2ZCZA

Crystal structures and thermostability of mutant trap3 a7 (engineered trap)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKKAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
molecule tags Rna binding protein
source organism Geobacillus stearothermophilus
publication title Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zczA00
3AQDA 5EF3A 1WAPA 2ZP9A 5EEUA 3ZZSA 4B27A 2EXSA 1GTFA 3ZZQA 1C9SA 5EEYA 5EF2A 2ZCZA 1QAWA 3ZTEA 2EXTA 2ZD0A 1GTNA 5EF0A 5EEWA 5EEVA 3ZZLA 2ZP8A 5EEXA 5EF1A 5EEZA 1UTDA
chains in the Genus database with same CATH superfamily
3I84A 3RGVC 2ROXA 5GGTH 3UTTA 2EIZA 2IPTH 3LNIA 4RGMB 1OD7A 1PFCA 4NO5B 2CM5A 3MV9A 4RRPG 2LGNA 4WHTB 2NUPA 4KVNH 1SOKA 1ODUA 3VMPA 3MLXL 4M8UA 2YRBA 4LO9A 4I3SH 5C0RH 1JYWA 4DP7X 3B6SB 2FX8L 1KLUB 2V3EA 4HS8H 1C12A 2RGSA 4G8GD 4L37B 1NCIA 1U8PA 3QIUD 5F9OH 3H3PL 5F7AA 3GUTB 1RUPH 3WDHA 3WFBL 3LKNA 3CTTA 1V55B 4TPRH 3TM6A 4RWHA 4LOVA 4A2FA 2C8NA 4P23C 1PNCA 5DJ6B 1AHWA 1UCTA 3JWOH 5EA0L 4JFPB 3ZMRA 1CBJA 3G5YB 4LLMA 1IGMH 3MA7B 3V5KB 4A6YH 1G84A 5I1GH 2HKFL 4BQ8A 4LGPB 3RFRA 4ZXBA 3MJ9H 2FT7A 4XCFH 2JK5B 2VL5B 1EFQA 1JZGA 3G6AA 3THML 4FKHA 4R8WL 5B8CA 3B2UD 4XI5D 4QY8A 2FRGP 1OT1A 4QTIH 4RAUA 1A4BA 3PP3K 3D0VA 1U8MB 4PD4J 3JV5A 4K9JA 2Y23A 1NOAA 2BIQA 4FG4A 1V05A 1RK0B 4LCCC 4XPBL 5DRNB 7CGTA 3HC0B 3V52H 3T0DA 2CA3A 1AZBA 5MENB 3ARBA 1XIWB 5D7IE 4MAYB 4UZUA 3Q44A 1A8ZA 1A7QH 4R7NB 3E8UH 3VFWB 4LLUA 5EO9B 2NY7L 2YD6A 1SYSB 1YEWA 1PLCA 5I18L 5HHQA 3PQYA 3A47A 3EH5B 4Y5XA 3X1NA 3ZX1A 4RESB 2ZX7A 4L8SB 2ITFA 5F93C 4LDLB 4QXUL 2ZSVA 4E42A 3TFKC 3US9A 5IUSA 4IU2B 3PNRB 5FB8A 1GGIH 4R9HA 4MZ3A 3GJFB 5F1IA 4S10A 4LDOB 2EE2A 3ESVF 2CMRH 4WFHD 3WFEH 2OP4H 2EJ1A 5IG7B 3QIBA 4U49A 4P5KB 3TVMB 2HWZL 2WCSA 2A6DB 2WNWA 3EOBA 3IFNL 5J8OA 1TUPA 3AGWA 1J8HE 2ZJSH 1IU1A 1I8KA 4X4ME 1UGNA 3VE0A 4D8PB 1QFOA 2MJWA 1J0JA 2DKMA 2QFRA 3J07A 4OIIH 1D5MB 3CFKA 4PIBA 4PJFE 3DRTA 2I7OA 4YXHL 2WBJC 4G6KL 3I50L 4AYFA 4CC4A 5DK2A 4L1TA 1IJNA 4K8RL 1M3JA 1A6WL 4WQOA 2VMFA 4PJ5A 2AZUA 1MJJA 3L4TA 3KPOB 3BKCH 3UEQA 3VFVA 1FP5A 1AG6A 4ZFFA 5HYQA 2XU9A 1YMMB 2LFGA 1PY0A 1OPOA 4Z8FH 2V2TB 5KSBF 3MQIA 4LCUB 1XVSA 1OW0C 1XGRB 3FONB 5F0PB 5BO1L 4OTXH 5IHUL 3HG4A 3S88L 3ESMA 2IV8A 1Z6JT 4LEBA 4U6XA 1A65A 5KVFE 4FQJH 1JV2B 2X4OB 3GKWL 1SXSA 1MLCA 2QQLL 3L6FB 4JG0H 4XMTA 3IDYB 5K33A 2E9IA 3N1PC 2QZ5A 3ZE1B 3AUWB 3RG1C 2RALA 1QYGL 4IM8A 5C7XH 3ISRA 1G9EA 1KYDA 3AMLA 4GSDH 1BQUA 2QZQA 2Y1YA 4PMEA 4Q97A 3O9WA 4JCMA 2NQDA 2EDLA 5MI0B 4AYBA 2I69A 5IR1B 3ZE2B 1AOZA 5KVDL 1DUYA 1E28A 5BOPA 5EMYA 2BVPA 4KVCL 4HS6A 4ABVA 3AT9A 1WZMA 2VLRE 1E2VA 1CQKA 2X4SB 2LOEA 3B2VL 5IMOB 1A4AA 3QQ4A 2J8UE 2ZWLT 3ZO9A 4QJ5B 1IFHL 3P9LB 4Z3HA 4KU1A 1P2CA 1HILB 2I07A 4AVIA 3PWVB 4CADB 1MCLA 3O3UN 4LPCA 3WJJC 5HVHB 1EANA 1J8KA 3R7QA 4R90L 4UINL 1SVCP 4WI2A 1UJ3C 2XV6B 3LMJL 3ZYJA 3BN3B 2HFFA 4FNSA 4WHYG 4X7SH 3SPIA 1W8NA 2MIZA 4F9LA 1DBMH 1KELH 4N6QA 2DQUH 2RB8A 3LKPA 3WOVA 3RTQD 3CHXA 2H0FA 5KS9A 2FZ3A 3EYSH 5AL8A 4OTXL 3V0FA 3HS9A 4UF7C 1XF4B 1XMEB 1KCRL 2DH3A 3MLSL 4ODXA 2SEBB 3VXSE 1L5GA 2RJMA 1F86A 3RDTA 1UUSA 3GKWH 1SLXA 3HE6D 3WO4B 5DFVD 3REWA 2WWMC 2FDBP 4ZQKA 3ETBF 5EO0B 1IQDB 3I9PA 2YOAA 4YSAA 2DQJL 2N7SA 1ZTXH 4FQXC 4PJ8B 2C9VA 1NDGA 2CK0H 1G1YA 1S7SA 4FTVA 3KXFD 2DYSB 2I60L 2MQCA 3HMXL 3GMQB 1T2QL 1Z3GH 3NACH 3NQIA 4RGOH 3ZDYE 4AV4A 1TSRA 3UJIL 3FFDA 1DSFH 3RGVA 5KVFL 4FQ1L 4G8GE 2YAMA 3BT2H 2JKSA 1MPAL 5K9QI 4RGNC 4LKCA 2DI9A 4HOMA 3OJDB 4FJ6A 2P9RA 1AY1H 1YEDB 4HFUH 4N1HB 1HWHB 1NJ9A 3L3KA 4S1RL 5D96C 5KBKA 3TN0A 5EB9A 3IDMB 3UYRL 3KR3L 3CU7A 5E8EB 1Y1UA 1PX8A 1T3FA 1W15A 4X5WB 3ZGIA 2Z93B 2Q76A 4C55A 2LHAA 5E2TL 3L3OB 3PGDB 2NYYD 1GOHA 2IXQA 2LTQB 3FT3B 4BFNA 2F1EA 4YN3A 5I74C 4YDLC 2IADB 3F7VA 4I85A 3F12B 1FVCA 2A5UA 4Q0XH 1G94A 2Y36H 1GCYA 3O0RL 5CJ8A 3H4FA 4XOCA 3AG2B 1I85C 3ZJAA 3VD9A 4GRLB 1A6ZA 4P2RE 2FEJA 1G7PA 2VW6A 4ZS6D 3T65A 2FX8H 3LCYA 3ZZSA 3LS5H 1BQHA 1IC7L 5B8CC 3MBXH 4PRHB 4RA0C 1TTFA 1GKOA 2L7EA 2VNCA 3EBHA 3FT1A 4EN2A 1P7HL 1EMTL 5KS9E 3I9IA 4RMBA 5DHVA 2W95A 5FGCB 5H8DA 3FH5A 3MRMA 2HKAA 2JWYA 3CXDL 4FDWA 3US0A 4QAWA 1JWSA 3MLVL 4WU7A 3ARBC 5FM5M 1WFJA 4A66A 5I6KA 3EO0B 2Y2YA 4PCYA 2ICWA 3KGUA 4QTFA 2X1PA 5DRZB 5CJ5A 4JCLA 1G6RH 2D3VA 1HH9B 1T4KB 4FQQA 4HKJB 5L9DL 4MBOA 3OHXA 3MLXH 3O45A 4K7FB 4JM0A 2BNRD 1NCTA 3CBKB 4P2AA 4V33A 3CDGB 1DN0B 1OLLA 1U3JA 3V5DA 5LWYL 1QUNB 2WN3A 3CX5J 3EGDA 4ISVB 4JM2A 1GYWA 4TSBH 3RDTD 3T77B 4OZIE 1KLUA 1I82A 2XWTB 3D4YA 3ZN6A 5CGTA 1G7QB 1NINA 3RVTD 4JFYB 1DCEA 3QNZA 1OQXA 5IVXB 2W9EH 2PPCA 2FHFA 4AE0A 4F37F 5HPOA 4MAZA 1R34A 1BM3L 1K8DA 1MHPH 4KQ4L 1WVZA 1BVKA 2W88A 3X11A 5I23A 3P30H 4PJ7E 3BGMB 2ZNXA 1P6FA 5EWIL 3PP4L 3BVWA 4AQ1A 4HJSA 4FE9A 1OGPA 5TDOA 5ICZA 1E50A 1QLEH 1UJ3B 3WHXB 1WAAA 4X6CE 4GW1A 3AW5A 4PJAB 3OKLA 3BPCA 4PRIA 3D8MA 3MRIA 4KRNA 1BD2E 1E9QA 4MZ2A 3IFNH 5E1IA 5IJKA 2AF2A 4PRHD 3QEQE 4YHZH 4Y1TA 4DKEL 1JS4A 3C60A 4MB1A 4OKDA 2CO3A 4CVUA 4HW6A 4NKIL 3ARBD 4MJHA 5EZIL 4FTVE 2CKBL 3CK0H 5KANI 2E7DA 2R0WH 2QGEA 3RWHA 2R56H 2NR6D 