2ZCOA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2zcoA00
1ZW5A 3V1XA 3LLWA 5JV0F 3LZ9A 5E8KA 5ILIA 3OACB 5IKAA 1VG6A 2Z7IA 5HNAA 1RTRA 2RAHA 5ERMA 3SDRA 1YYUA 5IK9A 3LSNA 4KKMA 1VG2A 4EA2A 2ZCRA 3ZOUA 4KVIA 4PVXF 5IN8A 3DYGA 5B01A 2PS7A 3OABA 3AE0A 2AELA 4LFGA 3KRFA 5B0JA 4WK5A 3IPIA 3OACA 3BNXA 5DGSF 4LUUA 1YHKA 1UBVA 3ADZA 4EA1A 3V66A 3N46F 3P8LA 3EZ3A 4NFJF 3RMGA 2ZCSA 3M0GA 4NFIF 4XQRF 1WL3A 2I19A 4NFKF 4P0VA 3WSAA 4EA0A 5DHKA 2OPNA 3DYHA 3KRCB 1HXAA 3M00A 5IM1A 2Q9ZA 2AZJA 3WEHA 4LFVF 4LZCA 4RXAA 3WCFA 3EGTA 1YYSA 3Q2ZA 3N0GA 3WJOA 2E8VA 3TC1A 3WEFA 3N1WF 5DJRF 4LZ3A 5DW7A 4E1EA 2DH4A 4KFAA 4RXDA 3LGKA 1N21A 4LIXA 3S4JA 3WC9A 4XQSF 5JV1F 5JA0F 3TFNA 3N6KF 2VF6A 3VJ8A 4KQSA 4LLTA 4MC0A 3MAVA 2E90A 1VG4A 2E8TA 3WCEA 2ZY1A 3KRAB 4UMJA 3V1VA 3AQBB 3TFPA 3ICNA 5ILDA 2F89F 2FORA 4DEMF 1UBYA 2E8UA 3WJNA 3ACYA 5EAUA 2J5CA 2F92F 3WCIA 4JXNA 3WCAA 4FP4A 3UCAA 4KQ5A 3P5PA 4JZBA 4NG6A 2Z4WA 4LTZA 3Q1OA 3KRAA 2AZKA 3QKCA 2Q80A 2ONHA 2F8CF 1YYTA 3WEIA 3CKEA 4QXSF 3DYFA 4F6VA 1HXGA 3WCDA 2Z4XA 5HN8A 4GP2A 5ILKA 3N3LF 3P41A 3SDVA 3B7LA 2Z4VA 3LK5A 3EFQA 3LOMA 3P5RA 1N1ZA 2E92A 4P0XA 4KPDA 2Z4ZA 3M02A 4DWGA 4F6XA 1WY0A 4QPFA 5B0MA 5H9DA 1WL0A 3LVSA 5ILJA 4ZQ8A 5A0KA 4FJQA 4RXCA 4OGUA 4H5DF 2AZLA 2E91A 1RQIA 4KWDA 3WCLA 1YYRA 3AQCB 1N22A 3PYBA 2Z50A 5B0IA 2F9KF 1HX9A 3QQVA 1UBWA 2PS8A 3LG5A 3LEEA 1YQ7A 4LOBA 4RNQA 3PKOA 5IK6A 3KRPA 3N1VF 5B02A 3LDWA 1HM4A 4LPGF 3TS7A 3LMDA 2QISA 5JUZF 2PS6A 2J1PA 4DHDA 3ACWA 3N0FA 2H8OA 5B03A 5E8LA 4GA3A 4OMGA 5EASA 5ILYA 5B0LA 5KSXF 1VG7A 1PS1A 5B00A 4DI5A 2FTZA 5IMPA 4KK2A 1DI1A 4LA6A 5CG5A 5IVGA 3M01A 4DZWA 3VJ9A 4KQUA 4LTVA 3VJEA 3NPRA 3S9VA 5HN7A 1DGPA 4P0WA 2EWGA 3M9UA 1WL1A 3RBMA 1RQJA 3RYWA 2F8ZF 2O1OA 3N3DA 3Q2QA 2F94F 3IBAA 3WEGA 4RXEA 4H5CF 2ZCQA 3N45F 5ERNA 3RYEA 5DJPF 2PS5A 5AYPA 2Q58A 1JFGA 2E95A 2Q9YA 3ICMA 3WCJA 3P8RA 1YV5A 3VJDA 3VJAA 5B0KA 5DZ2A 1V4KA 4JZXA 1N1BA 4MC3A 5ILHA 5A0JA 5CG6A 2E8XA 3WCHA 2AEKA 4XQTF 3SDTA 3APZA 4NUAA 4LLSA 3LGZB 4PVYF 3VJBA 3WCCA 4LZ0A 3WCGA 3ZMCA 4E9UA 1WL2A 3CC9A 5ILZA 4F62A 5ER8A 3Q30A 5EROA 2E93A 3N5HF 3KRPB 1FPSA 2Z7HA 5I1UA 2Z78A 4H5EF 2Z4YA 5IMIA 5HN9A 4JXYA 1HM7A 4LA5A 2E4OA 3WCMA 3ASXA 1V4IA 5IL8A 2OA6A 1N23A 3VJCA 1V4HA 1UBXA 2ONGA 5DHIA 1YHMA 4LFEA 3LJIA 1WMWA 1YYQA 4DXJA 3G4DA 3WEJA 3KROB 3NRIA 2ZEUA 3WEKA 4KUXA 4N1ZF 4JVJF 3WE9A 3SDUA 3ID0A 4KVYA 1N24A 3ICZA 3MZVA 1KIZA 4OKMA 3WJKA 4K10A 4E9ZA 2J1OA 3KBKA 3AQ0A 1YHLA 5E8HA 4NKFA 5DGMF 1WKZA 3N49F 3TFVA 2E94A 3BNYA 3WCBA 2ZEVA 3KROA 5AFXA 4NKEA 2P1CA 1KIYA 4RYPA 4JYXA 2E8WA 5EATA 2OPMA 5AELA 4DWBA 4HD1A 4N9UA 3PYAA 4MC8A 2F7MF 2OGDA 5IK0A 3G4FA 5IMNA 3WSBA 3NPKA 3ICKA 1V4JA 3KB9A 5DIQF 1V4EA 3KRCA 3NF2A 4L2XF 1N20A 1EZFA 3N5JF 3CP6A 1YJ4A 3W7FA 4OKZA 3SDQA 1VG3A 4KVDA 4KVWA 4LXWA 5DJVF 5DGNF 5IKHA 5JV2F 4Q23A 1JFAA 4OMHA 4GAXA 2PS4A 3OYRA 2Z52A 5A0IA 5AHUB 3SAEA 5C05A 3PDEA 3ACXA 4LPHF 4KPJA 3ZMBA 3ZCDA 3PH7A 1HXCA 5IL3A 3OABB 3ZL6A 4GP1A 2AETA 3KRFB 2ZCOA
