2ZCZA

Crystal structures and thermostability of mutant trap3 a7 (engineered trap)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
publication title Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 13
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zczA00
5EF2A 2EXTA 1C9SA 1GTFA 2ZP9A 5EEVA 1QAWA 5EEYA 5EEUA 5EF0A 5EF1A 3ZZSA 1WAPA 2EXSA 3AQDA 5EF3A 1UTDA 2ZD0A 1GTNA 3ZZQA 3ZZLA 2ZP8A 5EEZA 3ZTEA 5EEWA 4B27A 2ZCZA 5EEXA
chains in the Genus database with same CATH superfamily
3WIFB 1IEAB 1G9MH 1U8PA 4DP4X 1D5IH 3O4OC 1JCVA 2VQ1A 1XGPA 1PL3A 2YEZA 3IRPX 4GG8A 3TO4C 5CN1A 4G82A 1A3RL 3V6FA 3ARRA 4OF6A 4PIRF 3HE7D 2FK9A 1FL5B 1FFPA 3OAYK 3PP4L 4ZD3H 5I1KL 1KCRL 1KDIA 1TO5A 4U6TA 3A47A 4QXUH 4OZGF 4NJAL 4IBLT 3BUBA 4PGCA 4ZW8A 4AQ1C 3MO1A 2YD9A 3KPSE 4LEOA 2HKHH 2VM4A 5FUOH 4JRYE 5MP6H 1MOEA 3C6SA 5EUOA 3PJLA 2MTAA 1H6UA 4WW2B 3U6XS 5DJDB 5HYSG 4P5TA 3GJFK 4J1UA 4N90D 1S9XB 3I9IA 1BGXL 2P26A 4FA7B 4XE5B 2OX5B 3GSNL 4FQ2L 5C0ND 5E6YA 3APNA 3CTTA 2LLLA 3LDBC 3HHRB 2H1PL 4LKCA 2WXIA 3ECVA 3N04A 3ZSTA 2FATL 3KW7A 2OMUB 1ONQA 3GMLB 3VSVA 4Y5VA 3WN5B 1VERA 4K3DH 4RMQA 3WFDL 3TT3H 3QNZB 2WBJC 2CJSA 2W80C 3S8GB 1A21A 1XCTA 2VL5A 1L3WA 3SKOA 2JCWA 3U7YL 4UT7L 1EFQA 1X7TA 4Z0XA 1I1YB 2YN5A 3ZKMC 4LVEA 4NN6B 3MN8A 1DQMH 2R7EA 1U8HB 3MGTB 1IU1A 5BRPA 5E8PB 4NP4L 5DR5H 4YXLL 1S3KH 2DYPD 1KTLA 2DQGL 3CQPA 4OLWL 4LDEB 4ZW5A 2YO3A 3QPXH 2DQEH 2VXTL 4IHOA 4LBEB 3D18A 1MCPH 3UYOD 1FYHB 5DU7A 5I1GL 4OSUH 4G8EB 3QORA 1JZJA 1OAQL 4Y19B 3LHPH 4HCIA 3UP6A 5L6YH 3AXHA 4L1TA 4PB9H 4N2FA 5GPRA 5I15H 1UWXK 3LEXA 1P7QD 5BO0D 4ONFH 5JOFA 1JNNH 2BDNL 3S4SB 4L29B 4KTDH 1CC3A 1TOXA 4XMPH 1HILB 3UL4A 1UYWH 3DOSB 1ETJA 3QDGE 2BVYA 2HT3C 3H3PH 4YXKH 4UNTA 2H32H 5JPNB 5EOCJ 3K0YA 2WLHA 4OZIB 3CVCA 5JXAH 2X28A 3V0VB 5DJ0A 2E56A 4H2CA 5E6SB 4NZTH 3NJNA 4QLRA 3DBXA 4DEPC 3CMOL 4C56A 3WY4A 2E9IA 1CFBA 2BNRA 4XBGB 4IK7A 2NX5A 4YEFA 3P0GB 2YZ1A 3PL6D 3GXPA 4JPWL 1B6UA 2WZ5A 1MUJB 1WBZA 4PJ7B 4XAWH 3CFBB 2VO8A 1IILE 2O1AA 4F9LC 2Q8AH 4YN3A 5B38B 5D71H 2Q0ZX 5DHYA 1UB6A 3L3DB 2J4WL 3K6IA 4KHTL 3QUGA 2PCPB 4ZX6A 2Z91B 2V8LA 5L7XH 2FQFA 4YL4A 3QNXA 3VE0A 1TQVA 4H7VA 4IGBA 4Y5YA 3GUTB 3NAAL 2ZG2A 3R1GH 1QPKA 5BUGA 3WFHB 5HHOE 3FB8B 1ZLEA 2B1AL 2NY4B 3NCYS 2G60H 4ZS7L 5JMRA 4NHUB 4AMKH 7PAZA 5HPMB 5TE6L 1HL5A 1T2JA 5EOTB 2GJZA 4HJGB 3GEFA 5KZCD 2PN5A 4KDVA 3L4UA 3D2UD 5J6HA 1TJGH 2H45A 3MCKA 4ETQB 3F12B 4YSPA 4YHPA 1MQKL 1I4FB 2I60H 2BZDA 1JIBA 4LE8A 1YEIL 2XV0A 3SCMD 1ZGLP 2DRUA 3BUYA 3BT0A 4M7ZB 2VDPH 5ERWB 5FAAA 2BSSA 3OLGA 1IAOA 2HZHA 5E6UB 2K3TA 5T1KD 4G5ZH 3G5ZB 3HN5A 3JWOH 5D7IA 3KPNB 5I73B 2WXGA 4K8RH 2XPZA 1TTRA 4H8PA 3MROA 4IMLB 2E27H 2KQNA 3GMPB 3K8LA 5C3TA 1W0VB 4M48L 2L7EA 4WRLA 2QHLA 3CU7A 5CBEA 4YDKL 1PKQE 2XETA 4M29A 1P5UC 3QEUB 4BQ8A 2IMMA 1JVOA 4IRSB 1CYWA 2NY5H 1HHIA 4N2KA 4A6YL 4FI8A 1MCBA 1JWUA 1J5OL 2P8MA 3HVDA 2X4NA 1BLNA 4LIQH 1PKOA 5C70A 1F42A 2NCEA 2VXQA 2JJTC 2OYKA 2IG2L 1XCQA 4OBRA 4NZUH 2G2RB 5D8JH 3DX7B 4ERSL 2CO7A 1JUFA 3LMJL 4QRTA 2R1XA 4R4BB 3FFDA 2H6PA 2BNUB 3R8BB 3ZBMA 4WU7B 2CWRA 3UBXA 3ULUF 3GO1L 3H2QA 4KMTH 4ZMNA 4DQOL 1RLWA 2DQFA 1LO4H 5AOJA 1I7ZB 1U92B 1JZFA 5D1QE 3QJFB 1IAII 3TYFB 3HS0C 3NFNA 2X9YA 3SOTA 1WAAF 4PS8A 5J3HC 4PD4K 4PJ9C 2D0FA 2XQYK 1ZTMA 3IFOB 4ZXBA 3AQXA 1X4XA 4O02H 5ETUA 2FJGA 1KPRB 2AVFA 2EABA 1OTUD 1SQMA 3O3BA 5CR1A 3PPEA 1B4JL 1DUYA 3NDYE 3MSPA 4HWBL 4PS4L 4EN3D 1OGPA 2CCVA 3SY6A 1AP2B 2DQUL 2X09A 2D2OA 3VWJB 1C5DB 1MW3A 3W11D 2CBPA 4KRPB 2AJVL 5J1TC 4YXHL 3GZOA 4FQ1L 4JR9L 4GRWB 3ML9A 2NTFB 4OZHA 1F11B 1YMMD 4XMTA 1IIKA 3WKPA 3OZ9L 1PAZA 3WXVH 5IJDC 1SBBA 3VYNA 4PG9B 3L17A 2CE6A 3CCHB 5SWSB 3I85A 1FYTE 2J8UF 4UIKL 3KDMA 3M88A 3RVXD 3GXIA 4ZFFA 5EV7A 3M45A 1ASOA 2HTLD 4GSDL 1MFCH 4OJFH 3EHBB 3KBPA 2ZZUT 4G6KL 4QXGL 3AITA 3PPSA 2W60A 5C0CE 3TT1H 4DN3H 4JRXE 1IGIL 2V7NA 5LBGA 2WOBA 1Q1JH 4JFZL 4B0MB 3HFFA 4FKHA 1MFDH 4PP1C 1M9SA 2V9RA 3WMSA 3JWNG 4A7UA 1AANA 4TOYL 4G6AD 3ULUE 1A6UL 4LHJB 4LSVH 3BP6B 3RWEB 3W39A 3D7PA 5GSRB 5CM1A 3KCPA 4RQQB 5DUJA 3E3QE 5IM7B 5CSZB 3VSUA 1DUZB 1WAAE 5HY9A 2W59A 5EORH 3L1OL 2IDSA 4HEPA 4B7IA 1ZGLM 4ICWA 4AWJC 5LWYL 4PJBF 4UM8B 1PLGL 4N2IA 4LPXA 4YC2B 3O2VH 4MAYC 5DK0B 3QXWA 2ITDB 1QWHA 5KANI 1PFOA 4Z95L 5HHME 3GMNB 3EBAA 4NNYB 2Y1VA 2WGNB 1UVQB 4PCSA 3GIZL 3I75A 3KPRE 1E27B 4NUGL 4TVPL 5CO1A 1CIDA 1NGWB 3HG3A 2Z4TA 4EUPH 1IC1A 1S7TB 4NQCE 3WIHA 2H26B 4I3SH 4DK5A 2VITA 4NHCL 4MCYA 3AY4A 4PW9A 4AIOA 4PWEA 2CDFA 1F0LA 5IVNA 1ZIAA 4PCTA 3SDXB 5CJ5A 1KFAL 4ELMA 2IOOA 1CCZA 4UTBL 2KDYA 3C2SA 5TQ0H 3RNKA 3H53A 4WUUB 4HIEA 1ILSA 3BAYA 2AEQH 1D5ZA 2X3CA 3LZFL 2VWEE 4LK4A 4WWKB 2A74C 1J48A 4JGJA 3ARGC 4XHJC 2F7RA 3SE4A 5I8CB 5IB4A 4IEFA 4U0RC 3D4ZA 1QG3A 2HRPH 3VGBA 3FPYA 4IDJH 1WZ1L 4XO3A 3WEBA 4HJ0C 4LSTL 2NUPA 5DJCA 5IBUG 4IIQB 5F0MB 2FECI 3HZYB 1FO0H 3NSJA 2X42A 5JDSA 1F6FB 4DP5X 4X4YA 4BXVA 5LO7A 2P5WE 2BH0A 1CU4L 4Q7DA 4JFQA 1F1AA 1VAHA 3MV7E 5T1MB 3T5WA 2MJWA 2GG1A 3N5AA 4AC2A 5CF3A 1EVUA 2VSMB 1GTFA 5JPMC 2NZIA 1M6UA 2A77H 1WIOA 4ODWB 5TF0A 1ZOXA 