 1DPOA 4NZLA 1YF4A 1AB9B 1ELCA 2PHBA 2WV5A 3SJ9A 3OSYA 1TAWA 2BDBA 1O3KA 2FI4E 1QRXA 5FX6A 1YYY1 1DXWA 4MTBA 1YLCA 1A3BH 4ISIH 3UOPA 1MMJN 4NSYA 2Z9LA 1YPHE 3RMOH 4ISLA 2QYIA 4DT7B 4X8SH 1TX6A 3H7TA 5ABWA 1T8OA 3RXRA 1YPLH 3W94A 8GCHG 3DHKH 4B75A 3AW1A 2O8UA 3H7OA 1KTSB 4MQAA 2Y6TA 5J4SA 1EB1H 2XRCA 2VJ1A 1JRSA 3NK8A 4ZXYH 3L3TA 4MLFB 1OWEA 2O8LA 1CHOG 1SOTA 4Y79A 3NZIA 1UTLM 3P8FA 1ESBA 1FY1A 2W7UA 3SUFA 5HMAA 1KY9A 1P2NA 3RC6A 3TJVA 4DW2U 1VITG 5C5NA 3GDVA 1V2TT 1XUFA 2PUQH 3TNSA 3HGNA 5FXLA 2SNVA 2P3FH 3E1XB 3OU0A 1GJ8B 4ISOA 5SGAE 2P8OB 3UFAA 4MDSA 1C1RA 1NM6A 5I46H 2AMPA 1FIWA 5E8EH 1MD8A 3A7VA 4ZH8A 1XUKA 1QB6A 1LVBA 3A83A 1O3IA 3V12A 1IAUA 4MNXA 1DSUA 5AHGH 1HAHH 3CS0A 4X6NA 1ELBA 1ABIH 1GBJA 5EPYA 3SORA 1N1LA 1FAKH 2BY9X 1OP0A