chains in the Genus database with same CATH superfamily
1ZW5A 3V1XA 3LLWA 5JV0F 3LZ9A 5E8KA 5ILIA 3OACB 5IKAA 1VG6A 2Z7IA 5HNAA 1RTRA 2RAHA 5ERMA 3SDRA 1YYUA 5IK9A 3LSNA 4KKMA 1VG2A 4EA2A 2ZCRA 3ZOUA 4KVIA 4PVXF 5IN8A 3DYGA 5B01A 2PS7A 3OABA 3AE0A 2AELA 4LFGA 3KRFA 5B0JA 4WK5A 3IPIA 3OACA 3BNXA 5DGSF 4LUUA 1YHKA 1UBVA 3ADZA 4EA1A 3V66A 3N46F 3P8LA 3EZ3A 4NFJF 3RMGA 2ZCSA 3M0GA 4NFIF 4XQRF 1WL3A 2I19A 4NFKF 4P0VA 3WSAA 4EA0A 5DHKA 2OPNA 3DYHA 3KRCB 1HXAA 3M00A 5IM1A 2Q9ZA 2AZJA 3WEHA 4LFVF 4LZCA 4RXAA 3WCFA 3EGTA 1YYSA 3Q2ZA 3N0GA 3WJOA 2E8VA 3TC1A 3WEFA 3N1WF 5DJRF 4LZ3A 5DW7A 4E1EA 2DH4A 4KFAA 4RXDA 3LGKA 1N21A 4LIXA 3S4JA 3WC9A 4XQSF 5JV1F 5JA0F 3TFNA 3N6KF 2VF6A 3VJ8A 4KQSA 4LLTA 4MC0A 3MAVA 2E90A 1VG4A 2E8TA 3WCEA 2ZY1A 3KRAB 4UMJA 3V1VA 3AQBB 3TFPA 3ICNA 5ILDA 2F89F 2FORA 4DEMF 1UBYA 2E8UA 3WJNA 3ACYA 5EAUA 2J5CA 2F92F 3WCIA 4JXNA 3WCAA 4FP4A 3UCAA 4KQ5A 3P5PA 4JZBA 4NG6A 2Z4WA 4LTZA 3Q1OA 3KRAA 2AZKA 3QKCA 2Q80A 2ONHA 2F8CF 1YYTA 3WEIA 3CKEA 4QXSF 3DYFA 4F6VA 1HXGA 3WCDA 2Z4XA 5HN8A 4GP2A 5ILKA 3N3LF 3P41A 3SDVA 3B7LA 2Z4VA 3LK5A 3EFQA 3LOMA 3P5RA 1N1ZA 2E92A 4P0XA 4KPDA 2Z4ZA 3M02A 4DWGA 4F6XA 1WY0A 4QPFA 5B0MA 5H9DA 1WL0A 3LVSA 5ILJA 4ZQ8A 5A0KA 4FJQA 4RXCA 4OGUA 4H5DF 2AZLA 2E91A 1RQIA 4KWDA 3WCLA 1YYRA 3AQCB 1N22A 3PYBA 2Z50A 5B0IA 2F9KF 1HX9A 3QQVA 1UBWA 2PS8A 3LG5A 3LEEA 1YQ7A 4LOBA 4RNQA 3PKOA 5IK6A 3KRPA 3N1VF 5B02A 3LDWA 1HM4A 4LPGF 3TS7A 3LMDA 2QISA 5JUZF 2PS6A 2J1PA 4DHDA 3ACWA 3N0FA 2H8OA 5B03A 5E8LA 4GA3A 4OMGA 5EASA 5ILYA 5B0LA 5KSXF 1VG7A 1PS1A 5B00A 4DI5A 2FTZA 5IMPA 4KK2A 1DI1A 4LA6A 5CG5A 5IVGA 3M01A 4DZWA 3VJ9A 4KQUA 4LTVA 3VJEA 3NPRA 3S9VA 5HN7A 1DGPA 4P0WA 2EWGA 3M9UA 1WL1A 3RBMA 1RQJA 3RYWA 2F8ZF 2O1OA 3N3DA 3Q2QA 2F94F 3IBAA 3WEGA 4RXEA 4H5CF 2ZCQA 3N45F 5ERNA 3RYEA 5DJPF 2PS5A 5AYPA 2Q58A 1JFGA 2E95A 2Q9YA 3ICMA 3WCJA 3P8RA 1YV5A 3VJDA 3VJAA 5B0KA 5DZ2A 1V4KA 4JZXA 1N1BA 4MC3A 5ILHA 5A0JA 5CG6A 2E8XA 3WCHA 2AEKA 4XQTF 3SDTA 3APZA 4NUAA 4LLSA 3LGZB 4PVYF 3VJBA 3WCCA 4LZ0A 3WCGA 3ZMCA 4E9UA 1WL2A 3CC9A 5ILZA 4F62A 5ER8A 3Q30A 5EROA 2E93A 3N5HF 3KRPB 1FPSA 2Z7HA 5I1UA 2Z78A 4H5EF 2Z4YA 5IMIA 5HN9A 4JXYA 1HM7A 4LA5A 2E4OA 3WCMA 3ASXA 1V4IA 5IL8A 2OA6A 1N23A 3VJCA 1V4HA 1UBXA 2ONGA 5DHIA 1YHMA 4LFEA 3LJIA 1WMWA 1YYQA 4DXJA 3G4DA 3WEJA 3KROB 3NRIA 2ZEUA 3WEKA 4KUXA 4N1ZF 4JVJF 3WE9A 3SDUA 3ID0A 4KVYA 1N24A 3ICZA 3MZVA 1KIZA 4OKMA 3WJKA 4K10A 4E9ZA 2J1OA 3KBKA 3AQ0A 1YHLA 5E8HA 4NKFA 5DGMF 1WKZA 3N49F 3TFVA 2E94A 3BNYA 3WCBA 2ZEVA 3KROA 5AFXA 4NKEA 2P1CA 1KIYA 4RYPA 4JYXA 2E8WA 5EATA 2OPMA 5AELA 4DWBA 4HD1A 4N9UA 3PYAA 4MC8A 2F7MF 2OGDA 5IK0A 3G4FA 5IMNA 3WSBA 3NPKA 3ICKA 1V4JA 3KB9A 5DIQF 1V4EA 3KRCA 3NF2A 4L2XF 1N20A 1EZFA 3N5JF 3CP6A 1YJ4A 3W7FA 4OKZA 3SDQA 1VG3A 4KVDA 4KVWA 4LXWA 5DJVF 5DGNF 5IKHA 5JV2F 4Q23A 1JFAA 4OMHA 4GAXA 2PS4A 3OYRA 2Z52A 5A0IA 5AHUB 3SAEA 5C05A 3PDEA 3ACXA 4LPHF 4KPJA 3ZMBA 3ZCDA 3PH7A 1HXCA 5IL3A 3OABB 3ZL6A 4GP1A 2AETA 3KRFB 2ZCOA