3EYSL 3K8KA 2XFGB 2Z8SA 1HXMA 1L7TH 3KM2A 5A40E 4KH9A 1KGYE 3HRPA 4PJ8A 2CKBA 1T21A 2WO4A 1ITBB 4NQDD 4OZFA 4XC3L 4X9IA 1WAEA 3T3ME 5I1LA 5K59F 1LK3H 1PZDA 2VH5L 3BX7C 4PRHE 4N87A 3IAGC 2DIEA 1YY9D 3RNQB 2W07B 3KYAA 5E5MB 4YEEA 3A6CH 3ROOA 1WJ3A 2DWXA 5MERB 1JRHL 5E8NA 5J0BA 5JMOC 1MDTA 1BAFL 3TO4A 1MCLA 1HOCA 2AK1H 3QEQE 1FZKA 1YNLH 1J0JA 1EXUB 1MFEH 2RQ8A 3P9LA 1UJ3C 3QCVL 4KXZI 1BQ5A 4NS0A 4FTVB 3LJ3A 3MJ7A 4JFTA 5DTFB 2CBQA 1N8ZB 3JYBA 4TNGA 2R4SL 1DLFL 3NACL 1B0WA 3I84A 4XNQB 1P6FA 2CK2A 5GSVB 4FZ8H 1JZDC 5KSAC 2ZCZA 3WL9B 3BP5B 1IC7H 4LNRA 3PWNB 2JIXB 2WZPD 3LHAA 3QH3A 4FGMA 4N2MA 3OB0K 3NA9H 3CN0A 3IAQA 5D7JA 4Y4KB 3RGVB 1X5XA 4DTGH 4XGZB 5K39B 3Q2VA 4R26L 2YD7A 4TULH 5LG6A 2J6EH 4AQZA 4XMWA 1HX0A 4XP4L 4PN6A 5IROA 4DGUA 1A1MB 3EYQC 4YHMH 4G8GE 5HI3C 5FCUH 4NENB 1A6WL 1HC1A 3C5JB 1JHKH 4PRDB 2ADIA 4GFXA 4DN4H 2HVKB 2FBJH 2FT6A 4JFYA 3BAKA 1BEYH 3H2PA 4IRZA 2FH6A 5A6LA 2JCCA 2YKLH 4U6VH 5LN4A 3DVGB 3GTNA 3OGCA 3GKWH 2P8PB 3VXMA 3S35X 5DI8A 4N8VA 1IFRA 5HDRA 2MPAL 3VD7A 3ZGHA 1ZMYA 5K59E 4X0NA 3RL1B 1XGTA 1AMYA 2P5EA 1VZGA 4RWYH 1JGEA 2Y7OA 2ENSA 5DS8B 5JW4Q 1ZT4A 4HZAA 2BY3A 4QOKB 5E9DE 3VQMA 1B0IA 1OHZA 2B3RA 3UFIA 1OANA 5EOQH 4JN1L 4L8DA 5LVEA 1DR9A 1RZJH 1I7RB 4YDVB 1T2XA 1U2YA 3TJEH 5I1JL 3PUCA 1ZCRA 2DQJH 4I89A 1D5BA 3L3OA 1MJ7L 1J05B 1CT8B 5DRWB 3SPVB 2JXMA 1FRGL 2BP0A 3L4CA 3UIYA 1BMZA 1OT4A 1WQVT 4RCAA 2A99A 4J3OD 2NXZC 1NIAA 2NY1C 3QZNA 1IBGL 2MPVA 4XPTL 1XZWA 2BSDA 2CR3A 3GSRB 4P46B 4BWTA 3CFKB 1XF2A 4AYID 4Z7WF 4AEHL 5C9JB 1HOEA 2EECA 1CL7I 2E46A 2F7IA 3RJDA 3QUMB 3HN3A 5DLML 5C0AA 4YPJA 3FTVA 5AB9A 4OT1H 2HT2D 4WVRA 4EI5B 2UV3A 1U95B 5D1QC 4AGNA 2HJLB 5JHDE 3TBTA 3ESUF 4X80H 2V3EA 5F7MC 2CGYA 5AW5B 1HI6A 3UTTD 1DZ0A 4LF3A 5D2LE 3DV4B 1OALA 3FBKA 3EO9L 1VADB 1Q4NX 2G5UA 1BZ9A 1HINL 5H94B 2YPLB 4XT1C 3S88H 1WFMA 4F20A 2XT1B 1NCDH 1RUML 4XBMA 3ZDWA 3KW8A 4A2DA 4ODUA 1RXLA 3COOA 5KSVA 5E00A 1BVNT 2NY4D 4ADGA 2JSFA 3CX5K 1JDCA 1Q94B 3LPOA 2OYPA 2B7DT 3DUUA 3MOBH 5KUMA 1AH1A 2XG4B 5CLWA 2VM9A 1ODUA 3T8XB 4MNQB 3V4VA 2LTQC 4BKTC 3KEHA 3MRFB 3CIAA 3FYEB 1UA6H 3ARBB 2FSEB 3G5WA 3KHQA 3P4MA 4OJDH 5ITFB 4DZ8A 4ZZFA 1ZLVH 5IFJA 4IRJC 5EDXA 2CDGB 4N1CA 3BKMH 4GINA 3E6HB 2R29L 5B1AB 4H26A 4M5TA 1R5VA 2V9TA 1N12A 4DF9A 4FQCL 4X7CC 1LGVA 3TN0B 5I6LA 1E43A 4JKPL 4AGOA 5HYJA 2EE6A 3PWPA 4QRUB 4BD4A 4PJ5D 3QIWB 4QRRB 2YRZA 3FQNA 4K94L 3LKPA 2DQHH 3NCJH 3QQ4B 1NCWH 2OXHA 2UY6B 1D7DA 4Z7WE 4PB0L 4YWGL 1R3HA 3BVVA 3ULUC 4FG4A 3D85A 1B9KA 2WGXA 4IRSD 3S96B 1RULL 2VLJD 4NZRL 3RA7H 3RRQA 3ZHDA 3PQYB 3E3QC 3PP3K 4IKNA 5H37H 1AQHA 4MAUL 2BIQA 2VLKB 4JPIB 1OF2A 1HZHH 3SKMA 5FUZH 2CQVA 3RKDD 5T5NG 2FR4B 4LLUB 1JGUL 4BHUA 4DKEH 3UBXG 1T3FB 2MNUA 4Y4FD 3G04B 3A6BL 3NRPA 4AVJA 4NBXB 5DZ9A 2PCFB 3MRPB 2Y5TB 1BQHG 4OUUB 2UYLA 2BIMA 3DMMD 4DEWA 3OG6B 4N0YL 4LRNH 1I85C 3AREB 4Y4HC 5CMAB 1BOGA 1O7VA 4O2EA 5GGSY 4AXWA 2V2XB 1ULVA 1FNLA 5ISZB 1Z9NA 3P02A 4OD3L 4E42A 1DVFB 4UQ3A 4R7DA 5I0YA 5I26A 4C57C 2HTKD 1G0DA 2RR3A 2NY3B 3RAJL 1YAZA 4OLZL 5C0RL 1HL4A 5EZLA 5MEPA 2NT1A 1T66D 3IJEA 3QDME 3Q7JA 1NCAH 3NMEA 3VWJD 3LKNA 3KMDA 4ZJ9A 1R3JA 5JQHC 5B1KA 1RUKL 3KJ6L 2VLRA 5E8DH 3ILPA 2IH3A 4N9OB 5GGSB 4WKZB 1KGCD 4HS3B 2CGRH 2QSQA 3KPOB 1SF3A 1YEFH 4I0PB 4N24A 3ZTCC 5HXMA 4JFHE 4MBOA 2PO6D 5IB1A 2R9HC 3G6JA 3VJ6B 1KTKE 1E9PA 1N19A 2B15A 2HFGL 2JI2A 4JG5A 5D9SB 3PWUA 5BQDA 3GLAA 1SHWA 3RIAK 4HHWA 4B53A 4ZUSA 3BQUC 5FA3B 3MCYA 4GP4B 1A3LH 1R17A 2M2DA 4YK4C 4BUHA 2E3VA 1PIGA 4HF5H 4MD0A 3OAUH 5D5MF 3BEWA 1NGPH 1WC7A 1Q90A 4L48A 4HAGA 3VFGL 4NKOB 2XWZA 2AI0L 1H3TA 5FFGA 2UXTA 2X4SB 1SHSA 1EEZA 1JVLA 4N3UA 1AO7A 3KLAA 3PWVA 5ACZA 5I17B 2X88A 3VQ2C 3ZU8A 3WLWC 2BSEA 2IQ9L 3HG1E 4LEXH 3ZRFC 2ICEC 1QPXA 4OAWA 5I74B 1D5IL 2QKIB 3BPCA 3NK3A 5INCA 1KB5A 4HH9A 1Q72H 1XR8A 1FZOA 3QUZB 4G7RB 3DO3A 3MYJB 3PRZA 4M4RB 4AYFA 1KYOJ 2Z34A 4ZD3L 4QRQB 2NSMA 3P4OB 1ZS8B 4QXUL 1OW0A 1NBVH 1FE8H 3IKKA 3KPSA 4JRYA 3H4HA 5CP7A 3SDDA 5MP6L 2HKHL 2YRBA 5FUOL 4CSSA 4JQIH 3GMMB 2E75C 4H25A 5DJ8A 5I2IB 3LRGA 3D25A 2A9MH 3CVIL 4HCRA 5HDOA 1U8CA 4NIKB 3LH8A 2PKDA 1HNGA 2QHRH 3HEIB 1E3FA 5GRJH 1NUDA 2MQ3A 4F7MB 2A73B 2A4ZA 4JFXA 5DK3A 3IXTA 4X6EB 4PVMA 3KAAA 5F1IB 4LLAA 2X70A 4FJ6A 2NR6C 4OCWH 4P4RB 1K5NB 2NY2C 2P1YA 4UCFA 5IGXH 1DJYA 4G9FE 2FH8A 2VDPB 3DROB 4Z78B 1BZEA 3P30H 1GC1L 2Z3FA 4K3DL 4MKTA 1PAMA 3PDDA 5D5ME 3TT3L 2J20A 3IU4H 4A2FA 5L2KA 3RZWA 1JF1B 2BSTB 3HE6B 4Z9KB 4PJFB 4FFTA 3U1SH 3M7OA 4I0CC 1OSZA 5LNEA 4URTB 1KZYA 5DUBA 5DDHB 2AXWA 1DQML 4PREB 5F7DA 4PY8J 2WB1A 3MNVB 5EU6E 1KLFA 4TXVB 3O6LH 2BVQB 5FF6B 4DIXA 2C1OB 2YAFA 3K2IA 3L3IB 4MQXD 2EDEA 3JV6A 5BOPA 3C60C 5A16A 2D7QA 3QPXL 5HHVH 4D9RD 2W5PA 2DQEL 5FDWB 5A2KH 3IDMB 4TKWA 1OL0A 3HI1A 4NCC2 3FK3A 2BERA 4ZTEA 5FYKH 4Y2DC 4K4KA 3LHPL 4HIHB 3Q3GB 4WI4A 3B9VA 5KSBB 1VZHA 3O11B 1MNNA 2Y72A 3BGMB 5CWSB 3GKZA 4ORZC 4DP2X 1JNNL 1QEXA 2GCYB 2O5NA 3RJOA 4F7EA 3D06A 1URLA 5DD5L 4GS7B 3FH5A 3QDGA 2MMXA 3ALXA 4KTDL 5E2WH 5EU7E 3C9NA 4PTUB 4M3JA 3O81A 3IDYC 2PYEA 3QG7H 5AKTA 4LHUA 2XFXA 2ESVD 5JXAL 