3ARYA 1LWHA 4OLYL 1JNHA 1PJ9A 1OOWA 1QPKA 5HGGS 4JLRA 2OZ4A 4MWFB 4GIPD 1CBVL 1M53A 3QHFH 3QXTA 4L3CB 5KW9H 2K6YA 3LNDA 4MJJA 1GC1C 2BNRB 2VWEC 2Y5EA 3ECBA 4QJ3B 1MCOL 3O6FD 3L7EA 3HE7C 4BKSC 5K9JH 1BZEA 4JVWA 3ERXA 1DLHB 3L5WB 4ZTOH 1GJIA 1LEGA 2FWOA 4XOEA 5HHOE 2YPLE 5I1IH 5AZ2H 5FWQA 1AZZC 4P3DA 3WEBA 4AGMA 2EIKB 3MSPA 4R7VA 4TLSA 1KJ2A 1HCFX 2D0HA 1AYOA 1KN4H 1G6VK 1Q72H 4V1DD 4F91B 1ZT7B 3B9VA 3GSWB 4G6KH 1GSMA 1T04A 2HJFA 4LK4A 4FLOA 4X6CB 4NFCA 5T5NG 1AR1C 4U1IA 3MXWL 3VJ6A 3D3VB 1DVSA 1YEIH 1FORL 2O5XL 3JWDC 3PLYA 3DROA 3VDCA 3ZY7A 5KEZA 4NUJB 3M88A 4K23L 3PAYA 5IFAL 1UT1A 4XNXH 5D8JH 1U3NA 1XB3A 1KOAA 5D2NB 5F21B 3SE8H 1ZWIA 5CM1A 4HWNA 3WFHB 2H32H 1JGIA 3U1SH 4ZTEA 4U1GB 3A0OA 5D71L 2A2QT 1ZHKB 3A6CH 4JFHE 4CKVX 1N8OE 4HUCA 3G5XB 2DQDL 3V6OE 2X44D 4R4NC 5E1AA 1EO7A 4QRTA 4J4PD 4OZ4A 5DK0A 5SWZA 4L3EA 1ZSDB 2YBGA 3FRPB 2COQA 1MCIA 3O2VL 4KY1L 1X9UA 3SO5A 5M7QA 2ZQKA 1CI5A 4OAWB 3NRFA 2MEJB 3SGEH 3FU9A 2FL5B 1F4HA 5KVGE 4PGZA 4OLUL 2B20A 5GGVH 1L4IA 3FQRB 3JVFC 5HHXL 1MJUL 1MAKA 3HA0A 4P3CL 5DVOA 1OTTD 5D2LA 4D9RD 4N2EA 4O2EA 1Q9LB 3LKQB 4PBXA 2IOOA 4DOHE 2PYEB 3PAVA 1NBVL 1JE6A 3ZOAA 2X4SA 2FBRA 2EEDA 3EGSA 4Q9CA 3FF7A 1INQB 5KOVC 4M7KL 1Z0NA 5I17A 3GSOA 2D3LA 3DOSB 3TN0C 5BMFL 2NX5D 2LU5A 4MS8D 1DQKA 4PGBB 3N5AA 1V7ML 5T1LA 4QXTB 4E2OA 4X9HA 4ZT1A 4LHUD 1SXBA 3VXRB 4XVJH 2Z7WA 1A3RL 3FTGB 3OZKA 2OYKA 2XG5A 3OXRB 1AGCA 4UNTA 2HP4A 3OAUL 3BH8B 3ESOA 3LNFA 4PWIA 5HHMD 4Z78B 4H8WH 2XG4B 1USZA 2H3NB 1PG7X 1I8IB 2Q2EB 4UT6L 2WXQA 2WBJB 4GRLC 1ZTXL 2J21A 4QRPD 4ICWA 3MOQA 3NJVA 5DD1H 4G59C 1RY7B 1DJHA 2XSKA 2IGFL 1LE5B 2IF7A 2E7MA 4PRBB 3N85L 5KSAD 1KCVH 5DUJA 5HHOA 3M6DA 2N1TE 2H6UA 1F6AB 4OZIB 3GDBA 4MMYA 2E9BA 5TQ0L 4OIFA 4ELMB 4YSOA 3F85A 1NCOA 1QACA 4Y4KA 4F7MB 1WBXA 1JGEB 1WEJH 1VFUA 4NKOA 1QD0A 2YKKA 3FOMB 4D3CH 4QR7A 5E2UH 4XT1C 3QAZC 5E6UB 1EMTH 3PHSA 1Y0LA 2KERA 4LLWB 5DA0B 2P8PA 3SDXE 1P6WA 5GGTA 1VACA 2ZUVA 1EXGA 1KPRA 1BM7A 4XNBA 1VEPA 4NI3A 1PFOA 2CIIA 1DZ0A 2VXTH 4N25A 4P46B 4X8XA 3VXUB 3ESUF 4N22A 5I1KL 5A2FA 5I0DA 3Q3GB 1U8KB 4B53A 3M86A 3O0RH 2W9LA 3NEXA 3FB7A 4PJ8C 3P77A 3LRLA 4XVSH 2XWRA 4M6MH 3ZKXB 3UXFA 2HFGL 2ZXBA 2BFVL 3G5VB 2P26A 3S5ZA 1EAJA 4IOIB 1B0WA 3HRZC 3TJEH 5HGHB 1MQ8A 1RMFH 3GLAA 3V0IA 5BZDA 1N10A 1SEQL 1YPZF 1OOAA 5DUBB 1IC7H 4P5RA 4AQAB 3KGRA 4XP5H 1W0VB 1NCBL 3B8SA 3LB6D 3Q9PA 3E9UA 3DPDA 4UQEA 4NHUA 1J18A 4A2GA 5FUZH 1CXEA 4GT7A 3RL2B 1WE5A 2PXYB 2N4IA 4ZK8A 4GKZA 4GS7B 4LSDA 3X14A 4PWKA 2BSEA 5CWSB 4J4PC 1KIRB 3U4KA 1JPTL 3DA0A 4NBXB 1IE5A 2NOYA 2JCCF 4DK3A 4XZUA 3IGAA 2YN3A 2R59A 2CDGB 1QO3B 3CVIL 3HG3A 3FTVA 2DQIL 4JFDB 3X1BA 5IGXH 4OBRA 4XXDB 4YBLB 5DZNA 1NUNB 3GBNH 2NY3D 4XO3A 4OLEA 5AAMC 4YSRA 43CAB 1EGJH 5B4MC 1JWMA 5LBVA 1Z9MA 3PGFH 5CNHA 2CG9X 1UA6L 1J86A 5DTFA 3QZLA 5AD0A 1WG3A 2BNRE 4GW4B 4R97B 3EGDB 2ED7A 6PAZA 1R3JB 1S7UB 4O58H 1NGQL 5DI8A 5ID0B 3ATFA 3EDJA 4NBYB 3JWDH 4XC3H 4P9HC 2R0WL 3WY2A 3DURA 5E24E 1QHQA 3CXHK 5LGKA 1YHPA 2NTFB 2ZX8A 2UWEA 4HBQA 1F45A 3MROA 3GIVA 3OMIB 5IIEA 4NO2A 4WSKA 4KBPA 3BGMA 2O6EA 1UUNA 1BXXA 1FSKC 3JTTA 5DJXA 2PR4L 1ASOA 3NZUA 4AJYV 3VXPA 1HSBB 4PRHE 5J13C 4X0NA 3GF8A 3MNWA 4F92B 4O2CB 1UD4A 3IJSA 5C3TA 2FJGA 4GW1B 5ANHA 4JM4H 5ID1B 4PW4A 4U1NA 3SYOA 4LHUA 5JIMA 4YK4B 1M2VA 4RIRB 1E9QB 2VUYA 2G30A 3W39B 4PGJA 1OAZH 2VQ4A 4JHWH 2WV3A 4L4VD 5CZXC 4EEEA 5I8EB 1XGQA 5E99L 5T5FL 1VERA 3VVVA 1M56B 4Z0BL 5J12B 1IGYA 4PJ7B 4LPYA 4XP1H 2YN5A 5E2JA 2WB1A 3RZCB 4BZ1H 4DGIH 4Y16C 3D09A 5A2AA 3SKMB 2J6EL 1RZIA 3BKYL 1DJYA 1BZOA 1G5AA 1EGJL 4PJIA 3CXHJ 4NO0D 1YUKB 3VXUE 5DC9B 2A83B 1S3KH 5JW3L 4YNYA 5IFAH 1ROWA 4H2AA 5IFJB 3LN5B 2X4PA 4OSUH 3PS6A 4G6AC 2O5ZL 1FNAA 4H8PA 4I1RA 3INOA 2QGBA 2DWEA 2BNUA 4GAYB 3SKJL 3PXLA 1XGUB 1NFIB 2FBOJ 4YHPA 4YHLH 3LXAA 1CIUA 5IFHH 1GY2A 1DFBH 2YQ2A 2DYPD 2YPLD 3KPNB 1B9KA 1Q0EA 2DN7A 1KLGA 1OGAA 1YEGL 3RGHA 3LY6A 4F2EA 4HBCH 4X7TB 1JGVL 1MFDL 2DLTA 3C9NB 1CS6A 1JZJA 3L3HA 3VSTA 3HRPA 1DTUA 2W0LA 1HSAB 3WIHH 3T9WA 1HCVA 3CWGA 2BJMH 2AQNA 1ZT1B 2EDEA 3STLA 3U9PH 3WIHA 3AS3A 4P57B 3TONA 2BH0A 4HPYH 5ABDE 3EDFA 3I02B 5IP4A 4HG4K 4K3JH 2XTJE 5EHFA 4MDIA 4X6EB 3RDTC 4Y19D 4BFGA 1HX0A 3ARSA 3BWSA 2BSBA 5HGBB 2Z31A 3FO0H 3L48A 4LLYB 4OI7A 3UOAB 2I7SA 4HIHB 4G6ML 4OV5B 3HZVB 4FFYH 1WC7A 5ILTH 4NQCA 3HN5A 2XC8A 4AT6B 3GK8H 4UT9H 4QHPA 5GSVA 3EDKA 3DHPA 4HWBL 1NC4B 4Y1SA 2FSEA 5IJCC 3L54A 1GAFH 3PV7A 2DEXX 2AVFA 4W6WB 1HXMA 1RIUH 1PD0A 1NKRA 4KY1H 4N2HA 4ZUWB 3WLBA 4P2CG 4HUXA 5I5JA 1X9RA 5F1IB 4NC2B 1AZNA 2R7EB 1X4XA 4PJFA 1KYFA 3NIFE 4HXAH 2WBKA 2Y69B 2HLAA 3M07A 4FNLL 4N3TA 4ANWA 3KBHE 4J3BA 4ZX4A 1OAQH 1HHGB 1RZ8B 4XGZB 2WZ6A 1IBGL 1I3GL 4PRNA 3VFGL 5LN8A 3VGGA 3GXTA 3ZZQA 1T80A 1QFWM 4M4RA 3CN1A 3BPOC 4JGJA 4N2FA 2UYLA 1Z32X 3P4OA 1YNLH 4FKKA 4UBDD 1Q9OA 1S8DB 3CMGA 5GS2H 4MCYA 1TQSA 3DX1A 4FNUA 3QH3A 4BDVB 1RVFL 1XHHA 5J1SC 2DD8H 2XKUA 5AVZB 5DD5H 4WTWA 5TE6L 1WZKA 4YDKL 5AW5B 4OFKA 4V1DB 3LIUA 12E8H 5DVKA 1SMOA 1X5XA 5LCVH 4B9CA 3MJ7A 4QRQB 1M6UA 1CFSA 3B3BA 4LQFL 2R2HA 4PS8A 4MJIB 1CWVA 3KPPB 4G7YL 3GTTA 