2ZDGA

Crystal structure of d-alanine:d-alanine ligase with adp from thermus thermophius hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
319
structure length
302
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 85
structure length 302
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdgA01
4MA5A 1EUCB 2YZNA 3RV3A 3HO8A 4M98A 4I4TF 3TIGA 1C30A 4HR7A 4YJ3F 3NUAA 2R7LA 3KREA 2FPGB 1W93A 4M9UA 1KJJA 2W6OA 2W6MA 1IOWA 4IHJF 2V58A 5LXTF 2W6NA 3WO0A 4YAKB 4O7SA 2ZDQA 4IWXA 3R5HA 4O4LF 2DIKA 1VKZA 2OLSA 3QFFA 5C1OA 5HV6A 3TW6A 4ME6A 4C5AA 3RFCA 4E4TA 3WNZA 4EABA 2V59A 5JH7F 2XD4A 2R87A 3JZFA 4IZOA 3U54A 4C5CA 3ETHA 4O81A 5BPHA 4EA7A 1Z2OX 5JVDF 1EHIA 4FFMA 4DLKA 2NU6B 4O86A 3R5XA 3K3PA 4DIMA 5H80A 3VPBA 2CNQA 4O4HF 2CNVA 4XZ3B 4I55F 1M0WA 3Q1KA 2W6QA 4FE2A 4EA8A 4YJ2F 2DZDA 1A48A 3R9RA 5C8YF 3E5NA 4O7VA 3Q2OA 1E4EA 1DV2A 4O7WA 4O82A 4O84A 5K2MA 4O83A 3KAKA 2R7KA 3WO1A 1GGOA 3JZIA 4O2BF 4M99A 1DV1A 3TINA 4WD3A 3HBLA 4C5BA 2Z04A 4O4JF 4GGMX 2WYOA 3VOTA 5JVLA 1GSHA 1GSAA 3AX6A 3KALA 3BG5A 3OUZA 2YW2A 2YL2A 1M6VA 3K5HA 4XYLB 1I7LA 4RZQA 5I47A 4ZQIA 1B6SA 5CA0F 1T36A 2HJWA 2GPSA 3RUPA 2I8CA 1UC8A 4YBZB 5J2UF 2R86A 2NU7B 2C00A 3R5FA 2VR1A 4HNVA 5GONF 1M0TA 1OBDA 3HB9A 2IP4A 4HNUA 3G8DA 2CQYA 2W70A 5LP6F 5KKNB 1W96A 2I87A 2J9GA 2W6ZA 4IWYA 1PK8A 2PVPA 1KJ8A 3V4ZA 1GSOA 2YRWA 3ORQA 2PN1A 2W71A 3LP8A 3OUUA 2NUAB 5D8DA 5LYJF 4WBNF 4O7RA 4O7LA 1E4EB 5J2TF 1C3OA 1CQJB 1DIKA 4O4IF 4HNTA 1VBGA 4MV3A 1B6RA 5C1PA 5CAEB 5EZYF 4QSHA 3BFPA 4MAMA 1KJQA 3U55A 5BMVF 1JKJB 3MWDA 1KBLA 4YB8B 1SCUB 4ZOLF 4O7NA 3BSWA 1PX2A 4EAAA 4MV7A 1BXRA 2YYAA 4M9CA 1EUDB 5LA6F 2R85A 3AW8A 2DWCA 2FPPB 4EA9A 2R7NA 2X0SA 4IIJF 2YZMA 3ORRA 2YZLA 1GLVA 4TV8F 4O7ZA 1Z2NX 3TIIA 5LOVF 2QK4A 1JDBB 2FPIB 2YS6A 1KC7A 2Z02A 4FU0A 5CA1F 3VA7A 1JLLB 2QF7A 1WR2A 2DLNA 2R82A 4MA0A 2YZGA 2GQSA 2FB9A 1I7NA 1ULZA 3I12A 2I80A 1KEEA 4MV4A 1VBHA 2HGSA 5KX5F 3DF7A 4XYMB 2P0AA 4FGRA 3GIDA 2GPWA 2YWVA 5IYZF 1EYZA 2W6PA 2VHEA 1AUXA 2NU9B 3V4SA 5JQWA 3GLKA 2SCUB 2CNUA 4FFOA 4I50F 5BPFA 3TQTA 1AUVA 1KUTA 4MV8A 4FFLA 1EZ1A 5JQGF 4L1KA 3U9TA 2NU8B 2PBZA 4XX0B 3N6RA 3JRXA 2YRXA 3LWBA 2ZDGA 1JDEA 4FFNA 2GLTA 3KAJA 5DMXA 2R7MA 3BSYA 4ZHQF 4FFRA 4EG0A 5FNVF 1IOVA 2ZDHA 3R23A 2FP4B 2YS7A 4YAJB 3RV4A 3MJFA 3G8CA 2V5AA 1CQIB 1CE8A 3SE7A 3MWEA 5HBRB 1OBGA 3VMMA 4MV9A 3VPDA 4MV1A 4TV9F 3VPCA 1KJ9A 2R84A 1KJIA 1BNCA 3K5IA 4MV6A 4O7TA 4O2AF 5CB4F 3N8DA 1Z2PX 2VQDA 4Y8VB 1CS0A 3BSSA 2XCLA 3UFXB 4HQ6A 4O7YA 3U9SA 4ZI7F 2CZGA 4FFPA 2VPQA 3ETJA 2GQRA 4EGJA 2NPOA 3JRWA 2R6FA 4J6EA 4EGQA 1A9XA 1UC9A 4NYEA 4TUYF
chains in the Genus database with same CATH superfamily
2E4WA 3GWZA 2V7QD 3PQ2A 3BGSA 4RLQA 5HS4A 3J7AK 5IT9W 2C5AA 1U2DC 5HM8A 4ZAXA 2GZHA 1XG5A 1XLWA 2J3DA 3KXPA 4M98A 3GLHA 3ZHOA 3TJZA 1B2RA 1WRBA 3AEKB 1VJRA 3UJBA 4FMDB 3L7KA 2K7FA 4B9AA 1KPHA 2YXLA 3I1FA 2VZEA 4FSXA 1ZHQA 5JMPA 4HFNA 4U3JA 3TRDA 3BKXA 3K72B 2I65A 2J0VA 3P9PA 3CUWA 1U1GA 4DPKA 4O4LB 1ET0A 2I6UA 3ZQUA 1N1EA 4JLAA 5KU7A 3NM5A 1SUBA 3OLVA 1ONNA 5SYNA 5LOVA 4CLRA 2OFOA 4YPOA 2WUFA 4XSHA 2F8TA 3VO9A 2QTWB 3G5MA 4EUHA 4D9FA 4M9UA 3IIEA 1LVHA 4JU8A 1C4WA 2CLMB 1RK6A 2D0OB 1CFZA 2D06A 5AIAA 2VS1A 3W6ZA 3SCZA 1DLIA 1HMPA 2ZBPA 1VP9A 2PH1A 2WTMA 1SVLA 5DGAA 3M34A 2QWXA 2GKOA 1PKEA 3R7NA 4EHNA 3CVVA 2E0IA 4Q9AA 2W6MA 1NVAA 2YFQA 4K81B 4OYLA 2Y8EA 4Q9KA 1USWA 1LF0A 1B33N 3AP2A 3OLXA 2Q4RA 2GK6A 5CJ2A 4BXOA 3CW8X 1L5GB 4FHDA 1AXGA 2DC1A 4O7SA 3WGGA 1UF9A 2WP8J 3QEMA 4LXGA 1ILEA 3RVQA 3U60B 4AY4A 3BXPA 3R5HA 3UK0A 3USES 2O8FB 1DU4A 1E2FA 3GN2A 1I2CA 3IVGA 3QUQA 5CXSA 4BQPA 4Z3OA 1T1JA 1QGUA 3AOGA 3CBQA 2YJ6A 3MFQA 1SURA 2REBA 2WTEA 5C1OA 3N6XA 1RPJA 2IYEA 4IG9A 3OTOB 3QEBZ 1YZTA 3N5CA 4IJWA 4Y2RA 1NC1A 3Q3VA 3T9CA 2P77A 4EF4A 4MV5A 2Y68A 4HYYA 4UJ3A 5L6LB 2TMYA 2AEMA 4Q34A 5FOVA 1E63A 4EGCB 4E4TA 4LGCA 1R5BA 4KH1A 5KWSA 4F4CA 5TB5A 1YQ9A 4Z7OB 5IG2A 4UNRA 2NQ8A 1XNGA 4C3UA 3B2EA 2XD4A 3ZOKA 4BMXA 1JZTA 1QRSA 3IO5A 2ZUCA 2BMDA 4MHOA 5JOQA 4DUYB 3ZK9A 2ZBGA 2UXDB 3EQ7A 4I5DA 4AS2A 4V0KA 4QXMA 1P74A 2PUCA 3KUKA 1H8HD 1SG6A 3LULA 5FTNA 1O0BA 4G4GA 3AQ4A 3RF6A 3EF1A 2QJRA 2IXEA 2HD4A 2CHUA 2CF5A 4E1VA 2GHTA 2Q5HA 4JVOA 3DMFA 1NU6A 3B1VA 1QOZA 3HEMA 3BQ0A 3Q9NA 4NZMA 2A9QA 1XL1A 5CYPA 1PEYA 4C6TA 4GC6A 1CS4C 4LVOA 2X86A 