chains in the Genus database with same CATH topology
1ZW5A 3V1XA 3LLWA 5JV0F 3LZ9A 5E8KA 5ILIA 3OACB 5IKAA 1VG6A 2Z7IA 5HNAA 1RTRA 2RAHA 5ERMA 3SDRA 1YYUA 5IK9A 3LSNA 4KKMA 1VG2A 4EA2A 2ZCRA 3ZOUA 4KVIA 4PVXF 5IN8A 3DYGA 5B01A 2PS7A 3OABA 3AE0A 2AELA 4LFGA 3KRFA 5B0JA 4WK5A 3IPIA 3OACA 3BNXA 5DGSF 4LUUA 1YHKA 1UBVA 3ADZA 4EA1A 3V66A 3N46F 3P8LA 3EZ3A 4NFJF 3RMGA 2ZCSA 3M0GA 4NFIF 4XQRF 1WL3A 2I19A 4NFKF 4P0VA 3WSAA 4EA0A 5DHKA 2OPNA 3DYHA 3KRCB 1HXAA 3M00A 5IM1A 2Q9ZA 2AZJA 3WEHA 4LFVF 4LZCA 4RXAA 3WCFA 3EGTA 1YYSA 3Q2ZA 3N0GA 3WJOA 2E8VA 3TC1A 3WEFA 3N1WF 5DJRF 4LZ3A 5DW7A 4E1EA 2DH4A 4KFAA 4RXDA 3LGKA 1N21A 4LIXA 3S4JA 3WC9A 4XQSF 5JV1F 5JA0F 3TFNA 3N6KF 2VF6A 3VJ8A 4KQSA 4LLTA 4MC0A 3MAVA 2E90A 1VG4A 2E8TA 3WCEA 2ZY1A 3KRAB 4UMJA 3V1VA 3AQBB 3TFPA 3ICNA 5ILDA 2F89F 2FORA 4DEMF 1UBYA 2E8UA 3WJNA 3ACYA 5EAUA 2J5CA 2F92F 3WCIA 4JXNA 3WCAA 4FP4A 3UCAA 4KQ5A 3P5PA 4JZBA 4NG6A 2Z4WA 4LTZA 3Q1OA 3KRAA 2AZKA 3QKCA 2Q80A 2ONHA 2F8CF 1YYTA 3WEIA 3CKEA 4QXSF 3DYFA 4F6VA 1HXGA 3WCDA 2Z4XA 5HN8A 4GP2A 5ILKA 3N3LF 3P41A 3SDVA 3B7LA 2Z4VA 3LK5A 3EFQA 3LOMA 3P5RA 1N1ZA 2E92A 4P0XA 4KPDA 2Z4ZA 3M02A 4DWGA 4F6XA 1WY0A 4QPFA 5B0MA 5H9DA 1WL0A 3LVSA 5ILJA 4ZQ8A 5A0KA 4FJQA 4RXCA 4OGUA 4H5DF 2AZLA 2E91A 1RQIA 4KWDA 3WCLA 1YYRA 3AQCB 1N22A 3PYBA 2Z50A 5B0IA 2F9KF 1HX9A 3QQVA 1UBWA 2PS8A 3LG5A 3LEEA 1YQ7A 4LOBA 4RNQA 3PKOA 5IK6A 3KRPA 3N1VF 5B02A 3LDWA 1HM4A 4LPGF 3TS7A 3LMDA 2QISA 5JUZF 2PS6A 2J1PA 4DHDA 3ACWA 3N0FA 2H8OA 5B03A 5E8LA 4GA3A 4OMGA 5EASA 5ILYA 5B0LA 5KSXF 1VG7A 1PS1A 5B00A 4DI5A 2FTZA 5IMPA 4KK2A 1DI1A 4LA6A 5CG5A 5IVGA 3M01A 4DZWA 3VJ9A 4KQUA 4LTVA 3VJEA 3NPRA 3S9VA 5HN7A 1DGPA 4P0WA 2EWGA 3M9UA 1WL1A 3RBMA 1RQJA 3RYWA 2F8ZF 2O1OA 3N3DA 3Q2QA 2F94F 3IBAA 3WEGA 4RXEA 4H5CF 2ZCQA 3N45F 5ERNA 3RYEA 5DJPF 2PS5A 5AYPA 2Q58A 1JFGA 2E95A 2Q9YA 3ICMA 3WCJA 3P8RA 1YV5A 3VJDA 3VJAA 5B0KA 5DZ2A 1V4KA 4JZXA 1N1BA 4MC3A 5ILHA 5A0JA 5CG6A 2E8XA 3WCHA 2AEKA 4XQTF 3SDTA 3APZA 4NUAA 4LLSA 3LGZB 4PVYF 3VJBA 3WCCA 4LZ0A 3WCGA 3ZMCA 4E9UA 1WL2A 3CC9A 5ILZA 4F62A 5ER8A 3Q30A 5EROA 2E93A 3N5HF 3KRPB 1FPSA 2Z7HA 5I1UA 2Z78A 4H5EF 2Z4YA 5IMIA 5HN9A 4JXYA 1HM7A 4LA5A 2E4OA 3WCMA 3ASXA 1V4IA 5IL8A 2OA6A 1N23A 3VJCA 1V4HA 1UBXA 2ONGA 5DHIA 1YHMA 4LFEA 3LJIA 1WMWA 1YYQA 4DXJA 3G4DA 3WEJA 3KROB 3NRIA 2ZEUA 3WEKA 4KUXA 4N1ZF 4JVJF 3WE9A 3SDUA 3ID0A 4KVYA 1N24A 3ICZA 3MZVA 