2ZCLP

Crystal structure of human prostate specific antigen complexed with an activating antibody
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody
pubmed doi rcsb
molecule tags Immune system
total genus 52
structure length 237
sequence length 237
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zclP01
5FX6A 5JB8S 4KKDA 4GVUA 4AG1A 4JK5A 3TJVA 5I25A 5A0BA 1QJ6B 1AVWA 4IN1A 5E2PA 5DK1A 4A1VA 1V2KT 2Y7ZA 1MTNB 1RJXB 1TMBH 3RXEA 2PLXA 1ZTKA 5L6NH 3GDVA 5FHTA 5F6MA 1C1RA 4OGYA 3RMLH 5C3NA 4JZDH 3LGYA 3BTHE 5AVDA 1BBRH 3QGJA 4FVDA 2GGVB 1HIAA 2WPIS 4BANB 4MNVA 4X1SU 1OYTH 3SOSA 2ZA5A 3LONA 2CHAC 1HAHH 2J34A 1BRAA 2ESTE 1NROH 2R2MB 1O3MA 4ABAA 1HLTH 1TAWA 4BAOB 3MH6A 1MKXK 1S81A 3PLBA 2VIWA 3P8FA 1P2OA 1DT2A 4KGAA 2B7DH 4AFUA 3ZZ5A 1NESE 2O9QA 3ZVGA 1EAWA 2D1JA 4HFPB 1BHXF 1MKXH 1YM0A 1QRXA 2CF8H 5EXMA 1A3BH 1GBLA 1O2LA 3E3TA 1KXDA 4MNYA 2GKVE 5GPIB 1AZZA 2CXVA 2IJOB 1V2WT 1CO7E 1G3CA 2W7UA 1WTGH 3PMAB 4UFGH 3EA8A 1TLDA 4E7RG 1GJ6A 2QC2A 1AE5A 4DG4A 1S6HA 3ATIA 5LPFA 1TB6H 1OS8A 5DP8A 1TPPA 4SGAE 1JIRA 3B23B 3EDXB 2R0KA 4MQAA 4OS1A 2BQ6B 4UEHH 1BMNH 1EJMA 2ZHDA 5FPSA 2QIQA 1J14A 1KIGH 2QCYA 2OC8A 2P16A 1NFXA 1O3EA 1W11U 3F9EA 2OINA 3DFJA 3SJIA 1L1NA 4UFDH 5C1YA 1Q31A 1A46H 2ZFPH 2WPKS 2GV7A 4B73A 1V3XA 4NIXA 1LHDH 2PKSB 1S6FA 1DLKB 4D9RA 1ZLRA 2OQUA 3MOCA 3ZVAA 3VPKA 1V2UT 1KLJH 1QBVH 2SGQE 1P2NA 2AIQA 2ZU3A 3TPIZ 1M9UA 2VINA 2UWPA 2SGFE 2Z7FE 2STAE 1UVUH 4DGJA 1XKBC 2Q6FA 3NKKA 3PWBA 2XBYA 4X8TH 1O2OA 1QL8A 1HCGA 3ZVCA 1ESTA 3TJOA 1V2LT 1L1JA 1C5PA 1GHZA 1PYTC 1AD8H 1VCPA 1VGCB 1CT4E 3IG6B 1RFNA 1MTNC 3M37A 1SLXB 1WSSH 3SUEA 1FIWA 3BIUH 2D2DA 3E90B 4X6OA 4WH8A 8KME2 1F5LA 2BZAA 1UTKA 3UQOA 4ABGA 1O5DH 3SZNA 1FMGA 2ZDMA 3GOVB 1IQJA 1KLTA 1TBQH 4H6SB 1G32B 1SMFE 1BMMH 3AAVA 3F1SB 3SGQE 4RSPA 1T32A 4IGDA 1E35B 3ZVFA 1W8BH 3U1IB 3TK6A 2ZU2A 3TIUA 4TYDA 3SNAA 4AORA 1CA0B 1C1SA 3HKIB 1C1VH 3EAJA 4I8LA 4OS5A 1MTVA 1F0RA 2A31A 1O2IA 2H9EH 4ZXYH 3VXFH 1MCVA 4FU9A 1C2DA 4MG3A 3RXHA 1VITH 4CH8B 1PPEE 3M61U 2QF0A 1YF4A 3SV8A 2EEKA 3ZZ8A 4FUFA 5C1UA 4KTUA 1UHBB 2BLVA 3I78A 2ZDAH 3KL6A 4QT8C 1YLCA 1XM1A 1RD3B 5BPEA 3ZVDA 3RXVA 3CP7A 1TOCB 1GJBB 1BTWA 1A1RA 1C5RA 3GCTG 3BG8A 1V2RT 5TCAA 3P95A 1C5NH 8LPRA 1RRKA 3VB4A 3HPTB 4XSKU 3SORA 1CT2E 1H8DH 3V3MA 3H7OA 4GPGA 1UVTH 1UVOA 3SJOA 1NRQH 1V6DA 1F0TA 3E91A 1GI3A 3FP6E 4ZXXH 1UCYH 1H4WA 2XCNA 1GJ4H 3SO3A 1LVMA 2ZI2H 1V2TT 2VVVA 3FP7E 3B9FH 1GHVH 1F0SA 1FAKH 3QLPH 5HMAA 3AVZA 2C4FH 1XX9A 3Q3KA 2NU0E 5E2OA 1W12U 3GDSA 1KXAA 4TWYA 1OWDA 1UK3A 1P01A 1WYKA 2VH0A 2VIQA 3MMGA 4UONA 5E0GA 1S83A 3LGIA 4BTIB 1Y8TA 2G52A 1K1NA 3LT3A 1Z8IB 4WVPE 1JXPA 2PKSC 2Y81A 4B74A 1UTOA 2BM2A 3NK8A 3MH4A 5EQRA 2OXSA 2I6QA 1EP6A 4O3TA 3SHAH 4YM9A 3M7TA 1QRWA 1HB0B 1L4DA 5FCRA 1SGFG 1EB2A 1LPKB 3ATMA 1IOEA 2KAIA 5TJXA 4B1TA 1GI9B 1QIXB 2J94A 2XTTB 5F8TA 1DFPA 2SGPE 2C3SA 5H4IB 3EE0B 4X8UH 1WU1A 2TBSA 3E0PB 4ABEA 1LVOA 4AGJA 5PTPA 2W26A 5EXLA 1DOJA 1YCPH 3MWIU 1VGCC 2J95A 1UTNA 5EG4A 1WTHD 1DLEA 1HXEH 1PPCE 1Z7KA 5IDKA 1YCPM 3A83A 1SFQB 3ATKA 1PFXC 2ZFFH 4FU7A 2SGEE 1AQ7A 3BTDE 2O8WA 3S9BA 1D6RA 1YPLH 1QA7A 1GHWH 1K1PA 3PV4A 1E0FD 3MH7A 4KELA 1O5AB 1CQQA 1O3OA 3RXBA 3BSQA 1AB9B 3SU3A 3OU0A 4K8BA 1YKTA 3BTGE 3MI4A 3BEFB 3BTEE 2QF3A 1GI8B 1CA0C 3GY5A 1TPAE 1IQGA 2PKAA 3RU4D 1FV9A 1YPKH 4Y8YA 3SBKA 3PO1B 3RXLA 4X1PU 4ASHA 2GCHG 2VIPA 3O8CA 1PPHE 2NU3E 1IQKA 2GCHF 2B5TB 1K28D 3CENA 1CHOF 4D7FA 1GJ8B 4D9QA 5C2ZA 1BTYA 1SLVB 1O3JA 5A09A 1H9IE 2G5NA 4JZEH 3LDXH 1F0UA 3A8DA 3TVJB 4Q2KA 1A3EH 2AIPA 2FDAA 3GY3A 2FI3E 1P06A 1SGIB 2R0LA 1ETRH 1FONA 2OBQA 3PTNA 2A7HA 5CHAB 3RXKA 1QY6A 1Y59T 1O3DA 4K8YA 1DSTA 1NRRH 1GBKA 1GBMA 4Q7YA 1E37B 1K1IA 4GHQA 6LPRA 1GMCG 4JYVH 4TPIZ 2A5AA 1PQ7A 2CJIA 3VB6A 1NFUA 5HXFA 1XXFA 4CBOA 1JOUB 5DP4A 1WCZA 1C1NA 3HGNA 3KIDU 4GCHF 2A4QA 2ZP0H 1GJDB 1DXPA 3UNSA 4X2XA 2J9NA 3C27B 1GDUA 3SNDA 4X6NA 3HGPA 1Z8JB 3SJ8A 1GVLA 1VITF 1EPTA 2FOEA 1O37A 1V2QT 1BIOA 1OOKB 3SUDA 1BTXA 2GV6A 1P2QA 1F2SE 5J4SA 1C5XB 4NWKA 1G2LA 1TQ7B 2BY6X 4B2CA 1N6YA 3QWCH 3RMOH 4BTUB 1HGTH 3KGPA 2B8OH 2BDGA 3G01A 4ZKOU 2A4RA 3QDZB 1C5ZB 3SU0A 1ZZZA 2GZ9A 2PR3A 1QRZA 1LQEA 1Z8RA 5F03A 3FFGA 3H7TA 4U2WA 3P92A 3ZZBA 3RU4T 6ESTA 2PV9B 1ZHMA 4X2YA 3ELAH 4I31A 4INLA 4MPXA 1TE0A 2BDCA 1NO9H 1FIZA 1MBMA 1IQMA 2XNIA 1FN8A 3SI4H 2PSXA 2GZ7A 2CN0H 4O03A 1UTPA 2BY7X 1J16A 3QGNB 1TRYA 1SGNE 5G4BA 3R3GB 4CH2B 1JWTA 5EPNA 1NZQH 2WUBA 2ZGXH 5JDUB 2G55A 1TGBA 4GSOA 4RKOB 1ELEE 1TNIA 4IN2A 1FPCH 1GJ9B 2ZHWH 1QQUA 2WV4A 1XUJA 3SNBA 1FY3A 3SU6A 2BLQA 4WMFA 2HNTE 1S0QA 2V0BA 4XBCA 2IOTA 4VGCB 3E1XB 3OTJE 4YESB 4CBNA 2BTCE 1SFIA 1YPJH 3TK9A 1XMNB 5SGAE 2FTMA 1C2HA 1C1OA 1SOZA 1ARCA 1HIAB 2Y5FA 2AS9A 3D49H 3P17H 1LTOA 1O33A 3LGVA 5JYIA 4Y79A 1BJVA 2BDYA 1AB9C 1THSH 3FANA 1T8LA 5C20A 1LCYA 4ZH8A 2QXGA 4X2WA 1L1GA 1GJ5H 3BF6H 2WPJS 4UFEH 1O3BA 2G81E 8GCHG 1SPJA 3DHKH 3PO1C 2FX6A 1ZPZA 1IAUA 4WXVA 1C5QA 2ZPQA 3JZ1B 1AMHA 1TNJA 5AF9H 2XWBI 1GMHF 4AN7A 3SW2B 4WY3A 3NZIA 3DA9B 3OSYA 4HTCH 4JYUH 1G2MA 3A7VA 2A7JA 1Y5UT 4ZHMU 1HJAB 1DVAH 