3NP4A 4N2KA 2YS4A 2ZUSA 4MX7B 1XQ4A 1F3JA 3FB8A 3LKRA 4IKLA 4QRUB 3CZKA 4LBEA 4B5ZA 5EOCJ 4CSPA 4XNQB 3UC0L 1FZJA 3UTQB 1CZ8H 4ODTH 4OZHF 2VC2H 2B16A 1EX0A 4ZAKA 1FO0A 3QT2A 2YLHA 4O9HH 4NC1E 5MEOB 5E4EB 5TE4L 1HIMH 1UZ8A 3FQUA 4AG4L 4YZWA 2ORBL 4AEFA 4FQXD 4LL4A 3QQ3A 3MNVB 2BVQA 3B2VH 3NCYP 5BV7H 3SBWC 2VXTL 3OHXC 4J3XA 1NIFA 4MQ7B 4YFDB 3BIAX 4DK6A 3L3GB 3ZQXA 1KGXA 2IC2A 1NEZG 2IH3B 3QNFA 4RMTA 5T1KD 2NUTB 3TBWB 1U8NB 4EIGB 1PZ5A 3DUUA 1YNTF 3EYUH 4JPWH 4HIIA 5GXBB 2CH8A 5AW3B 3GZQA 4U6YA 1RZJL 4M7JH 1N0XH 4GYBA 4S2SB 1IBFA 4JFEA 3FTUA 2PO6D 1BAFL 1I8UA 2YEVB 3FO9B 4G6AD 3MLWH 1LEIA 1BG1A 3BGFB 5KN5A 5HHNB 1JD7A 3L4VA 1LL1A 5BUAA 5ESAB 5C08B 3K2IA 4QHLB 3HB3C 3QNXB 4U1SB 4XCYB 1CXKA 3ZUCA 3MUHL 1FE8L 4HSQA 5HTSA 5FLUA 1NWPA 4U33A 1A7OH 4Y16D 4HHWA 5AVQB 4QRSB 4DF9A 4OCRH 4XPGH 4OJFL 2IWEA 1U8QA 1O6VA 1KC5L 4IYKA 1PZ2A 4K4KA 3RX8A 1GZPA 1IIIA 3C6LC 2OFQA 2RAMA 3FCTB 4CMHB 2NNCA 4PP2A 3CFDA 4DVRL 2AJUH 5HGHA 3VFPA 4D9LL 1AS8A 3D06A 3T0EC 2QHRH 2ZCKL 3EYFA 4KRPD 4R5VA 5F88A 4J1UB 1A6AA 3DXAB 3RZCC 4Y7MA 3UO8B 4CN1A 1ZVSA 2JKTM 5AZ2L 1RFDH 3KLHC 2ZXCA 1G7IB 3AB0B 3S96A 1BWWA 5SWSB 3NJHA 4KJPC 3FFDB 5ADPH 2VDQL 3DJ9A 4JVPA 2DL2A 4LL1A 1YN6A 4FFWC 3KPRD 4DP0X 4WCYL 1MWAA 1CLOH 4J28A 4QTIL 2ZX5A 2FT8A 3SY0B 1MFBL 1URLA 4FHKA 4JKLA 4QCIA 1V3KA 4NN7B 2XN9D 4EVNB 4IS6A 1U8PB 2YAHA 5C0BA 1PDKB 3GQFA 2D2OA 3ME0A 4IIQC 4N6RA 5B4MD 1OPGH 2HMIC 2WBXA 4K7PX 4PLKC 3EFDH 2HPTA 5A2CA 2WBJD 4TNVK 5C08D 2NY3C 1VDGA 5EFIB 5FC9A 1JZIA 1B6DA 4LT7A 4OM1L 4QRRE 1QFWH 4FG6C 5IMKA 1OP5K 1GSKA 2D0GA 5DO8A 3FPXA 5B1BB 3L5HA 1IL1B 4JG1H 4HGWA 2G9HB 3LTVA 4I3RH 3RWIB 2Q8BL 3OKNA 4IDJH 2J4WH 4WLCA 4YIQB 2HT2C 5KVEE 1TTGA 4CBZA 3QHZH 4QY8B 3LVTA 3QJUB 1QBLL 3ZKSD 3PHOB 5I1EH 3ZKND 5AB0A 1C1EL 5FYLH 1QG3A 5FGCE 1RK0A 3QUYD 1AAJA 3O3DA 1X5YA 1AO7D 2XFXA 5BRQA 3MUZ1 5JIDA 5LCVA 5KAQG 1RL1A 1SZNA 1OCWH 2RMNA 3ILPB 4WU7B 4IOFC 1EAPA 2WK2A 1QI4A 3RZWA 3S3CB 3WBDA 1TZAA 3MBEA 5ANMB 4I0PD 2FAUA 2KDYA 4KXDA 3DX9A 3KWXA 2AABL 2DQTL 2X4UB 4P5TC 4N1CA 3KPRB 3SB3A 4BA8A 1J1PH 2R23A 4PJ5B 3N42F 4RAHA 4C56B 4Y16A 4IHOA 1CE6B 3BP6B 2O6FA 2A83A 3GJEB 3EXLA 4KI5F 1OM3L 5IG7A 4OZFA 1FJ1B 3MV7E 1U8OA 3UTSE 1Q8MA 4E0RA 1IAKA 1XGPB 1XTMA 3CBRA 1J9CT 1A3RH 2WWKT 3DMMA 5LN4A 3SDAD 3SQRA 2QLYA 3F05A 4BBWA 1KB9J 4N2IA 2AITA 2FWSA 2EO1A 2DMGA 3WIFB 5DS8B 1EEZB 3CSYA 1V3JA 1NCWL 1JGVH 2R2EB 4HC1H 3G6DL 3APDA 4F8TA 1O6SA 2R39A 1JGLH 1QYGH 4PJEB 1KXQE 2HVBA 3FU7B 4N2LA 5AKVA 1YVLA 2WXPA 4JFDD 3ARXA 3UFIA 3EF4A 1CDIA 5L2JB 1KYOK 4DN4H 5DEJA 3HBPA 3RVXC 5K5YA 1BYPA 3CVHB 4W4OC 5EZLB 1A4JB 1WWAX 1S5IL 3OZ9H 3V6FA 2CR6A 4KVCH 3KLHD 1T03L 3AXLA 2KPWA 2XHNA 4QAMB 2BVPB 1FIEA 4HS6B 3L3IA 4KKCC 4NP4L 4QD2E 1H3XA 2FH8A 3CUPA 4G8FB 3DGDA 4X6BB 5AOMA 1QHOA 4WI5A 3D5OF 5E2UL 3DIFB 3K6OA 4YBQC 2OK0L 4MWFA 3LEVH 1P2CB 2FWLB 2XQYK 4YC2B 1KZQA 3H2PA 4F15C 3NA4A 3RWJB 2CRIA 3IGKA 2Y7LA 2BX5A 4HCFA 5LQBL 3JVGC 4LSTH 1LP9E 5EU6A 3A23A 3NH7L 4GBXD 4X80H 3A6CL 1MVYA 3BRGC 5JIKA 1ACYH 4NKDB 3SEPA 1PY9A 4PRNB 3T8VA 3H3KA 1PX4A 3DVNA 2GEQA 4GINA 3BRDA 3NJGA 4IRZL 3RPIA 2VMJA 4R3SA 1I7RB 2XDHA 3CCHA 4NGHL 2Y2WA 1VENA 3IAPA 3UBXB 4O51B 5DQ9A 4PGEB 1OP4A 4WUKL 2FX7H 2I60H 1JF6A 2B1HL 1DJZA 3SGDH 1U91A 2V5RA 1VPOL 1BJ8A 5T3ZL 3BW9A 5F7KC 3RRQA 3FT2B 4AIEA 4XCEA 4D0BA 4XE5B 1EHKB 1A6UL 4L5FE 4YPJA 4B9JA 3TCTA 3PV6A 4M61B 1VFBA 2WYIA 3HI6L 2A74A 3BSZA 5GJTL 2EDFA 3G5XA 5GGVL 1P7KB 5CD3A 1M1XA 4WV1C 3DTDA 3QAQA 4CL7A 1BQ5A 3NVQA 1YEKL 2DYPB 2YPLB 3V4PL 1NMBL 4ENEC 2CIKA 1SBSL 4JRXB 4YE4H 5FYJE 4ZQKB 5IVNA 3FRPA 2VISA 3FT9A 1MCPL 2N01B 4O4YH 3EFOA 5IY5B 3JWDL 4KMLB 1A1MB 3C5JB 2H3KA 4PLJD 5T1LD 4AUYA 3MRGB 4DGYL 4PH8A 1S7SB 2H6OA 4OCYH 2G75B 2NX5A 4CJ0A 1L9NA 3SDCC 2AC0A 4YDMA 4LVOC 4WGVB 1MRDL 4WKXA 5C92A 4K5OA 4NN5B 2VDKH 4UTAA 2YK1H 3BX7C 3TT1L 1F90L 2PUQT 4JVUA 2EUXA 5E2VH 4NRZA 4DPAX 4XN9A 2NXYD 5C9JA 1DEDA 3QQNA 1ZVHA 1VRSA 4CC0A 3IGLA 2BVUA 1T1XA 1YCSA 1N8ZB 3DX8B 4JFFB 5BRZD 3HS8A 4MJ6B 1UD2A 2A1WH 2BK8A 4MZIA 3X13A 4Z7WF 1XB8A 5IQMA 2BSRB 3QJSB 1A3LH 1U93B 1FH5H 3ILEA 4JKNA 3ATBA 2P80A 1M6OA 4M7LL 5H2BA 3KPSD 4FULA 1R5WB 2D03L 4B9KC 3IDJA 3QQXA 5DDHB 5DJCB 5DEFB 1OQOA 5BW7A 3D3VD 4KUCD 3QXAA 4Y2OA 1BZ7A 2OCJA 3L1EA 2WKOA 1R6VA 1E42A 1SPDA 2AXFB 2TSAA 3IXTB 5AYTA 3TBTB 5D7KD 3VXRA 1CU4H 3D48R 2B4CC 3D39D 4P9HL 1EJOH 2CKBA 1V8HA 5DHXB 3RNQB 2C7FA 4Z7VA 5CR1A 3QNYB 1D5IL 5ICXA 3GNML 1L9MA 4QF1B 4XPAH 2VXVH 4DWHA 1VAHA 3QC5X 5MENE 3WN6A 4Z18A 2PYED 1RUQL 4QKTA 5CLTA 4F2MA 5CJQL 1JXFA 3VG0H 1KB5B 5F97E 2EXSA 3MV01 4PVMA 3CFIC 3N41B 2WM0A 5IVOA 4FQXB 3GWJA 3GXIA 4AJVA 5EF2A 2BIOA 2QPFA 3UO1L 4ETQA 2QELA 4CU8A 4HS3A 1G9MH 2FBJL 3LYRA 5EORL 3LDBB 5ICZB 4K2UL 2XKNA 4E9SA 2LU7A 2UXTA 3FS9A 1QMUA 4RGMC 4YE0A 3LZQA 1U95A 2ZAIA 2HLFC 3H3BC 1RP9A 3V5DB 3K4AA 4PRIB 4HCRA 2Y1VA 2GT9A 1OO2A 3GZOA 4KXAA 4S0HA 1LK3H 1YRKA 1HHHB 2WAQA 2WQXA 2XIBA 5FOBA 1PSKL 4TN9A 2CKBH 3QNZB 2BXZA 3P9MB 1HQ4B 4S1QH 3LNHA 4KI5D 4P2QD 2QLVB 4TSAL 3ZR5A 3CVIH 3MJ8B 4W9DC 3VXQB 3GHBL 1Z9LA 3KLSA 2VN4A 2QTVA 2ILLA 4R96A 2EDWA 