1KIZA 4OKMA 3WJKA 4K10A 4E9ZA 2J1OA 3KBKA 3AQ0A 1YHLA 5E8HA 4NKFA 5DGMF 1WKZA 3N49F 3TFVA 2E94A 3BNYA 3WCBA 2ZEVA 3KROA 5AFXA 4NKEA 2P1CA 1KIYA 4RYPA 4JYXA 2E8WA 5EATA 2OPMA 5AELA 4DWBA 4HD1A 4N9UA 3PYAA 4MC8A 2F7MF 2OGDA 5IK0A 3G4FA 5IMNA 3WSBA 3NPKA 3ICKA 1V4JA 3KB9A 5DIQF 1V4EA 3KRCA 3NF2A 4L2XF 1N20A 1EZFA 3N5JF 3CP6A 1YJ4A 3W7FA 4OKZA 3SDQA 1VG3A 4KVDA 4KVWA 4LXWA 5DJVF 5DGNF 5IKHA 5JV2F 4Q23A 1JFAA 4OMHA 4GAXA 2PS4A 3OYRA 2Z52A 5A0IA 5AHUB 3SAEA 5C05A 3PDEA 3ACXA 4LPHF 4KPJA 3ZMBA 3ZCDA 3PH7A 1HXCA 5IL3A 3OABB 3ZL6A 4GP1A 2AETA 3KRFB 2ZCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW5 A;  3V1X A;  3LLW A;  5JV0 F;  3LZ9 A;  5E8K A;  5ILI A;  3OAC B;  5IKA A;  1VG6 A;  2Z7I A;  5HNA A;  1RTR A;  2RAH A;  5ERM A;  3SDR A;  1YYU A;  5IK9 A;  3LSN A;  4KKM A;  1VG2 A;  4EA2 A;  2ZCR A;  3ZOU A;  4KVI A;  4PVX F;  5IN8 A;  3DYG A;  5B01 A;  2PS7 A;  3OAB A;  3AE0 A;  2AEL A;  4LFG A;  3KRF A;  5B0J A;  4WK5 A;  3IPI A;  3OAC A;  3BNX A;  5DGS F;  4LUU A;  1YHK A;  1UBV A;  3ADZ A;  4EA1 A;  3V66 A;  3N46 F;  3P8L A;  3EZ3 A;  4NFJ F;  3RMG A;  2ZCS A;  3M0G A;  4NFI F;  4XQR F;  1WL3 A;  2I19 A;  4NFK F;  4P0V A;  3WSA A;  4EA0 A;  5DHK A;  2OPN A;  3DYH A;  3KRC B;  1HXA A;  3M00 A;  5IM1 A;  2Q9Z A;  2AZJ A;  3WEH A;  4LFV F;  4LZC A;  4RXA A;  3WCF A;  3EGT A;  1YYS A;  3Q2Z A;  3N0G A;  3WJO A;  2E8V A;  3TC1 A;  3WEF A;  3N1W F;  5DJR F;  4LZ3 A;  5DW7 A;  4E1E A;  2DH4 A;  4KFA A;  4RXD A;  3LGK A;  1N21 A;  4LIX A;  3S4J A;  3WC9 A;  4XQS F;  5JV1 F;  5JA0 F;  3TFN A;  3N6K F;  2VF6 A;  3VJ8 A;  4KQS A;  4LLT A;  4MC0 A;  3MAV A;  2E90 A;  1VG4 A;  2E8T A;  3WCE A;  2ZY1 A;  3KRA B;  4UMJ A;  3V1V A;  3AQB B;  3TFP A;  3ICN A;  5ILD A;  2F89 F;  2FOR A;  4DEM F;  1UBY A;  2E8U A;  3WJN A;  3ACY A;  5EAU A;  2J5C A;  2F92 F;  3WCI A;  4JXN A;  3WCA A;  4FP4 A;  3UCA A;  4KQ5 A;  3P5P A;  4JZB A;  4NG6 A;  2Z4W A;  4LTZ A;  3Q1O A;  3KRA A;  2AZK A;  3QKC A;  2Q80 A;  2ONH A;  2F8C F;  1YYT A;  3WEI A;  3CKE A;  4QXS F;  3DYF A;  4F6V A;  1HXG A;  3WCD A;  2Z4X A;  5HN8 A;  4GP2 A;  5ILK A;  3N3L F;  3P41 A;  3SDV A;  3B7L A;  2Z4V A;  3LK5 A;  3EFQ A;  3LOM A;  3P5R A;  1N1Z A;  2E92 A;  4P0X A;  4KPD A;  2Z4Z A;  3M02 A;  4DWG A;  4F6X A;  1WY0 A;  4QPF A;  5B0M A;  5H9D A;  1WL0 A;  3LVS A;  5ILJ A;  4ZQ8 A;  5A0K A;  4FJQ A;  4RXC A;  4OGU A;  4H5D F;  2AZL A;  2E91 A;  1RQI A;  4KWD A;  3WCL A;  1YYR A;  3AQC B;  1N22 A;  3PYB A;  2Z50 A;  5B0I A;  2F9K F;  1HX9 A;  3QQV A;  1UBW A;  2PS8 A;  3LG5 A;  3LEE A;  1YQ7 A;  4LOB A;  4RNQ A;  3PKO A;  5IK6 A;  3KRP A;  3N1V F;  5B02 A;  3LDW A;  1HM4 A;  4LPG F;  3TS7 A;  3LMD A;  2QIS A;  5JUZ F;  2PS6 A;  2J1P A;  4DHD A;  3ACW A;  3N0F A;  