1TFRA 3GQCA 4XDZA 2JLAA 2DT5A 3RAJA 1S2LA 4ECUA 1SC3A 4US2R 1XDNA 3ZU2A 1HMYA 1ONSA 3EIWA 1JPNA 1ZZGA 4PNPA 4QUBA 4B3RB 1NDUA 2ZB2A 1GFZA 1W0KD 2ODEA 4J16C 4TSKA 3RBXA 5CFPA 4O3MA 4J9UE 4PGAA 1Z63A 2PLRA 1S03G 5DG9A 3KAQA 4P9NA 3JQ9A 4LCBA 3FYUC 1A9SA 1DHRA 3UT5A 2WJGA 4DVJA 4D4HA 5EP4A 4X8MA 1ZGJA 3PJEA 2Y0BA 2CNVA 1RHKA 4G5XA 2ZWVA 2DPJA 2W42A 1HFEL 2C9ZA 4J76A 3AFMA 3EVZA 3JQEA 1EFRD 4OBBA 5TPZA 3VPXA 4BS9A 4DCGA 5HUHA 7REQA 2AZXA 3M49A 2DZDA 4P7GA 4UBOA 1DC8A 4NQRA 4F3RA 3AI2A 1RQRA 2OO5C 2C8VA 2HPHA 3RG8A 3HSKA 5LDGA 2EOAA 5C8YF 2QU7A 3COZA 2Z2XA 1CERA 4R98A 4HB2A 1X2EA 2QDXA 1FFEA 4P22A 2GAOA 3TNDA 1E4EA 4GX5A 3JU3A 3EVNA 1X9GA 4DV0B 1UKEA 3KQLA 2W48A 1ZIOA 4PZ9A 5GGXA 2HFKA 5A03A 1B1CA 4JP5A 4OYRA 4O83A 3D59A 3M9XA 5D1NA 5JCOA 5FD5A 4TMFA 1I3KA 5CE8A 3QOFA 2A94A 3PHGA 5IJZA 3EOBI 1T34A 1ULBA 2EFGA 4HRVA 2X4GA 2NVUB 2H6EA 2PS3A 1KORA 1NF3A 3S81A 4DABA 4GXNA 4F3TA 4N8SA 3CX7A 3EUEA 3ZQ6A 3T4EA 1H6BA 4WD3A 2JGNA 3GJ5A 1W94A 3W04A 4DJAA 2OHOA 4WACA 3JZDA 4HVLA 1D0IA 4HSGA 1THTA 3KEQA 4BVFA 1FVFA 1L4MA 2V6IA 4A6DA 1JLLA 1RAAA 3ABQB 5LQUA 1P31A 3GCXA 3R6WA 1CHDA 1H6CA 4XCXA 1TA0A 2UVWA 3B85A 3LX5A 1CLEA 1XD2B 1E7SA 5KKAA 3K5HA 1W1UA 4YRCA 4XGIA 1MXHA 3REGA 4AXXA 2B36A 1UJMA 5BSTA 1V41E 1RE1A 4B3RH 3KKEA 2VPWA 3OBIA 1CXZA 2O4CA 1EQ2A 4GVXA 4LSGA 3GNLA 5MDHA 1LC0A 5DOVA 1ORHA 2VQSA 1FYWA 5AUPB 3FYHA 3DHWC 1B04A 3TW7A 2ZRHA 3DTVB 3O93A 4N5NA 4E21A 2CMGA 3F3MA 2I8LA 1OFUA 4KO8A 4RTPA 1Y6GA 1UC8A 2PYIA 2CUZA 2FETA 5JG7A 3OIFA 3EPGA 3CUUA 2YHBA 5DEOA 5J2UB 3MCZA 4CQLA 4K3VA 4A15A 3DL7A 1KP2A 5JVDA 4RA6A 2CL0X 2ZPAA 721PA 3RADC 4B8YA 1DS6A 2ON6A 4QHSA 1IY2A 5HJ2A 3GIQA 2QZJA 1UQRA 2VK4A 3I30X 2HHAA 5JASA 1ZN7A 4RK1A 1Z29A 2QRHA 3JR3A 1OBDA 1IH8A 1T9BA 3MK31 3NTVA 2DBZA 5BSKA 2F8LA 5HJEA 3OM1A 3QXSA 2Y9MB 4YVFA 3H2YA 5K0JA 2ZM5A 1TDJA 4KSYA 1L8XA 5IYBG 1JUDA 5K0NA 3X2FA 1V1JA 1TT7A 1II9A 3LWZA 5U4QA 5DM0A 4QLAA 1RTKA 1EA5A 1L9XA 3PF8A 3BH0A 3JQ9C 1Z4KA 4IDFA 2IFTA 1WA5A 1J56A 4WFKA 3S2EA 1UXHA 2EG9A 3HL4A 4WAUA 3VZQA 1PT6A 1VLVA 5CVUA 5KTTA 1HDYA 1YZGA 1T0IA 2QEQA 1R6UA 4EQ6A 5LMUB 1QFSA 5IARA 2HTEA 4QHTA 3UBMA 4D80A 3W6UA 2Y6VA 2WPDD 2JGLA 3GPBA 2F64A 5BN5B 1YBHA 2JIQA 2OA0A 4CIAA 3SDSA 1KYYA 1GSOA 4RH0A 5D6NA 2FSUA 3A1EA 3FVTA 4ZYLA 4F3KA 5KS2A 2JLRA 2QYOA 3M6AA 4ZYZA 4ZVSA 5GP1A 4Q3BA 3VYTB 2HA0A 1OMOA 1CZRA 5CEJA 1IY0A 2F1HA 4IXDA 1TQ6A 1UBSB 2C2XA 4RD4A 4DA4A 5CPFA 2BFAA 3RVDA 4F6RA 1JIUA 4O7LA 3QY9A 3FLEA 4MYRA 2D0IA 2G3YA 3AERA 1T91A 3KVYA 1T10A 4ZI2A 4NXMH 1SQSA 3E53A 2VUMA 4GF5A 3WYAA 4BFCA 1K0FA 4EG7A 1XK5A 2FZ4A 4H0CA 4LQCA 2VZ9A 1T5IA 2FK1A 4UUAA 3H3FA 4MB2A 3WNCA 3DT6A 4IFIA 2AC2A 1SOVA 3K5WA 1RBYA 5K3SA 4LMBA 3W8EA 2QOEA 4D3DA 2YKGA 5DLGA 2AJDA 4HTFA 5EZYF 3DT8A 1SB8A 2GM3A 3CBGA 4KB5A 2ANCA 3X2SA 3RREA 1UJCA 3TKLA 3WMXA 2OAQ1 4P8RA 4WHMA 1KJQA 3KLBA 4HP8A 5HW0A 3WYFA 4K3UA 4EBEA 4C78A 4ZYVA 5BMVB 3M4IA 4KMSA 2VDQB 1QHYA 3U4HA 2X1MA 4BX8A 5B4TA 3KTMA 1FU7A 3UK2A 3A4NA 2I34A 3VMFA 3R0ZA 1ZY2A 4PNEA 2NU7A 3DVAA 3OEWA 3EW9A 1EUDA 1CR4A 1QH1B 3GRAA 2XKKA 4LJYA 2YU9A 5A3VA 4BLWA 4DJTA 1KTIA 1HTWA 1YCGA 1W49A 3WLFA 1QTQA 1NOKA 3GLGB 3KJHA 2XUDA 3KZ1E 4M9CA 1XTUA 1BIFA 1PNOA 2ASEA 1HOTA 2FE1A 2Y4NA 3K0AA 4FHGA 1NZDA 4ZO7A 3TLZA 1V71A 4L4ZA 5KYYA 1MIOB 1U2RA 5E7IA 1L3IA 4O0LA 1QONA 3AEQA 2C99A 4YDRA 4LF4H 2LDXA 1RKQA 2ID4A 3R44A 1VHLA 4ZU3A 3ILXA 3WFJA 2YQZA 3OJOA 4IL5A 1KSHA 5H5JA 1GLVA 4UEWA 5I5UA 1DEXA 4HI0E 1ND5A 1QHGA 5FQNA 5CP8A 1Z2NX 2GD0A 1PSDA 1QIIA 3E7DA 2QY6A 3OJXA 1TLFA 4WW0A 3OKAA 2YV3A 4XWAA 3L0DA 3NC4A 1FQOA 2C61A 3D8SA 4BMVA 1TYBE 2QX6A 4G0XA 5D87A 4JI6B 3QVSA 3SBXA 2OV1A 1HL7A 1KDYA 2QF7A 2H7YA 3ICVA 3T9AA 3S6JA 4PWQA 3A6JA 4KKVA 3HCOA 1XPUA 3J7AC 4OP3A 2D5LA 3VKWA 3EOAI 1CS0B 1DAMA 2WE8A 4YPFA 3VPAA 3AHJA 5EOYA 4IXTA 2PMZE 3DHNA 4A3DG 1O4WA 1USVA 2BM0A 3FSEA 3GAZA 4GOXA 2EWMA 2PX6A 3U4QB 3PNBA 4IQ8A 1G3IA 1X3LA 2XUHA 3K4PA 4GKKH 1G63A 4EDHA 4WGFA 3BSFA 1WUYA 3SG0A 5BSWA 3RS7A 4ILKA 2NUTA 2ZRKA 3KYBA 2HUPA 4QVKA 2A3NA 1RMYA 3MJVA 4G56A 1EDDA 4ND2A 1SD2A 2YBDA 4IQ4A 4X7RA 1N8TA 4LHYA 2J1LA 2PSSA 2YXPX 3HABA 4RCVA 1DKRA 2W58A 3BE6A 5I5YA 5C37A 4TRMA 3HQ4O 5KX5F 2NSYA 1DCKA 5H81A 3X1KA 3I9NA 4PLHA 1T4DA 1XEAA 2Z2JA 2ZP1A 3FKIA 5TJ9A 2XQJA 4MQBA 3VU1A 2P1RA 1FFGA 3FCCA 2WLSA 1TVEA 1NVVR 