2P47B 5ESVA 3HNVH 1D5XB 1KTRL 2IF7A 1YEDB 3OF6D 4NZTL 3VWKC 2X3BA 1P7HL 3V5DB 1S2EA 1AQKH 5E4IA 2J2ZB 2XDHA 3B9KB 3VFTA 5HI4C 2VLME 3NVQA 1JPGB 2HFFB 5JLZA 4O02B 3TPUA 5KSAA 1AC6A 2Q8AL 5D71L 3LPPA 4X0KA 1R3IH 3DX2A 8FABA 3L08A 3TJHD 1UH2A 1C16A 4BZ2H 4CL7A 3DX0A 2QV2A 2XHNA 3RGVD 2D7MA 3MBEC 1FL3A 1LO5A 2Z31A 3FW6A 4R97B 2F9BT 4F2MB 4TUUA 2B59A 5HHOA 1VACB 1Q9WA 1KCBA 1HS6A 2ZWSA 3R1GL 4HK0B 3TU6A 1HHJB 3IBEA 4NNXA 3GIVB 2GIMA 4GBXB 2G60L 3RY4A 3BO8A 5AFAA 3NQKA 4CDHA 3L9EA 1UXWA 4V11A 2WMPB 1T1WA 3LKSB 5AAPA 3KXFB 4QIRA 4J4PD 2R2CA 2ZXDA 2QEJA 2HT4D 1U3ZA 4B5EA 3EH1A 5AD0B 4HUWA 1H15B 1R6VA 2FWUA 4Q2ZA 2OQJA 2OR7A 2ZP9A 4FC3E 3IU3A 4XE0A 4HUKB 3ARFD 4WFFE 1KT2B 1MI5D 2RIKA 4JZOA 3FUJA 1YNTB 4G6FB 4G5ZL 5HP5A 2OW7A 3SO5A 3OKLA 43CAA 3K4DA 2ID5A 5ICZB 1VF5C 4AC4A 5A1AA 4N0UE 3IDJB 2WJ5A 1AYOA 4ICXA 4BFJA 1PKQA 4M1CC 4PI0A 1DVUA 1TZOA 3F84A 1GYUA 5FYLD 1A4AA 3FQ4A 2D0HA 4ODSH 2EKJA 4XXDB 1AZUA 1ZD6A 5IVZA 1OP5H 4CA4A 3CLFL 3EJPA 4IOIB 5KN5A 3SBWC 4XN7A 5E0FA 1KG0B 3OZKA 2GSGB 1SXSA 3RDTA 1D6EA 1PD1A 1I3RB 2RGSA 3QDJB 4RBPH 1B0RA 5CS7A 1QLEH 4GI8A 4LIQL 4QNPF 4HLZH 2W0FA 3O4LE 3ZLQC 2WXFA 4WFGD 4J3WA 4QKXB 5K9KA 2R69A 2IAND 4FADA 1KYDA 4N90E 4YBQD 5TDOA 3BUTA 3ZPDA 2VM3A 3QDHA 3D87B 1RP9A 2X5PA 1NBZB 5K9OB 3UZVB 4NQSA 5CIPA 4BDVB 1MCJA 1TU2A 4Q8BA 5AOMA 4ETYA 2B4CC 3EO1B 2FLMA 3QA3A 3W82A 2CLVA 3HR5B 1TJXA 3VXUB 1EZUA 5IW1A 4NUPA 1KCKA 1LVEA 4IIZA 2PCYA 4RVBA 1FH2A 3PDOB 3A24A 4YIQB 5FGCE 2IDTA 4MNHB 4E0RB 4E5XB 3OR7B 4LOUC 3QQDA 3FJTA 2VSDA 3WDHA 1PEWA 4WV1A 1LM8V 3BVNA 4HSCX 3F6IA 2WSKA 4O02L 4NKDA 1KGWA 4GAYA 1FO0B 1J9TA 1XIWD 2FWOA 3CZUB 3RWFB 1OHQA 2GY5A 1H3GA 1F6LL 2EDMA 2UVFA 1FC1A 1Z9MA 1KJ2H 1MWAA 3D0LB 1YDPA 4P2OA 4HGWB 4AMWA 1ES0A 1FI8C 1BIIB 1BZ7A 1C12B 1HH9A 2LR4A 2PABA 2X1XR 3PWLB 4NQEB 3SBRA 5SWQB 2WYIA 5BQ7B 4L9LA 4RMWA 4WTZA 3X3FH 4WIQA 2BS8A 1XH3B 4IRJA 3HAEA 2FBOJ 5DD1H 2C4FT 2J56A 3M1OA 3DGGB 2AMGA 4OFYD 4PWKA 1OSEA 1FYTA 3QUHA 2WBXA 1ZAGA 3C87A 3B2UD 3EXLA 2XN9D 5E99L 4PGJA 5C0CA 5HVWA 5CU5A 4L4TB 5EEVA 4KJPC 1X9RA 1MFCL 3EKCA 4JRXA 4OJFL 3RWDB 1MW0A 2APXA 3GLZA 4X5WA 3VB9A 4C83A 4DN3L 3QYNA 3DK0A 4QRRD 1JNHB 2XN1A 3DIDA 3BZFB 1I9RH 1KPUB 3H85A 3ZDXF 4HIJB 3QWRA 2AQ1A 1MFDL 4FQXC 4ZTOH 1JK9A 2NW3A 3RUGA 3LQAL 4QHNA 3QXAA 1KIRA 2ZAGA 3W0WB 3B1UA 3TASA 3ZHKA 4FQIH 5JIQA 3OHXA 1A8ZA 1WAAA 4Z7IA 1GJUA 2EE0A 2IVFC 2VC2H 4OM1H 4R2GB 5GS3A 3FZUD 3O2DA 3T6QC 1U4FA 3D50A 3WCYA 1GC1C 5EN2A 1A4KA 5BS0D 2Q7AA 5C09B 5ALCH 2ZG1A 3O2VL 5I1DB 1VGEH 2IGLA 4OD1L 2YJLA 5DD3H 2YMXH 4G7VH 1AMXA 4JFFD 2DYSB 3KPRA 3Q9QA 4LPUA 1G9NC 3WSQL 3AQDA 3BN3B 2BIIA 4BSWB 2C9VA 1EJFA 3L5HA 2UZXB 3C6LD 4NQCA 4PCKA 3SGEH 3B4NA 5HGDA 4PV8B 1SEQH 1D9KC 1HQRB 3ARED 1GY1A 4NP9A 1U3HB 4JZJA 2EIBA 4X5RA 2DMBA 2BHZA 5ISZD 3D0AA 1R4XA 2ICWI 5LGJB 2OI9B 4OLUL 1NDMB 2F08A 2X44D 1OSYA 1J0HA 5ADPL 1LNUB 1G7PB 5I1CH 2EUXA 1QLRA 2IAMA 5TQ0L 5E08H 3LRLA 1YC7A 1JV5A 3LN4B 3VRJB 1R9FA 5EBWB 4MMZB 3RVUD 2DQDH 4XVJH 1KY6A 5HDLA 1NCGA 2F53D 3HBZA 3MJ8B 2E7LA 1MCWW 3T1FB 2VYRE 5F7EH 4JJ5B 1CVSC 4AIXA 2BWDA 4DK3A 1NGZA 2HRPL 1FZMA 4IDJL 5FB8B 3A67L 5KVDE 4LRIA 5GJTH 5JXED 3ZDXE 3OWEA 1Z32X 4J8RA 4KGLA 3REWA 2VKWA 1K8DA 1Z3RA 2M83A 4OTXL 2JV6A 3Q6GH 3FONA 1DQIA 4GFTB 1LLAA 4JFDB 3IVKA 3EFFA 3KYNA 1S7QA 3VXRD 4HWEH 3CDYA 1ZSHA 4FQJH 1T0NB 1SEBB 4OFKA 3BKYL 4LEEA 5C07B 4BM7A 1UG9A 2PW1A 3B3IB 2A77L 2D2CC 4W9GC 2AXGB 1QFWL 4JW3A 1L7TL 4YAQB 5ACMA 1QUNB 2R83A 1U8PB 1I7UA 1HHGB 3OJVC 4NBZB 2VQ1B 5IT2H 3HC0B 4KVNH 3ZE1E 4PJGF 1J1XL 4JAMA 5EC1B 4Z18A 1LK3L 2P80A 3C5SB 4CADA 4QHKI 3T65A 1FH5L 1PYWA 1G7HA 4P3CL 3A6CL 2CDEB 2VR7A 4PLNC 3IXAB 1OAUH 1E6JH 5HJDA 4Q4IA 3RFRA 1CFQA 5EUOB 1YNLL 5IWLC 1HQ4A 4KK9D 4E9YA 1M2OA 2Z0UA 1MFEL 4NKMA 5AAWC 1D5RA 1NAKH 3UPAA 4D94A 4IBUA 1H5BC 1M1XA 3LIZH 2ZKMX 4FJZA 4P2CG 2WOYA 1YECL 1KXVC 5DXWA 2EO7A 5E6IB 1PZUB 5KVGE 1YUHB 5DFWH 1U8OA 1IC7L 2HCZX 1TIUA 2EZ0D 1KYOK 2YQGA 3NA9L 5FOBA 3RI5K 5KVEH 5IY5B 1V10A 2EDBA 5HHPA 2Y5EA 1JK8B 3D9AH 3QJRB 4XWOD 2VL5B 2J6EL 4Z3HA 2YD3A 3MLVL 4QLWA 4YHML 5FCUL 2OZ4H 2G75A 3B83A 3I3DA 3T04D 1YPZE 3FRPA 5HYIA 2DWSA 4HKXA 4U6VL 4N2DA 1CXKA 3GKWL 3VTMA 4MMYB 4TUKH 4GO8A 4IHOB 4TVUA 1LE5A 3QJZA 1FVDB 3LXUX 4GJTB 4PJGE 1NCUA 2OMTA 3N2JA 1AHWB 3WXWL 2YSTA 4G42A 1TQCC 4YHIB 4LDCA 1HAUA 1K8IB 1LE9A 1ORSB 1QHOA 1CTMA 4WSKA 4RWYL 2IPTH 5E9DA 4AIZA 4A7GF 1A8JH 3VUAA 2A9DA 4F92B 1AFVH 2TRHA 3BYYA 1GPOH 1S8DB 3TIEA 5LCVA 1E4KA 3CFDA 1GVIA 1ZLUH 4BA0A 4NT6B 2WN2A 4YOKA 1RZ7L 4KZCA 3QIUD 4ZT1A 4R9HA 3HE7C 1E50A 5EOQL 4LHUG 4PVNA 2EDHA 3WIIL 3D39B 3SO3B 1TMQA 3TJEL 3G9AB 1UCTA 1JJUA 3U30C 3P40A 2RHEA 2AABL 2NX5B 4HQQL 1FAIL 3L3HB 4FLRA 3DWTA 2ZAHA 3L3JB 5CSBA 5DMKA 4PRPD 1REIA 5DVKA 2I26N 2DLHA 3FU7A 1GW6A 4HKZA 1QA9B 5FYKU 2X4OB 5C0NC 2DPKA 2Z4QB 1UB6B 3NYKA 2LU4A 4ZOEA 1FSKB 3G5VA 2JKSA 4CGTA 3QNXB 4IGBB 2ZONA 5BRQA 1FORL 3FQ1A 4EKJA 2VDMH 2GITB 4FNQA 3DTXB 2FAUA 1IAMA 1PDKB 1SMDA 2M1KA 4HH8A 4LVNC 4OT1L 4I9XA 3ULSB 4B9FA 5D7SH 4LMQI 3TF7C 3MV9D 1EDQA 3MRNB 1YUKB 4X80L 4KK5C 5D2LA 5KJRH 2BCKB 