1Q1JL 3BH9B 4HJUA 1DHKA 2HT4D 4S11A 2X6CA 3S36X 3MNMA 1AO7E 4MNQA 5F70A 2FR4B 4Q7DA 4HALA 4JFVA 2EINB 1A6VH 4BZ2A 1FH2A 4R0LB 1TOXA 4CKQA 1RK1B 2D7TH 4JY5L 1OM3H 5KSVA 5TH2A 4L05A 3FQTA 2XICA 3IFPA 3IMWA 4Q9RH 1BD2A 1FFOA 2YPKB 3NTCL 5CZVH 4AW4A 5I18H 4PJHE 5B3SB 4CMHC 3M46A 1MHCB 2CHNA 3LEYH 3S5LG 1CE1H 5DVMA 4NT6A 3IGAB 4IBTA 4DPBX 2PPAA 1IT9L 1QX1A 4XOBA 1WCQA 3ZU8A 5SWZD 2MCPL 2L4OA 4XN7A 1OF2A 1I7TB 3BSGA 5F72S 5HXMA 3BFQG 4JQIL 1F4WL 5I1DA 1IC5L 1DVUA 4N0YL 1W0WB 3TXAA 4FEIA 5DHEA 4BA0A 2P5EA 2XETA 2YGVA 1N5YH 1A64A 1BLNA 4WHDA 3BVDB 1MEXH 2Z4QB 1JZ7A 1S5IH 3OZ9L 4MAYA 3W38A 1SEBB 1XD1A 5IOKA 4JFOA 1UVQA 1RHFA 3WFEL 1IGCH 4D9QE 2EACA 3KCPB 1T83C 1PLBA 1XFPA 4APQB 5I74B 4LRIC 3HC3L 1CD0A 3VI4A 4XMXA 3R19A 1SHWA 3KPTA 4JHWL 1ZS8B 2CLRA 1EH9A 3SOTA 2BSED 4ERSL 5KYXB 4WI0A 1QBMH 1T04B 2HJFB 5HDQL 4O2CA 2VE6A 5EZJA 1BECA 4J39A 4XVTL 3Q13A 3FU7A 2PW1A 4Z0XB 4NFDA 5INDB 4Y7OC 7FABL 4BZ1L 4AKOA 1JHTB 1OKEA 3FBKA 4AQ8A 5AB1A 1QFPA 4HIXH 3CN0A 4MD0A 2J20A 1Z9OA 1P4BH 2OTPA 1B4TA 3K80A 4FI7A 3VE0B 1FAKT 3LS4L 4NUPA 3CSPA 1HE8A 4U7KA 3MKGA 3FYEB 4G9DB 4ADGA 3S97C 2MKLC 2A9ML 3CBJB 1T89A 4HBCL 3QUMH 4K3DH 3MFFA 3I6LD 1HJCA 1ZXQA 1XZWA 1DDHB 3R0MA 4IU2A 5DJAA 4B9GA 1FHNA 3DIDA 5DK0B 5SWZB 2WZPA 4Q4IA 4CGTA 3V0GA 3H9YA 4G82A 1T0MA 3NCJL 1HOCA 1Q0XH 3QHTC 1YQVL 1JDDA 2QQLH 5IEHA 4MS6A 4I4WB 1Q90A 4OI9A 1C16A 1NM4A 4KV5F 4QXWA 2XWZA 2LU4A 1MJ7L 3P4MA 1CF1A 1I8KB 1MIML 4D8PA 3BLPX 5HBBA 3HBZA 3DKHA 2H0PA 3M17B 3D6GA 3TBSA 4DPCX 3ZDXF 5F96L 3LQZB 4M8RA 4LASL 4WSGA 5CP7A 3VM7A 1AQDA 2E4FA 4JDVA 1R5VB 5I17B 3GSNL 4MNQE 3WFCL 4P59H 3UBXA 4NQEB 4PGEA 2HN7A 3VI4E 4FFZL 2VJXA 5SX4I 4C56D 4NQDD 4PRAA 4B5EA 2V2TA 1DJWA 4XNMB 3S98A 3WENA 1DUYB 3FF8A 4EOWL 1FRGL 3EGXB 5AEAA 5F7EL 4KH2A 5ESQB 3LX9A 1OAUH 5GJTH 3EFFA 3LHPL 3QIWA 2PW2A 2QKIC 3CV5A 3BP4A 1T1ZB 2FSEB 2PWDA 3VI3A 1HILA 2I07B 4Y8AA 4CADA 4HCIA 5T3ZE 5I76A 1SHXA 5E5UB 1D3CA 1NGZA 5C2UB 4WEUD 4X98B 1HL5A 4IRJC 3GRBA 1R5IB 1P4UA 4S1DC 3BKJH 3VYOA 2NRDA 3MV9E 3TWCH 4DP1X 3ZKQD 1V10A 4H20H 4X7CC 2JTYA 1CC3A 3MJWA 4R97C 3RB7A 3AS2A 2DIEA 3FOLA 1LE5A 4HJ0C 4IBWA 2W60A 2P3YA 3AREA 1PKOA 2B1OA 4MS8C 2ALAA 4AZ8A 5BXFB 1WIOA 1A1NB 6PCYA 3PP3H 4GUPB 3T1FA 4ALAC 5EU7C 3WN5B 3VW3H 2BXYA 4NKOB 1I53A 4ANKA 3FTYA 4JRYD 1TQVA 4JPIA 5EA0H 5IQ7H 4WK0B 1MIEL 4P4KD 3IMVA 2NY4C 4JO2L 2MTPA 3DTXA 4HLZG 3UC0H 4A68A 1SVBA 1CZ8L 3U1QA 3H0TB 1DSWA 1R46A 4XH2B 2ED6A 1KV7A 3KPPA 1QATA 4AYGA 2XNAA 5DJZB 4R8WH 2FUTA 1OCZB 1AOHA 5EEYA 5ETUA 4G8EB 1D7FA 3FCSA 4RMWA 3UDWA 5HYIA 1H3TA 3QWNA 1OAJA 2WZAA 5F71A 5EOCL 2Q8AL 4U1GC 2AJXH 2WXIA 3SGDI 4GRMB 1P1ZA 3ARDB 2OS7A 4DOHB 2XUWA 4B9YA 5KYYA 3TF4A 1AQ8A 3TO4C 3Q43A 3DMMD 3V52L 1FO0L 3DGCR 5CSBA 4HMEA 5DS1A 3V6OC 4ATTA 1FYTA 1NOLA 2B77A 3FHQA 1MI5A 5ECGA 3T0VA 2D3NA 3A67H 2J6EA 5D7LA 1EZVX 3T3MF 1K9TA 3FQXA 2X28A 4W1TA 3VSVA 4A2LA 3N9GH 2M1KA 4UQ3A 4O5LH 3PQYE 1J5OL 5D5ME 1N3NB 5EBLA 3QO0A 1XCTB 3PNWA 5CCGE 3K81A 4UQAA 1GS7A 2BHFA 3B2UC 3NCMA 4YQXL 2NTFA 4KOCA 4PN6A 1T2XA 4JL1A 2JK5A 3QJTB 1NPJA 3ARED 4ILDA 1KCSL 4KMTH 2BY3A 3DYMA 2H1LM 3BQUC 4D9LH 5E95B 1LD9A 5C0CD 3LRGA 1V5JA 2EYTA 1ANUA 3SYCA 4ZOCA 5A40E 1IAII 2OSXA 2A73A 1NSNL 5D1ZA 5IWLC 1RJYB 4ZFGH 1NBCA 5K9KB 3VAEA 3HHSB 2OM5A 4JFED 5GRXG 4JRXD 4AXWB 2ZUQB 4JFFD 1CK0L 5BRZB 1XGQB 4XO8A 3DI2B 5EO9A 2R1YA 2B5IB 3HLAB 3IK2A 3NSYA 4G8IA 4EMZA 3JQOB 3LQAC 2MCPH 1U4EA 3EKCA 4XN1A 3D25B 1WCBA 3T2NL 4IMKC 4KPHL 1H6TA 4HUKB 2YGNA 1GGCH 4WNJA 3D0AA 1S3KL 4PJIB 5A7EA 5JW3H 3TIEB 3K2MC 4HWEL 1JZ2A 5KZCD 2ZOKA 3RVVD 4P99A 4PCSA 4PRHA 4PS4H 2VZSA 4NX0A 4NQTA 1X7QA 4E36A 3SDDC 1GHFH 2PP9A 2ENJA 1ITCA 4I5BA 1J8HA 3W0WE 4MGXA 4KVPA 5EIQA 1MVUB 3AAZA 2DWTA 2BIMA 5L4IA 3S3DB 1IGTB 2DQGH 1AZVA 1AXTL 3BEVB 4LOUC 4WW2B 1JI1A 3DRQB 2YLKA 5C6PB 1GZQA 5EF3A 1MCOH 3Q6GL 1QRNE 2EO7A 3BVNB 4Z7QF 3FO0L 3R8QA 4MXWL 3FUFA 3QHZL 1SEBA 4LLYA 3O0LA 4TVPH 3SO3B 2WWNA 2J7LA 5CIPH 3F04A 4KRPB 3GKZA 2KKQA 3EZJB 4IOSD 4G3YL 4WUUB 5I5IA 1NMBH 1NWOA 3MRHB 5E6IB 4AEIH 4ZPTB 1RLBA 4N86A 1ZS8A 5SWSD 4M1GH 3U7YL 5KS9F 4NS0A 5FKAA 2JKRM 1U2CA 4PV9A 2PW1B 1JV5B 3C6SA 4XNXL 3C5SA 4OBSA 3D4CA 3T04D 1E43A 1KULA 1NFDE 3K2UH 1ZV9A 4R26L 2XQYA 1OL0A 3B1UA 2E46A 4M8QB 3JZ7A 2XN2A 2DF3A 3MV7A 2E9GA 2EC9U 2XIIA 3Q8FA 4L4TA 4LASH 3ZE0E 3IE4A 3VGHA 3QH3B 3ULUC 1C08B 5JHLL 1PU0A 2N7AA 4OLXH 4P59L 4ZS6C 5FA3A 4AVJA 4D0CA 4EI5B 1HOCB 1KBPA 3ZTJH 3BKML 1CICC 2QVFB 3ECWA 1EDHA 4HH9B 3MJGX 3VWKD 5AZUA 1KEMH 1HHGA 1UG9A 1ILSA 2F8VA 3LOWA 4XPBH 2HKHH 5IB4A 5INCB 1PZBA 4N8CL 5GRJH 4DN4L 1PG7L 2NY6D 1TJIL 4DN3H 4G3YH 4OFVA 4LPXA 2NY2D 3D85A 4U2ZA 1UFGA 4YMPA 2HRPL 3U0PB 3HCVA 1L0PA 5G4NA 2GIYA 4BXSV 4ZZFA 4NO0A 5HGDB 3S36H 5J57B 1KYAA 4HULB 2VDNB 2H0EA 1YPZB 2YUVA 4XXWC 3FH7A 4JHBA 1GMIA 1H8SA 3GMNA 1LO3H 5EZLA 2FYYA 2IAMA 2YO3A 4YO0B 2QQKH 4HJJL 4PVLA 3LKQA 4I0CC 1CDCA 3OAUH 1F1DA 4XPTL 5IV2A 4NRYB 3B56A 4I2XA 1SOXA 5IMMA 1KT2A 4RSVA 4N2CA 2Y3NA 1WFUA 4WI9A 4APQD 1DEEB 4PRPD 3C2AH 3IKCB 1JNNH 2VZOA 1KXQA 1B4LA 3HE6C 4CMMB 5AQ0A 1KENH 3BIBX 5JIIA 4JPVL 4CW1B 3WAKA 