1E3MA 2ZUEA 3ZIDA 2RK4A 2SKCA 4TKLA 5BURA 3DDHA 3X43A 1PZGA 5IVKA 1L8OA 3RB8A 4D6PA 4MVJG 3OF3A 3W8DA 3L07A 3MCWA 3NZEA 4EM6A 2C9OA 3PZBA 2FMIA 1M3SA 2VK1A 4TGLA 3O9ZA 4N0MA 1IQPA 1L1FA 5IANA 4FCVA 4YGXB 4W5RA 3PNYA 5AVJA 4DL2A 4UUQA 2COIA 4Q45A 1SUEA 4O33A 1Z0FA 4EHLA 1D0SA 1M33A 1UPAA 4LTDA 3VAZA 2I2BA 1JVSA 1OC2A 1TA8A 2A9RA 4GOMD 1SN7A 1YDGA 1WRVA 4X66H 1T3TA 4OOEA 1E4OA 3EG9B 2HGXA 4IR9A 3RT7A 3DKVA 1BE6A 3GBSA 3KHHA 2X7HA 1CJSA 3EARA 1T94A 2O1SA 3CJRA 4FNOA 3P9NA 3HM2A 2VP0A 4KZPA 4MUIA 1VTKA 1I94H 4X6XA 4ER5A 2NTEA 3PFIA 1OPRA 1PG0A 1QH1A 2ZRPA 3GDEA 2XT0A 1V16A 1JX6A 3CPSA 3KPYA 3OQBA 3QV2A 3LKBA 5ENDA 4BMDA 2Y1KA 3QU5A 1CJBA 3INGA 2XQKA 4MUEA 1XNHA 3KD3A 3LVBA 4YO8A 1BX1A 2H8GA 4IDNA 2GN0A 1DC3A 1FRQA 5C7OO 3N2EA 1S5PA 4J7UA 3WLPA 1JHPA 3WFIA 2A0XA 3FCAA 4NHEA 1XNQH 2VXCA 4YCJA 3ZZ1A 2VDJA 3GUUA 4IDOA 1JHOA 5JIBA 5EY5B 5CB0A 1YT5A 2DUWA 1T0UA 2OHJA 4HFJA 4HEA1 1QR2A 4XJTA 1L3BA 3V48A 4I1UA 5E7JA 5I9LA 4PSAA 1E2QA 1CJTC 4BWSC 2BZ1A 3LTEA 4LDZA 5JAMA 3HY4A 2FP4B 1Y8QA 3QV1A 4CG1A 1YC5A 4NCKA 1IQRA 4WK2B 3QITA 1M1ZA 4ZEWA 4H1VA 4B5LA 5I4BA 2J6CA 1CU1A 3EQ2A 3KE9A 4IVQA 4MVJM 3LVQE 2JFYA 2BDEA 3SC3A 2JH3A 1I94B 1PYOA 1ST2A 3GDHA 4ZV9A 5IK2A 2QVYX 2NAPA 2Y0PA 4FFBA 1U3UA 4JKIA 2QI9C 5BYKA 1FFDA 4GLWA 1IBMH 5DTEA 1UKAA 1VL8A 2DF8A 3CYFA 4RQUA 3UW1A 1EQUA 3LT2A 1Q1EA 1E3WB 3E82A 3LT0A 3W05A 4MV1A 1R0SA 5E6UA 4KP7A 1XDSA 4Y0VA 2I2FA 2A4KA 3I72A 4YUWA 1XRRA 5DDIP 3AETA 2X13A 1TIPA 2YFHA 1PLKA 2H5EA 3RAPR 1Z7BA 3OIWA 3WBFA 3S2GA 2EERA 1YKSA 3INTA 2FSSA 3JQBC 1O9HA 5HK8A 2X2FA 2JEIA 5D1HA 5FEUA 3ZV5A 3LC7O 3THYA 1SXHA 3BABA 3P97A 3F46A 4JSTA 5HNEA 3U0VA 3W5SA 4D99A 3PKZA 1MZBA 1JFLA 3USZA 4KXXA 3KKZA 2FGKA 2VAPA 2PMZA 1NULA 2OGTA 1V8FA 1IRXA 2QPTA 3B3FA 3DMRA 3LKZA 3M5CA 3N87A 4JYCA 5ELXA 1WXXA 3PDCA 3IPRA 1NVTA 1SM4A 1EU1A 2EVWX 2ZRGA 4N6NA 4WTOA 3UFXB 2BUAA 3PC2A 4LGMA 1UPTA 1Y4AE 3ASYA 2QUHA 1U2DA 1ZN2A 4LSMA 1BKSB 3BQMB 2AMJA 5FV7A 1RWOA 2JCBA 2ZRIA 4BUCA 4DILA 3OO0A 4JLVA 5CTJA 2PKWA 2CLOB 2MCTA 2JG3A 2R6GA 3GTKA 1RLTA 5K20A 4QL3A 2BFNA 3IVXA 3PC3A 5COBA 1OV6A 4QWDA 1QHXA 2Q4TA 2WKPA 2XRYA 4U8HA 2D6FA 1HDRA 1GPJA 1BCRA 5JXIA 1S1MA 2XXJA 4NJEA 4NCAA 1JI0A 3TO5A 3K0EA 2AE2A 2Z83A 4TUYF 5KJFA 2OE2A 2JH9A 2ID9A 1T4GA 5F1YA 5A05A 2ZBRA 3DVQX 4YRKA 2RHWA 1N2SA 2FPOA 3ISVA 4K03A 4RV4A 2J3LA 2Z57A 3E9NA 3ENVA 1XTBA 4HNGA 3FHJA 3I9V1 2PQMA 1W48A 2XODA 3B12A 2ZUUA 2PH5A 4HYTA 1XJWA 2JPDA 3CEJA 4M1YA 4Z6KA 4AJ1A 1V8PA 2CXRA 4MMZB 1QMGA 2ZANA 3U56A 5LD2C 3P9YA 4ZARA 1U4SA 4X95A 5HBRA 3JWIA 1V39A 4DCUA 5K0ZA 5E3HA 5FI5A 2EZ4A 3UH0A 2AXNA 3FYUA 2IPMA 3TDMA 2PGNA 1QKIA 4UHBA 3RTXA 2E2HA 1XCBA 3ZV7A 3ZCRA 3CIOA 5JZSA 3PSAA 1T3LA 2HMSA 2ZVPX 5EMKA 2XIGA 1Q11A 1BDJA 3EISA 4QRIA 4R01A 3TQSA 3DQPA 1KH3A 4X84A 1CQIA 2OCBA 3WB2A 1QAQA 3E70C 1CEYA 3LDUA 4CQJA 1L5SA 2VWGA 3IP5A 3EIHA 4DJFC 2CV2A 1G3RA 4ERNA 4FWTA 1MCZA 1VL6A 2BC9A 1LJLA 3A10A 5FWDA 5MN5A 3NASA 2Q3EA 3ADKA 2AV6A 3EGEA 1FB5A 1VKZA 5BWUA 1IG3A 1H0SA 4WLOA 5EUMA 2NZ2A 1YDMA 3RU3A 1UBCA 3ACCA 4BU0A 2QMZA 4RSHA 3RJMA 2ZSUA 1HDZA 4CUJA 3NUZA 1MXFA 3NAZA 3EIQA 1Z36A 1SXQA 4DPLA 1K7EB 1G42A 2AQIA 1I3LA 2WWRA 3Q8WA 1M7JA 3T1VA 1BJRE 1OOEA 1OB2A 5C4XG 2WIBA 1JAIA 3L7JA 5JH7F 1EGHA 1FSZA 5AW7A 5JDIC 2ONJA 3DFUA 3PNOA 4MRNA 4Z3DA 2QW1A 4UCSA 1NHWA 1ILWA 4OSEA 6NULA 4DLPA 4O81A 3VJRA 1I30A 2IL1A 4BGIA 1NW9B 3I05A 2IYVA 5KJ6A 2PUGA 4PWYA 3D6NB 4J75A 1IEWA 1WMBA 4XLZA 1KGSA 3V1MA 5ALXA 1U7OA 1XQ6A 1EP9A 1BMFD 1XMQH 1Z74A 2PT7A 3AILA 3DWFA 3KHKA 4FONA 4QEDA 1NBAA 3V1TC 2Z1DA 2OV8A 5KTPA 1FE8A 1E2HA 2HBZA 5GQSA 3ZW7A 5D1PA 2RBGA 1OF1A 1H69A 3GHYA 2BF4A 3M5DA 4I5IA 4MLDA 5E8JA 3U4DA 5JNVA 1Q77A 1HEUA 1P75A 4ZVLA 4C6TB 3FUCA 4YQWA 2AF3C 1HORA 1YQDA 4ZCTA 5JJCA 5JW6A 2G17A 3L7YA 3P2OA 4DGSA 2EWWA 1G4AE 1VAJA 1PQYA 2HEGA 1EZZA 2BGLA 4DDMA 4DUZB 1RXYA 3IMKA 1Q3KA 1RWMA 1MAWA 5COQA 4JUDX 1L6IA 3LPAA 2C9BA 2VBFA 2X9NA 1TU3A 2PLAA 4R9NA 4CFYA 4ODIA 4F4YA 2BR0A 3KUXA 3ED1A 2VJMA 4RMJA 4A8PA 1V11B 5ALFA 1Q19A 2X5XA 3TEFA 4X8HA 2XCAA 1OR8A 3GGOA 5LBUA 1LFDB 4V0MA 3PDIA 2GRAA 2X76A 4O7VA 3TDNA 4EJ6A 3JAKA 1C0PA 4HGZA 4LJLA 3VSBA 5AJZA 4CMIA 2PLWA 4PW0A 3EQ6A 4KO1S 4O8ZA 1V7ZA 1ZDMA 5CLJA 3EDQA 1GADO 2EEZA 1ENZA 2VP5A 5AI6A 1J0BA 3NPMA 5BSGA 3JYLA 3DE6X 3HUFA 1X15A 1QPZA 2ZYUX 4F3CA 