1TPSA 2H9TH 5CHAC 2UUKB 3UNQA 1O2ZA 1CHGA 2BLOA 3DUXH 3KEEA 3QK1A 4RN6A 1VR1H 3LH1A 3ZZCA 1O2SA 1AY6H 1YYY1 2F9VA 1MAXA 1SQAA 1Z1IA 1O3LA 2W5EA 1UVSH 4I32A 5EPYA 1W3CA 1THRH 1S82A 3U8TH 4X6PA 2B9LA 1QFKH 7GCHG 3RC6A 3M7UA 3UY9A 3ZZ7A 3M7QA 1A2CH 3URDA 3KQCA 1ZRBA 1DUAA 2VH6A 4AYVB 1WUNH 3RLYH 4K60A 3A8CA 3OX7U 1EZUC 1GHBG 1P8VC 2EI8A 5J4QA 1OKXA 3CS0A 1Y3XA 1OWJA 3UIRA 3OYPA 1RTLA 1ELGA 1LQDB 2DUCA 4A1XA 2HOBA 4NZLA 2OUAA 3AASA 4BAHB 1PPBH 1DY9A 3RC5A 4K1EA 5DPAA 1QCPA 5GWZA 4NSYA 5I46H 3KF2A 1QA0A 2XBXA 5DP5A 7LPRA 5DP9A 2XWAA 1CGJE 3A88A 1AI8H 2AGEX 4TY6A 1C9PA 5E0HA 3MTYA 4K3JA 1XVMA 4I8JA 5F8ZA 4HZHA 2UUFB 1ANCA 4DIIH 1OP0A 4Y8ZA 4J1YA 4DOQA 5FX5A 3AW1A 3S9CA 2F9UA 2HGTH 3KHVA 4NIWA 5EQSA 1HAPH 2XC4A 1PQ5A 2WYGA 2VWLA 4Q7ZA 4K5ZA 1KY9A 2TGDA 3QO6A 2FLBH 1H9LB 1NRSH 1F7ZA 1G9IE 3T25A 1MAYA 4ZHAA 1KDQA 1BTHH 1UO6A 3ESTA 1BB0B 1IHTH 4YOGA 3RXOA 4MNXA 2P3FH 1KTTB 4ZKSU 5DKMA 1NPMA 2SFAA 2GX4A 1SGFA 1XVOA 3L33A 4VGCC 1BRUP 2UUJB 2Z6BD 1GJCB 2Z3DA 1DWBH 4H6TA 2ZQ2A 2BD8A 4AYYB 3RDZA 3B8JA 2OQ5A 3QTOH 1V2NT 3T2NA 2UUYA 2BD5A 2G4TA 3M35A 2ZEBA 4BAKB 3UNRA 2QXHA 2OP9A 1XUKA 2BDHA 5DG6A 2W3IA 1FZZA 5L2YH 1RTFB 1C1TA 5C5NA 1INCA 5JB9S 1NY22 2AEIH 3SQHE 2XRCA 4OS4A 1EZXC 1AZ8A 4U32A 1WBGB 3RXSA 1GDNA 1ELVA 3RXIA 3TNSA 1VZQH 3GCHB 2W3KA 2P93A 3STJA 2ZO3H 2A4OA 2WV5A 2FI4E 3Q00A 1HJAC 2ANKH 2BXUH 1FI8A 3PLKA 2WPMS 1GI6A 3SQEE 2IPHA 2Z94A 3RXPA 4NCYA 1HAXB 2PTNA 4FVBA 1DWEH 4XOJA 1BCUH 3QX5H 3E8LA 5DJ7A 4TPYA 2A2XH 3S7KB 2ZGCA 3TGKE 4YZUA 4HGCA 1P09A 1SVPA 2A45B 1KSNA 1L4ZA 5LGOA 2WUCA 1P57B 2RDLA 1FXYA 5E8EH 1SR5C 3H5CB 2GTBA 3UWIA 5AFZH 4YT6H 4X8VH 5A0AE 1EP5A 5EW2H 1MTUA 4BOHA 1A0JA 1G3EA 1O2KA 1ZMJA 1BTUA 1O2HA 2V3OH 4MTBA 1GL1A 5HGGA 1P10A 3O8DA 3GY7A 3PMHB 1DS2E 1KLIH 4AOQA 2BVXH 3CS7A 4D8NA 4ISHH 1SB1H 2BQ7B 5C67A 1BDAA 1D3QB 1KXCA 2GD4B 1Y5BT 4MDSA 1YPHC 1C5VA 2HLCA 1C4Y2 1X7AC 2M5TA 1JMOH 1OXGA 4UD9H 1P2IA 2R9PA 3GICB 1TBRH 1GWAA 3ZZ3A 4A5TS 2ZU1A 1OYQA 2BY5X 1GVZA 2KAIB 2HNTC 3SGBE 4GHTA 3RXGA 1AGJA 1GMDG 3P8NA 1C2IA 4NFEA 1GBHA 2BD4A 3S69A 5A8XA 2XW9A 1CGIE 2VIVA 1J9CH 4MPVA 4Z0KA 1HAVA 4K1SA 1K1OA 2IN2A 5GDSH 4A1TA 3ZVEA 2BD2A 5E0JA 3I29A 1Y3VA 1Z8GA 1QL7A 3Q3YA 3QUMP 1L0ZA 1ZJKA 3TK5A 1GBEA 1Q3XA 2VU8E 3JZ2B 3A7ZA 3MFJA 4NA7A 3GCTF 3TJUA 2A32A 4KP0A 1QQ4A 2P94A 4UE7H 2ZDNA 1TYNA 2F91A 1K1LA 4NIYA 5A8ZA 3QTVH 3K6ZA 1GHAG 1GHAF 2HPQH 2TRMA 3QZQA 2BX3A 2YOLA 4YOJA 4ZKRU 3A7TA 2J38A 3MNSA 5A2MH 5FPTA 4BAMB 1GI4A 1CU1A 3MU4A 4XBDA 1QB1A 2J4IA 3PROA 1G3DA 1KXEA 3OY6U 2C8YB 1GBBA 1C1MA 2FP7B 1HJ9A 1HAYB 4X1QU 1CE5A 1O2NA 4ABBA 1K1JA 3SI3H 1XUFA 1EKBB 1AE8H 1P05A 3FZDA 2PKAB 1MZAA 2OD3B 3ZVBA 2C90B 2ZDVH 4ISLA 1ELTA 1BQYA 1NTPA 1VCQA 2PWXA 4GLYA 3BN9A 3MU0A 5JPMH 3DD2H 1QHRB 3GCHC 3A82A 2QAAA 1ELBA 1FNIA 2VWNA 3T29A 2ODPA 1HJ8A 4A92A 1BTPA 1C5YB 3S7HB 4BXWA 1FLEE 2THFB 1O5FH 1ZGIA 2GZ8A 2FS8A 3UUZA 3S9AA 1GG6B 1P3CA 1LPGB 1A7SA 4Y8XA 1UMAH 4DJZB 2ANWA 1ZRKA 1ZSKA 3LU9B 4Y10E 1DANH 1NRNH 3S0NA 1C2FA 3C1KA 1AU8A 1VJ9U 1GDQA 3QN7A 2WPHS 1PPZA 1GBCA 2ZKSA 2EA3A 1UTQA 1TRMA 1SBWA 3UQVA 1O2GH 1MD8A 1V2JT 1MQ5A 1LO6A 3FVFB 1N8OB 1P9SA 1HAGE 1BHXB 3SV7A 1TX7A 4ABHA 1O35A 3A87A 1LKBA 1GI5A 1EPTB 2VB0A 1ELDE 3F9HA 4ZUHA 1A5HA 2A4GA 1IQNA 3V7TA 1O39A 1NS3A 2BX4A 1PYTD 5FXLA 3A86A 1D3DB 1A0LA 1C4V2 1Y3UA 3NPSA 5AHGH 4SGBE 1W13U 2FXRA 2VVUA 3P6ZB 1JRSA 1CGHA 1QTFA 1BBRE 3GCOA 1PPFE 3LGUA 3UOUA 4ZAEA 1C9TA 5EODA 4B75A 1MCTA 1UK2A 4FUDA 2H2ZA 1ZSLA 2ASUB 3FZZA 4INHA 3TGJE 1G30B 1SOTA 2TPIZ 4X1RU 2RCEA 2NU4E 1T7CA 2FTLE 4DVAU 1A0HB 3SV9A 3SN8A 4AFZA 9LPRA 1D6WA 3RMNH 3KQEA 5LPEA 2C8WB 2I6SA 5A0CA 2GT8A 2XC5A 1K22H 5B6OA 4B76A 4CHAB 2ZTZA 1O3PB 4I8KA 2SGAA 4IC5A 2JETB 3MNXA 3HATH 1GBAA 2BOHB 1ELCA 1P3EA 2R3UA 1YPEH 3NXPA 4WH6A 1ESAA 3RXMA 3BTKE 1FQ3A 1SGYE 1DDJA 1MTSA 4ISNA 4JK6A 3LGTA 3U1JB 1GMCF 4J2YB 1BJUA 1LHGH 1MKWK 2R2WU 4FUBA 1C5OH 1TALA 2PGQB 1O32A 2XC0A 2ZIQH 4CRAA 1XKAC 2FODA 5BRRE 1O5EH 1T8NA 2FEQH 1D4PB 1SSXA 1HNEE 3VEQB 2OTVA 4BNRA 1D3PB 2ZGHA 2GCTB 2ZNKH 3ZZAA 1O2RA 2WPLS 4U30A 1O3HA 4X6MA 4OS6A 3PTBA 1Z71A 1SC8U 5FPYA 1PQ8A 2VWMA 1QR3E 2FWWA 5TCCA 2GVFA 1J15A 4IC6A 2BD9A 1QBNA 1EZQA 2F83A 4JZFH 1FDPA 1FY5A 2TGPZ 2ALVA 2G8TA 3F68H 1KYNA 2BVSH 2XYAA 1GJAB 2STBE 3MHWU 3T27A 3PM3A 3K6YA 2V35A 3ATLA 5F8XA 2VIOA 4CRDA 4IMZA 2NU1E 2BVRH 2HWLB 3W94A 3MNBA 6CHAB 1O2WA 1GG6C 1ANBA 1O3GA 1DITH 1O5GH 1KXBA 2EC9H 1UK4A 4Y76A 1K2I1 1W0YH 3A81A 2BD3A 2J92A 2FOGA 1BMLA 4Z6AH 2QV1A 4CRFA 1YPHE 1RIWB 3U98H 1NRPH 4NG9H 2F9BH 2QXJA 3SV6A 2HRVA 4LZ1H 1O3KA 1W7XH 4TY7A 1TNLA 2VGCB 1W10U 1DXWA 3BG4C 5L30H 1N8OC 2AGIX 3LJOA 1RGQA 1SLUB 1OWHA 1Z6JH 4WJG2 3E6PH 1TNHA 2ZGBH 4ISIH 3RXQA 1GI2A 3GISB 2G51A 1EPTC 4AGKA 2BMGB 3P70B 1D3TB 3SHCH 3TGIE 1AWHB 2OBOA 4XBBA 3U9AH 1AVGH 3GCNA 1DE7H 1ZSJA 3ZV8A 3A7XA 1ETTH 3A80A 3L6PA 2ZU5A 1EZSC 1SHYA 1C1QA 2BB4A 2LNCA 1DM4B 3SUFA 3Q3XA 4X8SH 1ZMNA 2GMTC 2OLGA 3U8RH 2TGTA 2VVCA 2ULLA 2FOAA 3ZZ6A 2Z3EA 1QBOA 3PYHA 2VWOA 8GCHF 1B7XB 5EU8A 3AAUA 5T6GA 2SNVA 5GCHG 1TGSZ 2H5DA 8ESTE 1TA6A 3PB1E 5EXNA 3KQDA 