4I77H 1J8SA 4LLDB 4U1NA 2Q3ZA 4WW2F 3UGUA 5BVPH 3DX6A 3KL0A 3SJVD 5F8RC 3S88L 1W0WB 3O8XD 2Y23A 5DJ2A 2VJ0A 3FU5A 1FAKT 4YHPB 1KYFA 3UACA 1VFBA 2D8KA 1A4CA 1IB5A 3T8MA 4NUMA 2ARWA 3DHJA 3ABLB 2DICA 4UDTA 3K1KC 2CU9A 4AW7A 3MOBL 4PV9A 1MH5A 4X5XB 2VDRB 1NUFA 3KXFD 4XCEA 4OKVB 4HS6A 4XN2A 2RH0A 2BY0A 2YD0A 2ZSWA 4OI7A 1F3RB 1ECZA 3MROB 4Q9RH 2WXRA 5JNYA 2ADGA 3LV3A 4NQDE 4IBWA 1MHHB 5EU4B 2E4TA 1J0KA 2XWTB 4GRLD 2Q8BH 4AV5A 4Z76A 3QR0A 4G6FD 4D8OA 1RKRA 3LOWA 1I1AB 3C5ZD 1OB1B 1QQDA 4LPYA 1ILUA 5T3ZH 4CN6A 2XX0A 3K6OA 3BGAA 3RWJA 3S34H 3T4AA 3MDJA 3US0A 5EPMA 4PRAB 1NCWL 3IF1A 5JORA 1BFTA 1PLCA 3PL6C 2GTQA 5A2AA 3WO4C 2ADJA 5IR1B 2VN7A 4FJYA 1YLBB 1XF5B 3W9EB 4ZMVA 2X0VA 4HETA 1G7MA 1A64A 1RURH 2IFFH 4D3CH 1E5UI 2YXVA 3DIFB 4MQ7A 3V4PA 4MA3A 3DSNB 4X42A 4LMQE 2PTTA 4WEEA 1HZHL 2P24B 3FOLB 3OKYA 3GMQA 5B1JC 4KOBA 4OF3A 5FUZL 3ULVH 2W91A 2A9NL 4B3EA 1AGDA 1GYAA 4DKEL 4OZIF 4MJ4A 3ZZQA 5IVXB 3TURA 1UM5H 1T5WB 1VEPA 3EOAB 2HFEA 4ONHA 4J3OF 5BV7H 1DO6A 3MLZH 3B9EA 1SVZA 4GXUN 2XRAL 1RLBA 3BISA 3RX9A 4W4NA 3AW5A 3OSKA 2E74C 3QXUA 1AR1B 3OPZH 1RZKH 1CQKA 1WFOA 2VE6A 4ZXBB 3WTTA 1ZIBA 4M43H 1WD8A 4LRNL 3M7FB 3NGBC 4MXWH 4K5MA 1DEDA 3O3BB 4OFIA 5KBDA 4L9DA 3G6DL 3BUQA 3HFMH 1NGQH 3DUSB 3TESA 3DX1A 3CVHA 3SDAD 3CDGA 3F7VB 3SCMC 1IBYA 4G59C 2NYKA 5ECJE 4P06A 3QDMA 4W9DC 4LP5A 4OZHB 1OK0A 2Z35A 3OWRA 4WTZG 5JW5A 3IWUA 2WSDA 4JFWA 1NCAL 3HAEG 3MBXH 4OU3A 3CZFB 5DZPA 3NK4A 4CC0A 4P5MB 3UG4A 1WITA 3L95A 2EAEA 5J9PA 4DKDC 2P7TA 1A7NH 2OTPA 4WHTA 1XSJA 4AT6A 5DJ6B 3MLSL 4Y19E 4J6IA 3NN8B 4MDIA 2JQMA 1I7TA 2CGRL 4CMHC 1RIHL 5HVHC 1YEFL 3ABGA 4NDMB 4N6QA 2PMZA 2VXUH 3EDDA 4GH7B 1Q0EA 3VAEA 1YEJH 2NY6D 2VERA 1AGCB 3FTYA 3EYVA 1I1RA 2CIIB 3LPFA 4OZIE 3QI9B 4XNMB 4DEUA 5CCJA 5L2JB 2J8OA 3KCPB 5FW6A 2P8LB 4XPAH 4B95C 3FCTB 2B5IB 4HF5L 3OAUL 4KBPA 5HY9B 2FJUB 4ABQA 3S36L 3DYMA 3HRZC 2X53A 1DTUA 3MLTB 1OOWA 4GNKB 4XCNA 1G6RH 4TLTA 4PJ7E 3HCVA 3DJTA 4UF7C 5DVOA 1HKLH 2JLLA 1Z9OA 3B34A 3WJMA 3M17A 4BE5A 1OCZB 3H9SD 2VDNB 3I75B 3BH9B 1B4LA 2OTUA 4BK5C 1YNKH 3FUKA 2GY7B 5T1LB 4FS0A 4JZNA 2KERA 4KGJA 2NY0B 4MCYB 4WJKB 3E8VA 3P77B 3ZHLA 4K15A 2J5LC 5F71A 2DM2A 5IB2B 5AB1A 1OTUC 2CDFB 4WHCA 5EF3A 4FULA 1BV8A 3LH9A 1FPTH 4ODHH 1OE3A 1CDJA 3PYCA 4GW1B 4PJHA 4OM0H 4ZSOA 1FLTX 1WV7T 3P4NB 1D9KA 1FE8L 1NBVL 4R3SA 3TWCH 3W11C 2BOCA 1JPST 2Y2YA 5IHWA 3BMVA 4JQIL 3VGGA 2A9ML 2JKIS 3IDNB 5IB4B 5J12B 1E4WH 3MRQB 4PJCF 1T89A 3TFKD 2R8SL 4RNRA 4H88L 5AVTB 5GRJL 2OTWB 1NC4A 1IM9A 3GRWA 4A2EA 3E1F1 4D7PA 1K2DB 4JFPB 4KROD 4BH7B 3I6LE 4YHNA 2IO5A 4ZAKD 3RVXC 4G9FA 1X5ZA 2HTLC 2E4FA 5IGXL 4B3VA 2BS71 1GA2A 5D5MA 4J3VA 3ZTJG 4Z7QB 4PLOB 3P30L 4PJ5E 3IM1A 3PJNA 5JHBA 3IU4L 3SDCA 2CLZA 2QSTA 1RZ8A 4NIYE 2EIDA 1T2QH 3LRSB 1P1VA 4ZO8A 3U1SL 1NJ9A 5FV2A 4G6AC 1PX3A 2BWQA 3VMPA 3S9DB 3QHZL 3RTLA 4MJ5A 1QWUA 3FCGA 5EU6A 3N85H 2DQCL 3HC4L 2Y36L 3CHXA 2CKBB 1T21B 3O6LL 3GSOA 4TVPE 2DMGA 4OZFB 1G0YR 5I76A 2GEQA 5C07D 1M7DA 1U36A 5KSUA 1N26A 4L8SB 5DSCB 5FYKL 1S9YA 3ARWA 1D2PA 3FU6A 4FMKA 4Y89A 1BAWA 1QLEB 3NRQA 1INDH 4L3EA 1XAKA 4EQ2A 1JRHI 1OGTA 3GHPA 3VU2A 4OF5A 3WEXA 2VXVL 3IMVA 2AKRB 4X6DF 5DFVD 4KAQH 1QRKA 2ZOWA 3MX0A 3OAWA 4N4YB 5E2WL 1R24B 2CHDA 3TBSA 1NZRA 2TRYA 4JUTA 3WNJA 3RILA 2G3MA 1BMGA 1S7UB 3MJ7B 2Y06H 4X4ME 5JHLH 3V0EA 2MCG1 1IQWH 3QG7L 1TENA 4PJCE 1IAKB 3P9MA 3HKFA 3WIAA 2VDKH 2DI9A 2R4RL 3H9HB 3HNVL 3NJMA 3NCMA 1QTSA 5IWLA 4WNQB 1NMBH 5IBTH 5TFSH 3HOGA 1EMTL 4L8BA 4P5TD 5D7JB 1X5GA 4Z77A 1CBVH 5T1DH 4JKKA 5DQ9A 1BQLH 3K0WA 4Q6IC 4DSYA 4HD5A 2D7TL 1GZHC 4HLEA 1R3IL 1OEZW 3PFQA 4GRWE 1KGCE 1U3NA 4ZFOA 1BVKB 5FLVA 4KWUA 1KJ2B 4BZ2L 3DURB 2I9TA 1BX2B 3TVMB 1BZOA 2OXGA 3OLDA 1G7IA 4G9DA 4RIRA 1GIGH 5LNGA 2FX8H 3G5YA 4OJCA 1JFQL 3FRPG 1ZHKA 4JY6B 1GZQA 4QHUA 4UQ2B 2XWEA 5SWSE 2EUVA 3OM3B 4MXQD 1ND0B 4N8VB 5DI8B 4EIZC 3T0XA 2GJRA 3L4WA 1OE2A 2PWHA 5DLLA 1D5MA 2E6PA 2O61A 3FRUA 2ZKHH 4I9WE 5DD0H 3T0DA 1KN4H 3MRGB 5CGBA 1CDUA 2O4EA 1K5WA 4LQFH 3H0TA 2G3ZA 2Y1AA 3SPHA 3ZT7A 5D1XA 4Z3FA 1N0LA 3VFUB 1G7LA 1CGUA 2K78A 4X6DE 1OARH 3QORD 1OZTG 4FLHA 1EGJH 4L0YA 4Y9BA 1OD9A 1WFJA 1YY9C 1P4IH 4YNYB 4LBAA 1A1OB 2R51A 1W80A 2HX8A 3FB6A 5CCKH 2ZUXA 4N0UA 2EDRA 1KJVA 1D5BB 3L3OB 5ICXA 4PR5B 4RSYA 3S7GA 4ZK8A 4ELDA 2VC2B 1H3PH 1DSWA 4LCYA 3IT8D 3PV7A 3NJHA 4KDTA 5KBLA 2BW4A 4CW1A 3CN3A 4YFLI 3F7LA 1UEMA 3TZVB 3UEQA 3KYOA 3V2AR 3R0MA 4C56D 2AQPA 3BKJH 2WKGA 2BNRD 1L9RA 2NX5D 2EIZB 3O4LA 1QLEL 1ADQA 4XO9A 3PNWA 4P8QA 3RWIA 1IM3B 5J1SC 2LU7A 2QTVA 4NWUH 3MV8A 2G5RA 4WW1B 1M7IB 2HWZH 3BKCL 3ZZSA 3D0VB 4W4OC 2YBGA 2WKOA 4NWTH 4WUUE 1ZLVK 2QPSA 4WJ5A 1I1FB 4JO4H 4O51A 3MJ9H 4APQA 4IGBD 4QTFA 2GPZA 3GBNL 4U1MB 4LHQB 3VXNB 2EP6A 6FABH 5BJTB 1WYJA 2J88H 2V3FA 3B6SA 3IRCA 2KL6A 4S1RH 5AEAA 5KSVB 4HX1B 2KC0A 4WEUD 3EOBB 3FSVA 4AJ0A 3DPBB 2EEXA 3UCQA 5SX4I 1N68A 3O41A 4NLHA 2EC9T 2MQ0A 3WY2A 2EDLA 4K9EC 1DQQB 4JG9A 2FJHA 3I74A 1BECA 2BW5A 4IM8A 1U8MB 1TPXC 3AUWB 5IEKB 5GHWH 1CI5A 1CG9A 1IQDA 1T83C 3X3GH 3I6GB 1CXFA 5DMIH 5FA4A 3T2NH 1QSEB 3L6FA 4JO3H 1JDDA 2KI6A 1A1NB 