3TZQA 3DEIA 3EGDA 3OQMA 1J00A 1QJCA 2XF2A 5EGSA 1Q0TA 5FLMG 3RJ0A 5J5AA 4RNOA 1IFXA 4R2MA 3F3KA 4A8JA 3QYFA 4DY4A 5L45A 1M8FA 1P2TA 2Z09A 1ZIXA 1SEIA 1YJ8A 4UTPA 4F04A 1P3Y1 2YIDA 4YB8A 5FTJA 1SIWA 4GGMX 1XBTA 3ENZA 3WFZA 4CPDA 3MJ4A 1ZHHA 3H2BA 1S3GA 4A5OA 4PRKA 3KTOA 2JIZA 1UMBB 4FMBB 3WRXA 2E49A 1GWNA 2YCLA 1FVOA 1S2GA 2ORED 4QUDA 4Z0NA 5J59A 1C9DB 3SR0A 1NYRA 3GLHB 4F11A 4JJFA 3L43A 1ESDA 2B8JA 4ARSA 4DUYH 1A2OA 2VNSA 5C8DA 1RR6A 3F2IA 1YR6A 3ABIA 3IALA 5I47A 3UXYA 4GH5A 4R7TA 5KYUA 2HDWA 3H13A 2WJAA 3E7XA 5EWLB 3VI4B 4OGLA 4PZPA 2NYAA 4YQZA 2I7XA 3R20A 4PSVA 4WUTA 2HJWA 3COPA 1JLSA 2GXUA 4LSWA 1E9CA 1QKKA 1ZGBA 2G07A 3LQFA 5AQEA 2J9RA 3NT2A 1YVUA 5E9QA 4MAFA 3ONDA 4PR0A 3ZYZA 3HUUA 1LVGA 3BN3A 2E55A 3HI6A 2D3WA 4AO6A 5KYWA 3NHZA 2F9MA 3W5DA 3LYUA 2W90A 4OIMA 5BQXA 1YJXA 3IEIA 3LNCA 3MSXA 2ASDA 2YASA 3GJZA 2VJAA 4KUHA 4DKJA 4HAWA 4FR0A 4RVFA 3IESA 4W1PA 4ZJZA 1XX6A 1CX9B 1EXMA 1IK4A 4L4XA 1QR6A 4HNUA 1N8SA 4MCHA 4Q3AA 6CHYA 1K7XB 3OTIA 4UARA 5TGDA 2ZR9A 1Q2UA 3ZV6A 1JR3E 4BRUA 3LLUA 1RKVA 4BFXA 3D54D 4BFWA 4KHPH 2AKYA 3VDRA 2D00A 1ZK4A 2WSSA 4MWEA 4U0JA 5IKPA 4OLFA 1JTEA 2KS6A 4RHEA 1QBGA 3UA4A 3IAM6 4GXTA 1M54A 1T0PA 3WL8A 4YONB 1Z39A 2P0EA 2Y1OA 1Y9EA 4EH1A 1HO3A 2XQVA 3GAMA 1D2HA 4FOLA 1VMAA 4RMGA 3BXGA 3DE7X 2V7PA 5E1OA 2DXIA 5IVIA 4BAZA 2H5JA 3FSJX 4ZEXA 1XQWA 1CIJA 2ZEJA 3L2OB 4ACBA 1BA2A 3LCVB 4PQRA 3R7WB 4Q1VA 1K1QA 1GXSB 4AZSA 2FZGA 1QDEA 3HS3A 3LHSA 4W5WA 1SHUX 3VPGA 4PX2A 3JQDA 3OZGA 2NUAB 3U7QA 2FW1A 3KXLA 2RHTA 3SS7X 5LU9A 1PNTA 1ZIYA 2FEMA 1O08A 5EJMA 1FRFS 5CD9A 3T5PA 1FVIA 1Q3TA 4UZFA 1ZSVA 4FBLA 3WNDA 4PYOA 4TROA 3KNZA 3OP4A 2PBLA 3C41J 3ER8A 3Q12A 1QU2A 1RCUA 1RADA 1N6NA 1BDHA 2JH8A 4EPWA 2FUEA 1MJGM 2KYRA 1E3EA 2QYHA 4C7XA 4EMSA 1K83A 1XCJA 1OJ7A 1IC6A 4ROTA 1IBLB 4QIWE 3DR5A 4UNPA 4AL4A 4WK6A 2J67A 2IIPA 2X9QA 2SECE 3COWA 4L5BA 4LYHA 1MO2A 2ZVJA 4LH7A 2BH2A 1NDQA 3ZTYA 4BZPA 4DR1H 3MAJA 3MCTA 3QK7A 1NE2A 2PXAA 2I1VB 1EFPB 5K4AA 3W6PA 3LMLA 5E9JA 1SU6A 3SGIA 1WCMA 2B1QA 3OX3A 4KXFB 1X92A 4Z9AA 5JHHB 4RHXA 2FRVA 3WLOA 5IJ9A 3A25A 2Q9AA 2IUSA 3IBYA 3RIHA 3W79A 4ZIRA 1YS1X 1O03A 2O1EA 5JC1A 3HJAA 2PWPA 1TCUA 3IC5A 4JSYA 4RHCA 4WZBA 4Y1RA 1YGPA 2X9GA 2G6BA 5HOQA 3IP6A 4EUSA 1CSEE 3VQTA 4BNMA 1P4HA 3PRYA 4RJLA 2F62A 1OV4A 5IU6A 1UINA 1YKFA 4BNDA 4MDFA 4MOWA 4ZYTA 1SZPA 3LHFA 2H4XA 1DTSA 1PR5A 4I4CA 3U31A 3ZWAA 3PFCA 2CJPA 5JSKA 3WLKX 4YUYA 2RCYA 4C14A 1R0CA 3TAXA 3SDZA 3WJ7A 1RYSA 4TTJA 1FF9A 2WNSA 2ATLA 3H8VA 2R00C 4R16A 4RGQA 1I33A 3WGVA 3EGCA 3AW8A 2RSLA 4HH0A 4WY8A 1WP9A 2A7QA 5IASA 1T4CA 3VAYA 3GYGA 4Q43A 2GDJA 2HY7A 2N0SA 1SY7A 1ZD3A 3L8ZA 4IDDA 4K2AA 1DRKA 1L4FA 1N6IA 2IDJA 2LIPA 3F1KA 2X0SA 4IFEA 4MQUA 2CNDA 4YS6A 1NXSA 5F73A 4A6EA 3OLZA 1NP7A 4GBMA 3L8DA 3A6HA 1HTBA 3F8TA 3H18A 4MPRA 3WKCA 5EIXA 4DV3H 4WDQA 1WV1A 2DFDA 1NX9A 2C2GA 3RKUA 3TR0A 3W6OA 5K3OA 3VC7A 2PJZA 1KQPA 1VRWA 3Q9SA 2JFFA 2YWGA 3L93A 1U7DA 5FTMA 3QHPA 4XQ0A 1DBIA 1TVCA 1ST3A 4W1QA 4B7ZA 3D2CA 2HDOA 2MYUA 3LF1A 4IIGA 1KNQA 1XTIA 4LJKA 4NAHA 2YS6A 5B1SA 3GGDA 4ZALA 5C51B 2IYYA 2P5SA 2A58A 5LQAA 1RRVA 2JIBA 1F4VA 3BF8A 3BBLA 3O4GA 4EPTA 1LC3A 1KTVA 1KYZA 2NQTA 4YRJA 2J48A 1JLLB 2EJCA 2QNRA 2ZIAA 2RAFA 3UO8B 2IODA 4DM4A 2IU3A 3IJPA 1S97A 8ABPA 4QJFA 1A1VA 1C1HA 4UCTA 2IYWA 4F60A 4I1VA 8MHTA 3TW8B 1WTAA 5EHZA 3RSSA 4BQQA 2O7SA 3N41B 1OT3A 2N9UA 1ZKMA 2VHJA 3CLRD 4RGYA 2WNHA 1N2BA 1Y1TA 3W1WA 4R6WA 3OSNA 5LQKA 1LDGA 1MFPA 5AI5A 3FMGA 4GWKA 2NQ2C 5A4MS 4UDOA 4NF2A 4TX1A 4OQ4A 2FB9A 2QUBA 4EKEA 1Z0DA 2JBHA 4E2ZA 4WKBA 5JPDA 2FEWB 2PKQP 3O73A 3HDTA 3DDWA 2AN1A 1R10A 1VPVA 2NOAA 4OHXA 3W6NA 4U02A 2IUFA 2V6MA 2Z6UA 1NRXA 1AN7A 1QANA 4GC7A 1ZH6A 4HEHA 3CM0A 2P8JA 4JGGA 4PZDA 5LBIA 3I6YA 5DQGA 3WYBA 4AC9A 3ETDA 4XIFA 2E21A 1JHUA 1JSLA 1KZ6A 2GLXA 1LK7A 2WAXA 4YUVA 3ESYA 4WCDA 1MFZA 2HW8A 4ZP1A 4I1YA 1KZ4A 4FGRA 1KMHA 4UCRA 4LK2A 4EJSB 3AESA 3ZX4A 1GCAA 4JKOA 1N2OA 1Z88A 2HEIA 4DL7A 1PNVA 3W8NA 1P9OA 3OC6A 1P2VA 5J4LA 1A27A 3JQBA 4P84A 1QJ4A 2CW5A 2DRIA 3JX9A 4WIAA 1TW2A 4DBZA 3H9BA 3OFND 4ZAFA 4QOGA 3NHBA 5BWLA 5IDWA 3GXBA 3RR5A 1GU7A 4IJ5A 5EXPA 3PJGA 4ZU6X 4D74A 3BL5A 4HB0A 4IKOA 3K8OE 1IN1A 3OSPA 1X1QA 5KAPA 3VKFA 4LGYA 3V8BA 5EPOA 3ZNQA 1V25A 3BRWD 5FOUA 1GLGA 4BTVA 4R8UB 1VFNA 2CDRA 3SDBA 1OXVA 4M7PA 4ZYUA 2R8ZA 