4NGAH 1PQAA 2FIRH 3SJKA 1QGFA 5LPRA 5HM9A 2ZFTA 3DT0H 4CHAC 1SHHB 5CE1A 1BRBE 3M5LA 1C4U2 4CR9A 2JH6D 2JETC 4F49A 4LXBH 1P11E 1SQTA 2OC1A 3ZV9A 4AX9H 1O2XA 3SU1A 1GCDA 1T4VH 1RS0A 2Y7XA 1LKAA 3ZZ9A 1O2JA 4DCDA 1KDQB 2NU2E 2PUXB 2ZGJA 3RC4A 3RXFA 3RXJA 1SGQE 1FY8E 1O2QA 3HK3B 1AFEH 4MPUA 1GCTB 3DFLA 4D76A 4HI3A 3VFEA 1EASA 2GDDA 2Z3CA 1O3IA 1C5LH 1E36B 1S0RA 1G37A 1WOFA 1GHYH 7GCHF 2HALA 1FPHH 3PLPA 1GJ7B 1C2KA 1EQ9A 3MO9A 3ZZDA 1V2VT 2GCTC 3A85A 3PWCA 1MMJN 1U6QA 1UCYE 1F5KU 1VCWA 1BMAA 4H42U 4O9VA 1HAOH 1EAIA 1TA2A 2DE8A 1ANDA 3V0XA 3EYDA 1GHBF 2H9HA 1GHXH 2H1UA 1AKSA 4KTCA 1LVBA 2A7CA 4UDWH 3LC5A 1JRTA 1BZXE 2ANYA 2QYIA 1ID5H 1BBRK 4INKA 1FN6A 4YO9A 2DE9A 2HVXA 2W7SA 3KCGH 2ZQ1A 2NWNA 3BTQE 1BA8B 4PROA 6CHAC 5K0HA 1MBQA 1BT7A 1TBZH 1YBWA 2PTCE 1G3BA 3LH3A 3LJJA 2G5VA 3Q77A 3GDUA 2Y5HA 1GI7B 3A8BA 2FX4A 2P8OB 4AFQA 1TONA 1P0SH 1GGDB 4Q7XA 1P2JA 1RIWC 1C2EA 1C5WB 1T4UH 4DIHH 1O5BB 1FJSA 1H9HE 3SNEA 1EOLA 4WWYA 2ANMH 2FZZA 2VGCC 3K9XB 4WF8A 1C5UA 1SGPE 4M7GA 4ZHLU 1MZDA 3Q76A 4MPWA 2P59A 1EJAA 2QY0B 1SGEE 2AMQA 3IITA 3ZYEA 4AFSA 1XUHA 3FP8E 1P2KA 2Z9LA 3BTME 4MNWA 4ZMAH 5T6FA 3TITA 1XXDA 7KMEH 1WQVH 1OWEA 2A5IA 5EOKA 2A2QH 2SGDE 4FUHA 1UJ1A 1S84A 1SGTA 3RMMH 1K1MA 1OPHB 1TOMH 1EATA 1CBWB 3R0FA 2TIOA 1SGCA 4OS7A 3EA7A 3EQ0H 3RXDA 4LZ4B 1AVXA 4ABIA 2J2UA 2P3TB 4DY7B 1DICA 1AFQB 1AO5A 1MQ6A 2ZDLA 3SUGA 3ZZ4A 2ZZUH 4FUCA 2YNBA 1EX3A 1NT1A 4Y7AA 3A7WA 2BYAX 3BEUA 3M36A 2O8UA 3TH4H 4GAWA 2ZPRA 1J17T 1MU8B 1TQ0B 1NFWA 2FI5E 2QN5T 1Q2WA 1C1WH 1HAVB 1MUEB 3IWMA 3LOXA 5CMXH 5GJ4B 4NSVA 3NUMA 3VGCB 3K65B 1ORFA 1V2OT 1C5TA 4X2VA 1ZHPA 3BTFE 3L3TA 1B5GH 1BOQA 4ABJA 1O5CB 1OWIA 2CF9H 1HPGA 3RLWH 3D62A 4WMEA 1GCTC 2JH0D 2AH4X 3UWJH 1S5SA 1G36A 2A1DB 1O30A 3RXCA 1THPB 2RA0A 1Z6EA 2ZHFH 1C1PA 5A8YA 1RTKA 3NWUA 1HV7A 3UPEA 1NN6A 4X1NU 2XBVA 1O2YA 1GBFA 3BIVH 3MH5A 3ODDA 1IQEA 2FPZA 1HFDA 2BY9X 2FOBA 3PMBB 5T6DA 1C2LA 1V2ST 4KTSA 1IQLA 1HYLA 1C5MD 2AERH 2JH5D 4NA8A 1C5SA 3EGKH 1JBUH 2FOCA 1P03A 1Y3WA 2AFQB 4IMQA 4YTAA 4A7IB 2PUQH 4DT7B 2VNTA 1P9UA 4YLQH 3M3TA 1IQIA 5FAHA 5EGMA 7ESTE 1YLDA 5L2ZH 1O2UA 1F5RA 4UFFH 1MU6B 2BOKA 2AMDA 3SU4A 3TH3H 3UR6A 1E34B 3MNCA 1A61H 1EAUA 2P8OC 2ZHQH 3RXRA 3VB7A 1TRNA 1GGDC 1GVKB 2FYQA 1MTWA 2ZFQH 1V2MT 1GMDF 3LIWA 4H4FA 4A6LA 2BY8X 3ODFA 3SGAE 3BEIB 4K69A 1W14U 3TJNA 1PJPA 2BQWB 4Y71A 5GIBA 1IHSH 3A84A 5C5OA 3GY2A 4MVNA 1TMUH 2Y6TA 5LH8A 1TPOA 1O31A 2Q6DA 4NIVA 2ZG0H 1O36A 1P12E 1OSSA 4F4OC 5ESTE 5JBCS 4WMDA 4Y7BA 1W0ZU 1ZYOA 4Y6DA 1OP8A 1AHTH 3F9GA 2WINI 1YP9A 2CV3A 3AW0A 3M5NA 1GBDA 4BTTB 1ABJH 1C2MA 1Z1JA 1CBWC 2QXIA 4AB9A 1UCYK 1LHFH 3TNTA 1ZR0A 4IBLH 2Y80A 3F9FA 1ABIH 4TWWA 2LPRA 3T26A 3MO3A 1C2GA 2BDAA 3SJ9A 1A4WH 4LOYH 2F9NA 1AFQC 1HRTH 4Y11E 3RM2H 2F3CE 5ESBA 2ZFSA 2V3HH 1AIXH 1GI0A 1TNKA 2BDIA 2FOHA 1GBIA 1TABE 4AB8A 2TGAA 1TFXA 4DW2U 5AFYH 1LMWB 2FMJA 4E05H 4OGXA 3M3VA 2UWLA 1ESBA 5HM2A 3A7YA 4R0IA 3VGCC 2CGAA 1YC0A 5IYTA 1TMTH 1MD7A 2ZCLP 1DWCH 1UTLM 5DP3A 1NC6A 3V13A 3OY5U 2XCFA 4IS5A 1N6XA 1BTZA 5ETXA 4B71A 6GCHG 6GCHF 5FBEA 1UVPA 2XXLA 4JMYA 5DGJA 2QA9E 2ZHEH 3BG4B 1C2JA 4CRGA 1LPZB 3GYLB 1TX6A 4JZIA 4B2BA 5FCKA 2P3UB 1DWDH 3W95A 4OS2A 1OX1A 3UOPA 1ACBE 1ELFA 1TX8A 2EI6A 1YCPK 1YPMH 1SGDE 2FO9A 1O2MA 3TH2H 1UHBA 1N1LA 3D65E 2AYWA 1HAIH 4I7YH 4CRCA 1T8OA 4CR5A 4GUXA 1O3AA 1Y3YA 4LK4A 1K9OE 1K21H 2GMTB 3NCLA 4FUJA 1DX5M 1YGCH 1EB1H 1DY8A 1DUEA 1ZPCA 1SG8B 1AUJA 2PW8H 2PHBA 2GT7A 2A0QB 3RP2A 1TWXB 2Z9JA 2ZCHP 1KXFA 1ETSH 2ZWLH 3BTWE 3VB5A 4AZ2B 2Q1JA 2Y5GA 4FUEA 3A89A 3T5FH 2B0FA 3M3SA 2C93B 1GI1A 2VJ1A 1LHEH 4ZKNU 2BHGA 2Z9KA 1CVWH 3TU7H 4FUGA 1EJNA 1O0DH 2ZF0H 3RXTA 1B0EA 2FYRA 2RG3A 5C1XA 1HAZB 3SV2H 2G4UA 4ESTE 1QB9A 5FBIA 1QNJA 2P95A 2A5KA 4IW4E 5ABWA 2HPPH 2Z9IA 1ZTJA 1DSUA 1NU7B 5DP7A 1P2MA 1CHOG 3M5MA 1GPZA 4XDEA 2FS9A 2HNTF 2QGRA 1NU9A 1IQFA 2RA3A 3UR9A 4Q80A 3SU2A 1O2VA 1GBJA 1HDTH 4O3UA 3U69H 2JKHA 1LHCH 2D26C 3MU1A 1TGNA 1XUGA 2GDEH 3MO6A 2F9OA 3VB3A 1ZJDA 4JCNA 1LDTT 3LKWA 1IQHA 5JBAS 1MKWH 2PSYA 1ZMLA 2H6MA 2ZECA 1FY1A 2FOMB 3BV9B 3K2UA 1O38A 4GCHG 3RXAA 1FY4A 1TNGA 2SNWA 1WAYB 3E0NB 1QL9A 3EA9A 1VITG 2ALPA 4AG2A 2AMPA 1JIMA 2ODYB 3D23A 1QJ7B 3P8OA 4FXGH 3UFAA 3LGWA 1T31A 1HXFH 2BDBA 2FOFA 3A8AA 3KN2A 2Y82A 1A5GH 1D9IA 1MH0A 3QZRA 1SQOA 3KQBA 5DO4H 9ESTA 3LPRA 3MU5A 1PPGE 1YPGH 2CHAB 1S85A 1RXPA 2G00A 3E16B 4CRBA 2PFEA 1O2TA 2ILNA 4I8GA 1KTSB 1SI5H 1AUTC 1GBTA 3VXEH 3URCA 1VJAU 4B2AA 1H8IH 4I33A 2EI7A 2FLRH 2D8WA 5EQQA 1XUIA 3RU4E 1LVYA 2V6NA 2Z9GA 3WY8A 1W7GH 2YNAA 4YOIA 3HK6B 2ZC9H 3FAOA 4XFQA 4THNH 2BLWA 4BAQB 1P04A 2C8XB 1OP2A 3PMJA 4WXIA 4U01A 2VIDA 3O8RA 1EXFA 1AKSB 5JBTA 3ATWA 4ISOA 1SLWB 1O34A 4E06H 4YLUA 2H5CA 1DPOA 2FM2A 1L2EA 1OWKA 4FU8A 5HYOA 2BZ6H 1NFYA 1O3NA 2O8TA 2Q6GA 4NFFA 5JBBS 3RUOA 4Y0YE 1WQSA 4K2YA 1QJ1B 3GY8A 2R3YA 4NZQA 2BD7A 1CT0E 2ZFRH 3U8OH 1TGCA 1H1BA 4E7NA 1ANEA 1BITA 3GYMA 3P8GA 5K7RA 4R8TB 3RXUA 1BUIA 1O3CA 1ELAA 3I77A 1GL0E 4JZ1A 2K1QA 3HKJB 4D7GA 1FAXA 2OC7A 3T62A 4FUIA 5GCHF 3MU8A 1CSOE 2F9PA 2OCVB 4NWLA 1AN1E 1A5IA 4NA9H 3SNCA 3M5OA 1TGTA 1WV7H 4I8HA 3T28A 5DP6A 1EOJA 1NM6A 4XE4A 1ZGVA 1P02A 2XBWA 1UTMA 3ITIA 1ARBA 2OC0A 2UWOA 1SL3A 3RM0H 1O2PA 1ZPBA 2GP9B 3KNXA 1UTJA 1TIOA 4Y0ZE 1ZHRA 5GXPA 1GMHG 1HBTH 2PGBB 3UREA 3V12A 1Y5AT 3GY6A 1C1UH 3O8BA 5EW1H 4BXSA 4ABDA 1F92A 3ZYDA 2ZTYA 3BTTE 1O3FA 4RKJB 1T8MA 1AWFH 1W2KH 3GY4A 4JYTA 4ZROA 1QB6A 3MYWA 2O8LA 1CA8B 3UTUH 2O8MA 1SGRE 1HUTH 2WYJA 4ABFA 1J8AA 2ZTXA 3SU5A 4MLFB 5T3HA 2CMYA 2ZPSA 2ZCKP 1QURH 2BXTH 3STIA 3F6UH 2ODQA 3N7OA 1ZOMA 3LC3A 1V2PT 4YT7H 2AGGX 1ZTLA 2C8ZB 1BRCE 3ENSB 3TLOA 4DURA 2ZDKA 4CREA 1EAXA 1E38B 1EUFA 4X0WU 2ZU4A 2FESH 4O97A 1B0FA 4K1TA 1FUJA