1R5VB 4PWIA 1C7TA 2CCWA 3OLIA 4B7LA 3S48A 1A6AB 5HYJB 3X3FL 3WHXA 3JWDH 1P7QA 1MCRA 1T1XB 2JWYA 3D48R 1W72H 3VNZA 3VXPB 4LCCC 4E9SA 3N42F 4JHVA 5D6CB 1ID2A 2OXHB 3ET9F 3ZIYA 5I24A 3MRMA 4KPHH 1NEUA 3TBWA 4HG4K 4YPGA 3D85B 1S7VA 1RVFH 4QT5B 2YGPA 4C59B 1FWXA 3TA3B 3GS7A 3ROLB 2Q9OA 1NDGB 4KC3B 3O3EA 4J3OC 5DA0B 4JG1H 1BP3B 1IIIA 2J1WA 4X6CB 3BAEH 1CFSB 1AR2A 1ZA6A 3TP4A 2VAJA 4G80A 4ZTOL 2H1LM 4FTVE 3HUJB 2FBRA 4YL9A 4XMUA 2DDQH 3ULAB 1W2KT 4ZYKB 1TZ8A 2HT2C 4XNZB 2N1TE 5E1GA 1RUAH 1FV1A 2VC2L 2ZOUA 1E65A 1UACH 3ILEA 4FNLL 4N0CD 3K2KA 2XVBA 3CK0H 4HIPA 5FKAB 3SQRA 4GSUA 2V2WA 4UQBA 4CVZA 4LAQH 4LCWB 5MEQA 3STZB 2B16A 1QI3A 1LWJA 5ALCL 3BRGC 1LP9F 1VGEL 1TZHA 3ETBF 1KGUA 3IS0X 3DRQB 3L5JA 4G1EB 3T2QA 2GSIA 5DD3L 4G43B 4G7VL 2CMRL 3DOHA 2NY4C 2IPKB 5FO9A 4P07A 3I02B 1CLZH 4ZXBD 1PD6A 3CHRA 1JS4A 3RLSA 3F7QA 5JDJA 5EZLB 5D7LB 4PGBA 5IOPA 3GI8H 5MEPB 1SEQL 3UZEA 5B8CC 2ATPA 3P9WB 3APMA 4TF4A 4KNQA 2ZWLT 5BO1H 1E9OA 5T5FA 2W0KA 4AL8H 1MFBH 2XQYA 2RFXA 5DD6B 1ZSDA 1XXFC 4MA8H 2BHYA 1XF4B 4M7ZC 4QTIL 2IH3B 3PGCA 5I1CL 1OCCB 2A3TA 3T3PB 4R96A 4Q52A 4OI9A 5IHUL 3CZEA 5HJGA 4UINL 3THMH 3LN5A 5IQNA 3B2VH 5E2TL 5JIPA 1D6VH 4L0PB 4DPRA 4XVJL 2G3XA 3WFCH 1AGFB 5IB1B 1P4LA 4M1GL 4LKXA 4UTAA 5F7EL 4QOKE 4LFHG 2KPNA 3WJLC 3H7BA 3KLSA 4WK4B 5IIEA 3BFWA 3APDA 4ZUSB 4FXGA 5FYLE 4ADJA 5EBLA 1EZLA 2DQIH 3Q6GL 5DZOA 3QEHA 3KPMA 4IRSC 1WC7B 4WFHD 3WE6B 2DTSA 3NFPA 3VSQA 2XU9A 5EF2A 4WHDA 1YMHA 2JLPA 4HWEL 4WI0A 2EDOA 4Z7UB 3VFPA 4FQJL 2CUHA 1EEYA 1EEZB 3RKDC 1FN4B 5ACZB 5DFAA 3KPLB 4WFGE 1PX4A 2ZUSA 4Y4FC 1BYOA 3GS4A 3S3CB 1R3KA 3BHBA 1GS6X 4GAFB 3L5IA 3WTVA 3VD0A 1AD9B 1PNDA 2CR0A 1WLHA 4Y1SA 4C4KO 1CL7H 3BIKA 4MSWB 4Q97A 5E4AA 1JVKA 3WU1A 1T4KA 3NBNA 5INCB 2WLLA 5IKCA 3DMMC 2VAAA 4M6AA 5LNDA 1O0VA 3POHA 3J7HA 1SUHA 5ELIA 1UURA 4WJG3 1SDYA 4UQDA 1ZT1A 1A7OH 1ZE3H 2ZOOA 2HG5A 2VDMB 2R0WL 3G6AB 1W8OA 1NTDA 2HTKC 2NY0D 1E6JL 2YPLE 1C8QA 5DJ8B 4H25B 3EFDH 1PSKL 2HXAA 5JQ6H 1T66C 5AVSB 4XXWC 1DLHA 1G1KA 1FNSH 4JBSA 2YBRB 4R4FH 4TTGA 4MA1C 2O26U 1ADWA 1I9JL 3MHZA 4NZDA 3VWJC 4JFXB 5CJQH 4CN4A 3G7TA 1V7NL 3Q5OA 4JNXA 3FQTB 4KRPC 4FFWD 4UDUA 1PZ5B 4MNQE 3L1EA 1C9SA 1L4IA 5IJVA 4KUZH 2DEYX 4AYSA 5AG9A 1ZT7B 4ATTA 4JLRB 4RAUA 4OH2A 1ZPLA 3QRGL 3D9AL 4S0TD 5HJBA 1QI5A 3HHSB 1HIMH 5DEZA 4AJYV 4ENZA 2BRQA 5FHAH 2B20A 1OSZB 3OGOE 4TNWF 3S5LA 3CPUA 5IB5A 2V37A 4RGOH 2OZ4L 3KWWB 1YPZA 3GBMH 4WUKH 2IGTA 2OL3L 1IGYB 2F1EA 4QRRE 4X7FC 2OS7A 1BXAA 4F7CB 1MNUH 3CH1A 1TQTA 4KQ0A 3CXHJ 2VW7A 2PPFA 1BJ8A 1ZV2A 2VERN 4TUKL 2NZ9D 3ECUA 4NM8H 4YVUA 1U8IB 3UYRH 3X12A 1J8KA 1N0XH 5J56B 3UMNA 3WDIA 1A9VA 1PG7H 3HNTH 2R56L 12E8H 1YVLA 4NZ8A 3PQYE 25C8L 3QIBA 4PJ8D 1FNGB 1L9TA 1R3LB 2V2TB 2HVBA 2VLKE 1JPTL 5DQDH 2PXYB 1KB3A 1YYMH 5EA0H 5DVMA 4QY8A 2CR6A 5F7YC 5DHVH 5T1JA 1AFVL 2DMKA 1TVBA 1JNLH 1GPOL 2PYEB 3MRCA 5T3XD 5HHNA 5KYWB 2B39A 2AC0A 4FABH 4FFYA 4RFNC 1N59B 2IPUG 5IJKA 3GSNA 5AL0A 1XGYL 3TO4D 3RFZB 2J8HA 4JKNA 2VR8A 1PJ9A 3HHMA 2HRHA 4ABUA 5C6TH 5FKPB 4AK1A 3EJZD 5DZVA 1FHGA 1KTDB 3MTRA 3S36X 5ISZE 1FBIL 2AJZA 2GBTA 2YSSB 2XOTA 3WTXA 1YC8A 1JGVH 3APCA 1YN7A 5INDB 3T77B 3IGLA 3FOMA 2OCCB 4TRPH 1MHEA 3MRHB 2TAAA 3UAJA 4PY8I 4YZWA 2Q3XA 3MMEA 1LEIA 5EIQA 5D7JD 4D0DA 3FS9A 1FL3B 2Z31B 5CBAB 4S1QH 4TN9A 4ANUA 3L4YA 3T6ZA 4Q6IA 2DBLH 3ZDZB 3D30A 4V1DA 5IROD 4OZ4B 2BVPB 4NNXB 5SX5H 1KEGH 2P44B 5D7SL 4ZUUB 3X1FA 3T0EA 4HWUA 2I85A 3BO8B 1UWGH 1QTYT 3O9WB 4I77L 5HGHA 2ZIDA 4AZ8B 1UXWB 1PY0A 1R1CA 4HAFA 5C08B 1JV2A 1P2CB 4EXPX 4JRWA 4K5PA 3VA2C 5L9DH 5CN2A 5EZJA 4F7PB 1D7BA 3LN9A 1JDAA 3X1NA 1OP5K 4HUWB 3VXMD 5MENB 4JL1A 4IU2B 3IJYA 3ORJA 2X87A 4MQXC 3QGVA 3IU3B 2VZVA 4MDJA 2QQQA 1JPSH 1MFVA 3MA7A 4Y2OB 2ZX5A 2F19H 2GK0B 2P5ED 2EADA 1SJEB 2CPCA 3C09C 3I2CH 3KWVA 4H1LH 4U33A 4XOEA 1FQ9C 1FNHA 43CAB 3S8FB 1HEZB 5E03A 3WLBA 2EDNA 4PJFF 1DBJH 1CIUA 2UZYA 1KBPA 4LCUB 1TQSA 3BEVA 2IWEA 3LSOB 3ZTDC 4YSRA 5I0DA 5B7EA 1X3DA 2FHFA 1AIFA 2O5XH 3GXTA 4FNUA 2Q8BL 4WY7L 5CEZD 3WIFA 1IEAA 3BDYL 2YN3A 2NXYB 7TAAA 1G6RB 4GIAA 5EC2B 4GUPB 4H0IA 4W9LC 5DJAB 5JOPD 5I9QB 5T3ZL 1ZRUA 1D6EB 3CJJA 3MA9H 4PTTB 1J8HB 3IJ7A 3B2PA 1FL5A 5DMGD 2J43A 2J73A 3U82B 5JTWA 4AI7A 3B56A 1CO1A 5TDOB 2FEEL 1JXDA 4OJEH 2JB5H 2WYTA 5BPPA 2IFFL 3WJJC 4D3CL 3B5TA 4M3HA 3JZ7A 4NQSB 2E9GA 1IBHA 2F7OA 4JN2A 2EXTA 4WW2A 5DJDA 2WZPA 4K3GA 4AQEB 2X2IA 3QA3B 3TJHC 4KNSA 3BT2H 3ULVL 1S9XA 3D05A 5C0AD 3RGVC 2OX5A 5F9WC 1BFSA 2WQXA 5DEGA 5IW1B 4J23A 1KN2H 5KW9L 4AEFA 5BV7L 4CNIA 2OMUA 2XVGA 3OAYH 2XY1A 1SYSB 3GMLA 3PXJA 4ZBJA 3WN5A 1RZKL 1QFWM 4WV1B 3BVNB 4M43L 5LB1A 5KG9B 3QNZA 1JOIA 4HV8A 4MXWL 4DO6A 1AYRA 2FWOB 2X0UA 4J4PC 4WF7A 3KZ8A 1NAMH 4PJFE 3GJFH 1I1YA 3SKNB 2VOTA 4R8WH 1LILA 1ES0B 1HH9B 3IETB 1AXTH 1U8HA 4F37K 3MGTA 3ARFC 4K7PH 3SEPA 3V9FA 4UB0H 1EO5A 3MOAH 3S3JA 5PAZA 1CLOH 2FYYB 4B50A 2GVYA 3ARUA 3BP4B 4LBEA 1XT5A 4A6YA 3P73B 1RV6X 3F58H 5IEHB 1WRFA 4JEGB 4G8EA 4Y19A 3KVQA 3UIZA 1S4IA 4JS7A 3CBJB 1U4EA 1X9QA 4GAJH 3NSCA 1ML0A 1NWOA 3ARDB 3EYFB 3QRFM 3IJSB 5HYJD 3PWPD 5KSBE 4U1SB 2XWXA 3U0WH 4C83B 