1F4YL 2XA8H 3VH8G 1OAKL 3L8QA 1AMYA 3QI9B 2GITA 3S37H 4R4ND 2OBGA 2N0KA 3T4AC 5TQ0H 3U9WA 2WVUA 2AJVH 3K5SA 4HMCA 4C54A 3B7YA 4MXVE 2ODHA 4QLRA 4TS6A 3TYGL 7PAZA 3E6FA 1T22B 2R15A 4PG9A 1WTGT 4UU9B 3HVNA 3H53A 3KXFE 3B34A 3E6HA 1MJ8H 3RI5K 2AEWA 1TJMA 2E5EA 2YD2A 5HHPA 3FCTA 1OGTB 2IV9A 2FEEI 1C7SA 2XG4A 3EJRA 3RVWD 5B7EA 4KY2A 2H3NA 2HRPH 5JPNB 1MCQA 4ZS7L 5LGHL 2HLEB 4G72B 1BV8A 3Q8CA 3VFMB 1IGIH 4GI9A 5KJRL 4W9CC 3EO9L 4I13B 4M03A 3VFNA 3LEYL 1NH6A 5KBPA 5L6YH 4M9PA 4QHLA 3REVA 5LDSA 3PGCA 3ATDA 2ICWB 4XH2A 5DRZA 3ZSSA 2VSKB 3TCLB 4XCEB 1MUJA 3WNNA 4N2GA 2VXUL 2LT9A 5IROA 2B14A 2D31A 3BVVA 1T1WB 1Z66A 5B7MA 2G5BA 4NQDB 4XRCA 5CILH 4XN5A 3VWKC 4GBXB 2YGQA 4R4BB 5CD3B 2VYRE 4YGAB 3HE7D 4N9GB 3ARDA 5KYYB 4PYGA 1E4WL 1JWUB 3IU3B 4HKXB 2CIKB 4PRPB 1P4IH 1TXKA 2ORBH 3U2SA 5ALBH 5G2NA 1FFPB 3CFTA 3L5JA 1SLWA 2Q3XA 4KHXL 1BVNP 4P5TB 3SBPA 3MGTA 2KZKA 2A6KB 2VAAB 3WKMH 1IFHH 3ULUD 2R0ZL 4UQCA 2A3TA 3E38A 3IMRA 4NUGL 4Q0XL 2CPUA 2GSIA 3X3GL 2JB6B 5CR8A 4EZLA 5FF6B 1S4IA 3PNWB 4KKLD 4PJHB 5D1XE 1IGJA 2X3BA 5GPRA 3DO3A 1QEWA 3AQYA 4OKVB 2GG1A 2R4SL 2VLLA 3U7WL 4KROD 1AVAA 2HTKC 1W0VA 2P1YA 2XWBB 4PSPA 4XN2A 5A2LH 2V5SA 4G80B 3ZTNL 3CFJB 3OF6A 2Z35A 1EJOL 2UY6A 3EO9H 5ALCL 4M3JA 3V6ZA 1G9HA 4XE0A 3L1OL 2EXWC 1MNNA 4JGUA 1UENA 1KIRA 4BYHA 4F80A 2NY0D 1GS8A 1JNHB 5B38B 1FYTE 4WVRA 4JFXB 2AXFA 3HN3A 1P5UC 1AIFB 1BW8A 1AKJD 1ZAGA 1XH1A 3MYJB 1HNGA 3ECBB 4OJDH 2JE8A 3FPYA 3GUTA 1OB1A 5K1VA 1WFNA 5D1XB 1CFMA 1S7UA 3H9SD 5BZXA 5E6SB 4DW2L 4P2OB 1B0RA 5GS0H 4MKMA 1YNTB 4J12A 1CFQB 5E4EC 3VVWA 1QFUL 5BOJA 4HJTA 4Y4HA 4DNLA 4PJXB 3PABA 4XP9H 3TNMA 4J6RH 4WO4D 5J12C 5IB3B 1CR9H 3ILPA 1MLBA 2F54A 1ED3A 3MFGB 4DJMA 2CDGA 1G5GA 1HEJC 5EG6C 4NQVB 5I28A 1YAIA 2DQGL 3HNVL 5I73C 4G7QB 1D6VH 2IANA 5JNYA 1DVTA 1CLOL 3DOHA 1WA0X 1O6SB 4WFHE 5BJTA 2JNZA 4UNIA 2ITDB 2EZ0D 3VJ6B 1CI3M 2IDUA 1JWMB 3NN8B 2DJUA 3L4CA 3GMLA 2OMYB 3IFOB 3KM1A 1M2VB 4DKEH 2YRLA 1HNFA 2JI1A 4AQEB 4QNPE 2WLNA 5CZVL 4NM8L 2VR9A 3QIUB 1XIWC 4Z8FL 1A4JA 2ZKHH 5C09A 2QGDA 4U1LB 2FGWH 3OPUA 4OZFH 3IN2A 1ZHKA 4GRWB 1KTKE 3FZUD 3NGBB 3PPSA 4KDTC 3SGKA 1E4JA 3L3IB 1B0GB 4DZ8B 1UD3A 4KX9A 1U6AH 1LQBC 4KTEL 3ULUF 3G08B 5AVYB 3VXSB 4JQIH 1QSEB 1OSZB 4X9BA 4F37K 3FMGL 2JI3A 2FJGB 3RWGA 3QUZD 3QIBB 1R24A 2N56A 4XPHH 3CFCL 3ZMNA 1RULL 1A1OA 3ARWA 3G6JF 1F13A 2HPOA 3CC1A 3MPCA 4YFLF 5EUOA 2YPKA 1LJMA 4X6DF 3CZFB 1CFBA 2KMWA 4U0RB 3TZVB 5LHDA 4N2AA 4TNVF 5D9SB 4M93B 1JF1A 3PPEA 1CPUA 4KTGA 2KLRA 4DTGH 4NGHH 1INQA 1ZJAA 4XBEH 1IQWH 3H7BA 1OF2B 5DD1L 1RERA 1XTLA 2JQZA 1J0KA 3MLTB 4GMTH 4DUWA 1EAQA 1BAGA 1IJ9A 1JIBA 4DKTA 1AKPA 1KCVL 2OXGB 5DZAA 1YMMA 5IVXF 1C9SA 2QT6A 3DHMA 4H25A 2APVA 4UT6A 5HVWA 5KZCB 3N50A 1F2QA 3DX0A 3MX0B 1IM9A 4R90H 1UEMA 4UINH 4XVTH 2AEPL 3CVBA 3NJFA 2NQCA 1TF4A 3QI9C 5D4HA 1EO8H 5C07A 1VESA 1HFUA 4OD1L 2MSPA 3FXIC 3QJFA 4KKQA 3P11H 3MN8A 3VTMA 4MAUL 4JMNA 4OCSL 3OJ2C 4DO6A 2Y4SA 3BIKA 3MRPB 2IMNA 1EQWA 4JPVH 4LB8A 3LV3A 2QL1A 2BRQA 2EIJB 3GXPA 4FJYA 4JRFA 3ZRSA 2FNBA 5AOJA 1V27A 4B27A 4WGWB 5HYJA 4DGYH 4YDIL 1BOGA 2Q3AA 2IBZX 1UA7A 2JFCA 4GBXC 4IRSD 1TVBB 5K9OB 3VDBA 2HTLD 3F62A 5HGBA 1DSFL 1YPZA 2NT1A 4JUTA 3P02A 3UEZA 2RTTA 1ERNA 4UIKH 5IK3B 3HBGA 1T2QH 5GS2D 1MPAH 4KK8D 3KPQB 1RIHH 2J71A 4K7PH 1Q9WB 6FABL 3ULUE 4ZUTB 1A4KA 4FQ1H 4XMVA 1CGWA 1TIUA 3MFFB 1F0LA 4J23A 3HAEB 4F8OA 4FC3E 1NIBA 4A2EA 1Y0LB 1HXMB 2Z0BA 1NCCH 3KJ4C 5IW1B 4YSQA 4JRXA 1V7NH 1E90A 1K6QH 1SDDA 2BSTA 5E6ID 4AJWA 4NLHA 4JJHA 4PRPE 3MYZA 4IU3B 3BD3A 5D7SL 2OAAA 4YWGH 2R2HB 2R0KH 2RQEA 2CUMA 3P4NB 4MMXC 1RZ8A 1S2EA 3IDXL 4NHCL 1I1RA 5HD8C 3B5HA 1ZIBA 4X5RA 5TF1H 3X3FH 3TBTA 1I8MA 3U4EB 3VA2C 3D0LA 3FW6A 4H0GA 1EO8L 3Q01A 4LNRB 4XMKL 1N6QL 4Z95L 1S8DA 1ACXA 1J9TA 4FERA 1NBZB 1UZ8B 2VUOA 3FQUB 2H45A 3RWDA 5K9QG 5KVGL 4QGTA 1MCNA 1YY8B 3MLWL 2HRGA 3NGBC 4NWUL 2ZUUA 4PTTA 3SDAC 1VGEL 2RA1A 2MRYA 5LNDA 1XL4A 4H20L 3RY6A 25C8H 1I1AB 3P3TA 3G6JB 2N3JA 2P5WB 5E6ZA 5FCUL 6TAAA 4MBRA 1CF8L 4EJ1C 1TZHB 1SJMA 1FFRA 4MA7L 3NIFB 5DMJB 3VW3L 2YUWA 5D55A 4UV4L 2VR8A 2P47B 1BYOA 1HCYA 4DVBB 2NUPB 1OHQA 2XIDA 3PWNB 3I2CH 4G43B 1CLYL 4MKTA 1EEYB 3CG8A 4IOFD 3U82B 2JTDA 3LJ3A 4JO2H 2GSGA 4LE8A 1JAEA 1V3LA 2NY1C 3BD4A 3DJSA 5LUMA 2IBBA 2C34A 4BSWB 4I89A 5DLML 4JDZA 4TNWK 4BFBD 1AJ7H 5D6DA 2J12B 1T20A 1ADWA 1UYWL 2A6IB 3EH4B 4M29A 5F89A 4HOXA 3MAWA 4OZHB 3JV4B 1NMAL 3DWTA 3GXMA 4HJGA 1MKFA 1KJMB 2RFXA 3ARVA 4K55A 3CFDB 4XVUD 3W5NA 2DV6A 5I15H 4ZW7A 4TPRL 4FHBD 1AR1B 2AP2A 3D0VB 3S3JA 4FD0A 4CSZA 4DO5A 1BGXL 3FUNA 1JUFA 4UTAL 5DR5L 4FMFA 2P8LB 1N64L 4DIXA 3MODH 1XIWA 2FK9A 4ODSL 1XR9B 3TGXA 4KJWC 1XR8B 1QPPA 1XEDA 1TNMA 3GMPA 2F8OA 3MC0A 3MNZB 1E7UA 4ELME 3L5IA 1XF5A 4OLYH 3MNDA 1CDJA 1O5PA 2NNAB 2Z34A 5DMKA 3CLWA 2X9YA 1K5NB 3N44F 5HJ3A 2OW6A 3VXMB 1MAMH 3AM8A 1OE3A 2PETA 5T33H 2XZCH 3KW7A 2VXVL 3QEHA 2FE0A 4NENA 1ZHBB 3QXDA 4H1LB 2IALB 1DLFL 2HA1A 2BM3A 1A7PH 1NPNA 4AL8C 4BQBA 5IESL 1Q1PA 1A7NL 1OARL 2AJ3B 3ME0B 1S5HB 4GSRA 5D5MB 3GSQA 3ZYOA 4CN4A 1BFTA 2J8UA 4ZFQA 4YHPB 1TTRA 5DD6B 2XWCA 1AYRA 3MRBB 1CL7I 1QNZH 