chains in the Genus database with same CATH superfamily
5FX6A 5JB8S 4KKDA 4GVUA 4AG1A 4JK5A 3TJVA 5I25A 5A0BA 1QJ6B 1AVWA 4IN1A 5E2PA 5DK1A 4A1VA 1V2KT 2Y7ZA 1MTNB 1RJXB 2F43B 1TMBH 3RXEA 2PLXA 1ZTKA 5L6NH 3GDVA 5FHTA 5F6MA 1C1RA 4OGYA 3RMLH 5C3NA 4JZDH 3LGYA 3BTHE 5AVDA 1BBRH 3QGJA 4FVDA 2GGVB 1HIAA 2WPIS 4BANB 4MNVA 4X1SU 1OYTH 3SOSA 2ZA5A 3LONA 1W0JD 2CHAC 1HAHH 2J34A 1BRAA 2ESTE 1E79D 1NROH 2R2MB 1O3MA 4ABAA 1HLTH 1TAWA 4BAOB 3MH6A 1MKXK 1S81A 3PLBA 2VIWA 3P8FA 1P2OA 1DT2A 4KGAA 3W1EA 2B7DH 4AFUA 3ZZ5A 1NESE 2O9QA 3ZVGA 1EAWA 2D1JA 4HFPB 1BHXF 1MKXH 1YM0A 1QRXA 2CF8H 4YXWD 5EXMA 1A3BH 1GBLA 1O2LA 3E3TA 1KXDA 4MNYA 2GKVE 5GPIB 1AZZA 4FOUC 2CXVA 2IJOB 1V2WT 1CO7E 2VBCA 1G3CA 2W7UA 1WTGH 3PMAB 4UFGH 3EA8A 1TLDA 4E7RG 1GJ6A 2QC2A 1AE5A 4DG4A 1S6HA 3ATIA 5LPFA 1TB6H 1OS8A 5DP8A 1TPPA 4SGAE 1JIRA 3B23B 3EDXB 2R0KA 4MQAA 4OS1A 2BQ6B 4UEHH 1BMNH 1EJMA 2ZHDA 5FPSA 2QIQA 1J14A 1KIGH 2QCYA 2OC8A 2P16A 1NFXA 1O3EA 1W11U 3F9EA 2OINA 3DFJA 3SJIA 1L1NA 4UFDH 5C1YA 1Q31A 1A46H 2ZFPH 2WPKS 2GV7A 4B73A 1V3XA 4NIXA 1LHDH 2PKSB 1S6FA 1DLKB 4D9RA 1ZLRA 2OQUA 3MOCA 3ZVAA 3VPKA 1YWUA 1V2UT 1KLJH 1QBVH 2SGQE 1P2NA 2AIQA 2ZU3A 3TPIZ 1M9UA 2VINA 2UWPA 2SGFE 2Z7FE 2STAE 1UVUH 4DGJA 1XKBC 2Q6FA 3NKKA 3PWBA 2XBYA 4X8TH 1O2OA 1QL8A 2EY4C 1HCGA 3ZVCA 1ESTA 3TJOA 1V2LT 1L1JA 1C5PA 1GHZA 1PYTC 1AD8H 1VCPA 1VGCB 1CT4E 3IG6B 1RFNA 1MTNC 3M37A 1SLXB 1WSSH 3SUEA 1FIWA 3BIUH 2D2DA 3E90B 4X6OA 4WH8A 8KME2 1F5LA 2BZAA 1UTKA 3UQOA 4ABGA 1O5DH 3SZNA 1FMGA 2ZDMA 3GOVB 1IQJA 1KLTA 1TBQH 4H6SB 1G32B 1SMFE 1BMMH 3AAVA 3F1SB 3SGQE 4RSPA 1T32A 4IGDA 1E35B 3ZVFA 1W8BH 3U1IB 3TK6A 2ZU2A 3TIUA 4TYDA 3SNAA 4AORA 1CA0B 1C1SA 3HKIB 1C1VH 3EAJA 4I8LA 4OS5A 1MTVA 1F0RA 2A31A 1O2IA 2H9EH 4ZXYH 3VXFH 1MCVA 4FU9A 1C2DA 3NRLA 4MG3A 3RXHA 1VITH 4CH8B 1PPEE 3M61U 3FN8A 2QF0A 1YF4A 3SV8A 2EEKA 3ZZ8A 4FUFA 5C1UA 4KTUA 1UHBB 2BLVA 3I78A 2ZDAH 3KL6A 4QT8C 1YLCA 1XM1A 1RD3B 5BPEA 3ZVDA 3RXVA 3CP7A 1TOCB 1GJBB 1BTWA 1A1RA 1C5RA 3GCTG 3BG8A 1V2RT 5TCAA 3P95A 1C5NH 4RT0A 8LPRA 1RRKA 3VB4A 3HPTB 4XSKU 3SORA 1CT2E 1H8DH 3V3MA 3H7OA 4GPGA 1UVTH 1UVOA 3SJOA 1NRQH 1V6DA 1F0TA 3E91A 3PV2A 1GI3A 3FP6E 4ZXXH 1UCYH 1H4WA 4M9FA 2XCNA 1GJ4H 5EIYA 3SO3A 1LVMA 2ZI2H 2KM0A 4ACAA 1V2TT 2VVVA 3FP7E 3B9FH 1GHVH 1F0SA 1FAKH 5EJ1A 3QLPH 5HMAA 3AVZA 2C4FH 1XX9A 2LP6A 3Q3KA 2NU0E 5E2OA 1W12U 3GDSA 1KXAA 4TWYA 1OWDA 1UK3A 1P01A 1WYKA 2VH0A 2VIQA 3MMGA 4UONA 5E0GA 1S83A 3LGIA 4BTIB 1Y8TA 2G52A 1K1NA 3LT3A 1Z8IB 4WVPE 1JXPA 2PKSC 2Y81A 4B74A 1UTOA 3AK5A 2BM2A 3NK8A 4Z1MD 3MH4A 5EQRA 2OXSA 2I6QA 2AHME 1EP6A 4O3TA 3SHAH 4YM9A 3M7TA 1QRWA 1HB0B 1L4DA 5FCRA 1SGFG 1EB2A 1LPKB 3ATMA 1IOEA 2KAIA 5TJXA 4B1TA 1GI9B 1QIXB 2J94A 2XTTB 5F8TA 1DFPA 2SGPE 2C3SA 5H4IB 3EE0B 4X8UH 1WU1A 2TBSA 3E0PB 4ABEA 1LVOA 4RI0A 1VKYA 4AGJA 5PTPA 2W26A 5EXLA 1DOJA 1YCPH 3MWIU 1VGCC 2J95A 1UTNA 5EG4A 1WTHD 5GNDA 1DLEA 1HXEH 1PPCE 1Z7KA 5IDKA 1YCPM 3A83A 1SFQB 3ATKA 1PFXC 2ZFFH 4FU7A 2SGEE 1AQ7A 3BTDE 2O8WA 3S9BA 1D6RA 1YPLH 1QA7A 1GHWH 1K1PA 3PV4A 1E0FD 3MH7A 4KELA 1O5AB 1CQQA 1O3OA 3RXBA 3BSQA 1AB9B 3SU3A 3OU0A 4K8BA 1YKTA 3BTGE 3MI4A 3BEFB 3BTEE 1YY3A 2QF3A 1GI8B 1CA0C 3F0PA 3GY5A 1TPAE 1IQGA 2PKAA 3RU4D 1FV9A 1YPKH 4Y8YA 3SBKA 3WW7A 4FETA 3PO1B 3RXLA 4X1PU 4ASHA 2GCHG 2VIPA 3O8CA 1PPHE 2GCHF 1IQKA 2NU3E 2B5TB 1K28D 3CENA 1CHOF 4D7FA 1GJ8B 4D9QA 5C2ZA 1BTYA 1SLVB 1O3JA 5A09A 1H9IE 2G5NA 4JZEH 3KYFA 3LDXH 1F0UA 3A8DA 3TVJB 4Q2KA 1A3EH 2AIPA 2FDAA 3GY3A 2FI3E 1P06A 1SGIB 2R0LA 1ETRH 1FONA 2OBQA 3PTNA 2A7HA 5CHAB 3RXKA 5EJLA 1QY6A 1Y59T 1O3DA 4K8YA 1DSTA 1NRRH 1GBKA 1GBMA 4Q7YA 1E37B 1K1IA 4GHQA 6LPRA 1GMCG 4JYVH 4TPIZ 2A5AA 1PQ7A 2CJIA 2KZ4A 3VB6A 1NFUA 5HXFA 1XXFA 4P02A 1COWD 4CBOA 1JOUB 5DP4A 1WCZA 1C1NA 3HGNA 3KIDU 4GCHF 2A4QA 2ZP0H 1GJDB 1DXPA 3UNSA 4X2XA 2J9NA 3C27B 1GDUA 3SNDA 4X6NA 3HGPA 1Z8JB 3SJ8A 1GVLA 2JDID 1VITF 1EPTA 2FOEA 1O37A 1V2QT 1BIOA 1OOKB 3SUDA 1BTXA 2IPQX 2GV6A 1P2QA 1F2SE 5J4SA 1C5XB 4NWKA 1G2LA 1TQ7B 2BY6X 4B2CA 1N6YA 3N7DA 3QWCH 3RMOH 4BTUB 1HGTH 3KGPA 2B8OH 2BDGA 3G01A 4ZKOU 2A4RA 3QDZB 1C5ZB 3SU0A 1ZZZA 4B6EA 2GZ9A 2PR3A 1QRZA 1LQEA 1Z8RA 5F03A 3FFGA 3H7TA 4U2WA 3P92A 3ZZBA 3RU4T 6ESTA 2PV9B 1ZHMA 4X2YA 3ELAH 4I31A 4INLA 4MPXA 1TE0A 2BDCA 1NO9H 1FIZA 1MBMA 3SZEA 1IQMA 2XNIA 1FN8A 3SI4H 2PSXA 4AC9A 2GZ7A 2CN0H 4O03A 1UTPA 2BY7X 1J16A 3QGNB 1TRYA 1SGNE 1SQRA 5G4BA 3R3GB 4CH2B 1JWTA 5EPNA 1NZQH 2WUBA 2ZGXH 5JDUB 3MQKC 2G55A 