5IHLB 2YMOA 3LZRA 3VVVA 3S4SA 1CFMA 4L29A 3E9TA 1SLXA 5L4JA 1HILA 2XXFA 3DOSA 4N0RA 4TPRL 1I8MB 2UY7B 5AOKA 1PU0A 3NJXA 5JPNA 1NPJA 2VXUL 3QXAB 3D85D 5ESQA 1YNTF 1TLMA 5EU5A 4RRPM 1F6AB 3V0VA 5IMMA 4EZMA 4PRIB 4Y2LA 1SM3L 1J10A 4M5YL 2MKLC 4YBQC 5KS9B 2XBDA 1EDHA 2C3GA 1EXGA 1LEGB 5K69A 1SXAA 4P59H 4F1ZA 4P46C 2N59A 3GXFA 1MUJA 1A4KB 2VDKB 3IB4A 4PJ7A 1AXSB 2NSQA 3KJ4B 1M53A 1SHXA 1G6RL 2EIEA 2ETWA 3OKKA 3WS6A 5JIDA 1G5AA 5B38A 4ODVL 1HNYA 3L3DA 3L3KB 4M6OH 1P7BA 1MRDL 2PCPA 3B7SA 4FLQA 4LEBA 4EDXB 1NH6A 2Z91A 4JM2B 1DQTA 2ITCB 2BZCA 3WNIA 4NUQA 1YNKL 1TQBB 3T0BA 4BEIA 4WU5B 3GUTA 5A2FA 1RIUH 2KYIA 5AW0B 3SJVE 3IYLW 1ORQA 3FB8A 2I25N 4D2NA 3N40P 4UZSA 2F5BL 2YC1B 2FTAA 4N25A 1XIWC 3U1PA 5GS1B 4NHUA 5FS5A 4FAAB 1FPTL 2IJ0C 4ODHL 1ESOA 4HIIB 5HPMA 1ZVSA 4AQAB 5EOTA 5FIEA 4NB7A 4HJGA 4NN5B 3TWCL 4XO8A 4ZMXA 5IJCC 2G30A 3P1VA 4ETQA 2EVJA 3KXFE 1I4FA 3ARBC 2DQTH 3UROR 3BXNB 3IN0A 2VLRD 1A0QH 5ERWA 2WTRA 4P23B 1N18A 3IMSA 4JVWA 1AS6A 2E0PA 2RCSH 4J8RB 3G5ZA 5J11C 1WIPA 3B2UC 4W6XB 3CN2A 3KPNA 3NCXA 5FYJH 1KIQB 3S3PA 1DCLA 2G4EA 3CC5B 2YA1A 4IMLA 3GMPA 3VI3B 2YUWA 3FONB 4LCIH 4K07A 1QYGH 1W0VA 1GOHA 2Y6SD 1BMWA 3DC0A 4P3WA 2CG9X 3F6LA 4NGHH 5I6MA 1XL6A 2AJXH 2C9XA 3QEUA 1G9MC 4J8QA 5FGRA 1USQA 3DKHA 4YSCA 2WVTA 3FAWA 1XZ0B 1OM3H 3H3KA 4PMEA 1QFWI 1NGYB 1OWWA 1KWKA 3PHOB 3BZ5A 1UWYA 2XQ0A 1GKEA 3QDJE 1EFXB 3FZUC 1DQVA 2JQAA 2X6VA 2FUTA 2KZKA 5HYFA 1AO7D 2K3HA 1GYVA 5HTSA 4A39A 4JAMB 2Z6FA 2WXQA 3DX7A 1XGUB 1N4XH 4HJTA 2BSED 4GXFA 4R4BA 1PYWB 3U7AA 5CD3A 1INDL 1TR7A 2BNUA 2R0LH 4WU7A 5GISL 3LXAA 2YA0A 2RA1A 4HPYL 4GQRA 3C6LC 3GZKA 1ODAA 1I7ZA 1U92A 2PTVA 2X4UB 3AREC 1I8KB 3J07A 4NKMB 3Q44A 4X4MA 5D4JA 3VXUE 4I18C 2JF1A 2FD6L 3CFIC 2HG0A 4MNGB 4OBSA 3C08L 1KJMB 5JHLL 2NNFA 3GSUB 4QYAA 3UP1A 4I1RA 2Y6TE 3KPSD 3L7FB 5IFHL 1OQOA 4JRYD 3F6JA 2VDKL 3F3HA 3SDDD 1UOKA 1KPRA 3TC9A 3AXLB 5DC9B 4XTRD 2ZUWA 2H2PD 4P04A 4XXWA 5LG1A 1BEXA 5TFSL 2CK0L 5AENA 5FOBB 1QR1B 3QSKB 2I24N 5D6DC 1CBVL 3RVUC 1AP2A 2I9LB 4WI3A 4Z3JA 1C5DA 1OQXA 1UGNA 1BXXA 2QL1A 2C9AA 1R0AH 3M86A 3ZXAC 1BQLL 2DZEA 3HIZA 1X5FA 1IC4H 4UU9A 3LD8C 4NQEE 5JXEC 2K9UA 2NTFA 3VGAB 1F11A 2FJFB 3FHAA 3S5LG 1E42A 2WUCL 2WVVB 2X6UA 3TBVB 4HJ0D 1O6SB 4G6JL 2FX8L 2V8MA 4HKXB 5L2KD 3INUH 5SWSA 1WH0A 2VDOH 4DCQB 1Z3GH 3Q8CA 3NFSL 1LE5B 3UJJL 3MUGB 5M95B 2IH9A 2QSCL 3OMIB 3FQXB 3CH8A 1W72B 3BZ4B 1G7JB 2LABA 2OMTB 3WMPA 2WKLA 6PCYA 1YEHH 3R4RA 3KGRA 4FFZH 3VXSB 2ZKHL 1A9BB 1HVXA 4JUSA 3GI9H 3HTLX 5DD0L 4HU2A 1OTSD 5IBUB 3F64A 4DP1X 1KN4L 3MLUH 4GMTH 3OKMA 1MRFL 1SOSA 4QHMB 3BP6A 5H8DA 3L13A 2V5MA 5GSRA 3I9GH 4P2AA 3TIEB 4HPOL 4RQQA 4UWQB 3IE9A 4Z7VF 3R7QA 2ZXAA 4NPKA 4HAKA 5CSZA 1EGJL 1DUZA 4JB9H 3II1A 3BPLB 4M6MH 5EUKA 3GLEA 3ZGIA 2BXYA 1UZ6E 3QDGD 5DK0A 5CCKL 4WO4B 3OV6A 3Q06A 2ITDA 4OLYH 5C09E 2Y3AA 4I48B 4NNYA 2PYED 1UVQA 1H3PL 4LHUD 4KK9C 1INQB 1CE1H 4OGAD 1E27A 4FNTA 3MLXH 1NGWA 1HSBB 4PRNB 1CXEA 3ZX1A 1S7TA 3ZYIA 3CHOA 1YEKL 2H26A 2PW2A 4YBLC 4BGDA 2A5UA 4PJXB 4FG0A 3SYQA 4HUXB 4HIQA 4UT6H 1ZGLB 3SDXA 2EZ0C 1MG2C 2AV1B 5KSAD 1G4MA 2DIAA 1J0YA 2Z8RA 4WUUA 3K72B 3NJFA 4XWOC 3ECBB 4WWKA 5EUOF 4NWTL 3RZCB 5I8CA 1EK3A 4TQHA 2Z31D 1R33A 2CSPA 4P2RB 1M56B 5HDQH 5HHOD 6FABL 3W3BA 2J88L 2WTOA 3ELQA 3LKRA 3MPCA 4JE4B 4S1RL 4X5QA 1YY8B 5HI3D 4QWWD 4X7SH 4DOHB 1BPLB 4IIQA 4D9LH 3HZYA 2W94A 4XBPA 5F6IC 4TVSa 3F62A 4R0LB 4PV9B 5CJOH 1MH5B 5ESAB 1DSYA 1CFTB 4Z7VE 1GKOA 3V0JA 2UVEA 3EW3B 2ZSWB 4JFDE 5T1MA 1VSCA 5I0WA 3OXSA 5GHWL 3X3GL 4HUMB 2ADGB 5DMIL 3LV3B 3T2NL 4ZMLA 4JO3L 4N9GA 2NY5C 3ESMA 4ODWA 5C07E 4M8UA 3X14B 5D93B 1A4BA 4KKCD 43C9B 1WG3A 3GT6A 1U8NB 5EHFA 3QIUC 3BIAX 1QQDB 3JWDL 4R4ND 4E41B 4B9CA 4B9ZA 5GGTA 5EH1A 1E2WA 2EQDA 2L7UA 3AXIA 3PP4H 2W07A 2IWFA 3RNQA 4XMKL 4K71C 2HJKB 1E3ZA 4R7NB 3E7JA 4NJAH 1RVFL 4GI6A 3O3DB 4ZPTB 5GGVY 3WKYA 1G7MB 1I8LC 1SY6A 4NPYB 3RDTD 3RU8H 4JG1L 1E9QB 1EXUA 4X7EC 5I6KA 5EUOE 1CGYA 3BDXA 4N2LA 4FTVA 2EE9A 2GB2A 3T6XA 4FL4B 5DTFA 1N8ZA 3MACH 2NY1D 1UD8A 1NMCC 1K85A 4ONHB 3U46A 2DKSA 4EXKA 1L5GB 4XNQA 3NSYA 5GSVA 4PI2A 3CLWA 3EDJA 3WL9A 4L4VB 4M03A 3ZJAA 3PWNA 1KCLA 1RUAL 1MLCB 2JIXA 3A5VA 3WN6A 1UACL 2XZQH 4Y4KA 1S7RA 5K39A 2NNCA 4LAQL 2HP4A 1TKWB 4JMNA 1QSFB 3QQ3B 2WXMA 4R97C 2VJ8A 3O8XC 1QSVA 2B2XL 2VLLB 1A1MA 4TQ8A 2VMEA 5IESL 4ACTA 3CVHB 4NENA 4PRDA 1HTYA 2HVKA 2R29A 5DUMH 4ZUVB 1CLZL 2G2NA 3N41B 1HSAA 3KG5A 4G3YL 4OF8A 5ICUA 2Z35B 4Q89A 1IX2A 1NOAA 1JXGA 3DVGA 4OLWH 2WSPA 5JW5B 4MFHA 2P8PA 5F1KC 2CJ3A 2QLVB 1ZJAA 5BO1L 1I3VA 3L95B 3ZKQD 4P2OD 4AL8L 1Z6JT 4Y9FA 3L5XH 2HRLA 2CJUH 4MA8L 3RL1A 4GRLC 1PW3A 1A25A 3IFNH 3THML 5DS8A 3B2VL 1FFQA 4B9KC 4PG2A 3C5ZC 3EUDA 2UWEA 4FYRA 2D0GA 4QOKA 5GS2D 3UAAA 1CR9H 3WFCL 1FYTD 3S4SG 2BINA 4IQHA 4XPGL 1PY9A 3HLAB 5BCAA 1ERNA 3D4GA 5C0CD 1CF8H 3EYVB 3UJIH 2ZOKB 3QYCA 4JRXD 1I7RA 3N1MC 5D2NB 2EC8A 2R59A 5DHVB 3D39E 1X6NA 4HKBB 4WCYH 1J05A 5DRWA 1GZPB 3SPVA 3CBKB 2RB8A 3QWRD 4PW4A 2NX5E 3BW9B 2PWEA 4M7LT 4JDTH 2XY2A 3UO1H 1QBMH 3CFNA 3NCBB 4Z3EA 5FFLA 1S7XA 2AK4A 1O9VA 1U41A 2XWBB 2ZQKA 4PWJA 