5AKIA 3MJEA 1A4RA 4KFTA 1K1SA 4OSPA 2WF7A 4M46A 3DLCA 2XC9A 2SBTA 1JDEA 3GIJA 1YU6A 3DMYA 5A0FA 3A28A 1XVAA 3L7OA 1YB4A 1GR1A 3IUMA 4QEKA 2ZZKA 4J9OA 3JYOA 4E0BA 1A8PA 4A3MG 2GBCA 4MYUA 3NXSA 5J4VA 3DKKA 1KPIA 1J2JA 3ITNA 4GBED 3BHIA 3HK2A 2LKDA 2GM4A 3RR2A 2BMVA 1E5DA 3RGWS 3D4PA 3IQEA 5LCXA 2FUCA 4EG0A 1C50A 3ZDQA 4FILA 2XD9A 1UP7A 3CINA 4K26A 4LDQA 1RAHA 1MX3A 2XV1A 2H00A 3ZDZB 1HY3A 1IZ7A 1LX6A 4MS1A 3GQBA 4XQEA 3KQUA 4Z9BA 4LRWA 4ED8A 1QCCA 2OG2A 4KLAA 2NUPB 1T4MA 3KYDB 1NXOA 4L6AA 5SZHB 3LPDA 3BEOA 4O0MA 1FP6A 2FPIA 3I04M 1Y8QB 1YRBA 2R65A 2GFQA 3KBBA 3K31A 3WQRA 4XKJA 4ZK6A 3F97A 4J4BA 3C2QA 3W2TA 1F0PA 2OSBA 3HFGA 3EPHA 1N33H 3G59A 3VMMA 1TIKA 1BROA 2ODWA 5DTMA 3GVCA 1T8SA 1YDWA 2RHHA 5FO0A 4AU1A 2X0FA 5LMZA 3HFRA 4DZRA 1TM5E 3MOSA 4ENUA 3VPCA 1PTJA 1XIVA 2W83A 2DR2A 1LB1B 1L7DA 3QE4A 4IS3A 4NBUA 4UHHA 4W5HA 1VG0B 4J03A 1QVWA 4M7RA 2A0UA 2HSEA 4MWBA 2C7RA 2HNBA 2JAQA 1E64A 1UPCA 3ESCA 4LYYA 5THKA 2QMEA 3AF5A 1GPBA 1ZRHA 4LGVA 4RK4A 2LCQA 5K5EA 1ODTC 3EMVA 2HIGA 3ZWOA 4R41A 3G5UA 4GBGA 5K1ZA 2GGSA 4DMLA 1QC5A 2VQDA 4IIBA 3ZWBA 3H4MA 3GRYA 2DYKA 1J8YF 1TMKA 2O57A 2A30A 3GJ4A 4WH0A 3W3AD 2W2MA 1QRUA 3O8QA 2OLEA 3L6CA 4CC5A 1X1DA 1EDOA 2ZIFA 3R5SA 1J1ZA 2FLKA 2ADMA 1M2EA 2IYUA 1EFVA 2O4UX 4AYBE 2VDVE 3MWFA 4M9RA 4OK5A 5ICCA 4M0UA 4LBZA 1Y33E 4QOSA 4R9SA 4TXJA 4YMIA 1B3RA 1M6EX 1TO1E 2VK8A 3M83A 1YWGO 4LV8B 4DRFA 1NVUQ 1H3NA 1XLTC 3ANTA 4LYEA 1I5OA 1NYLA 4FDMA 2D4HA 4KG7A 1LNSA 2IU4A 2R8XA 3EZ2A 3M2PA 4BWGA 5KFJA 3DEKA 4C6RA 4DY6A 2BCJQ 4PPFA 1HNNA 1UPXA 2ZRLA 3D6JA 1E0KA 4DIKA 4J90A 2QLMA 2XE4A 3PFBA 1UC9A 1CUSA 5FIUA 4EVQA 3M6MD 3UY4A 2MYPA 1WF6A 2GHQA 2QV0A 3X1DA 3ZWQA 1SBZA 2FPUA 3BWMA 3HUEA 5K3BA 4E09A 1YZ3A 1SXJD 1M1NB 1Z3IX 3K32A 2WUVA 3S5JA 4H7EA 3DLBA 1H5NA 4R69A 1L7AA 1A88A 3H97A 4YJ2B 1ZYUA 4IR1A 4NXNB 1W52X 3OT1A 3KVNA 4CWAA 2H2HA 3LCRA 2ATVA 2Z6AA 3FNEA 1IBMB 1N2CE 2QM7A 1SULA 13PKA 4XDYA 3WWOA 2QL5A 4TLCA 4YWJA 3TVDA 3VGJA 1FLVA 1QB8A 3K0BA 1GCUA 4QDZA 3UMSA 3QELA 3WLTA 1I3QA 2IYSA 4X63A 1LDBA 5ALPA 3IVAA 2QVLA 4GX2A 2YUIA 2RG7A 5FBZA 3WWJA 1J9GA 2WAYA 1PV4A 3A6EA 3LUKA 2TSYB 2BFFA 3FVQA 4K8RB 3ELDA 1UQTA 3LCCA 1P1CA 2O3UA 3FMOB 3I9V6 3NRJA 4E5PA 5FPHA 5IM4F 4ETMA 2WUDA 3PHBE 3PGKA 3D5QA 3RC2A 1MW8X 1PR3A 1GAXA 4JUFA 2EKQA 3UMBA 4NBSA 1YZNA 2BP7B 1FLAA 2OB1A 2ZR8A 5AH0A 3CCBA 3N75A 5IAGA 4EG1A 5KTNA 1AQJA 2VTKA 3SKYA 3FB1A 2GSWA 3OOHA 5IK2D 5CYOA 3Q3CA 2V58A 1Y14B 1P5JA 2WFMA 3EIUA 4YRQA 2VPYA 5EZYA 1EVIA 4CHGA 3TX2A 3V1UA 3LY5A 2LE0A 2CBZA 2ODNA 4U3JB 3QMWA 3VTAA 1QGED 3NVKI 1CKMA 1H2YA 2GD1O 1NN5A 2O8BB 4XCQA 4U2FA 2CWDA 1Q7EA 3O5AA 1GG8A 3UQZA 1WL8A 1GRCA 5AUNB 3OQIB 2ZWMA 4EHDA 3DOUA 3EZ9A 4JBNA 4ZXFA 1LGYA 1TUEA 5EL0A 4C4RA 4X3CA 3FZGA 1DRJA 3OEHD 3PFKA 2X40A 2XE8A 4FCWA 2QDKA 3F6RA 3U44B 4R1UA 2C82A 3FPSA 1K06A 5FLEX 1K8QA 4QW8A 1YDHA 1Y3FE 3AVYA 1FSPA 1X38A 4IZOA 2J6SA 3HVHA 1B8PA 1UWKA 2ZJ3A 3DDUA 3V6KA 1OPXA 1IHUA 1TKBA 3MOIA 3O8QB 1U28A 3PWZA 1YASA 3CR3C 5IHXA 1DQYA 2ZROA 4KO4S 5ULLA 1WB4A 4P36A 4Y9DA 1Z2OX 1W76A 1GU1A 3R9XB 3LX8A 1WUHS 3PT5A 4FDVA 4LA4A 1UANA 3CWQA 5ALUA 3FOZA 2HJHA 2Q1TA 3UQ8A 1QGZA 4FFMA 1WOYA 3KYIB 4NP6A 3A2LA 4HDOB 4F50A 3HU3A 3DZKA 4G26A 5BNZA 2PLFA 2PU5A 3DCNA 3CKMA 3O4VA 3Q6NA 1Z83A 1WUJS 3QJYA 3KAPA 4H7HA 4I55A 4QYXA 4U1RA 2JD2A 3I9KA 4MZXA 3R8CA 4A9AA 3KQNA 1HNXB 1EK6A 1D3AA 2XZDA 1V9CA 3LP6A 2C22A 3SK0A 1CEXA 5E2AA 3VR6A 1ZH2A 2RHCA 3JARA 3DOCA 4WKOA 9LDTA 2NZ8A 5JSHA 2WILA 3PVSA 2X8JA 4FJ0A 2Q9BA 5CURA 5FOXA 1H85A 5CVCA 1S0UA 4YJ2F 2R7ZG 1V0JA 5CDUA 3D5TA 3F3SA 4WKPA 4HEA6 3WQSB 4V3BA 3CKLA 4ID9A 2JANA 4XM1A 1QCYA 2R8JA 3MB8A 4J3NA 2VRNA 3MJDA 5C52B 1WZ2A 1Y1QA 2QLBA 3U3XA 1OI4A 4FMCB 5AUQA 3ESQA 5FLYA 1HZZC 2K6GA 4M4SA 1O95D 5TLSA 4ZC8A 1K6IA 2AT1A 1KVQA 4RZ3A 1M8PA 1YBMA 4TVIA 3M1YA 4G9BA 2NSLA 5GZ3A 3CWZA 3PDWA 4EI7A 3K3VA 3RSGA 4FEYA 1C3EA 3OBBA 1W5AA 3QLUC 1BVYF 1U0NA 4B84A 1IEVA 4Q02A 1NU8A 3V9AA 1LRJA 4KE8A 2GZMA 2G88A 1S3IA 3LPCA 4OQMA 1K66A 1P5RA 2VNAA 1N56A 1GGOA 2H5IA 2VHUA 4NBVA 4LNUB 4M8LA 4OMCA 4YP9A 2BSAA 1YE5A 2IWRA 4C9BA 4J6FA 4O2BF 4GI2A 2IA6A 4FXPA 4JP8A 2QR3A 1D2RA 4YACA 1WZUA 5T4HA 1N4DA 3OHPA 1L7OA 2PL9A 3OZFA 7REQB 5KTMA 4AY6A 5LMCA 3CZ5A 1VJDA 4HGQA 2FUNB 1U2TA 1FJ2A 1CW2B 4YI5A 1GPNA 2IEAA 3GMIA 4MYSA 3K9NA 3VNUA 2GN9A 