2H8O A;  5B03 A;  5E8L A;  4GA3 A;  4OMG A;  5EAS A;  5ILY A;  5B0L A;  5KSX F;  1VG7 A;  1PS1 A;  5B00 A;  4DI5 A;  2FTZ A;  5IMP A;  4KK2 A;  1DI1 A;  4LA6 A;  5CG5 A;  5IVG A;  3M01 A;  4DZW A;  3VJ9 A;  4KQU A;  4LTV A;  3VJE A;  3NPR A;  3S9V A;  5HN7 A;  1DGP A;  4P0W A;  2EWG A;  3M9U A;  1WL1 A;  3RBM A;  1RQJ A;  3RYW A;  2F8Z F;  2O1O A;  3N3D A;  3Q2Q A;  2F94 F;  3IBA A;  3WEG A;  4RXE A;  4H5C F;  2ZCQ A;  3N45 F;  5ERN A;  3RYE A;  5DJP F;  2PS5 A;  5AYP A;  2Q58 A;  1JFG A;  2E95 A;  2Q9Y A;  3ICM A;  3WCJ A;  3P8R A;  1YV5 A;  3VJD A;  3VJA A;  5B0K A;  5DZ2 A;  1V4K A;  4JZX A;  1N1B A;  4MC3 A;  5ILH A;  5A0J A;  5CG6 A;  2E8X A;  3WCH A;  2AEK A;  4XQT F;  3SDT A;  3APZ A;  4NUA A;  4LLS A;  3LGZ B;  4PVY F;  3VJB A;  3WCC A;  4LZ0 A;  3WCG A;  3ZMC A;  4E9U A;  1WL2 A;  3CC9 A;  5ILZ A;  4F62 A;  5ER8 A;  3Q30 A;  5ERO A;  2E93 A;  3N5H F;  3KRP B;  1FPS A;  2Z7H A;  5I1U A;  2Z78 A;  4H5E F;  2Z4Y A;  5IMI A;  5HN9 A;  4JXY A;  1HM7 A;  4LA5 A;  2E4O A;  3WCM A;  3ASX A;  1V4I A;  5IL8 A;  2OA6 A;  1N23 A;  3VJC A;  1V4H A;  1UBX A;  2ONG A;  5DHI A;  1YHM A;  4LFE A;  3LJI A;  1WMW A;  1YYQ A;  4DXJ A;  3G4D A;  3WEJ A;  3KRO B;  3NRI A;  2ZEU A;  3WEK A;  4KUX A;  4N1Z F;  4JVJ F;  3WE9 A;  3SDU A;  3ID0 A;  4KVY A;  1N24 A;  3ICZ A;  3MZV A;  1KIZ A;  4OKM A;  3WJK A;  4K10 A;  4E9Z A;  2J1O A;  3KBK A;  3AQ0 A;  1YHL A;  5E8H A;  4NKF A;  5DGM F;  1WKZ A;  3N49 F;  3TFV A;  2E94 A;  3BNY A;  3WCB A;  2ZEV A;  3KRO A;  5AFX A;  4NKE A;  2P1C A;  1KIY A;  4RYP A;  4JYX A;  2E8W A;  5EAT A;  2OPM A;  5AEL A;  4DWB A;  4HD1 A;  4N9U A;  3PYA A;  4MC8 A;  2F7M F;  2OGD A;  5IK0 A;  3G4F A;  5IMN A;  3WSB A;  3NPK A;  3ICK A;  1V4J A;  3KB9 A;  5DIQ F;  1V4E A;  3KRC A;  3NF2 A;  4L2X F;  1N20 A;  1EZF A;  3N5J F;  3CP6 A;  1YJ4 A;  3W7F A;  4OKZ A;  3SDQ A;  1VG3 A;  4KVD A;  4KVW A;  4LXW A;  5DJV F;  5DGN F;  5IKH A;  5JV2 F;  4Q23 A;  1JFA A;  4OMH A;  4GAX A;  2PS4 A;  3OYR A;  2Z52 A;  5A0I A;  5AHU B;  3SAE A;  5C05 A;  3PDE A;  3ACX A;  4LPH F;  4KPJ A;  3ZMB A;  3ZCD A;  3PH7 A;  1HXC A;  5IL3 A;  3OAB B;  3ZL6 A;  4GP1 A;  2AET A;  3KRF B;  2ZCO A; 
#chains in the Genus database with same CATH topology
 1ZW5 A;  3V1X A;  3LLW A;  5JV0 F;  3LZ9 A;  5E8K A;  5ILI A;  3OAC B;  5IKA A;  1VG6 A;  2Z7I A;  5HNA A;  1RTR A;  2RAH A;  5ERM A;  3SDR A;  1YYU A;  5IK9 A;  3LSN A;  4KKM A;  1VG2 A;  4EA2 A;  2ZCR A;  3ZOU A;  4KVI A;  4PVX F;  5IN8 A;  3DYG A;  5B01 A;  2PS7 A;  3OAB A;  3AE0 A;  2AEL A;  4LFG A;  3KRF A;  5B0J A;  4WK5 A;  3IPI A;  3OAC A;  3BNX A;  5DGS F;  4LUU A;  1YHK A;  1UBV A;  3ADZ A;  4EA1 A;  3V66 A;  3N46 F;  3P8L A;  3EZ3 A;  4NFJ F;  3RMG A;  2ZCS A;  3M0G