1TGBA 4GSOA 4RKOB 1ELEE 1TNIA 4IN2A 1FPCH 1GJ9B 2ZHWH 1QQUA 2WV4A 1XUJA 3SNBA 1FY3A 3SU6A 2BLQA 4WMFA 2HNTE 1S0QA 2V0BA 4XBCA 2IOTA 4VGCB 3E1XB 1NBME 3FKSD 3OTJE 4YESB 4CBNA 2BTCE 1SFIA 1YPJH 3TK9A 1XMNB 5SGAE 2FTMA 1C2HA 1C1OA 1SOZA 1ARCA 1HIAB 2Y5FA 2AS9A 3D49H 3P17H 1LTOA 1O33A 3LGVA 5JYIA 4Y79A 1BJVA 2BDYA 1AB9C 1THSH 3FANA 1T8LA 5C20A 1LCYA 4ZH8A 2QXGA 4X2WA 1L1GA 1GJ5H 2KCPA 3BF6H 2WPJS 4UFEH 1O3BA 2G81E 8GCHG 1SPJA 3DHKH 3PO1C 2FX6A 1ZPZA 1IAUA 4WXVA 2V7QD 1C5QA 2ZPQA 3JZ1B 1AMHA 1TNJA 5AF9H 2HLDD 2XWBI 1GMHF 4AN7A 3SW2B 4WY3A 3NZIA 3DA9B 3GS9A 3OSYA 4HTCH 4JYUH 1G2MA 3A7VA 2A7JA 1Y5UT 4ZHMU 1HJAB 1DVAH 1TPSA 2RFKC 2H9TH 5CHAC 2UUKB 3UNQA 1O2ZA 3PRBA 1CHGA 2BLOA 3DUXH 3KEEA 3QK1A 4RN6A 1VR1H 3LH1A 3ZZCA 1O2SA 1AY6H 1YYY1 2F9VA 3OFND 3FOAA 1MAXA 1SQAA 1Z1IA 1O3LA 2W5EA 1UVSH 4I32A 5EPYA 1W3CA 1THRH 1S82A 3U8TH 4X6PA 2B9LA 1QFKH 7GCHG 3RC6A 3M7UA 3UY9A 3ZZ7A 3M7QA 1A2CH 3URDA 3KQCA 1ZRBA 1DUAA 2VH6A 4AYVB 1WUNH 3RLYH 4K60A 3A8CA 3OX7U 1EZUC 1BMFD 1GHBG 1P8VC 2EI8A 5J4QA 1OKXA 3CS0A 1Y3XA 1OWJA 3UIRA 3OYPA 1RTLA 1ELGA 1LQDB 2DUCA 4A1XA 2HOBA 4NZLA 2OUAA 3AASA 4BAHB 1PPBH 1DY9A 3RC5A 4K1EA 5DPAA 1QCPA 5GWZA 4NSYA 5I46H 3KF2A 1QA0A 2XBXA 2K0QA 5DP5A 7LPRA 5DP9A 2XWAA 3F2HA 1CGJE 3A88A 1AI8H 2AGEX 4TY6A 1C9PA 5E0HA 3MTYA 4K3JA 1XVMA 4I8JA 5F8ZA 4HZHA 2UUFB 1ANCA 4DIIH 1OP0A 4Y8ZA 4J1YA 4DOQA 5FX5A 3AW1A 3S9CA 3KQ5A 2F9UA 2HGTH 3KHVA 4NIWA 2J97A 5EQSA 1HAPH 2XC4A 1PQ5A 2WYGA 2VWLA 4Q7ZA 4K5ZA 1KY9A 2TGDA 3QO6A 2FLBH 1H9LB 1NRSH 1F7ZA 1G9IE 3T25A 1MAYA 4ZHAA 1KDQA 1BTHH 1UO6A 3ESTA 1BB0B 1IHTH 4YOGA 3RXOA 4MNXA 2P3FH 1KTTB 4ZKSU 5DKMA 1NPMA 2SFAA 2GX4A 1SGFA 1XVOA 3L33A 4VGCC 1BRUP 2WSSD 2UUJB 2Z6BD 1GJCB 2Z3DA 1DWBH 4H6TA 5HIZA 2ZQ2A 2BD8A 4AYYB 3RDZA 3B8JA 2OQ5A 3QTOH 1V2NT 3T2NA 2UUYA 2BD5A 2G4TA 3M35A 2ZEBA 5DSFA 4BAKB 3UNRA 2QXHA 2OP9A 1XUKA 2BDHA 5DG6A 2W3IA 2KCOA 1FZZA 5L2YH 1RTFB 1C1TA 5C5NA 1INCA 5JB9S 1NY22 2AEIH 3SQHE 2XRCA 4OS4A 1EZXC 1AZ8A 4U32A 1WBGB 2QF5A 3RXSA 1GDNA 1ELVA 3RXIA 3TNSA 1VZQH 3GCHB 2W3KA 2P93A 3STJA 2ZO3H 2A4OA 4ZCNA 2WV5A 2FI4E 2XOKD 3Q00A 1HJAC 2ANKH 2BXUH 3ZIAD 1FI8A 3PLKA 2WPMS 1GI6A 3SQEE 2IPHA 2Z94A 2KX4A 3RXPA 4NCYA 1HAXB 2PTNA 4FVBA 1DWEH 4XOJA 1BCUH 3QX5H 3E8LA 5DJ7A 4TPYA 2A2XH 3S7KB 2WHXA 2ZGCA 3TGKE 2JJ2D 4YZUA 4HGCA 1P09A 1SVPA 2A45B 1KSNA 1L4ZA 5LGOA 2WUCA 1P57B 2RDLA 1FXYA 5E8EH 1SR5C 3H5CB 2GTBA 3UWIA 5AFZH 4YT6H 4X8VH 5A0AE 1EP5A 5EW2H 1MTUA 4BOHA 1A0JA 1G3EA 1O2KA 1ZMJA 1BTUA 1O2HA 2V3OH 4MTBA 1GL1A 5HGGA 1P10A 3O8DA 3GY7A 3PMHB 1DS2E 1KLIH 4AOQA 2W6JD 2BVXH 3CS7A 4D8NA 4ISHH 1SB1H 2BQ7B 2L74A 5C67A 1BDAA 1D3QB 1KXCA 4RT1A 2GD4B 1Y5BT 4MDSA 1YPHC 1C5VA 2HLCA 1C4Y2 1X7AC 2M5TA 1JMOH 1OXGA 4UD9H 1H8ED 1P2IA 2R9PA 3GICB 1TBRH 1K0HA 1GWAA 3ZZ3A 4A5TS 2ZU1A 1OYQA 2BY5X 1GVZA 2KAIB 2HNTC 3SGBE 4GHTA 2PP6A 1AGJA 1GMDG 3P8NA 3RXGA 1C2IA 4NFEA 1GBHA 2BD4A 3S69A 5A8XA 2XW9A 1CGIE 2VIVA 1J9CH 4MPVA 4Z0KA 1HAVA 4K1SA 1K1OA 2IN2A 5GDSH 4A1TA 3ZVEA 2BD2A 5E0JA 3I29A 1Y3VA 1Z8GA 1QL7A 3Q3YA 3QUMP 1L0ZA 1ZJKA 3TK5A 3F3BA 1GBEA 1Q3XA 2VU8E 1FX0B 3A7ZA 3JZ2B 3MFJA 4NA7A 3GCTF 3TJUA 2A32A 3PRDA 4KP0A 1QQ4A 2P94A 4UE7H 2ZDNA 2IJD1 1TYNA 2F91A 1K1LA 4NIYA 5A8ZA 3QTVH 3K6ZA 1GHAG 1GHAF 2HPQH 2TRMA 3QZQA 2BX3A 2YMSB 2YOLA 4YOJA 4ZKRU 3A7TA 2J38A 3MNSA 5A2MH 5FPTA 4BAMB 1GI4A 1CU1A 3MU4A 4XBDA 1QB1A 2J4IA 3PROA 1G3DA 1KXEA 3OY6U 2C8YB 1GBBA 5C17A 1C1MA 2FP7B 3VG8A 1HJ9A 1HAYB 4X1QU 1CE5A 1O2NA 4ABBA 1K1JA 3SI3H 1XUFA 1EKBB 3N99A 1AE8H 1P05A 3FZDA 2PKAB 1MZAA 2OD3B 3ZVBA 2C90B 2ZDVH 4ISLA 1ELTA 1BQYA 1NTPA 1VCQA 2PWXA 4GLYA 3BN9A 3MU0A 5JPMH 3DD2H 1QHRB 3GCHC 3A82A 2QAAA 3OE7D 5B6LA 1ELBA 1FNIA 2VWNA 3T29A 2ODPA 1HJ8A 4A92A 1BTPA 1C5YB 3S7HB 4BXWA 1FLEE 2THFB 1O5FH 1ZGIA 2GZ8A 2FS8A 3UUZA 3S9AA 1GG6B 1P3CA 2JIZD 1LPGB 1A7SA 4Y8XA 1UMAH 4DJZB 2ANWA 1ZRKA 1ZSKA 3LU9B 4Y10E 1DANH 1NRNH 3S0NA 1C2FA 3C1KA 1AU8A 1VJ9U 1GDQA 3QN7A 2WPHS 1PPZA 1GBCA 2ZKSA 2EA3A 1UTQA 4P00A 1TRMA 1SBWA 3UQVA 1O2GH 1MD8A 1V2JT 1MQ5A 1LO6A 3FVFB 2KCYA 1N8OB 5DN6D 1P9SA 1HAGE 1BHXB 3SV7A 1TX7A 4ABHA 1O35A 3A87A 1LKBA 1GI5A 1EPTB 2VB0A 1ELDE 3F9HA 4ZUHA 1A5HA 2A4GA 1IQNA 3V7TA 1O39A 1NS3A 2BX4A 1PYTD 5FXLA 3A86A 1D3DB 1A0LA 1C4V2 1E1RD 1Y3UA 3NPSA 4Q63A 5AHGH 4SGBE 1W13U 2FXRA 2VVUA 3P6ZB 1JRSA 1CGHA 1QTFA 1BBRE 3GCOA 1PPFE 3LGUA 3UOUA 4ZAEA 5C0TA 1C9TA 5EODA 4B75A 1MCTA 1UK2A 4FUDA 2H2ZA 1ZSLA 2ASUB 3FZZA 4INHA 3TGJE 1G30B 1SOTA 2TPIZ 4X1RU 2RCEA 2NU4E 1T7CA 2FTLE 4DVAU 1A0HB 3SV9A 3SN8A 4AFZA 9LPRA 1D6WA 3RMNH 3KQEA 5LPEA 2C8WB 2I6SA 5A0CA 2GT8A 2XC5A 1K22H 5B6OA 4B76A 4CHAB 2ZTZA 1O3PB 4I8KA 2SGAA 4IC5A 2JETB 3FO8D 3MNXA 3HATH 1GBAA 2BOHB 1ELCA 1P3EA 2R3UA 1YPEH 3NXPA 4WH6A 1ESAA 3RXMA 3BTKE 3OEED 1FQ3A 1SGYE 1DDJA 1MTSA 3DSOA 4ISNA 3LGTA 4JK6A 1GMCF 3U1JB 4J2YB 1BJUA 1LHGH 1MKWK 2R2WU 4FUBA 1C5OH 1TALA 2PGQB 1O32A 2XC0A 2ZIQH 4CRAA 1XKAC 2YMSC 2FODA 5BRRE 1O5EH 1T8NA 2FEQH 1D4PB 1SSXA 1HNEE 3VEQB 2OTVA 4BNRA 5HIYA 1D3PB 2ZGHA 2GCTB 2ZNKH 3ZZAA 1O2RA 2WPLS 4U30A 1O3HA 4X6MA 4OS6A 3PTBA 1Z71A 1SC8U 5FPYA 1PQ8A 