4LESA 2HMIC 2K7PA 5B38G 1U58A 1ZHNB 3GSRA 2WXPA 1DQJB 4P46A 1HYSC 1ZTXH 3CFKA 1G94A 4OY9A 3DX3A 2OTUB 5C9JA 1U91B 4PBDA 2BJML 4QTHB 3AM8A 3PAZA 3QUMA 4JZNB 1VKXB 3NAAH 5HHMD 1J86A 5IB3B 1N2RA 4EI5A 1CE6A 1U95A 5L4FA 2BWIA 2HJLA 2WQ8A 1FNEB 4A2GA 4CBZA 3ISRA 2IAAC 3T4YB 4J5VA 3DV4A 4NQCD 4PJHB 5T5NF 5FGBC 4L5FH 4HEME 4ZSOB 1VADA 2OMVB 1IKNC 3SDAC 3GHEH 1NL0L 2YPLA 4LP8A 3SPCA 3BSHA 1M71B 1F90L 4YDMA 3BLKA 4Y16A 3EFDL 3V8CA 5BRZB 1BQHB 1A6VH 4X9FA 1W16A 1Q94A 2H3KA 4QXTB 1MW1A 4E9LA 3MUJA 4I1NB 4BZ1A 2XG4A 2IAMD 1CPUA 5CJQL 3T8XA 3CE1A 4MNQA 3H2WA 4YHNB 3EZJB 4LVOC 4UM9B 5ITFA 3CHPA 2BSRB 3ARBA 4JCLA 4KRMB 4BJLA 4MHHG 4DKFH 5JW4R 2Z64C 3TONA 4KUZL 3VDBA 1WVZA 3E6HA 4A68A 4H1LB 1HIML 5I82A 3HZ3A 2F1AA 4OZHF 3TN0A 2NW2B 5J06A 2NY6C 1FL6A 1BHGA 3P0VL 4XN8A 1J5OH 3QIWA 4WUKL 3L5WB 3KYMA 1U0QA 4NPJA 1UM6H 3QQ4A 2UY6A 2A6DB 3JWNC 1MNUL 3IJHB 3PS6A 4ZMTA 2WXNA 1HCZA 3HBPA 1TVHA 4NM8L 1N0XL 1S9YB 2V9UA 3PQYA 3QQNA 4HLJA 1PG7L 3HNTL 2XWDA 3LMJH 5CFAA 1L7IH 4JKLA 1VCBC 2VLKA 3FUMA 4JPIA 4L3EB 3ZYJA 5I30H 4KXDA 4R2GC 3TFBA 1RD6A 3OVUB 5AB0A 2FR4A 4LLUA 3O0LA 5DQDL 4XCFL 1T3FA 1N8OE 3MX0B 3G04A 1YYML 5G4MA 2AF2A 5IJBC 3LNHA 5IVXE 1FJ1B 2G2PA 2P80D 4XP5H 5CR8A 4LXFA 1JNLL 3ZL4H 3HS9A 2XV6B 2NCMA 2EC9U 2Y5TA 1KFGA 3EJYD 4IDLA 1UXMA 4OUUA 1KV7A 2F68X 1AG0A 2WIIB 3FDWA 2ZXGA 2PWFA 4FXKB 2Q3AA 4MMXB 3AREA 5CMAA 4K7PY 5C97A 4P4KB 3RBGA 2OMBA 4HWBH 3BI9X 2V2XA 3CHQA 5C6TL 3VW3L 3L2MA 5F7HA 3WY1A 5DQJB 1DVFA 2AJVH 2VXQL 3TFKC 4P5RA 1T5XB 1JGVL 3DGDA 3F7YB 1I8IB 1MCCA 4TRPL 2C3VB 2BZ7A 1JHTB 3DETD 4ZFOB 3U36B 1NAMB 4OZHE 5FEBA 3GJFB 3IDIB 4ZAKC 1SOXA 3ARYA 4G9DB 4RIRB 2V6HA 3MCLH 1TZAA 4N6RA 4WQOA 2WO2B 2DBLL 1KNOB 5GGSA 4WKZA 2OW6A 1X5LA 4AZUA 4XZ4A 4HS3A 4NRZB 5J7CC 3KPOA 4G6KH 1UWGL 2XN0A 3G08B 4ZZKA 5IMLB 4I0PA 1IGIH 3L4VA 1D5MB 1AS7A 4I5BB 2AXHA 3VJ6A 4KQ3H 5D9SA 2WLIA 4EI0A 1A6UH 1H8OA 1RZJC 5FA3A 2LU3A 3P0YL 5D1ZI 5J4MA 1T1ZB 2XX1A 1JPSL 1RZPA 5IUSA 2F19L 4AIEA 4B9GA 4OV6F 3GB7B 1NSNH 4CU6A 4Z7QF 2H32A 1CJYA 3JTSA 3AWEA 4LLQA 4NKOA 4UV4H 4DT2A 3KLQA 5E9DD 3QG6A 3QXDB 4M8QB 4UILL 2X4SA 5B7MA 1DBJL 5CD5D 2P45B 5CGYD 4Z95H 4IJ3B 2F0CA 1UT2A 5DFVC 5I17A 3VM5A 2VCOA 4HHAB 2EIJB 1KCSL 5AW9B 2XTJB 1RJLB 5K9QI 2DJSA 3IGFA 5I71B 5BW7A 2E86A 2QKIA 1FZJB 4PJIB 5DRNA 1NC2B 1KMGA 4NHCH 5CKGA 3QUZA 3D2TA 3MYJA 4M4RA 4P5TC 1KFAH 2DL2A 3NPSC 3O4OB 4UTBH 4QRQA 3ULUH 3P4OA 1ZS8A 4TTDD 4C47A 5MI0C 2BVTA 5A6IA 5TK4A 3LZFH 3UTQB 2YHGA 3SD5A 1UXSB 3QFGA 3PREA 5I2IA 3GMMA 2X6MA 1UCBL 3V4LA 1H19A 3A4AA 4XNUH 4ZMZA 3BT2L 4Y5VC 1WZ1H 4ZTPH 3NJJA 4F7MA 2A73A 4AQ1B 2Q76B 4X9GA 3KGUA 4A66A 4X6EA 5F1IA 1K5NA 1INEL 4MXQC 1DZBA 1JNJA 2JKTM 3RQ3A 1CD8A 3QYMA 3BCDA 4Z78A 2DLTA 3VSTA 3LDBB 1IFGA 3QCTH 3BH4A 3WI9A 4Z7QE 1RU9H 1JF1A 2BSTA 3HE6A 5E8OB 1DJGA 4PJFA 5LAXB 4EVNB 2N7SA 5E0QA 3MZGB 3L6FB 1NAML 3EYSH 1QVOB 3MRDB 4R8WL 5DDHA 5E1IA 4K23H 1AXTL 4HC1H 2WBJB 4PJAB 3FB5B 1DQDL 4UT9H 3MNVA 4K7PL 3O6MH 2BVQA 5FF6A 3L3IA 3MOAL 4XC3H 3RY5A 2H5UA 5FDWA 2IADB 2VH5H 2O6DA 3IDMA 1FG9C 3BSGA 4KZEH 5FCSH 3QWQB 3TBWB 1F4WH 4A2HA 3GSQB 3Q3GA 4GAJL 4WWOA 4YSUA 5KSBA 3O11A 3I6KB 5E8EB 2ROYA 3BGMA 5CWSA 3U0WL 2GCYA 3D34A 3WGUB 1HCFX 3SO3C 5DK2B 3BWAA 5B1CA 3ZTJH 4RMUA 4PTUA 1ZA6B 1AZZC 1CB4A 1A6ZB 2F8IA 1DJIA 1NBYA 2R4SH 2ZKYA 4AENB 3UTSB 4NJ9H 1D5XA 3FH8A 1YEDA 3LH2H 3VX1A 5I6OA 1UUNA 3V5DA 4HA1A 4B41A 1FV1B 2J2ZA 3B9KA 3ZKSD 3HJEA 2XWJA 4P59L 1AY1H 3BVWA 4F2EA 1BWMA 1JPGA 4IGBC 4Y5YC 3DVFA 2QQKH 4O02A 4XP4H 1TZHB 2Y25A 1L9PA 3CGTA 4M6OL 3JT0A 2DTMH 1OXYA 3N44B 2OSXA 5IOKA 2DLGA 2RD0A 4N1EA 5T3XL 1CDCA 1RY7B 3JV5A 4A67A 4YQXH 4XMZA 3K6SA 4F2MA 4OIAA 2H0FA 1RIUL 1PLBA 1HHJA 2ATPB 3FFCB 1EH9A 4M7JH 2WY3B 4W9JC 3GIVA 1OT2A 4GBXA 2Z7WA 3Q0HA 5GRVL 4JY5H 1T22B 4H20H 4HU8A 1ZANL 3QFJB 4NQUA 1GCYA 1ZLDA 2EYSA 3QDMD 4I3GA 3LKSA 2YXMA 1DVZA 2VDOB 4X98A 3EYUH 4ZW7A 3KXFA 1HJBC 4NX0A 1NFIB 5JA8B 2YAHA 2GJJA 5AD0A 1QASA 4ELKB 2DQTL 5I6XC 2BIOA 3P3TA 3TTYA 2JVUA 2V5YA 4YMPA 1LDSA 2M26A 3D09A 7PCYA 1KT2A 2AV7B 3EF7A 2IGFL 4JN1H 2RCSL 4X8XA 1YNTA 2I69A 2DMHA 4C8XA 5CEZE 3L4XA 1I1AC 2JJVA 4PH8A 5ICZA 4CKQA 4H0LC 1NFDB 3B8YA 4YDJB 4R84A 4LCIL 1MJ7H 4N2BA 5TDNA 3IDJA 2VDLH 3RG1C 3RPKA 3FU3A 2NNAB 5L8KB 3WNLA 3KH3A 4NGHL 2QPFA 4KJPD 3RGHA 4XXDA 1P7KB 2UX7A 4Z23A 1JGLH 3GGWB 3NABH 4IOIA 3MUY1 4BSJA 4WI6A 4FG6D 1RHHB 4K9JA 1BD2B 1QATA 1KG0A 3LZPA 1EUUA 1OM3L 5DHMC 2C9PA 2GSGA 1I3RA 3QNYB 3QDJA 5JYMA 3H8NA 1P5UB 2DLFH 3PCYA 4FMVA 2X12A 4PD4J 5BNXD 5C3LD 4QHLA 4N0CC 2IDFA 4GPVA 5DLMH 4EUPA 1UOVA 2QDVA 5CJXA 4YSOA 3EJJX 3MUZ1 4I8DA 1GXEA 3W37A 1QLFB 1XB6A 1AQMA 3P3RA 3K91A 1NBZA 1CI3M 3NDZE 2NUTB 5JIMA 5K9OA 1N4XL 2ICWB 3QUKA 3UZVA 5C0DB 4LB8A 4X6CF 4BDVA 1HINH 3EO1A 3UC2A 4NQVB 3IGAB 3HR5A 4ZXBC 2ZPKH 3ZDYB 1E6OL 2AJYH 2H41A 3VXUA 2CRYA 1G0XA 1U8LB 1DLHB 3PDOA 1OD7A 1UD5A 4I2XB 2JKJA 3Q6FB 1OAXL 3FBQA 4MNHA 5ES4B 4E5XA 4E0RA 1D9KD 4WLCA 5EEZA 5F9OL 2NQDA 2VMJA 3WS3B 2JMRA 4BQBA 4UDUB 4NERA 3HS0B 5EEXA 1DDHB 2Z0BA 1FO0A 1TZIA 1EPFA 2FWSA 2VMCA 1NC4D 1IM9D 4RAUB 3D0LA 4XPFL 1AGBB 