4GT0A 4PW9A 2BHUA 4I1NB 1EK3A 2WO2B 4N0CD 3PWJB 3GDCA 1AANA 1JERA 1D5MA 1NFKA 2NY7H 3QDGD 4PJAA 3PWPD 3HFML 4ZFOA 3SGJC 1XL6A 3CVHH 2P5WE 4GAGL 5L8JB 2JMRA 2YRZA 3LZFH 5F6IC 4DGVH 4FZ8L 1CT8B 2D7NA 2X4RB 5F1KC 1EXUB 5F2FA 1HCZA 1BMZA 3H3PH 2NY4B 3VD3A 1CYWA 4AXWA 2NXYB 1UACL 2MFNA 4Y9GA 2JQMA 4GS7C 5I16A 3FUMA 3VFSA 5J6GB 3EJTA 1QI3A 2J1KA 2CDEB 2IG2L 4K9EC 4XHQA 4YDJA 5GS0C 1RZJC 3FT4B 1WBYA 4W81A 2VLKD 3G08A 4YIQA 3IJHB 3TL5A 2IAMC 2EIEA 4WI0B 2FTAA 5F3FA 4FXLA 5KYUA 5A3ID 1P9MA 2L7QA 1JGUL 4FYRA 3CZJA 1TQCC 2NSMA 5J89A 4KZDL 4OGQC 1RHHA 1W16A 3G5WA 4LLQA 4YXLL 5K1JA 1U58A 4G9FD 4TVPD 2C3VB 4XGZA 4UI2A 4F8QA 3NAAH 3DMMB 5C0CB 3IJ7A 4PY7B 5FUCE 4Q9QH 2IQ9L 3TBVA 4AE1A 3KBEA 3ROLB 1HI6A 5IR1A 3QQ9C 1I1AC 1S7XB 1BBDH 3FQYA 1H3PL 4FXGC 3WUWA 2PO6B 2BMKB 1CVSC 3LQZA 3ATAA 4X6CA 1IGTA 4M7KH 5FGBC 3T2QA 5DUPL 4MDJA 1QHPA 4JEGB 2VL4A 1BFSA 4ZYKB 2F0CA 3KPLB 1MXDA 2WGNB 3QG7H 2FQGA 2PN5A 4N2NA 3AC0A 1YYCA 4X6DB 5LAXA 1N5YL 1AD9A 2UX7A 4ELKB 3LVEA 3RWFA 3EJZC 4OZIF 1WAPA 3O6FB 1AZRA 1G0YR 1NLBH 3BMVA 4NPKA 3TP4A 1FVDB 4WFEE 4JREC 2FECL 2WLMA 4G6MH 4ZPVA 1P7QD 3QJXA 3S2CA 4GMSH 4NUMA 1KCBA 4FI6A 4G42A 2VITA 5DC0A 3BQVA 3OWEA 4NNXA 5KS9B 1EEZA 3CSYB 3GBMH 1KBVA 3SDXB 1GJWA 3ZL4H 4L3EB 3D05A 4YHOH 5E6IA 3IPFA 3DXAD 4BQCA 2VLRD 2WIIB 5G5DA 1TCRA 3U2JA 2NPLX 4YXHH 2VLME 1G1OA 4Y1AA 3QFDA 5E9DB 3RIFF 3FDWA 2TAAA 4I9XA 1JRHH 3GXUB 2WANA 3N55A 1BHGA 1BOGB 2K7PA 4TVPE 1IBGH 4IBSA 5CZKA 1CDGA 2E27L 1PZ5B 4IEFA 1PG7H 3HPLB 1FL5A 3MV8E 3V4PA 4BUQA 2GAZB 4AIZB 3MTRA 1PF3A 5AYUL 2LVEA 2O5ZH 4Z95H 3ML8A 3V0WH 3AWEA 4M8QA 4TTDC 2AJZB 4ONHB 4ZUTA 1THCA 3GSOB 3KYOA 3BP4B 2MPAL 1U3HA 5I75B 3LXUX 4I1PA 1JXKA 3APNA 1IE4A 3EBAA 3FHAA 1J48A 1NGZB 2F9BT 3TH3T 2XWJB 5EBMA 5JHDB 3D51A 4IRSC 1GGBH 3HHMA 2F53D 2XVLA 1A21A 2PCYA 1D9KA 3H2WA 2DQHH 1HL9A 4ORGA 4CNIA 2MNUA 3T0XA 3IXAA 1F2XK 4GUCA 3F00A 1EHNA 1JPGA 5FUOH 3T09A 2X2UA 4BFJA 1IV8A 1FVCB 3OZLA 1RURL 1GPOL 5MERA 2FIKB 1FPTH 1WK0A 3POCA 4N28A 1MFAL 1F42A 1PLGL 3EOTH 4HWUA 2K45A 3GGWB 4BQ9A 3MRNA 3ULSB 1CMOA 2VC2B 1I7RA 3S34L 3VFPB 3NPSC 1XCXA 5E2TH 1H8NA 1NCHA 1F90H 3LDBC 1UOKA 2OL3B 1IEBA 3F7QA 4TUJB 2WQVA 3U2IA 3WL9B 3WXVL 4FMVA 5GS0D 5KVGH 4OI8A 1A9VA 1IGML 2ZWNA 2D03H 3LRKA 1EFXA 1JRHL 2LVCA 2QFPA 2VXQL 4HU2A 4MA3B 4KJQD 5JMRA 1J8RA 2FIRT 1J7VR 1X7TA 4UM9A 4UQBA 2WWKO 3V4VH 2C5DC 2FYYB 2IAMB 3IRPX 1DBML 3EO0A 4YBLC 2NCMA 3RE0A 2VDMB 1CYXA 3ZKMC 1L0YA 1WBZA 1EEQA 3IJYB 5MP6H 5AB2A 3GRGA 4ZOAA 2BNQB 3WJJA 2KPNA 1JPFA 1GW6A 1MWAH 4LSPH 1E3XA 4K94L 2YMXH 1HWWA 3IPBA 5AVTB 4PAZA 4F9PA 1X4ZA 2AXGB 1BFVL 2XVKA 3GHEL 4GI8A 4QTHB 1RZFL 3JSSA 4B60A 3I6SA 1MCCA 1KFGA 1V54B 2HAZA 2LLNA 3FB6A 4PJGA 4ZTPL 4JKMA 1U92A 4ONFH 2WC7A 3SDAA 3T0WA 5L2KE 5CJQH 4I3GA 1M6OB 3QDME 5H2BB 1MWOA 1VB9A 5BRZA 1F58L 4L8BB 2QDVA 1U8KA 2G75A 5E2WH 4GG6A 3OKKA 5BPPA 2R27A 3LH9A 5LCVL 5IJVA 4HLJA 2B7DT 1KGCD 3T2NH 1K8IA 3CXDH 4N0FA 5KSAB 1HINH 4JK0D 4WENB 3CZSA 5CLXA 4OUUB 1NBQA 3NIDE 4RFNC 2VDRH 4QXUH 4HX1A 2PLTA 5DUBA 3M1OA 5E8NB 5HHPB 3KPRE 4QF1A 1HL4A 4K8RC 1S9VB 4QHKI 2EH8H 3MCKB 4F7KA 2H1PL 4ZW6A 2A73B 2CGRL 4W68A 2HJKB 3C5ZA 5DR5H 4DQAA 5HPMB 5TE4H 1D6EB 3D9AL 2I26N 4EDWH 3D3VE 3L4WA 2VDQH 3MLUL 1L9RA 4WTQA 4PJCE 3KE0A 5CP3H 4PJDF 3RTLA 2YD8A 3B9DA 4U6HB 2Q86A 1ORQB 4TUOB 1TZIB 3CDZA 2AMGA 5CHNA 2ICEA 4ACTA 2WXMA 3X3GH 5FW7A 1IKFL 1F4XL 1ZHNB 3DRQA 2GT9B 2EXTA 1D5XA 3W2DH 1WITA 3RBGA 2O30A 2YD4A 5F3HB 4L37A 4F5CA 5DT1H 4PUBH 1GY1A 4ZRGA 2FATH 1IAKB 4X5QA 1RU9L 4XHJC 3MROB 4HV8A 4BK5A 1J8HB 3INUH 1KG0A 1XT5A 1F97A 3WIFA 1HT6A 2E7LA 4OJYA 2YOCA 3FUEA 4X5PA 1UH4A 2P5WD 4L4TD 1INDL 4WUUA 4RISL 1F02I 4OF7A 2NZ1A 4NO3B 2AK4A 3FK3A 3MCG1 5AB9A 4TQPA 4B9FA 4ZW5A 1E4XL 1UZ6E 2DM2A 3UG3A 4CUCA 2MOGA 5CS7A 1IBZA 4ZO7A 1AGBB 5I6LA 3B3IA 4IRJA 4NKMA 3FQTB 4YHYB 3S4SB 4ACPA 2EXWD 2CRZA 1CGSH 3GMRA 2D9QB 4KO9A 5D2NA 3WSQL 3MV7D 1KTCA 3NOIA 1A14L 5DWUH 5DYFA 4QRAA 2XT1B 3QWRA 3BLKA 4E41E 4OLZH 2O6DA 3UX9B 3KWWA 3MRFB 3FT4A 5J0BA 1TTUA 4MNQB 2FR4A 1NFDF 3C6LA 3MI6A 3NZ8B 5DD0H 3C5XA 5D4JA 1I9JH 2WP3O 1F56A 4FNLH 3FBQA 1RJLA 4HHAA 3VXMD 5GZNC 2CBTA 2K8MA 4NXSA 2XX1A 1U0QA 2A6DA 4NKDA 2ZP0T 2VR7A 1T5WA 4WY7L 4ODUA 4POZC 2NNFA 3MRRB 2WXKA 4LEOB 4HP5A 4FA7B 4POYA 1Q9LA 1I1FA 4PB9H 2I5YL 2V4LA 4K3DL 1N7MH 5BQDA 3DBSA 3MTXA 3WUWB 3UIYA 1OM9A 4L4TB 4LSUL 4ZODA 2CBOA 5KG9A 4WV1A 2OMVA 3OKEA 3VRIA 4M48H 4MQSB 4AH2B 3IMBA 4KKAC 2HCZX 3IJ8A 1ASPA 2EAEA 5I1DB 1KGWA 2AEIT 5J9PA 1M57B 2ESVA 2ZONA 4W9FC 4XN4A 5DJ0A 4F58H 3CD4A 3V9CA 1ZLSL 2DD8L 4AM0B 2OSLA 4MDIB 4KK8C 4EI5A 4MQXC 5T1DL 5MI0C 4P3CH 2O5YL 1LO3L 2ADIA 1XMWA 3MREB 4X0KA 4CAGA 1BQLH 3GMNB 2EIMB 3QDJD 3KCPA 3TN0D 4PJIF 3NRPA 3QFJD 5AVXB 3WE6B 1JOIA 4S1RH 1NGYB 2CLZB 5B39B 4FXGA 5IMMB 2JF1A 4G1EA 1MVFA 5HHXH 2NR6A 5I8CB 3QZNA 1EZLA 4LQ1A 4M1CC 1M3IA 2JB5L 4N85A 5DQDH 1JXGA 4N2MA 2C3WA 4YHOL 3US1A 2QQQA 2IDFA 1HEZB 3BP5A 4NI6A 5MEPA 2Z7YA 1ET5A 4FFZH 4ZMYA 4ZZKA 2GFBB 5A43C 1NBVH 3VACA 1EHLL 1AQKL 3RUGE 1RUAH 1CLVA 1U21A 2C9QA 1CDUA 4N68A 4XMPH 1ZA6B 1NEPA 5B38G 3ZT5A 4KUCF 4K71B 