2VWMA 1QR3E 2FWWA 5TCCA 2GVFA 1J15A 4IC6A 2BD9A 1QBNA 1EZQA 2F83A 4JZFH 1FDPA 1FY5A 2TGPZ 2ALVA 2G8TA 3F68H 1KYNA 2BVSH 2XYAA 1GJAB 2STBE 3MHWU 3T27A 3PM3A 3K6YA 2V35A 3ATLA 5F8XA 2VIOA 4CRDA 4IMZA 2NU1E 2BVRH 2HWLB 3W94A 3MNBA 6CHAB 1O2WA 1GG6C 1ANBA 1O3GA 1DITH 1O5GH 1KXBA 2EC9H 1UK4A 4Y76A 1K2I1 1W0YH 3A81A 2BD3A 2J92A 2FOGA 1BMLA 4Z6AH 2QV1A 4CRFA 1YPHE 1RIWB 3U98H 1NRPH 4NG9H 2F9BH 2QXJA 3SV6A 2HRVA 4LZ1H 1O3KA 1W7XH 4TY7A 1TNLA 2VGCB 1W10U 1DXWA 3BG4C 5L30H 1N8OC 2AGIX 3LJOA 3U28C 1RGQA 1SLUB 1OWHA 1Z6JH 4WJG2 3E6PH 1TNHA 2ZGBH 4ISIH 3RXQA 1GI2A 3GISB 2G51A 3UB0A 1EPTC 4AGKA 2BMGB 3P70B 1D3TB 3SHCH 3TGIE 1AWHB 2OBOA 4XBBA 3U9AH 1AVGH 2XNDD 3GCNA 1DE7H 1ZSJA 3ZV8A 3A7XA 1ETTH 3A80A 3L6PA 2ZU5A 1EZSC 1SHYA 1C1QA 2BB4A 2LNCA 3OAAD 1DM4B 3SUFA 3Q3XA 4X8SH 1ZMNA 2GMTC 2OLGA 3U8RH 2TGTA 2VVCA 3UAIC 2ULLA 2FOAA 3ZZ6A 2Z3EA 1QBOA 3PYHA 2VWOA 8GCHF 1WXRA 1B7XB 5EU8A 2QF4A 3AAUA 5T6GA 2SNVA 5GCHG 1TGSZ 2H5DA 8ESTE 1TA6A 3PB1E 5EXNA 3KQDA 4NGAH 1PQAA 2FIRH 3SJKA 1QGFA 5LPRA 5HM9A 2ZFTA 3DT0H 4CHAC 1SHHB 5CE1A 1BRBE 3M5LA 1C4U2 4CR9A 2JH6D 2JETC 4F49A 4LXBH 1P11E 2J98A 1SQTA 4OM9A 2OC1A 5C94A 3ZV9A 4AX9H 1O2XA 3SU1A 1GCDA 1T4VH 1RS0A 2Y7XA 1LKAA 3ZZ9A 1O2JA 3DCLA 4DCDA 1KDQB 2NU2E 2PUXB 2ZGJA 3RC4A 3RXFA 3RXJA 1SGQE 1FY8E 1O2QA 3HK3B 1AFEH 4MPUA 5T1VA 1GCTB 3DFLA 4D76A 4HI3A 3VFEA 1EASA 2GDDA 2Z3CA 1O3IA 1C5LH 1E36B 1S0RA 1G37A 1WOFA 3F0OA 1GHYH 7GCHF 2HALA 1FPHH 3PLPA 1GJ7B 3OEHD 1C2KA 1EQ9A 3MO9A 3ZZDA 1V2VT 2GCTC 3A85A 3PWCA 1MMJN 1U6QA 1UCYE 1F5KU 1VCWA 1BMAA 2W6ID 3F2GA 4H42U 4O9VA 1HAOH 1EAIA 1TA2A 2DE8A 1ANDA 4XD7D 3V0XA 3EYDA 1GHBF 2H9HA 1GHXH 2H1UA 1AKSA 4KTCA 1LVBA 2A7CA 4UDWH 3LC5A 1JRTA 1BZXE 1EFRD 2ANYA 2QYIA 1ID5H 1BBRK 4INKA 1FN6A 4YO9A 2DE9A 2HVXA 2W7SA 3KCGH 2ZQ1A 2NWNA 3BTQE 1BA8B 4PROA 6CHAC 5K0HA 1MBQA 1E1QD 1TBZH 1BT7A 1YBWA 2KR7A 2PTCE 1G3BA 3LH3A 2KFWA 2G5VA 3LJJA 3Q77A 4I86A 3GDUA 2Y5HA 3CNRA 1GI7B 3A8BA 2FX4A 2P8OB 4AFQA 1TONA 2EQNA 1P0SH 1GGDB 4Q7XA 1P2JA 1RIWC 1C2EA 1C5WB 1T4UH 4DIHH 1O5BB 1FJSA 1H9HE 3SNEA 1EOLA 4WWYA 2ANMH 2FZZA 2VGCC 3K9XB 4WF8A 1C5UA 1SGPE 4M7GA 4ZHLU 1MZDA 3Q76A 4MPWA 2P59A 1EJAA 2JJ1D 2QY0B 1YLNA 1SGEE 2AMQA 3IITA 3ZYEA 4AFSA 1XUHA 3FP8E 1P2KA 2OK5A 2Z9LA 3BTME 4MNWA 4ZMAH 5T6FA 3TITA 1XXDA 7KMEH 1WQVH 1OWEA 2A5IA 5EOKA 2A2QH 2SGDE 3WWBA 4FUHA 1UJ1A 1S84A 1SGTA 3RMMH 1K1MA 1OPHB 1TOMH 1EATA 1CBWB 3R0FA 2TIOA 1SGCA 4OS7A 3EA7A 3EQ0H 3RXDA 4LZ4B 1AVXA 4ABIA 2J2UA 2P3TB 4DY7B 1DICA 1AFQB 1AO5A 1MQ6A 2ZDLA 3F2FA 3SUGA 3ZZ4A 2ZZUH 4FUCA 2YNBA 1EX3A 1NT1A 4Y7AA 3A7WA 2BYAX 1MABB 3BEUA 3M36A 2O8UA 3TH4H 4GAWA 2ZPRA 1J17T 1MU8B 1TQ0B 1NFWA 2FI5E 2QN5T 1Q2WA 1C1WH 1HAVB 1MUEB 3IWMA 3LOXA 5CMXH 5GJ4B 4NSVA 3NUMA 3VGCB 3K65B 1ORFA 5HKKD 1V2OT 1C5TA 2LELA 1ZHPA 4X2VA 3BTFE 3L3TA 1B5GH 1BOQA 4ABJA 1O5CB 1OWIA 2CF9H 1HPGA 2QE7D 3RLWH 3D62A 4WMEA 1GCTC 2JH0D 2AH4X 3UWJH 1S5SA 1G36A 2A1DB 1O30A 3RXCA 1THPB 2RA0A 1Z6EA 2ZHFH 1C1PA 5A8YA 1RTKA 3NWUA 1HV7A 3UPEA 1NN6A 4X1NU 2XBVA 1O2YA 1GBFA 3BIVH 3MH5A 3DSGA 3ODDA 1IQEA 2FPZA 1HFDA 2BY9X 2FOBA 3PMBB 5T6DA 1C2LA 1V2ST 4KTSA 1IQLA 1HYLA 3OTPA 1C5MD 2AERH 2JH5D 4NA8A 1C5SA 3EGKH 1JBUH 2FOCA 1P03A 1Y3WA 2AFQB 4IMQA 4YTAA 4A7IB 2PUQH 4DT7B 2VNTA 1SKYE 1P9UA 4YLQH 5KEDA 3M3TA 1IQIA 5FAHA 5EGMA 7ESTE 1YLDA 5L2ZH 1O2UA 1F5RA 4UFFH 1MU6B 2BOKA 2AMDA 3SU4A 3TH3H 3UR6A 1E34B 3MNCA 1A61H 1EAUA 2P8OC 2ZHQH 3RXRA 3VB7A 1TRNA 5CDFE 1GGDC 1GVKB 2FYQA 1MTWA 2ZFQH 1V2MT 1GMDF 3LIWA 4H4FA 4A6LA 2BY8X 3ODFA 3SGAE 3BEIB 4K69A 1S6LA 1W14U 3TJNA 1PJPA 2BQWB 2L6OA 4Y71A 5GIBA 1IHSH 2CK3D 3A84A 5C5OA 3GY2A 4MVNA 1TMUH 2Y6TA 5LH8A 1TPOA 1O31A 2Q6DA 4NIVA 2ZG0H 1O36A 1P12E 1OSSA 4F4OC 2K8IA 5ESTE 5JBCS 4WMDA 4Y7BA 1W0ZU 1ZYOA 4Y6DA 1OP8A 4TSFD 1AHTH 2F4LA 3F9GA 2WINI 1YP9A 2CV3A 3AW0A 3M5NA 1GBDA 4BTTB 1ABJH 1C2MA 1Z1JA 1CBWC 2QXIA 4AB9A 1UCYK 1KMHB 1LHFH 3TNTA 1ZR0A 4IBLH 2Y80A 4TT3D 3F9FA 1ABIH 4TWWA 2LPRA 3T26A 3MO3A 1C2GA 2BDAA 3SJ9A 1A4WH 4LOYH 2F9NA 4F55A 1AFQC 1HRTH 4Y11E 3RM2H 2F3CE 5ESBA 2ZFSA 2V3HH 1AIXH 1GI0A 1TNKA 2BDIA 2WV9A 4ACBA 1UW7A 2FOHA 1GBIA 1TABE 4AB8A 2TGAA 1TFXA 4DW2U 5AFYH 3DSPA 1LMWB 2FMJA 4E05H 4OGXA 3M3VA 2UWLA 1ESBA 5HM2A 3A7YA 4R0IA 3VGCC 2CGAA 1YC0A 2M2AA 5IYTA 1TMTH 1MD7A 2ZCLP 1DWCH 1UTLM 5DP3A 1NC6A 3V13A 3OY5U 3SYJA 2V3MA 2XCFA 4IS5A 1N6XA 1BTZA 5ETXA 4B71A 6GCHG 6GCHF 5FBEA 1UVPA 2XXLA 4JMYA 5DGJA 2QA9E 2ZHEH 3BG4B 1C2JA 4CRGA 1LPZB 3GYLB 1TX6A 3N7EA 4JZIA 4B2BA 5FCKA 2P3UB 1DWDH 3W95A 4OS2A 5CHBA 5C0UA 1OX1A 3UOPA 1ACBE 1ELFA 1TX8A 2EI6A 1YCPK 1YPMH 1SGDE 2FO9A 1O2MA 3TH2H 1UHBA 1H8HD 1N1LA 3D65E 2AYWA 1HAIH 5KECA 4I7YH 5FL7D 4CRCA 1T8OA 4CR5A 4GUXA 4XRNA 1O3AA 1Y3YA 3H09A 4LK4A 1K9OE 1K21H 2GMTB 3NCLA 4FUJA 1DX5M 1YGCH 1EB1H 1DY8A 1DUEA 1ZPCA 1SG8B 1AUJA 2PW8H 2PHBA 2GT7A 2A0QB 3RP2A 1TWXB 2Z9JA 2ZCHP 1KXFA 1ETSH 2ZWLH 3BTWE 3VB5A 4AZ2B 2Q1JA 1W0KD 2Y5GA 4FUEA 3A89A 3T5FH 2B0FA 3M3SA 2C93B 1GI1A 2VJ1A 1LHEH 4ZKNU 2BHGA 2Z9KA 1CVWH 3TU7H 4FUGA 1EJNA 1O0DH 2ZF0H 3RXTA 1B0EA 2FYRA 2RG3A 5C1XA 1HAZB 3SV2H 2G4UA 4ESTE 1QB9A 