3GFBA 3UMFA 4DUGD 3GTMA 1QK3A 3CUEF 4ML3A 1I2DA 4F8YA 1F8UA 4F46A 5B7GA 1DIGA 1PWHA 3LA6A 4M49A 3I8SA 2XNCA 3H7AA 5SYAA 1RVV1 2B7CA 1K4YA 1JRLA 4LFBB 2DQSA 4OQZA 3QI7A 2WKWA 1B6SA 1TCAA 5KYYB 1VG1A 5K09A 1MJHA 3O4FA 4EGFA 4DR4H 2H11A 2P7IA 3DXFA 3KZOA 2V5VA 3QX9A 4JXKA 4RHFA 3MN1A 3PP8A 4NMHA 3SIRA 3TCKA 3HA2A 1W5TA 1HT1E 2JCXA 2C3MA 4WN3A 3KEOA 5F77A 2WT9A 1MW9X 1HZZA 1L4UA 1LA2A 2Q5LA 2HJGA 3P9QA 1GA6A 3GIWA 2OO3A 4GKVA 5BQ3A 1YBFA 3Q8LA 1SXJA 5FBKA 2WTNA 4XUEA 3SEQA 3ANSA 2W7TA 1DG3A 2V9WA 1OBVA 4Y6GB 4LFBH 1R1DA 1QZZA 4PFJA 2Y0SE 3ZY6A 1ZJWA 4WZAB 3H5IA 1NOJA 1HDCA 2QAGB 3B8HA 1QIDA 4P33A 1EB8A 1ESMA 4B82A 3LFUA 1XZLA 1UQUA 2R6AA 1EUZA 3NYRA 1FYDA 2YIJA 3FA2A 4BVKA 5JZVA 3TQFA 1XN4A 3R9KA 3MTIA 2C7BA 3EY9A 3JSLA 4FX5A 2GM5A 4PY2A 4EW3A 1O6GA 4YAKA 2AOVA 3UK1A 4FGUA 2I2DA 3CVZA 3X1YA 1HNZB 3T3EA 1Z75A 2QGFA 2I87A 3C8DA 4F92B 4Q9IA 4JYAB 3SHVA 2R8HA 1RZRD 1XA3A 3AC0A 3P0EA 1YXMA 3LCJA 1KKLA 4ECRA 1ZU4A 1R6AA 2PV0A 3L1JA 5DNDA 3EYAA 2IEBA 3LUDA 5EUQB 5I7HA 2FPXA 4QT0A 3GIIA 1US8B 3MTJA 3ES9A 3NJ8A 4QXOA 5AOVA 5CB6A 1MB9A 4U7CA 2B6NA 1ZJJA 4LZJA 3GVPA 4FZ5A 5AVTA 5LNK6 1CVIA 1E9DA 3LGAA 3FPKA 5F33A 1ECGA 3RVPA 4URHA 1U5AA 1U6IA 3GOQA 4QAQA 5AKYA 3MHTA 3L7MA 2GS9A 2W37A 3G9UA 4J1TA 4RKYA 2P5TB 5J2TF 4W6ZA 4AWAA 3FOFC 1L5YA 3E9EA 3GJ6A 5DNEA 3RS5A 2GEUA 5SICE 5EMLA 4TWAA 4ED7A 3UMRA 1E5VA 1XXHB 1B6RA 2QZPA 4PVCA 4PWZA 3LYLA 2XA1A 1DTEA 1E2LA 2OHIA 2X4DA 1X7WB 2H2FA 2Y77A 3K70C 4DR3H 1S0NA 1WXWA 3GEEA 3I23A 4Y2GA 1INLA 3JD4A 2YMQA 4Z4HA 4M0LA 2C8KA 4DR7B 2P6NA 3BFPA 4LN1A 2WB2A 1E2JA 1A4UA 5DT2A 4DJDC 2MTBA 3OQ6A 4YR7A 1M2HA 1ZICA 2FV8A 3SZLA 2QRVB 3K0HA 5DGDA 1E1DA 4HMOA 2M1XA 3KVVA 1SK8A 4ZCLA 3GJXB 4TZKA 2PGDA 4LHZA 1J25A 3GV5B 3WVNA 1SCDA 2TMGA 5CFLA 3QXCA 4BKMA 3FTPA 4LNUA 1DQRA 1Q7GA 4UHCA 8AT1A 4DZZA 2YYAA 2VCYA 2K2QB 1LZKA 2Y6UA 1VLJA 5L9XA 2YRFA 4P2BA 5CMLA 1BAPA 1H2BA 1Z73A 3L4KA 2AZTA 4TLLB 3HEAA 4B7UA 4G1UC 1KBZA 5KI6A 1BW9B 3D7KA 1TCVA 4LE0A 4N6GA 2A86A 5F1OA 4BO2A 1DJQA 4NENB 1JIQA 4X94A 1DRVA 3ZWWA 4J07A 1SHZA 1G21E 3A26A 2OFPA 4W5NA 2P69A 4LE1A 3HLKA 1GVHA 2AXPA 2WHPA 5I5VA 3IPYA 5KX5A 4N9QA 2YZMA 3ORRA 1UBMS 1ZCJA 3KIPA 4TKMA 4CTNA 3PW4A 3KVOA 4UNIA 4TV8F 4LF6H 1J24A 3FDFA 3WB0A 3JYNA 3QE3A 4YCLA 2GESA 3AETB 1SPXA 2SNIE 4QO8A 3RWOA 2HTFA 4E7OA 2J3HA 5A4KA 1EVKA 2GM9A 5A6SB 3UAXA 2PU7A 1W6RA 1J8FA 2O6LA 2PIDA 4JNCA 1JX4A 4J7XA 1XMPA 1D04A 4N7MA 4D4KA 2RARA 3BWDD 4IIUA 2QR2A 2RKOA 3TD6A 5AXCA 1CQWA 3H4TA 3K94A 3L92A 4YLEA 2FXIA 5A9SA 3PW0A 3BL8A 1NDHA 3L1VA 4X6LA 2OFXA 3MLEA 4Y3UA 5UKDA 1AU9A 4GMKA 2B9VA 5EE5B 3H3JA 2AFHE 4EW2A 2GI4A 3QNWA 3RYCB 3DMTA 2GUGA 2DWQA 3G0OA 3FMAA 3T1YB 1A5AB 3WE7A 4DE5A 2HV9A 5AVUA 3LA8A 3TFOA 5TS2A 4CM5A 3D7RA 3IMCA 3BQ9A 1E2DA 3OZEA 2OXCA 3WGMA 2AMLA 2XUAA 2J0EA 3DP7A 3HBAA 3BRQA 3ZGLA 4XD7D 2I80A 3WOVA 4B87A 4BY7G 2VJBA 4LJ4A 2GZ3A 1XA0A 1PJSA 2IDMA 3LUCA 3MTBA 5DP1A 1V2GA 2H0QA 2C5EA 4BPBA 3ECAA 1NVGA 2RJOA 1PCXA 1SNYA 1UOPA 5L51A 5T4FA 2YJ4A 4QOIA 2JIPA 3W8FA 1XCLA 3TF5A 3ZS8A 3SBOA 4ZGWA 3ZV4A 4X62B 4F4XA 1VIVA 4ZCMA 1L8QA 3SSOA 1BGWA 4TL7A 3REQA 4D0RA 1PR0A 5DI9A 2Z3WA 1OYYA 3FRIA 3W90A 5AKZA 3AB8A 3HE3A 1KAOA 1TUBA 5DWDA 2VHEA 3P7MA 5ALLA 4OM7A 5AI0A 5E38A 4P81A 2H2DA 2V74B 3FMVA 1MZVA 821PA 1XQ9A 2J9ZB 1WUKS 3AR5A 3ILHA 1JH9A 2JFGA 1IM2A 2I54A 4CLDA 2JHFA 2E85A 4ZFNA 5JCPA 5CH5A 1VI6A 1L5RA 1RJ9B 4MV8A 3PVXA 1BO6A 1E77A 1GGHA 3EFEA 3H11A 3QKRB 2IS1A 3MVEA 3EUWA 2VT3A 1OZFA 4CQMB 3Q87B 3F5FA 3ZCQA 2HNAA 4KNWA 4KRFA 2ATEA 1J0XO 3JRXA 1JAZA 1FFAA 1RSZA 2RHJA 4ZICA 4GI7A 5BWOA 4KBYA 1XMVA 1OILA 1QYWA 4KE7A 4MTCA 2AZ4A 3V8NA 5U9CA 3DFKA 4FFNA 4TWRA 4N76A 2YOHA 3SZOA 4BC0A 3NHSA 1XZHA 4JV5B 3HJHA 4IO0A 3T5KA 4LXTA 5DMXA 1KEZA 2R79A 3AF2A 2FWIA 1OUMA 4HKTA 4IRXA 3TTVA 4QNRA 1GL7A 3LUGA 5KKCA 4S24A 4CM1A 4GLXA 1KFBB 4NAUA 3I01A 4N3NA 3R23A 2ZDHA 1KC3A 2G7ZA 3PEVA 1QU3A 4BRZA 3Q8RB 2VYCA 3NTLA 4GLOA 3G8CA 3IUNA 5HQTA 4EX7A 4AWBA 3BZBA 1CQIB 2X0EA 3ANYB 4YR0A 1MPXA 4YCDA 5M34A 2G25A 2VQEB 2AR7A 2AFIE 1ZJ5A 3EIXA 3TQHA 1SU8A 4UNSA 2ORVA 1YJQA 2M32A 3E1KA 5A3RA 1SAYA 3HYCA 5IM4A 1EIWA 1CD5A 3ACDA 4WUVA 3RT9A 4DUZH 3RI3A 5ADHA 1GVNB 4XQGA 4JI1H 5KSOA 4C0SA 2BZ0A 3T5TA 3CO5A 4MW5A 3VR0A 3VNNA 1Q50A 3EODA 4C2TA 1CJMA 1DGQA 3PD0A 5F4ZA 2D0PB 3CNLA 3KUUA 4QTXA 5AVXA 