A;  4NFI F;  4XQR F;  1WL3 A;  2I19 A;  4NFK F;  4P0V A;  3WSA A;  4EA0 A;  5DHK A;  2OPN A;  3DYH A;  3KRC B;  1HXA A;  3M00 A;  5IM1 A;  2Q9Z A;  2AZJ A;  3WEH A;  4LFV F;  4LZC A;  4RXA A;  3WCF A;  3EGT A;  1YYS A;  3Q2Z A;  3N0G A;  3WJO A;  2E8V A;  3TC1 A;  3WEF A;  3N1W F;  5DJR F;  4LZ3 A;  5DW7 A;  4E1E A;  2DH4 A;  4KFA A;  4RXD A;  3LGK A;  1N21 A;  4LIX A;  3S4J A;  3WC9 A;  4XQS F;  5JV1 F;  5JA0 F;  3TFN A;  3N6K F;  2VF6 A;  3VJ8 A;  4KQS A;  4LLT A;  4MC0 A;  3MAV A;  2E90 A;  1VG4 A;  2E8T A;  3WCE A;  2ZY1 A;  3KRA B;  4UMJ A;  3V1V A;  3AQB B;  3TFP A;  3ICN A;  5ILD A;  2F89 F;  2FOR A;  4DEM F;  1UBY A;  2E8U A;  3WJN A;  3ACY A;  5EAU A;  2J5C A;  2F92 F;  3WCI A;  4JXN A;  3WCA A;  4FP4 A;  3UCA A;  4KQ5 A;  3P5P A;  4JZB A;  4NG6 A;  2Z4W A;  4LTZ A;  3Q1O A;  3KRA A;  2AZK A;  3QKC A;  2Q80 A;  2ONH A;  2F8C F;  1YYT A;  3WEI A;  3CKE A;  4QXS F;  3DYF A;  4F6V A;  1HXG A;  3WCD A;  2Z4X A;  5HN8 A;  4GP2 A;  5ILK A;  3N3L F;  3P41 A;  3SDV A;  3B7L A;  2Z4V A;  3LK5 A;  3EFQ A;  3LOM A;  3P5R A;  1N1Z A;  2E92 A;  4P0X A;  4KPD A;  2Z4Z A;  3M02 A;  4DWG A;  4F6X A;  1WY0 A;  4QPF A;  5B0M A;  5H9D A;  1WL0 A;  3LVS A;  5ILJ A;  4ZQ8 A;  5A0K A;  4FJQ A;  4RXC A;  4OGU A;  4H5D F;  2AZL A;  2E91 A;  1RQI A;  4KWD A;  3WCL A;  1YYR A;  3AQC B;  1N22 A;  3PYB A;  2Z50 A;  5B0I A;  2F9K F;  1HX9 A;  3QQV A;  1UBW A;  2PS8 A;  3LG5 A;  3LEE A;  1YQ7 A;  4LOB A;  4RNQ A;  3PKO A;  5IK6 A;  3KRP A;  3N1V F;  5B02 A;  3LDW A;  1HM4 A;  4LPG F;  3TS7 A;  3LMD A;  2QIS A;  5JUZ F;  2PS6 A;  2J1P A;  4DHD A;  3ACW A;  3N0F A;  2H8O A;  5B03 A;  5E8L A;  4GA3 A;  4OMG A;  5EAS A;  5ILY A;  5B0L A;  5KSX F;  1VG7 A;  1PS1 A;  5B00 A;  4DI5 A;  2FTZ A;  5IMP A;  4KK2 A;  1DI1 A;  4LA6 A;  5CG5 A;  5IVG A;  3M01 A;  4DZW A;  3VJ9 A;  4KQU A;  4LTV A;  3VJE A;  3NPR A;  3S9V A;  5HN7 A;  1DGP A;  4P0W A;  2EWG A;  3M9U A;  1WL1 A;  3RBM A;  1RQJ A;  3RYW A;  2F8Z F;  2O1O A;  3N3D A;  3Q2Q A;  2F94 F;  3IBA A;  3WEG A;  4RXE A;  4H5C F;  2ZCQ A;  3N45 F;  5ERN A;  3RYE A;  5DJP F;  2PS5 A;  5AYP A;  2Q58 A;  1JFG A;  2E95 A;  2Q9Y A;  3ICM A;  3WCJ A;  3P8R A;  1YV5 A;  3VJD A;  3VJA A;  5B0K A;  5DZ2 A;  1V4K A;  4JZX A;  1N1B A;  4MC3 A;  5ILH A;  5A0J A;  5CG6 A;  2E8X A;  3WCH A;  2AEK A;  4XQT F;  3SDT A;  3APZ A;  4NUA A;  4LLS A;  3LGZ B;  4PVY F;  3VJB A;  3WCC A;  4LZ0 A;  3WCG A;  3ZMC A;  4E9U A;  1WL2 A;  3CC9 A;  5ILZ A;  4F62 A;  5ER8 A;  3Q30 A;  5ERO A;  2E93 A;  3N5H F;  3KRP B;  1FPS A;  2Z7H A;  5I1U A;  2Z78 A;  4H5E F;  2Z4Y A;  5IMI A;  5HN9 A;  4JXY A;  1HM7 A;  4LA5 A;  2E4O A;  3WCM A;  3ASX A;  1V4I A;  5IL8 A;  2OA6 A;  1N23 A;  3VJC A;  1V4H A;  1UBX A;  2ONG A;  