5FBIA 1QNJA 2P95A 2A5KA 4IW4E 5ABWA 2HPPH 4HG6A 2Z9IA 1ZTJA 1DSUA 1NU7B 5DP7A 1P2MA 1CHOG 3M5MA 1OHHD 1GPZA 4XDEA 2FS9A 2HNTF 2QGRA 1NU9A 1NBMD 5F53A 1IQFA 2RA3A 3UR9A 4Q80A 1QZ8A 1O2VA 3SU2A 1GBJA 1HDTH 4O3UA 3U69H 4Q4LA 2JKHA 5IK2D 4F48B 1LHCH 2D26C 3MU1A 1TGNA 1XUGA 2GDEH 3MO6A 2F9OA 3VB3A 1ZJDA 4JCNA 1LDTT 3LKWA 3EE7A 1IQHA 5JBAS 1MKWH 2PSYA 1ZMLA 2H6MA 2ZECA 1FY1A 2FOMB 3BV9B 3K2UA 4B6FA 1O38A 4GCHG 3RXAA 1FY4A 1TNGA 2SNWA 2HVYB 1WAYB 3E0NB 1QL9A 3EA9A 1VITG 2ALPA 4AG2A 3KYGA 2AMPA 2WZQA 1JIMA 2ODYB 3D23A 1QJ7B 3P8OA 4FXGH 3UFAA 3LGWA 1T31A 1HXFH 2BDBA 2FOFA 3A8AA 1WDIA 3KN2A 2Y82A 1A5GH 1D9IA 1MH0A 2J98B 3QZRA 1SQOA 3KQBA 5DO4H 9ESTA 3LPRA 3MU5A 1PPGE 1YPGH 2CHAB 1S85A 1RXPA 2G00A 3E16B 4CRBA 2PFEA 1O2TA 2ILNA 2RDEA 4I8GA 1KTSB 1SI5H 1AUTC 1GBTA 3VXEH 3URCA 1VJAU 4B2AA 1H8IH 4I33A 2EI7A 2FLRH 2D8WA 5EQQA 1XUIA 2GJGA 3RU4E 1LVYA 2V6NA 2Z9GA 3WY8A 1W7GH 2YNAA 4YOIA 3HK6B 2ZC9H 3FAOA 4XFQA 2J5UA 4THNH 2BLWA 4BAQB 1P04A 2C8XB 1OP2A 3PMJA 4WXIA 4U01A 2VIDA 3O8RA 1EXFA 1AKSB 5JBTA 3ATWA 4ISOA 1SLWB 1O34A 4E06H 4YLUA 2H5CA 1DPOA 2FM2A 1L2EA 1OWKA 4FU8A 5HYOA 2KCAA 2BZ6H 1NFYA 1O3NA 2O8TA 2Q6GA 4NFFA 5JBBS 3RUOA 4Y0YE 1WQSA 4K2YA 1QJ1B 3GY8A 2R3YA 4NZQA 2BD7A 1CT0E 2ZFRH 3U8OH 1TGCA 1H1BA 4E7NA 1ANEA 1BITA 3GYMA 3P8GA 5K7RA 4R8TB 3RXUA 1BUIA 1O3CA 1ELAA 5KGOA 3I77A 1GL0E 4JZ1A 2K1QA 3HKJB 4D7GA 1FAXA 2OC7A 3T62A 4FUIA 5GCHF 3MU8A 1CSOE 2F9PA 2OCVB 4NWLA 1AN1E 1A5IA 4NA9H 3SNCA 3M5OA 1TGTA 1WV7H 4I8HA 3T28A 5DP6A 1EOJA 1NM6A 4XE4A 1ZGVA 1P02A 2XBWA 1UTMA 3ITIA 1ARBA 2OC0A 3PV5A 2UWOA 1SL3A 3RM0H 5EJZA 1O2PA 1ZPBA 2GP9B 3KNXA 1UTJA 4DT4A 1TIOA 4Y0ZE 1ZHRA 2WPDD 1GMHG 5GXPA 1HBTH 2PGBB 3UREA 3V12A 1Y5AT 3GY6A 3WWFA 1C1UH 3O8BA 5EW1H 4ASUD 4BXSA 4ABDA 1F92A 3ZYDA 2ZTYA 3BTTE 1O3FA 4RKJB 1T8MA 1AWFH 1W2KH 3GY4A 4JYTA 4ZROA 1QB6A 3MYWA 2O8LA 1CA8B 3UTUH 2O8MA 1SGRE 1HUTH 2WYJA 4ABFA 1J8AA 2ZTXA 3SU5A 4MLFB 5T3HA 2CMYA 2ZPSA 2YMSD 2ZCKP 1QURH 2BXTH 3STIA 3F6UH 2ODQA 3N7OA 1ZOMA 3LC3A 1V2PT 4YT7H 2AGGX 1ZTLA 2C8ZB 1BRCE 3ENSB 3TLOA 4DURA 2ZDKA 4CREA 1EAXA 1E38B 1EUFA 4X0WU 2ZU4A 2FESH 4O97A 1B0FA 4K1TA 1FUJA
chains in the Genus database with same CATH topology
5FX6A 5JB8S 4KKDA 4GVUA 4AG1A 4JK5A 3TJVA 5I25A 5A0BA 1QJ6B 1AVWA 4IN1A 5E2PA 5DK1A 4A1VA 1V2KT 2Y7ZA 1MTNB 1RJXB 1TMBH 3RXEA 2PLXA 1ZTKA 5L6NH 3GDVA 5FHTA 5F6MA 1C1RA 4OGYA 3RMLH 5C3NA 4JZDH 3LGYA 3BTHE 5AVDA 1BBRH 3QGJA 4FVDA 2GGVB 1HIAA 2WPIS 4BANB 4MNVA 4X1SU 1OYTH 3SOSA 2ZA5A 3LONA 2CHAC 1HAHH 2J34A 1BRAA 2ESTE 1NROH 2R2MB 1O3MA 4ABAA 1HLTH 1TAWA 4BAOB 3MH6A 1MKXK 1S81A 3PLBA 2VIWA 3P8FA 1P2OA 1DT2A 4KGAA 2B7DH 4AFUA 3ZZ5A 1NESE 2O9QA 3ZVGA 1EAWA 2D1JA 4HFPB 1BHXF 1MKXH 1YM0A 1QRXA 2CF8H 5EXMA 1A3BH 1GBLA 1O2LA 3E3TA 1KXDA 4MNYA 2GKVE 5GPIB 1AZZA 2CXVA 2IJOB 1V2WT 1CO7E 1G3CA 2W7UA 1WTGH 3PMAB 4UFGH 3EA8A 1TLDA 4E7RG 1GJ6A 2QC2A 1AE5A 4DG4A 1S6HA 3ATIA 5LPFA 1TB6H 1OS8A 5DP8A 1TPPA 4SGAE 1JIRA 3B23B 3EDXB 2R0KA 4MQAA 4OS1A 2BQ6B 4UEHH 1BMNH 1EJMA 2ZHDA 5FPSA 2QIQA 1J14A 1KIGH 2QCYA 2OC8A 2P16A 1NFXA 1O3EA 1W11U 3F9EA 2OINA 3DFJA 3SJIA 1L1NA 4UFDH 5C1YA 1Q31A 1A46H 2ZFPH 2WPKS 2GV7A 4B73A 1V3XA 4NIXA 1LHDH 2PKSB 1S6FA 1DLKB 4D9RA 1ZLRA 2OQUA 3MOCA 3ZVAA 3VPKA 1V2UT 1KLJH 1QBVH 2SGQE 1P2NA 2AIQA 2ZU3A 3TPIZ 1M9UA 2VINA 2UWPA 2SGFE 2Z7FE 2STAE 1UVUH 4DGJA 1XKBC 2Q6FA 3NKKA 3PWBA 2XBYA 4X8TH 1O2OA 1QL8A 1HCGA 3ZVCA 1ESTA 3TJOA 1V2LT 1L1JA 1C5PA 1GHZA 1PYTC 1AD8H 1VCPA 1VGCB 1CT4E 3IG6B 1RFNA 1MTNC 3M37A 1SLXB 1WSSH 3SUEA 1FIWA 3BIUH 2D2DA 3E90B 4X6OA 4WH8A 8KME2 1F5LA 2BZAA 1UTKA 3UQOA 4ABGA 1O5DH 3SZNA 1FMGA 2ZDMA 3GOVB 1IQJA 1KLTA 1TBQH 4H6SB 1G32B 1SMFE 1BMMH 3AAVA 3F1SB 3SGQE 4RSPA 1T32A 4IGDA 1E35B 3ZVFA 1W8BH 3U1IB 3TK6A 2ZU2A 3TIUA 4TYDA 3SNAA 4AORA 1CA0B 1C1SA 3HKIB 1C1VH 3EAJA 4I8LA 4OS5A 1MTVA 1F0RA 2A31A 1O2IA 2H9EH 4ZXYH 3VXFH 1MCVA 4FU9A 1C2DA 4MG3A 3RXHA 1VITH 4CH8B 1PPEE 3M61U 2QF0A 1YF4A 3SV8A 2EEKA 3ZZ8A 4FUFA 5C1UA 4KTUA 1UHBB 2BLVA 3I78A 2ZDAH 3KL6A 4QT8C 1YLCA 1XM1A 1RD3B 5BPEA 3ZVDA 3RXVA 3CP7A 1TOCB 1GJBB 1BTWA 1A1RA 1C5RA 3GCTG 3BG8A 1V2RT 5TCAA 3P95A 1C5NH 8LPRA 1RRKA 3VB4A 3HPTB 4XSKU 3SORA 1CT2E 1H8DH 3V3MA 3H7OA 4GPGA 1UVTH 1UVOA 3SJOA 1NRQH 1V6DA 1F0TA 3E91A 1GI3A 3FP6E 4ZXXH 1UCYH 1H4WA 2XCNA 1GJ4H 3SO3A 1LVMA 2ZI2H 1V2TT 2VVVA 3FP7E 3B9FH 1GHVH 1F0SA 1FAKH 3QLPH 5HMAA 3AVZA 2C4FH 1XX9A 3Q3KA 2NU0E 5E2OA 1W12U 3GDSA 1KXAA 4TWYA 1OWDA 1UK3A 1P01A 1WYKA 2VH0A 2VIQA 3MMGA 4UONA 5E0GA 1S83A 3LGIA 4BTIB 1Y8TA 2G52A 1K1NA 3LT3A 1Z8IB 4WVPE 1JXPA 2PKSC 2Y81A 4B74A 1UTOA 2BM2A 3NK8A 3MH4A 5EQRA 2OXSA 2I6QA 1EP6A 4O3TA 3SHAH 4YM9A 3M7TA 1QRWA 1HB0B 1L4DA 5FCRA 1SGFG 1EB2A 1LPKB 3ATMA 1IOEA 2KAIA 5TJXA 4B1TA 1GI9B 1QIXB 2J94A 2XTTB 5F8TA 1DFPA 2SGPE 2C3SA 5H4IB 3EE0B 4X8UH 1WU1A 2TBSA 3E0PB 4ABEA 1LVOA 4AGJA 5PTPA 2W26A 5EXLA 1DOJA 1YCPH 3MWIU 1VGCC 2J95A 1UTNA 5EG4A 1WTHD 1DLEA 1HXEH 1PPCE 1Z7KA 5IDKA 1YCPM 3A83A 1SFQB 3ATKA 1PFXC 2ZFFH 4FU7A 2SGEE 1AQ7A 3BTDE 2O8WA 3S9BA 1D6RA 1YPLH 1QA7A 1GHWH 1K1PA 3PV4A 1E0FD 3MH7A 4KELA 1O5AB 1CQQA 