5E08L 1Y18B 5D7JC 4LVHC 2PYEE 4G9DA 2FWUA 2H8PA 3S8GB 3GC3A 4E5XA 3IAGC 2R29L 1RZJH 2PCPB 3CSFA 1N18A 5L2KB 1QTSA 1KCUL 1WICA 4GOSA 5JA8B 5ENWB 2BW4A 5D1QE 5KBLA 2LW3A 4QMEA 4Y2LA 5E5LA 5D1QC 1MCRA 1U8LB 2H9GA 2UWEE 2IGFH 4B0MM 4AWJC 4AQ1C 4BGDA 1KEGL 4LCYB 3SYQA 2VMDA 3L1FA 2QVMA 5JUEH 2R0LL 4P9MH 5GGQL 2VXUH 5IREA 2A74C 2FUQA 3JYCA 1QA9B 4J3SA 3ZE2E 2KC0A 3PIQA 5JXEC 4TTDD 4UTBL 5CO1A 4ZFOL 3N6YA 2CCLA 4JPKL 4FP8H 3BH4A 2D4FA 1SBSH 5DF0A 3MRNB 1NCAH 1M7DA 2VXSL 5JIQA 1LLAA 5BZDB 4KHXH 1C12B 3CIAA 4PS7A 4TSBL 3M1BA 5D7SH 3SPVA 4GKLA 3UJTL 4YDVA 1BVNT 2ZCLL 2ZKMX 2ENYA 4GLRI 4JFWA 4PIRF 5I1KH 1A6PA 5CBEA 1RUAL 3PU7A 2VLRB 2Q7AA 2VDNH 3PHQA 4G8AC 4UB0H 1UWXH 4AEHH 2Y7QA 2WXHA 4HGMA 1OCRB 3VQ2C 3REVB 4OD3H 2ALWA 4B41A 1KJ2L 4JO1H 3WNKA 2JLPA 2I9LA 3O6FC 4KQ4H 4PEEA 1KIPA 1H9VA 1IEAB 1S78C 3HMWL 3GS4A 2ZPKL 3GSUB 5C07E 3SGJA 3VQ1C 1QO3A 4KNUA 3QIWB 4UT7H 5H37A 1H8LA 5AW7B 4OLVH 5CJXA 2JI2A 4JPIB 1E6OL 3SE3A 4Q9RL 4NZFA 3D12B 4PJHA 2XBZA 5E8EA 2XZAL 5ESAA 3IU4L 3L3DB 1KXTA 5GQBA 1BZ9A 1HQ4A 1KGJA 4IGBC 5C3LD 1NCBH 2BS9A 2XN1A 2ZXQA 4WKZA 2DLEA 4KO6A 3MOAL 1CF8H 2Y06L 3H42L 4FNPA 4OCXL 4AYMC 3B9AA 5T1KB 3EYQD 3IS0X 1DJGA 2P8MB 1AIFA 1KY7A 4Y5YB 1KCSH 2OI9B 2HYMA 2YWZA 5G4OA 2EE9A 3RFZA 2GJRA 5B1JC 3WEOA 3GXNA 4PJHF 1AO7A 3GI8H 3U36B 4RAUB 2C26A 4ELMF 1RZ7H 1BZ8A 1BEYL 3RY4A 4R7DA 3WIAA 4KV5E 2DKUA 3UG4A 3T6XA 2F5BL 1WAEA 1G7IA 3GEFA 5DHVB 1VIWA 2K6WA 3QO0B 1CK0H 1MHCA 1WGOA 2HFEA 3O4LA 4H44C 3BE1L 3SYAA 2HJKA 3C5ZB 5LGYA 3TO2A 1I1AA 1Q94A 2P5WA 5F7MC 4QDGA 3MMEB 1F3RB 5GSRA 3FSAA 2JVUA 2OMTB 4YL9A 35C8H 3UBXG 4W4OA 2AHIA 1Z3RA 3UBFA 5C0EA 4X99A 3X2QB 3VWJC 1DO6A 1S9YB 4J3OC 3WXWH 5I8OL 3JWNH 1D2OA 3CDZB 4F8LA 2GB2A 3OR7A 4MSWB 3KH4A 1DN0A 1AFVL 3N43F 4XNDA 1AGFA 3ECQA 1UYWH 1N59A 4FCHA 4E9XA 3MGOB 3RAJH 3HHSA 1NC2D 1PNDA 2ZZUT 1MW2A 5EBLB 4AM0Q 2CDFB 1H6UA 3LPFA 4C57C 3CAFA 4J27A 4EUPB 3CN3A 1S78D 1L9SA 3OXSA 5CFAA 1INDH 5CZXD 2DTSA 3U9UA 3RJDA 4P05A 4FNRA 5HDRA 4XNUH 3L6FA 5C70A 4HJGB 4XP1L 2NY5L 3KGSA 2FO1A 3OKLB 4UTCA 4K07A 4ODVL 3IDGA 5JPNC 1HH6A 2XN9B 2FVNA 3VFOB 1FZMA 2VW7A 3QJVB 3L4ZA 4ZMNA 1M42A 5EUOB 5D70L 3NCBB 4XB7A 1G0XA 2YHGA 4HK3N 2ZXDA 2B3RA 2V9TA 4DT2A 3AU0A 4XC3L 3OKDA 3JWNC 1XR9A 4LCUA 5GGRB 1Z1WA 1XGRA 2GJ6A 2ZIDA 2YQBA 4WI4A 3B7UX 1LVEA 5BW7C 3QWRD 4NNYA 1X5FA 5BO1H 2F19H 3PXHA 4AT6A 1NIDA 1MLCB 4GMTL 2D3JA 4N2DA 3WNIA 4YEEA 2AMUA 2WLHA 3H7LA 3NCXA 4DW2H 3UCRA 4KO5A 3DK0A 4PJ5D 3ZZLA 4Z7WE 3P0GB 4HHAB 4UANA 1VEMA 1IGCL 2ZSWA 3BWAB 5D5MA 2Y07L 4BWTA 5HYEA 2GBUA 5E6RB 3ZXAC 4KNQA 3QYMA 4MMZC 3X1GA 2F7RA 4JJOA 1OGAD 1SJHB 5E70A 2BZ7A 3PDOA 2IOIA 2WAHA 4RWYH 2E7BA 5TGBA 4MRBA 4JQVC 1EDYA 4WW2A 2B1AL 1U2YA 3KBPA 5LBSL 1XAKA 1EFXD 3H7BB 4LCWA 1KTLA 4PLOB 3UTZA 1EHLH 4FADA 4D9RE 1KIUA 1LO5A 2F53E 3ILDA 3VXTA 1G7MB 2DLGA 5I6OA 2OMUB 5ESVA 1A5FH 4NUJA 3LQMA 5D93C 5FYJL 3MRCA 2EUVA 2R8SH 3X17A 1CFSB 3LRHA 2OR9L 3B9EA 4RX4D 1YECH 3DSFL 4X7SL 3SD2A 3CC5B 4QHNB 1QFHA 3W9EA 2NW3B 3RILA 2CHDA 3U46B 4LSPL 3ULVH 4TLKA 5KJ4A 3HAEA 1C08A 3C8KB 5FAAA 1WA1X 2YSSB 3APMA 5CSGA 5CZRA 4CBPA 4OZ4B 4OT1H 3ETBJ 4URTB 2XN0A 2DWSA 1EUTA 1KLFB 1T6VN 2QTEA 4LLAA 4YVNA 2NSXA 4BZ2H 1EDQA 2YKLH 5KUMA 2XQBL 4MNQD 4PHZA 3QDGB 2BWIA 2IADA 3F7VB 4WWID 4KKAD 4DAGL 2QR0A 1RLWA 1AP2A 1YEEH 2VDKL 1C5DB 2X6AA 3L3GA 4Y5VB 1BLIA 1MCWW 4G8GA 4PY7A 5HHME 4XNAA 4XCNA 2C4FU 2ZXWB 3GSXA 3ROLA 4JANB 5IHZA 5TFSH 3T1FB 3FU6A 3MV7B 4H2CA 3RIAK 2ZOOA 3NJIA 5E94B 2K0RA 3JT2A 3OJDA 2HX9A 4N8PA 1ZRUA 3HC3H 3FTSA 1AH1A 4JFEB 3T3PF 3CIQA 3NP3A 4OQ1A 4Y89A 2Z31C 3KLAB 4EAEA 3QXVA 3QO1A 5DURD 4MRCA 1D5ZA 5L0QC 3QORC 1LDPL 3IDIA 3TS8A 2PTUA 2W38A 1BF5A 3QNXA 4U1SA 5JLZB 2KL6A 4NSKA 4BFOA 1NCUA 2TRHA 4PCTA 4TOYL 3QUXC 1XDTT 2ZG3A 1XAUA 1QW8A 3A4FA 3EUDA 2GKIA 4BE6A 1HHIA 4OM0L 5I19H 1GS6X 2VOTA 5IEKB 4CW1A 1GC1H 3NG5A 3O6LL 5FFGA 1YAZA 4BK4A 3RYMA 4HAKA 3VCLA 5IMLA 1WIUA 1NGQH 1T2JA 4JFYA 3VO0A 4O00A 4AGPA 1N3NA 5K59F 2D4DA 5L88L 3LH2L 1XCTA 4AEHL 1UB5B 2EC8A 3VGEA 4BSWA 3G6JA 1UCBH 3I3EA 2YD0A 4RFOH 2XI9A 3QJHA 3S96B 5H35B 2GHZA 3HZKA 1NMAH 1PG7W 3JXAA 2ICWI 3NIGF 3VD1A 1SHMA 2IGLA 3RIAF 3DPBA 1HH9A 3GT6A 5I6XC 3S34H 3WY1A 4EDXB 5I5RA 2X4QA 5ALBL 1DEEA 1EPFA 3N43B 4IIZA 2XCMC 5I1JH 4MJ6A 3PWNA 2GUOB 3SJVA 1MIEH 4BH7B 4PJ9B 3VA6A 1CLZL 3ECVA 5DVPA 1RFDL 2F5BH 1NDMB 5T8IA 3B2XA 3MU3A 4JZNA 5D2NC 2OV0A 1E9OB 4WJ5A 4HD9A 1R5WA 1BJ1J 2FYVA 5DURB 1VACB 1THAA 1L9OA 4R2GD 2WMPA 4GQQA 1NAMH 4M6AA 4CNIB 4JO5A 3VD5A 1GOGA 1L0XA 4JGNA 1K8DB 3VRJA 3SDDD 1BM3H 1KGUA 1MHPL 4OU3A 2BO0A 5IMKB 3N41F 3LSOA 2VRKA 3JV4A 4JW3A 4QI3A 5DMKB 2VMCA 1PPIA 1FO0H 4N9GA 4AZUA 3JUZA 4ZTPH 2WLZA 1MFNA 4W4NA 1NAKH 1DJIA 1F5WA 1PQZA 1F8TH 3OG6B 3N3EA 4WUUE 3D08A 3SZ6A 1MWAL 4BH8A 4GB9A 1S5HA 1JK8A 3GSQB 5SWSE 2PXYA 3RWEB 5HVFB 3QIUC 2Z1PA 4KHTL 2APSA 2F5AL 3S35L 3C2SA 2PWFA 3SDYH 4CVXA 5DU7A 1N2RB 3H4HA 4NZTH 5LXGL 3ZQ9A 1P0SE 1QLRA 1SXZA 4G70B 5TK2A 1JHLL 3OLEA 1QEWB 3EDEA 4KQ3H 5C08E 1M2OA 1U8IA 3MBEB 2V17L 1ZT7A 2NNAA 3GSWA 3H8NA 3KWUA 4GAGH 2UZIH 3B7SA 3UJJH 4FLSA 2OCCB 3P2DA 1ZT4A 