5DHI A;  1YHM A;  4LFE A;  3LJI A;  1WMW A;  1YYQ A;  4DXJ A;  3G4D A;  3WEJ A;  3KRO B;  3NRI A;  2ZEU A;  3WEK A;  4KUX A;  4N1Z F;  4JVJ F;  3WE9 A;  3SDU A;  3ID0 A;  4KVY A;  1N24 A;  3ICZ A;  3MZV A;  1KIZ A;  4OKM A;  3WJK A;  4K10 A;  4E9Z A;  2J1O A;  3KBK A;  3AQ0 A;  1YHL A;  5E8H A;  4NKF A;  5DGM F;  1WKZ A;  3N49 F;  3TFV A;  2E94 A;  3BNY A;  3WCB A;  2ZEV A;  3KRO A;  5AFX A;  4NKE A;  2P1C A;  1KIY A;  4RYP A;  4JYX A;  2E8W A;  5EAT A;  2OPM A;  5AEL A;  4DWB A;  4HD1 A;  4N9U A;  3PYA A;  4MC8 A;  2F7M F;  2OGD A;  5IK0 A;  3G4F A;  5IMN A;  3WSB A;  3NPK A;  3ICK A;  1V4J A;  3KB9 A;  5DIQ F;  1V4E A;  3KRC A;  3NF2 A;  4L2X F;  1N20 A;  1EZF A;  3N5J F;  3CP6 A;  1YJ4 A;  3W7F A;  4OKZ A;  3SDQ A;  1VG3 A;  4KVD A;  4KVW A;  4LXW A;  5DJV F;  5DGN F;  5IKH A;  5JV2 F;  4Q23 A;  1JFA A;  4OMH A;  4GAX A;  2PS4 A;  3OYR A;  2Z52 A;  5A0I A;  5AHU B;  3SAE A;  5C05 A;  3PDE A;  3ACX A;  4LPH F;  4KPJ A;  3ZMB A;  3ZCD A;  3PH7 A;  1HXC A;  5IL3 A;  3OAB B;  3ZL6 A;  4GP1 A;  2AET A;  3KRF B;  2ZCO A; 
#chains in the Genus database with same CATH homology
 1ZW5 A;  3V1X A;  3LLW A;  5JV0 F;  3LZ9 A;  5E8K A;  5ILI A;  3OAC B;  5IKA A;  1VG6 A;  2Z7I A;  5HNA A;  1RTR A;  2RAH A;  5ERM A;  3SDR A;  1YYU A;  5IK9 A;  3LSN A;  4KKM A;  1VG2 A;  4EA2 A;  2ZCR A;  3ZOU A;  4KVI A;  4PVX F;  5IN8 A;  3DYG A;  5B01 A;  2PS7 A;  3OAB A;  3AE0 A;  2AEL A;  4LFG A;  3KRF A;  5B0J A;  4WK5 A;  3IPI A;  3OAC A;  3BNX A;  5DGS F;  4LUU A;  1YHK A;  1UBV A;  3ADZ A;  4EA1 A;  3V66 A;  3N46 F;  3P8L A;  3EZ3 A;  4NFJ F;  3RMG A;  2ZCS A;  3M0G A;  4NFI F;  4XQR F;  1WL3 A;  2I19 A;  4NFK F;  4P0V A;  3WSA A;  4EA0 A;  5DHK A;  2OPN A;  3DYH A;  3KRC B;  1HXA A;  3M00 A;  5IM1 A;  2Q9Z A;  2AZJ A;  3WEH A;  4LFV F;  4LZC A;  4RXA A;  3WCF A;  3EGT A;  1YYS A;  3Q2Z A;  3N0G A;  3WJO A;  2E8V A;  3TC1 A;  3WEF A;  3N1W F;  5DJR F;  4LZ3 A;  5DW7 A;  4E1E A;  2DH4 A;  4KFA A;  4RXD A;  3LGK A;  1N21 A;  4LIX A;  3S4J A;  3WC9 A;  4XQS F;  5JV1 F;  5JA0 F;  3TFN A;  3N6K F;  2VF6 A;  3VJ8 A;  4KQS A;  4LLT A;  4MC0 A;  3MAV A;  2E90 A;  1VG4 A;  2E8T A;  3WCE A;  2ZY1 A;  3KRA B;  4UMJ A;  3V1V A;  3AQB B;  3TFP A;  3ICN A;  5ILD A;  2F89 F;  2FOR A;  4DEM F;  1UBY A;  2E8U A;  3WJN A;  3ACY A;  5EAU A;  2J5C A;  2F92 F;  3WCI A;  4JXN A;  3WCA A;  4FP4 A;  3UCA A;  4KQ5 A;  3P5P A;  4JZB A;  4NG6 A;  2Z4W A;  4LTZ A;  3Q1O A;  3KRA A;  2AZK A;  3QKC A;  2Q80 A;  2ONH A;  2F8C F;  1YYT A;  3WEI A;  3CKE A;  4QXS F;  3DYF A;  4F6V A;  1HXG A;  3WCD A;  2Z4X A;  5HN8 A;  4GP2 A;  5ILK A;  3N3L F;  3P41 A;  3SDV A;  3B7L A;  2Z4V A;  3LK5 A;  3EFQ A;  3LOM A;  3P5R A;  1N1Z A;  2E92 A;  4P0X A;  4KPD A;  2Z4Z A;  