2ADFA 2CKMA 1TNDA 4UHJA 4PGHA 5EQDA 3MA0A 3MAGA 2UZIR 2AF4C 2OCLA 2UYOA 3R3XA 3VPSA 1LTQA 3L6UA 3T06B 4MLPA 4DLRA 1Y63A 3VKUA 4O7TA 2YCHA 1VLMA 5SZJA 3A7EA 1MJ5A 5CB4F 1DVRA 2AJLI 4I8IA 4L7VA 3ZGYA 3NKVA 2VDUE 3T35A 4DV0H 1N5OX 1ZD2P 5AICA 3OFVA 4FXOA 4ZU1X 5CDFA 1Y8AA 3FZYA 3WP1B 3OG9A 3U4IA 2JS7A 1X19A 4A73A 4B6PA 1Q5PA 1B0PA 3KXYT 1GQOA 2GO1A 2IDKA 4MJ7A 1FPQA 4D8WA 4TZ6A 3EDMA 3U5TA 4HQ6A 1M2OB 5LZ2A 1U63A 1PUJA 2A57A 3H6HA 1PV1A 1U1DA 5IC4A 1BQEA 2C98A 4WXHA 4CMEA 4ZYWA 3BREA 4IIYA 5HR5A 1Y8RA 1WH2A 1X94A 1JE0A 2ORWA 2ZI6A 1OXXK 3UXEA 3OETA 3KLMX 4N7RA 4NQZA 4ENVA 1NT2A 1RYNA 2KSWA 2A14A 2XUQA 3PXUA 4E4RA 1KARA 1T8PA 3H0KA 4YRFA 1I2KA 2JIOA 2Z8XA 3CF4G 3IQZA 4B73A 4CUZA 4D2IA 4Q47A 3QA9A 1SCJA 1UXOA 1ZRNA 3PC8C 3VH1A 3K9BA 2DGDA 1TWGA 4LYFA 5K4GA 4JI3B 4QRHA 4M8SA 1Y8CA 3NIDB 3CVJA 2GN4A 3GDOA 3OKCA 4U2CA 3LHKA 1OSNA 4HNAB 4BB9A 1PYGA 2VP3A 3E18A 2YYZA 2JIZD 3G2OA 3GEHA 5ALRA 2KBFA 5C8ZA 5L9AA 5JLAA 1QDUA 2AKAB 3MT0A 5E6RA 2GERA 4FE3A 4OSOA 4PYKA 4BLSA 1GZ4A 3NGLA 3UJ3X 2JHGA 2IYFA 3EC7A 4OV6B 1RM4A 5ALJA 2J4FA 2WICA 5K8CA 4FLMA 4C0AC 4IY1A 4YJ3B 4WN9B 3WBBA 1SYXB 2G76A 1Z6AA 2JGRA 3GJQA 1LSJA 3N74A 1YMVA 5FF9A 4CCAA 3N28A 1R0ZA 4V02A 1T5TA 1OA0A 2ZT5A 2JFQA 2AEJA 4FLEA 1V5GA 4N0QA 4R7GA 2DBVO 5A06A 2FPGB 4JSRA 5B1DA 2YOFA 2XUIA 4K9SA 1ZWLA 3PRHA 2O1WA 5AM5A 5DYGA 1T5LA 1QGYA 2ETVA 4D8UA 4K05A 2P6UA 3G3EA 4HVAA 4CN8A 3M6VA 2B5WA 4DMGA 4LMPA 5BXQC 1KJJA 4FEAA 1GN8A 1LNQA 1NNUA 2AW5A 1CULC 1NUHA 2C5BA 3C6ZA 3HO6A 4ARUA 1R15A 5TC4A 1FQWA 3VJKA 3CZPA 4TTRA 1RI3A 4R3NA 4S05A 1F8GA 3MR5A 3IAFA 3IP9A 3K92A 5IHPA 4MMXB 3WGTA 1P7VA 3QEAZ 3UMYA 2GEBA 3V32A 3GG9A 1PZHA 1P80A 1L2TA 4PZ6A 4OQEA 4Q9HA 3Q7EA 2BP7A 1YJAA 1I1OA 2Z0MA 3WO0A 5EOVA 2XYQA 3KOXA 1UWVA 3FKQA 3NWJA 1U3VA 1KA9H 3FSRA 3HRKA 3TVYA 5ADUS 4A82A 1YULA 5FFNA 1WSCA 4O4LF 3NC1C 4LMYA 5KFNA 2BEUB 3IR7A 3Q72A 4GNKA 1YZQA 4NU5A 4PAGA 4WKNA 2ZGIA 1JU4A 5IPFA 4UEKA 4B3SH 5KT5A 2X0JA 2YVUA 1Z47A 2X1HA 2IXDA 3OH8A 3VU0A 4QODA 2V7EA 2WZCA 3KPVA 5LP6A 4MRRA 1JFFB 4OHKA 4GZ6A 3ZY5A 1T6XA 2DUMA 3FNQA 1HH4A 3T41A 1KY4A 4AYXA 3FLAA 1FNSA 1LDYA 1IQUA 2VDNB 1Y1WA 1CJKC 1JHAA 1H66A 1X87A 4NBRA 3UPTA 4NI5A 3QPVA 4YY3B 4EJ2A 1C3XA 5DG8A 4QNMA 5DLQC 3KKPA 2B8EA 2IQ5A 1AMNA 1LPBB 4HD8A 3V42A 1F7UA 2QX4A 4WQMA 3U80A 1U80A 1VMIA 2VJOA 4JU9A 2GETA 3GH1A 3L0YA 2CKZB 1M7GA 3E9RA 4PBCA 3NHPA 3O90A 5G1NA 1W2WB 4KJXA 3ROMA 4KAJA 4K9QA 2HWXA 4EUNA 1C1XA 2H51A 4QBFA 4XM0A 2QW8A 1N57A 3R4VA 5AW3A 4C4SA 3C5WP 2B82A 3NM4A 1K5HA 3BGIA 4XLTA 1OXKB 2ZSFA 3HCDA 4FGKA 2CXXA 2XMPA 4BDSA 5JBIA 3VGPA 1BGVA 4ITUA 1Z0AA 3MYYA 1YDEA 4IJVA 4NPCA 3OEYA 1QHFA 3FW1A 3QM1A 4DR5B 4IIFA 4D9HA 5EJGA 2H9IA 2VQ6A 2ZB3A 3GW8A 3AV0B 1QOQB 1ZG3A 2ECQA 3IMFA 3L8MA 3IKMB 3ABOB 5EHQA 2AG6A 1UZMA 2O2YA 2XMQA 3AGPA 4S12A 4OH1A 5CK5A 3AKCA 3WQHA 3ZLVA 4BC1A 4B48A 4CRWB 2CV1A 4RK6A 4NU6A 2Z5GA 4KAFA 1DC7A 2FUG1 4W1RA 1JR4A 2XUOA 2VAMA 4BKQA 4OBXA 1KYTA 1NKTA 1OBCA 1QX4A 1EDEA 2ZSDA 4N39A 3W2FA 3WGYA 5EIBC 4BB0A 1A8SA 2R8EA 5LC1A 1MKYA 1UMDA 1SCIA 2QAIA 5EKSA 4AROA 3AHIA 3K05A 2Y71A 2NTYC 1J21A 4A26A 4EYSA 3UQYS 2ZB8A 1NNEA 5EWMA 2WOJA 4XM2A 3GEPA 1PN3A 5DM1A 3T3GA 4ER3A 1Z4MA 5BOVA 4JI2H 4G01B 4XQ9A 4D43A 2TMDA 2XCUA 4RYDA 4JXUA 2M1ZA 1U9JA 1SFOA 1HDXA 1UBGA 2WM9B 1VS0A 3ILYA 2YVLA 5DM2A 2C0PA 3T1OA 4C0QC 2VNKA 3GJ0A 4BO1A 1G9XA 3DBLB 2W2OA 3CISA 5CT9A 4BCBA 2V0CA 4D9KA 4YUAA 1HE2A 2X3FA 1EJ0A 2BRUA 3HBLA 4C5BA 4U2BA 4M83A 5F52A 4CGZA 5K45A 5CUQA 1N2JA 4ISBA 1LLUA 3N2GB 5AOAA 4U9IS 1ITZA 5ECDA 1PBNA 2V8BA 1UDAA 2KWIA 3HADA 3I4FA 3U1BA 5A62A 4F1KA 4TL6A 4A7PA 3MD9A 1R8XA 2BE7A 4RELA 4D96A 3HBFA 1E1QD 1H9CA 3V4RA 3B60A 4EITA 2V98A 1MX9A 4KVGA 4ZTZB 2B5VA 4D9EA 5HXAA 2GK3A 4PSKA 1TO2E 3OEHA 1H05A 1KDZA 4QJ3A 5IXYA 2BEJA 4DR5H 3DE2X 2PQ0A 121PA 2FFQA 3GR6A 1CB0A 1XP5A 1Q0RA 3KDSE 4ZQIA 3I2KA 3B7GA 3D1LA 3NJRA 3T7RA 2IOYA 3ICWA 4G4IA 5BN4A 2G63A 5EVCA 3IKJA 5J5VA 2VTBA 1QRTA 4NAVA 2QTHA 4R7ZA 2C77A 4P54A 3S8YA 3IUSA 3EVBA 3QEKA 5KWVA 4MQFB 3E2PA 4MGZR 4P5PA 4P7BA 1K75A 1FY2A 1WZEA 3NU1A 4MVJF 1IN8A 3PCXA 4IHJA 4CLOA 4N9WA 1SCKA 3E3AA 4AJHA 5E25A 2H7CA 1S9FA 2ODAA 3AHEA 1ZZEA 2LCFA 2P4SA 4G09A 5GONF 5BVGB 1O0CA 4MVJI 4QD3A 2DULA 3HWX1 4ZT4A 3EWAA 1NMYA 4GYYA 3H5RA 1DAKA 3BOSA 3GGSA 3N7AA 4PX9A 3HCCA 2AMYA 5JY1A 