2EEBA 3JUYA 4QOKB 5CEXA 4Y5VC 3QUYA 3FQNB 1U41A 1CLZH 3T3PB 4E41B 4IDJL 4H1LA 1DBKH 4GSQA 2ITCA 4L4VE 2NTSP 3AFLA 3JV0A 1HJBC 2Z6FA 3UZQA 1UH2A 2ZWSA 2EZ0C 2FWOB 2YXVA 1X5LA 3WFHA 4A7TA 5DJYA 3O2DL 4E0RB 4PV8A 1SYSA 1UA3A 2NR6C 1XGPA 4FG0A 5SWZE 2NY1B 3A4EA 4LCCA 4XBPB 1B4RA 5KWYC 4GI6A 3AG4B 4CVZB 1XCQB 1K8IB 4N0FB 5JXAL 3X12A 1CO1A 3MYJA 2E76C 4FZEL 4QNPF 1FGVH 1J5CA 3MZGB 5I15L 4M6OL 3ZK0A 4NM8H 4QHUA 4B97A 3I6GB 9PCYA 2I25N 2X9XA 2IQAA 4JRWA 2FHCA 1XH0A 3WKNA 2W81C 5ID1A 4FS0A 4EI6B 1QFWI 1F11B 3UMNA 4Y4HB 4PJXA 3AADB 4RMSA 5I1LA 1JXDA 4KC3B 3VRLE 1GYAA 4ODSH 4KHTH 5I8EA 1FZOB 3MUY1 4G2AA 4PJEF 4Z7UA 2Z65C 4JZOA 3VTAA 1CD9B 1HZHH 3LKOA 4FN0A 5JZ7D 2J8HA 3WIIH 2BMKA 1YNLL 2IWKA 5FFOA 2CLVB 1HS6A 1FQ9C 1B4JH 5DZPA 4QWWC 2V2WB 4ZUVB 3MV8D 1E30A 2EYRB 5GJSH 3TEZA 5FO2A 2C9AA 3AG1B 3F58H 5K39B 1S9XB 4AQEA 4JZJB 5KVFH 1GH7A 2XPGA 2R8SL 3W3BA 4DP2X 1UVQB 2ZCHL 4OJEH 4PVNA 5C97A 3GLEA 3SY6A 1NMCB 1NC2B 4IGBD 5F6IB 4S1DD 2WO4A 2VITB 5CSZA 3CVCA 3ZL4L 2QQNL 4WK4B 1OCWL 3RUGB 1HHKB 1P84K 2L7UA 3VXSA 4PPTA 4OIIL 3KDMA 4FQ2H 3WLWC 4ANXA 5TGBB 1KB5L 4R3SB 5DWUL 3DVGB 2X9WA 1I8IA 3EOAA 4JQVA 2W65A 4YDLB 2XXFA 5SV4A 3VXRE 2LTQC 3BZFB 4DAGH 1KB9K 4DEPC 4QXTA 5IJDC 5GZOA 1X5KA 3CFEA 4AYDC 3P4LA 4NC0B 3RY5A 1JXJA 3TESA 1M71B 2IBGA 2YD5A 3CDYA 3CHQA 4X8GA 4U4IA 2IFFH 5TFSL 2I9TA 2OMNA 2WLJA 1AXSA 3B9KC 4JPWL 4OUOA 4YR6A 3WJMB 5I24A 2BOBB 2MCG1 4I88A 2NXYC 2X40A 4OGAC 5AENA 5DJAB 1H19A 3MRFA 1OLZA 2VM3A 3VSUA 4PJXE 4FFVC 5DFTA 4WDIB 2Q20A 4LIQH 3FRUA 4HC1L 5E5MB 3PWPA 4L2LA 4LLWA 4AGNA 5CINL 5E4AA 5GRYA 4UWQB 3CU1A 5TDNB 4Z7OE 2OI9C 1A1OB 1PKQE 3IPEA 3H42H 3C5JA 4M48L 3TNNB 5KSBB 1E8ZA 2ZXAA 2X2IA 1T22A 4LRNL 1QWUA 3FU5A 2WINA 4JKWA 3RX9A 1LXMA 1QKZH 3HBQA 1QUPA 5FYKH 1YZZA 3LEXA 1F6AA 1Y6KR 3QFGA 4G6FD 5E1QA 3SDXF 4OZIA 1FCCA 5B21A 1T4WA 5KBDA 5JPNA 1A6UH 2ITEA 4LVNC 2DEYX 1UH3A 4JM2F 1NEZB 1CGTA 3MGAA 1ML0A 2VDMH 1NUFA 4MA3A 5JOFA 1MQKH 2OXHA 5FYJD 1D5ZB 1TPXB 4HF5L 5IROC 1V7NL 3V5HB 1EZVY 4X8JA 2G3XA 2GTQA 2MHAB 4APQC 4ZMWA 5IZ7A 4X7EC 2OTUA 3BHBB 4RLDA 1IC0A 3VB9A 4NQDA 4P5MB 4GBXA 4RAVA 2OYPA 1IC4L 1EGJA 3H9SB 2ZUTA 1JRHI 1OVZA 4IW4C 2CKBB 1OP3K 3SKOA 3UG5A 1SN2A 3RNQA 5F7DB 3LN4A 5HI3C 4DUVA 2AQQA 2K3TA 1EJ8A 4U6VH 3O2WH 3RX5A 5IMLB 1Z2KA 3B83A 3VCLB 2YXWA 4LP8A 4R7LA 2EDRA 1UZ6F 2YXFA 2EEXA 5FF6A 4U3CA 3TV3H 1OIOA 1KBKA 3EFDL 3MACL 3VD2A 1VGEH 2CJ3A 1OTSC 4LRNH 1ECYA 1ZJBA 1Y6NR 4ZNEE 4W9JC 2J2ZA 3K72A 3ETTA 3ARQA 5AWNL 1IC1A 1N68A 1TQBC 3KLDA 4N2BA 1NCAL 2CHXA 4I3RL 4HX1B 5BQ7A 3CGTA 1PKQA 2B2XL 3BT2L 1NAKL 3EAKA 5I1JL 2FX9H 3IS1X 3TN0B 1HEHC 4WRLA 4EDXA 4W9HC 3QFJB 5DLLA 1JZEA 4ZD3H 1N70A 4U1NB 2HVJB 3DTXB 3BYTA 4OD2A 1C1EH 4TNWF 3ZTDC 2VDNL 3EJYC 4NZRH 1Z9SB 4MJ5B 2CGYA 3MRDB 4TUKH 3PGDA 1SFHA 4L8BA 4MXVF 2DQJH 2WTOA 4YAQB 2WPGA 3ULVC 3P9MA 3CH1A 5I71B 3QG6B 4NWTH 1E9PA 4NN5C 3VG0L 4LL9A 1PZUB 2H5UA 3P54A 3PIQB 4U6HA 4DGWC 2ZKWA 3RY6C 2XVBA 4UT7L 5J6SA 1J87A 4M6ML 2ED9A 1LYQA 3KVQA 3SE4C 1G7PB 1OT2A 5E23A 2DLHA 1GZPB 4XCCH 4ZMVA 4KRLB 3MNWB 1G7JB 1OANA 2YD3A 2PPDA 3EZ8A 3UACA 1BQHB 3CPLA 3BXNB 2EUZA 1DBKL 3A4AA 2FGWL 1WJ3A 5IBTL 3DJZA 4Y9BA 3S6CA 3F2LA 4X5LA 1WH0A 3HNSH 4BH8B 3PHQB 4D7BA 3W39A 1D6EA 3ABLB 4GAYA 4NYLA 3IETA 1JN6B 1K72A 2C1PB 3AU1A 4XTRD 4F7CA 4NQVA 3KPSB 1SNRA 1RD6A 3CFUA 3ES6B 4W70A 1TETH 1IEAA 2VO8A 3TCXA 1HTYA 1QEXA 4I18C 2Q86B 4DZBB 4URKA 4Q56A 3QCTH 4ZW8A 3TPKA 4ZNCD 5K59E 5C86A 2OSYA 2VUKA 1I3VA 1HSAA 2CO2A 3ZTNH 3BSZH 3CLEL 1HWGB 1QUNA 4FLQA 1P5VB 2GJ6E 5C6TH 1MRFH 1KBGH 3WNLA 1IMHC 1MCEA 5ADOL 1IVLA 1LP9B 4W93A 2CO7B 2E47A 4WHCA 1OSPL 4Z3TA 3IFLL 1LNUB 2IO5A 5FPIA 3DC0A 3L16A 2X89D 1QAWA 5T5NF 4XHJD 3WTTA 3LRSA 1NBYA 2BNUB 3DARA 1QLFA 1P5UA 2EDJA 4YHIA 4UT9A 4ALAH 1AE6H 3WHE0 5JXAH 3JBG7 4IKIA 4L1LA 2KH2B 1BFOB 1VSCA 32C2B 4JB9L 5L7XL 4FQJL 3TEUA 4PG2A 1NICA 2CLRB 2F8IA 3HUJA 5B39G 5HY9B 4YC2C 3F7LA 5J4MA 5DHYB 3JZYA 2AJ3A 3UAJA 2UZXA 2WD0A 3L4UA 5I1CL 1QZNA 4LCWE 2IDSA 5CCKH 2AEOA 2QEJA 4P04A 5CKGA 2YFNA 2Y9RT 5FHBH 3QRGH 4YHML 4NQCE 5D6CB 4QXVA 1WWCA 3P0YL 5DMGD 2ESVD 1IAOA 2NW2A 3MNZA 5DK3A 4Z3FA 4P23D 2UXGA 2G0KA 4X99B 5F7BA 1I3RB 3V7AG 3MV8A 1NZRA 4Q89A 1KMGA 3QDAA 1QLEL 1O7VA 2CE6A 3V9EA 1NAMB 4NZUL 4AVHA 2IANE 4YXLH 3KDPB 4JZJA 1DLHA 4XO5A 1XXDC 2WYTA 4OCNC 3TU6A 3STBA 3BQUD 2D0FA 5DRXB 1IAMA 3MLYL 3S35X 1NL0H 2OZ4L 1NIAA 3AJ7A 2R4RH 3QQDB 4ODWB 4EUPA 3MRHA 1TO4A 5F6HI 2GQHA 3TBSB 3VXSD 2OL3H 3L2LA 4ENED 2R2EA 2W0FB 2HTLC 3UPRB 1USQA 1KNOA 1KJ3H 1U8CA 3DVGA 1GRWA 1I9RH 3D18A 3VU1A 2WY3B 3WNOA 1IC5H 4DKDC 3TIDA 3IDGB 5ERWB 3IYLW 2K4AA 1JZHA 2HN7B 3BZFA 3DUSB 4N8VA 2GEEA 2KHAA 1Z0MA 3PFUA 5HYSA 4MD4A 3WSQH 1J8SA 3EYVB 4K9EL 5FOJA 3KPQA 2OX5A 2QQKL 2SODB 4K5MA 1R9FA 2GJ6B 4YFEA 3ABZA 3DX4A 1JTTA 4MDJB 3WJMA 2WTRA 3KYMB 1L7TH 2H32B 3W9DB 3DIFA 3I9AA 4P23B 5FA3B 4ZAKB 1Q9KB 2EADA 4JHAH 2EVGA 4M5TA 3QISA 1AD9B 4GXUM 3RWFB 2IOMA 4Z7NE 4Y1AD 4GO9A 1WV7T 5C0JA 4MQ7A 2K9UA 4A1RA 5J11C 1OAKH 1TO5A 4EXPX 3DETC 5IGXL 1ZD6A 2JCCA 1UM6H 3PHAA 2BP3A 4HIJA 3TYGH 1OEZW 4F7EA 2IH3A 1E5YA 5GGUB 1NL0