3M02 A;  4DWG A;  4F6X A;  1WY0 A;  4QPF A;  5B0M A;  5H9D A;  1WL0 A;  3LVS A;  5ILJ A;  4ZQ8 A;  5A0K A;  4FJQ A;  4RXC A;  4OGU A;  4H5D F;  2AZL A;  2E91 A;  1RQI A;  4KWD A;  3WCL A;  1YYR A;  3AQC B;  1N22 A;  3PYB A;  2Z50 A;  5B0I A;  2F9K F;  1HX9 A;  3QQV A;  1UBW A;  2PS8 A;  3LG5 A;  3LEE A;  1YQ7 A;  4LOB A;  4RNQ A;  3PKO A;  5IK6 A;  3KRP A;  3N1V F;  5B02 A;  3LDW A;  1HM4 A;  4LPG F;  3TS7 A;  3LMD A;  2QIS A;  5JUZ F;  2PS6 A;  2J1P A;  4DHD A;  3ACW A;  3N0F A;  2H8O A;  5B03 A;  5E8L A;  4GA3 A;  4OMG A;  5EAS A;  5ILY A;  5B0L A;  5KSX F;  1VG7 A;  1PS1 A;  5B00 A;  4DI5 A;  2FTZ A;  5IMP A;  4KK2 A;  1DI1 A;  4LA6 A;  5CG5 A;  5IVG A;  3M01 A;  4DZW A;  3VJ9 A;  4KQU A;  4LTV A;  3VJE A;  3NPR A;  3S9V A;  5HN7 A;  1DGP A;  4P0W A;  2EWG A;  3M9U A;  1WL1 A;  3RBM A;  1RQJ A;  3RYW A;  2F8Z F;  2O1O A;  3N3D A;  3Q2Q A;  2F94 F;  3IBA A;  3WEG A;  4RXE A;  4H5C F;  2ZCQ A;  3N45 F;  5ERN A;  3RYE A;  5DJP F;  2PS5 A;  5AYP A;  2Q58 A;  1JFG A;  2E95 A;  2Q9Y A;  3ICM A;  3WCJ A;  3P8R A;  1YV5 A;  3VJD A;  3VJA A;  5B0K A;  5DZ2 A;  1V4K A;  4JZX A;  1N1B A;  4MC3 A;  5ILH A;  5A0J A;  5CG6 A;  2E8X A;  3WCH A;  2AEK A;  4XQT F;  3SDT A;  3APZ A;  4NUA A;  4LLS A;  3LGZ B;  4PVY F;  3VJB A;  3WCC A;  4LZ0 A;  3WCG A;  3ZMC A;  4E9U A;  1WL2 A;  3CC9 A;  5ILZ A;  4F62 A;  5ER8 A;  3Q30 A;  5ERO A;  2E93 A;  3N5H F;  3KRP B;  1FPS A;  2Z7H A;  5I1U A;  2Z78 A;  4H5E F;  2Z4Y A;  5IMI A;  5HN9 A;  4JXY A;  1HM7 A;  4LA5 A;  2E4O A;  3WCM A;  3ASX A;  1V4I A;  5IL8 A;  2OA6 A;  1N23 A;  3VJC A;  1V4H A;  1UBX A;  2ONG A;  5DHI A;  1YHM A;  4LFE A;  3LJI A;  1WMW A;  1YYQ A;  4DXJ A;  3G4D A;  3WEJ A;  3KRO B;  3NRI A;  2ZEU A;  3WEK A;  4KUX A;  4N1Z F;  4JVJ F;  3WE9 A;  3SDU A;  3ID0 A;  4KVY A;  1N24 A;  3ICZ A;  3MZV A;  1KIZ A;  4OKM A;  3WJK A;  4K10 A;  4E9Z A;  2J1O A;  3KBK A;  3AQ0 A;  1YHL A;  5E8H A;  4NKF A;  5DGM F;  1WKZ A;  3N49 F;  3TFV A;  2E94 A;  3BNY A;  3WCB A;  2ZEV A;  3KRO A;  5AFX A;  4NKE A;  2P1C A;  1KIY A;  4RYP A;  4JYX A;  2E8W A;  5EAT A;  2OPM A;  5AEL A;  4DWB A;  4HD1 A;  4N9U A;  3PYA A;  4MC8 A;  2F7M F;  2OGD A;  5IK0 A;  3G4F A;  5IMN A;  3WSB A;  3NPK A;  3ICK A;  1V4J A;  3KB9 A;  5DIQ F;  1V4E A;  3KRC A;  3NF2 A;  4L2X F;  1N20 A;  1EZF A;  3N5J F;  3CP6 A;  1YJ4 A;  3W7F A;  4OKZ A;  3SDQ A;  1VG3 A;  4KVD A;  4KVW A;  4LXW A;  5DJV F;  5DGN F;  5IKH A;  5JV2 F;  4Q23 A;  1JFA A;  4OMH A;  4GAX A;  2PS4 A;  3OYR A;  2Z52 A;  5A0I A;  5AHU B;  3SAE A;  5C05 A;  3PDE A;  3ACX A;  4LPH F;  4KPJ A;  3ZMB A;  3ZCD A;  3PH7 A;  1HXC A;  5IL3 A;  3OAB B;  3ZL6 A;  4GP1 A;  2AET A;  3KRF B;  2ZCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...