1O3OA 3RXBA 3BSQA 1AB9B 3SU3A 3OU0A 4K8BA 1YKTA 3BTGE 3MI4A 3BEFB 3BTEE 2QF3A 1GI8B 1CA0C 3GY5A 1TPAE 1IQGA 2PKAA 3RU4D 1FV9A 1YPKH 4Y8YA 3SBKA 3PO1B 3RXLA 4X1PU 4ASHA 2GCHG 2VIPA 3O8CA 1PPHE 2NU3E 1IQKA 2GCHF 2B5TB 1K28D 3CENA 1CHOF 4D7FA 1GJ8B 4D9QA 5C2ZA 1BTYA 1SLVB 1O3JA 5A09A 1H9IE 2G5NA 4JZEH 3LDXH 1F0UA 3A8DA 3TVJB 4Q2KA 1A3EH 2AIPA 2FDAA 3GY3A 2FI3E 1P06A 1SGIB 2R0LA 1ETRH 1FONA 2OBQA 3PTNA 2A7HA 5CHAB 3RXKA 1QY6A 1Y59T 1O3DA 4K8YA 1DSTA 1NRRH 1GBKA 1GBMA 4Q7YA 1E37B 1K1IA 4GHQA 6LPRA 1GMCG 4JYVH 4TPIZ 2A5AA 1PQ7A 2CJIA 3VB6A 1NFUA 5HXFA 1XXFA 4CBOA 1JOUB 5DP4A 1WCZA 1C1NA 3HGNA 3KIDU 4GCHF 2A4QA 2ZP0H 1GJDB 1DXPA 3UNSA 4X2XA 2J9NA 3C27B 1GDUA 3SNDA 4X6NA 3HGPA 1Z8JB 3SJ8A 1GVLA 1VITF 1EPTA 2FOEA 1O37A 1V2QT 1BIOA 1OOKB 3SUDA 1BTXA 2GV6A 1P2QA 1F2SE 5J4SA 1C5XB 4NWKA 1G2LA 1TQ7B 2BY6X 4B2CA 1N6YA 3QWCH 3RMOH 4BTUB 1HGTH 3KGPA 2B8OH 2BDGA 3G01A 4ZKOU 2A4RA 3QDZB 1C5ZB 3SU0A 1ZZZA 2GZ9A 2PR3A 1QRZA 1LQEA 1Z8RA 5F03A 3FFGA 3H7TA 4U2WA 3P92A 3ZZBA 3RU4T 6ESTA 2PV9B 1ZHMA 4X2YA 3ELAH 4I31A 4INLA 4MPXA 1TE0A 2BDCA 1NO9H 1FIZA 1MBMA 1IQMA 2XNIA 1FN8A 3SI4H 2PSXA 2GZ7A 2CN0H 4O03A 1UTPA 2BY7X 1J16A 3QGNB 1TRYA 1SGNE 5G4BA 3R3GB 4CH2B 1JWTA 5EPNA 1NZQH 2WUBA 2ZGXH 5JDUB 2G55A 1TGBA 4GSOA 4RKOB 1ELEE 1TNIA 4IN2A 1FPCH 1GJ9B 2ZHWH 1QQUA 2WV4A 1XUJA 3SNBA 1FY3A 3SU6A 2BLQA 4WMFA 2HNTE 1S0QA 2V0BA 4XBCA 2IOTA 4VGCB 3E1XB 3OTJE 4YESB 4CBNA 2BTCE 1SFIA 1YPJH 3TK9A 1XMNB 5SGAE 2FTMA 1C2HA 1C1OA 1SOZA 1ARCA 1HIAB 2Y5FA 2AS9A 3D49H 3P17H 1LTOA 1O33A 3LGVA 5JYIA 4Y79A 1BJVA 2BDYA 1AB9C 1THSH 3FANA 1T8LA 5C20A 1LCYA 4ZH8A 2QXGA 4X2WA 1L1GA 1GJ5H 3BF6H 2WPJS 4UFEH 1O3BA 2G81E 8GCHG 1SPJA 3DHKH 3PO1C 2FX6A 1ZPZA 1IAUA 4WXVA 1C5QA 2ZPQA 3JZ1B 1AMHA 1TNJA 5AF9H 2XWBI 1GMHF 4AN7A 3SW2B 4WY3A 3NZIA 3DA9B 3OSYA 4HTCH 4JYUH 1G2MA 3A7VA 2A7JA 1Y5UT 4ZHMU 1HJAB 1DVAH 1TPSA 2H9TH 5CHAC 2UUKB 3UNQA 1O2ZA 1CHGA 2BLOA 3DUXH 3KEEA 3QK1A 4RN6A 1VR1H 3LH1A 3ZZCA 1O2SA 1AY6H 1YYY1 2F9VA 1MAXA 1SQAA 1Z1IA 1O3LA 2W5EA 1UVSH 4I32A 5EPYA 1W3CA 1THRH 1S82A 3U8TH 4X6PA 2B9LA 1QFKH 7GCHG 3RC6A 3M7UA 3UY9A 3ZZ7A 3M7QA 1A2CH 3URDA 3KQCA 1ZRBA 1DUAA 2VH6A 4AYVB 1WUNH 3RLYH 4K60A 3A8CA 3OX7U 1EZUC 1GHBG 1P8VC 2EI8A 5J4QA 1OKXA 3CS0A 1Y3XA 1OWJA 3UIRA 3OYPA 1RTLA 1ELGA 1LQDB 2DUCA 4A1XA 2HOBA 4NZLA 2OUAA 3AASA 4BAHB 1PPBH 1DY9A 3RC5A 4K1EA 5DPAA 1QCPA 5GWZA 4NSYA 5I46H 3KF2A 1QA0A 2XBXA 5DP5A 7LPRA 5DP9A 2XWAA 1CGJE 3A88A 1AI8H 2AGEX 4TY6A 1C9PA 5E0HA 3MTYA 4K3JA 1XVMA 4I8JA 5F8ZA 4HZHA 2UUFB 1ANCA 4DIIH 1OP0A 4Y8ZA 4J1YA 4DOQA 5FX5A 3AW1A 3S9CA 2F9UA 2HGTH 3KHVA 4NIWA 5EQSA 1HAPH 2XC4A 1PQ5A 2WYGA 2VWLA 4Q7ZA 4K5ZA 1KY9A 2TGDA 3QO6A 2FLBH 1H9LB 1NRSH 1F7ZA 1G9IE 3T25A 1MAYA 4ZHAA 1KDQA 1BTHH 1UO6A 3ESTA 1BB0B 1IHTH 4YOGA 3RXOA 4MNXA 2P3FH 1KTTB 4ZKSU 5DKMA 1NPMA 2SFAA 2GX4A 1SGFA 1XVOA 3L33A 4VGCC 1BRUP 2UUJB 2Z6BD 1GJCB 2Z3DA 1DWBH 4H6TA 2ZQ2A 2BD8A 4AYYB 3RDZA 3B8JA 2OQ5A 3QTOH 1V2NT 3T2NA 2UUYA 2BD5A 2G4TA 3M35A 2ZEBA 4BAKB 3UNRA 2QXHA 2OP9A 1XUKA 2BDHA 5DG6A 2W3IA 1FZZA 5L2YH 1RTFB 1C1TA 5C5NA 1INCA 5JB9S 1NY22 2AEIH 3SQHE 2XRCA 4OS4A 1EZXC 1AZ8A 4U32A 1WBGB 3RXSA 1GDNA 1ELVA 3RXIA 3TNSA 1VZQH 3GCHB 2W3KA 2P93A 3STJA 2ZO3H 2A4OA 2WV5A 2FI4E 3Q00A 1HJAC 2ANKH 2BXUH 1FI8A 3PLKA 2WPMS 1GI6A 3SQEE 2IPHA 2Z94A 3RXPA 4NCYA 1HAXB 2PTNA 4FVBA 1DWEH 4XOJA 1BCUH 3QX5H 3E8LA 5DJ7A 4TPYA 2A2XH 3S7KB 2ZGCA 3TGKE 4YZUA 4HGCA 1P09A 1SVPA 2A45B 1KSNA 1L4ZA 5LGOA 2WUCA 1P57B 2RDLA 1FXYA 5E8EH 1SR5C 3H5CB 2GTBA 3UWIA 5AFZH 4YT6H 4X8VH 5A0AE 1EP5A 5EW2H 1MTUA 4BOHA 1A0JA 1G3EA 1O2KA 1ZMJA 1BTUA 1O2HA 2V3OH 4MTBA 1GL1A 5HGGA 1P10A 3O8DA 3GY7A 3PMHB 1DS2E 1KLIH 4AOQA 2BVXH 3CS7A 4D8NA 4ISHH 1SB1H 2BQ7B 5C67A 1BDAA 1D3QB 1KXCA 2GD4B 1Y5BT 4MDSA 1YPHC 1C5VA 2HLCA 1C4Y2 1X7AC 2M5TA 1JMOH 1OXGA 4UD9H 1P2IA 2R9PA 3GICB 1TBRH 1GWAA 3ZZ3A 4A5TS 2ZU1A 1OYQA 2BY5X 1GVZA 2KAIB 2HNTC 3SGBE 4GHTA 3RXGA 1AGJA 1GMDG 3P8NA 1C2IA 4NFEA 1GBHA 2BD4A 3S69A 5A8XA 2XW9A 1CGIE 2VIVA 1J9CH 4MPVA 4Z0KA 1HAVA 4K1SA 1K1OA 2IN2A 5GDSH 4A1TA 3ZVEA 2BD2A 5E0JA 3I29A 1Y3VA 1Z8GA 1QL7A 3Q3YA 3QUMP 1L0ZA 1ZJKA 3TK5A 1GBEA 1Q3XA 2VU8E 3JZ2B 3A7ZA 3MFJA 4NA7A 3GCTF 3TJUA 2A32A 4KP0A 1QQ4A 2P94A 4UE7H 2ZDNA 1TYNA 2F91A 1K1LA 4NIYA 5A8ZA 3QTVH 3K6ZA 1GHAG 1GHAF 2HPQH 2TRMA 3QZQA 2BX3A 2YOLA 4YOJA 4ZKRU 3A7TA 2J38A 3MNSA 5A2MH 5FPTA 4BAMB 1GI4A 1CU1A 3MU4A 4XBDA 1QB1A 2J4IA 3PROA 1G3DA 1KXEA 3OY6U 2C8YB 1GBBA 1C1MA 2FP7B 1HJ9A 1HAYB 4X1QU 1CE5A 1O2NA 4ABBA 1K1JA 3SI3H 1XUFA 1EKBB 1AE8H 1P05A 3FZDA 2PKAB 1MZAA 2OD3B 3ZVBA 2C90B 2ZDVH 4ISLA 1ELTA 1BQYA 1NTPA 1VCQA 2PWXA 4GLYA 3BN9A 3MU0A 5JPMH 3DD2H 1QHRB 3GCHC 3A82A 2QAAA 1ELBA 1FNIA 2VWNA 3T29A 2ODPA 1HJ8A 4A92A 1BTPA 1C5YB 3S7HB 4BXWA 1FLEE 2THFB 1O5FH 1ZGIA 2GZ8A 2FS8A 3UUZA 3S9AA 1GG6B 1P3CA 1LPGB 1A7SA 4Y8XA 1UMAH 4DJZB 2ANWA 1ZRKA 1ZSKA 3LU9B 4Y10E 1DANH 1NRNH 3S0NA 1C2FA 3C1KA 1AU8A 1VJ9U 1GDQA 3QN7A 2WPHS 1PPZA 1GBCA 2ZKSA 2EA3A 1UTQA 1TRMA 1SBWA 3UQVA 1O2GH 1MD8A 1V2JT 1MQ5A 1LO6A 3FVFB 1N8OB 1P9SA 1HAGE 1BHXB 3SV7A 1TX7A 4ABHA 1O35A 3A87A 1LKB