1QSEE 4HGWA 1R0AL 3PWLA 1BIIA 1C12A 5B1BB 3BQVA 3HB3D 4NQEA 2DEXX 5HJ3A 5SWQA 5LBSH 2R1WB 2X2YA 4ZW3A 5BQ7A 4MZRA 1IC4L 3M6DA 4G9FD 1XH3A 2DS4A 4LDLB 5HYJE 5L4IA 3DGGA 3ATFA 2B9BA 3MODL 1UXLA 3RB5A 3QJOA 3N1FC 1WF5A 2VISB 3SDCD 2ICWJ 1SJHB 4PB0H 2BPBA 3INUL 4L4JA 4X9YA 1J88A 2BP8B 1Z3GL 2VDOL 1GOFA 1UKTA 5HGAB 3QULB 1JI2A 3X12B 2FSDA 5ICYB 2PP9A 1RULH 1E3XA 2ZCKL 4NZRH 4L4TA 1RZIB 4FEIA 1E5YA 2WWNA 3RWDA 2A4CA 4MAUH 5HSFA 2A83A 1JNHA 5IQOA 1RCYA 1U93B 4LSPH 1X7QB 1YEHL 3QIBB 4LGSB 3BZFA 1KPUA 2B5IC 4FFZL 3GI9L 3V4VL 1JGUH 4JQXC 4X6CE 4YSAA 1BXVA 2LVCA 3MLUL 1PCSA 4GMTL 1X5JA 1ZV5A 3W0WA 3A6BH 5F96H 2HSIA 2R2EB 4DVBB 3HUJE 3Q5YA 3SGJA 3UH8A 4DPCX 2XZAH 5HHNB 5E23A 4L3ED 4GSXA 4MKMA 3C8HA 2O6PA 4JB9L 4XNXL 1A5FH 2CM6A 3GSNB 4M6ML 5LN8A 2UZPA 4NO3B 4ZODA 3R7RA 3JSSA 5HBBA 5DHEA 4IBZA 5D7KD 5C09A 4N8PA 4LCWE 4M4PA 4MCMA 5SX5K 5I1DA 2NY0C 3AY4C 3WDJA 5DURD 4AUJA 1WZKA 4OD3H 1JG9A 3V9EA 4BSWA 1CE1L 2AJZB 2FVNA 3RAJH 1QFOA 1K4CB 1OV8A 4EAEA 5KVEE 2UZXA 5L0QB 1TSHA 5G5DB 1J5IA 3AG2B 3OJDB 2J6EA 2YPKA 4M7LH 1HQRA 3TEZA 1U3HA 5D7LE 5I66B 3BSZH 1ACXA 1WS8A 1LEIB 2VLMD 2F61A 4FFVD 4FFWC 4P5SA 3FN0H 2JELH 4H8WC 3SE4C 3Q43A 4UT6L 5J12C 1RUKH 3KJ6H 5LGJA 2YA2A 1NDMA 2JKRM 1QRNB 1V3MA 3ZIMA 1P53A 3KBEA 5J1AA 2GK2A 1G7PA 2VLRE 4V1DB 5C2UB 4QHKJ 1R5WB 4F27A 3VRJA 3GJEA 1XDTT 3T3PE 4MMZA 2J71A 4OCLC 2EKSA 1JFHA 4HKJB 3D3VB 2HUHA 3MJ8A 4H44C 3T1FA 2AQSA 1XH2A 2B4CH 3KD4A 5EBMB 5HDQL 2LAGB 3AG4B 5FB8A 4GUOA 1B2YA 2QADD 3PGDB 2ITEA 1HCYA 1NEZB 4TNVF 2A74B 3ARGB 3VH8B 4X7SL 1VB9A 4KO9A 3WEAA 4D9LL 1IBBA 2AQ2A 4S0HA 2PP8A 3JXAA 3IBOA 3A3YB 3MA7B 2EO9A 2NZ9C 2W8CA 3MREB 5TH2B 1DQLH 2BVUA 4M5SA 4JFDA 3VFGH 3WMQA 2DKMA 2VSKB 2AI0H 4Y1TA 4PJ8C 2X9WA 3ZTNH 1SMAA 3WLBB 5D1XD 4JKMA 3TV3H 5J13B 4JDVA 4Z7UE 4WFFD 3B3IA 3JVGA 4L1HA 2YOAA 1J0ZA 1AIFB 2AXGA 3X17A 4D8PB 4YAQA 2IQ9H 1U9KA 3FCBA 2ALWA 1QUNA 1HHGA 5JPMB 4CSZA 3WUWB 3HC0A 3D33A 2N7BA 3NJLA 1BYPA 5IK3B 2EDTA 5EC1A 5FPIA 2HLAA 4WAFA 1UOLA 2PTUA 1FFRA 5F0JB 1U8KA 3C5SA 3HR6A 6TAAA 4P9HC 4QR7A 1JGDB 2N1KA 3EJZC 3EUUA 4OZGB 2J21A 2CDEA 2FEEI 3IXAA 5GIRA 3Q1SH 1QFPA 3VFRB 2NNRA 5HI5D 3CN4A 1SVCP 3E6FA 3RU8L 3CVIH 1S5HA 2YLKA 4JN2B 1PG7X 1ASPA 1D3CA 2FB4H 3O4LD 2X4TB 1UATA 3NOIA 1X44A 5D7JC 1A7QH 3MV8D 1AQ8A 3MACL 4XVTL 5DEGB 4ZOAA 4U1IA 2E59A 4TSAL 3FC8A 5AL8A 5E6IA 4CNIB 1OAKH 1UJ3B 5IROC 5JW3L 1YUHA 2L0DA 4APQD 1L9NA 4AUYA 4F8TA 1NKRA 3RHWK 2XZQL 4YH6A 1GC1H 1UHVA 2O6FA 4Q9CA 3OG4B 1HEJC 1SXZA 1UZ8A 1JK8A 2E8ZA 3C2AL 3BVXA 4HV8B 5GGRY 3VFSB 4KK5D 3QO1B 1I9IH 1CURA 4RFEA 2JJSA 2QGDA 2X38A 1KB5L 5L2KE 3AS1A 3DSFL 1DBKH 3TBYB 1G9NH 4F57H 2XTLA 1KXQE 4AEEA 5F44A 3GXMA 2C4XA 1DJSA 2R2BB 3GBEA 5DUML 3UDWA 3ZT5A 1CD1B 3ZDZF 4XNDA 2E7HA 4MMYA 2CLRA 1Y1DA 2FEDD 4TV3A 1FVDA 4HCRL 4ZUWA 4A6YB 1PCXA 3Q05A 1EERB 5BZZA 2ZWYA 2DV6A 5T3ZE 2Y69B 2W88A 3FT4B 1AHWA 5EB9A 5GGRB 3L5XL 3Q9PA 1CICA 1KXTB 2CJUL 3F00A 3LZNA 4WWID 4YHIA 2EYRB 1K8IA 1F4XH 1ORSA 4BFKA 3K6DA 2VTFA 4JGUA 3IFNL 3U83A 1AKPA 5DD5H 2NZ1A 3VD5A 3CU1A 2Q6WB 1ZDSA 1CR9L 3ARZA 3L3OC 4OIFA 5D72L 2BSBA 1S8DA 3T2PA 3V0GA 2PPEA 4NT6A 2X9XA 5EIIB 5ESQB 2PYEE 1F58H 1MCEA 3ESPA 5EU5B 1CF8L 3UJIL 5IMMB 3QC5X 5DMGC 1GYCA 3ULVE 4UQCA 3D39A 1DO5A 1F97A 1FGNH 1JE6A 2QDWA 2KH2B 1LD9B 4WCYL 5GRVK 2ZWZA 3L3HA 3L3JA 4JFEB 1AKJB 3QT2A 4JDTL 2XWCA 3UO1L 3IDGA 1QBML 3T9WA 4U6XB 3OKKB 4HOZA 3X13B 1QA9A 3CFJA 2X4OA 1FG2B 4KX7A 2Z4QA 2F5AL 3FSZA 3SY0B 1TFPA 1RUQL 2PETA 3E2HC 4ENED 5LGKA 4X2UA 1BVLB 1ZTXL 2HRGA 3BCFA 3CX5J 5DZNA 2X10A 2GITA 2NXZB 1GS8A 3DTXA 3O45B 1PDKA 1MXGA 1IGTB 3ULSA 1ORQB 3ZDZE 1TEYA 3VNYA 1PS3A 2QLYA 3MRNA 5GZOA 2IOMA 2YPVH 4KMLB 2BCKA 4LLDA 4HEMA 2L3BA 3MKKA 3C8KA 1ZVSB 3BJ91 4L5FL 4FHKA 2J1YA 1YN6B 3GHEL 1N7MH 5CJ8A 5C08E 1CTOA 1W0WA 4R5XA 1DVSA 1TUPA 1MCOH 3FFCD 2F58L 5B7FA 5F3BB 5MENE 1A6VL 1XL4A 3MV11 3NT0A 4NQQA 2WTRB 5DJZB 2WZ6A 1IGJB 4X5XA 5F21B 1IO4C 4M5ZL 4OKVA 3VFWB 1TITA 4ODXB 4UQ9A 3LS5H 3M46A 4DKFL 2EEFA 3AZUA 2ZOLB 3QHTC 3D69B 4P5KA 4WTWA 2WW8A 2XZZA 3ZE2F 2XLLA 4MYWB 1MHHA 3ARVA 5EU4A 1F2XK 2XWTA 2LTQB 1DVQA 1Z9PA 2BP3A 3CLFH 1I1AA 5F2FA 3VYPA 1OB1A 4FDWA 3ZL2A 1HE7A 5LAPA 4N68A 1QBAA 4J27A 2ZXBA 3B43A 3ZY7A 4PRAA 1UM6L 1CDBA 4K7PX 1UC6A 2VQ4A 4DGIH 2JE8A 4TLUA 1Q0XL 5IR1A 4D7BA 1XF5A 3W9EA 1CGSL 3NZ8B 3QP3A 5TGBB 5C6WH 1H9VA 5EF0A 3BWSA 1JYWA 3DIFA 1GGIH 3DSNA 1L7IL 1N3NB 5AW2B 2MCAA 2X05A 5BVJB 5CD3B 5I30L 3VD1A 2P24A 3FOLA 4L8CB 5CLTA 2OMNA 1L6PA 4NAQA 3QFDA 3RUGF 1BIHA 3BZDA 4AYEC 4JY4B 1DANT 4JFOB 1PZAA 2ED8A 3JVFC 3QAQA 4Z3IA 5IVXA 1BQKA 1T5WA 1UA7A 4KX8A 2CO3A 3EOAA 3H4FA 3EG9A 4U3CA 4JQIA 3UGXA 4XP5L 1AGEB 1F56A 3ZL4L 2XV2A 1LWRA 1QMUA 4XB8A 2J1XA 5I5RA 2NY7L 3I9AA 3NJVA 4NZJA 4U31A 3RYMA 4E5XG 4UIMB 4KNTA 5DC2A 3RIKA 4M1DL 2OMYB 3RIFF 1JZ3A 1A02N 1KGJA 4FQLH 4DP7X 2NNXA 3DUSA 3KPQB 1M6OB 1MCIA 2XA3A 3F7VA 4MBRA 4CMMB 3ZE2E 3ZKXB 3T0AA 3VMNA 1IKFL 2DWDB 3QO0B 4Y4HB 3AG3B 4UU9B 5FO2A 4DP8X 1IC5H 5EG6C 4FG2A 4GKOA 4W9ZA 1V5JA 4FLOA 1MJUL 3CZFA 2ZNWA 2ARJQ 4P5MA 3MCLL 4XC1L 4FHJA 2J8UB 5E99H 2Y6SC 2NYZA 5DJ6A