4CKYA 1NQWA 4QZVA 4GKKB 4C2MA 2JLZA 4F4WA 1FNCA 4Z51A 3P0HA 1L6RA 2YJ3A 1OZ0A 4MROA 1XOIA 4RTMA 4BXOB 3I4MG 3DJYA 3NONA 1ANKA 1KXJA 1NKSA 5KOHB 1GG2A 2C2KA 2HCFA 2I4MA 3QE0A 3H40A 1P8LA 1DAEA 1TGYA 3NKLA 5DBGA 2QBYA 5D3MA 3EMBA 3LV8A 1PQWA 5BWXA 4E6EA 3BTOA 1JFTA 1IULA 2IT1A 5I7FA 3AR4A 3B82A 2A0FA 4MVXA 5HRUA 3LFTA 1EAMA 4UDNA 1AH2A 5IDYA 4PGGA 3FCOA 5SV2A 2PVPA 4KKXB 1KJ8A 1GPKA 5F7ZA 4NMLA 5GY7A 3ZLJA 3QLUA 5FPKA 5A0TA 4D42A 3ONEA 2P9JA 4ON9A 1PW7A 2PA0A 2PN1A 3HP4A 4CVNA 3WY9A 4PFSA 5BRAA 1UBUS 1I4EB 2HA5A 4JJ4A 1XKTA 1GDDA 1MC8A 3ICOA 2H7VA 1JDPA 3OWHA 2O19A 3THRA 1ZMTA 1RXCA 2HK8A 2FSIA 2HC9A 3HG7A 3ISJA 4XRRA 1KYXA 4QU5A 4F9GA 4RAYA 3C7KA 1KI1A 1ZX1A 5KFAA 1FZQA 2EW2A 4DIEA 3H1FA 1XKXA 2WLTA 3F8SA 5IRCD 1SC1A 1B74A 5CA0A 1HYBA 4N18A 3TRIA 2C4TA 3B6EA 4RVOA 2UU9H 4EI9A 3NP9A 5AK3A 4EY6A 1HNWB 1VQ1A 5C1PA 3AUFA 1Q0PA 4OJMX 2ZXUA 4G86A 1ZC4A 2XDQB 2J6IA 3S28A 5TARA 4KOAA 1KT8A 5DNVA 4ED6A 3KVRA 1DKLA 2W7PA 3N8GA 4I50A 1UP4A 3ET4A 4I55B 4PVDA 3WA7A 3HVUA 1MB0A 4I4NA 1V4BA 1ORVA 2BFCB 3OJFA 1XZBA 4JS0A 3UOWA 4AJ2A 4RTNA 1TZ2A 2KQUA 1Q57A 3MPUA 4MCJA 4QTTB 3IE0A 5KWEA 3RRZA 1DIOB 3OM0A 3RIXA 3LBNA 4RA6B 3W3AA 2FUKA 4G4JA 2O50A 4NJEB 4BPRA 1I80A 4RTOA 3JSNA 2IGTA 1VG8A 1RU3A 3SS9X 1QIKA 4EAAA 4RY9A 4F2WA 5F4BA 4WNCA 3PQ8A 3WLNA 4ZVNA 1EE2A 5DM70 5K99A 4DR2B 2VPXA 1MB2A 4UTRA 3MFHA 1COZA 1GQYA 2HHCA 3O91A 4EA6A 1ORIA 4BBPA 5JDCA 3KYDA 1TZBA 3OHSX 3QVXA 3TI9A 5JFGA 3A6ZA 2DWCA 4MEBA 2UKDA 1SBYA 2R7NA 1TD1A 5KFXA 2B5OA 1IAVA 4BZWA 4BO0A 4AIIA 3NBYB 4BKUA 3MWKA 1KFJB 5DTJA 3D31A 1QH0A 3KSUA 3GVHA 3TQQA 2ATXA 5BW5A 4UUMA 3QHQA 4FN5A 4ILEA 3C70A 4QYSA 2C83A 3HDJA 3TUJC 4QJ5A 1X14A 3FJ1A 4Q0YA 1W30A 4MUXA 4MQ6A 1KO8A 4PPYA 4CKBB 2H0RA 2RGGA 3O8DA 3PHJA 1ZGAA 5C5DA 1FFSA 2WMOB 3FDJA 1USIA 3NAGA 3W2EA 4N40A 1V48A 5AIBA 1I0ZA 1S9HA 4DM7A 5LIPA 4HNSA 3K71B 4GNRA 4DB2A 3KWFA 3QPUA 2FPKA 1PHPA 4IMRA 2WJ3A 3RH0A 3VC2A 3QFHA 2H1HA 4X93A 2ZS7A 3P4YA 4U7HA 4QWCA 4TYYA 2YTZA 4U6SA 4B09A 4KU4A 1OBFO 3GLVA 4D57A 4JC4A 1BS9A 2ODBA 3PCRB 3WMWA 3WDSA 4M1TA 1E0SA 1LZLA 3M6FA 4P2GA 5EG5A 2DLCX 3WIVA 2QSUA 4EEYA 5KOIA 3GUYA 5SY9A 2QTZA 3K0CA 3KOMA 1IHYA 2IA5A 2CEAA 3LGXA 2FK3A 3PR3A 4HZGA 5IAKA 2YNMA 3KJQA 2Q2OA 4IDCA 5IZCC 2O8VA 2PL3A 5IC5A 4OMFG 3HBNA 5KVCA 2EFCB 1C9EA 4NH0A 3FN4A 3IAS6 2D8MA 5AXAA 3RTDA 3T7JA 4B6QA 1A2BA 2X5JO 1R3UA 1GO3E 4UREA 5SYMA 1G6Q1 4H1HA 2J6TA 1TJ4A 1MA0A 1AN9A 3QENA 4CKWB 1SOAA 5IYZF 1KNXA 3DCYA 4M1WA 2D7JA 1O6FA 1ZH8A 4CMAA 4I1IA 2PUTA 5EKXA 3TLYA 4M3NA 4PZEA 1MV8A 5BN1A 2D7DA 1CCWA 3GT3A 1E9VA 3PVZA 2B6HA 1OW3B 2JHCA 1RWVA 4UQOA 4WECA 3KSZO 1I50A 1ZK0A 2OYRA 2WFLB 3WKAA 2O5VA 4CTKA 1YQUA 4ZJYA 3EFOB 1CYEA 2ASLA 2SCUB 3Q2KA 2CNUA 4K9KA 5TNXA 4FFOA 4E2XA 5I7VA 3TQTA 5CLGA 4DQ0A 5KFLA 5IWAB 3GT0A 2CMKA 5ARCA 3KSMA 1EZ1A 3V2HA 4IDEA 2YFYA 2NU8B 4EEQA 3IUBA 4H6PA 5EQJB 4CL8A 5H8WA 1V4VA 5EWJB 5JUWA 1J22A 2H1LA 4GPAA 5HOEA 2NZXA 2PPLA 3ZCXA 4O3QA 4RB0A 1RHMA 2C04A 1RQLA 4JI6H 1IPFA 2CN1A 2IC5A 4TVKA 3BVPA 4IR7A 1M2JA 1EVZA 3OTHA 4MVJE 1S89A 2OQ2A 2Z4TA 3AVVA 3NWOA 1I01A 4JGBA 3IHKA 3LVFO 1WW8A 4V0ME 2HZBA 3R0VA 4KE6A 2ZUSA 4NRDA 1FP1D 3B1FA 4OOFA 5G4KA 5I5TA 5ALMA 4GVLA 1RP1A 5I9SA 5JT1A 1NY6A 1DX6A 5CM2Z 5T41A 3WLAA 4EFMA 4ZHQB 4ZMBA 2O20A 1IBKH 2FWAA 5K3CA 1C0LA 4LRYA 2P27A 3B1YA 3EGIA 3WWIA 5KT2A 2O2GA 2Q6TA 2V7GA 3G2MA 4NBLA 3SXUA 1UAAA 3DZCA 3EGOA 3O7WA 4U9HS 1II0A 1KAGA 5E0KB 5FPYA 1PNQA 1NXXA 4BP3A 2FK8A 3U3ZA 1RRCA 1DDGA 3EJWA 3MF4A 1ZC3A 1BDIA 3OOYA 1ZS9A 2OECA 2P9EA 5GZ6A 2OQIA 5M5BA 3SLRA 3FLBA 3N8HA 3P9ZA 4RAZA 4F8EA 1ZGZA 3A14A 4N47A 4Z49A 1U6KA 5JSUA 1OBGA 2Q0SA 2D54A 3HKEA 1CUIA 2JLQA 3A6FA 2ACEA 2F1OA 5TVKA 4ALMA 4F1JA 1H2RS 4MV9A 1VPEA 1AKNA 2FRDC 1LSOA 3GIKA 1CY4A 2CYCA 3D6UA 1SA0B 3HKCB 1E98A 3LL7A 1OZAA 1Z6PA 2YXDA 3FPEA 4DDTA 3N7UA 5C9ZA 2XVAA 3D6VA 1IWBB 1M0SA 2EXXA 1UDCA 4L4YA 1C2YA 2FCAA 3C6BA 3Q8MA 1GTJ1 3PDJA 2I3BA 1V1MB 4AYTA 4ND1A 3L05A 2H2IA 3CRNA 1E9EA 2IOQA 2P9HA 3H04A 1DIRA 3M5WA 1AMOA 4DR7H 4EHAA 1B3BA 4GC9A 4LHEA 5JSYA 3V33A 4D5GA 3NBQA 4OUDB 4NV1A 3NDJA 2YVQA 2OUKA 3SHQA 1SUFA 3E1SA 3AUJB 3VXKA 4AZWA 3GLGE 4RUCA 2L18A 2A5JA 3FOBA 4RS4A 3TCNA 4YP5A 5JPCA 1Z4QA 2VUIB 3EA5A 4P0TA 1EWQA 2WMYA 4UMEA 3T3IA 3BSSA 2XCLA 1D2GA 1NBEA 2WU0A 16PKA 3I92A 2QRQA 4RH1A 5DBEX 4ZRMA 3DLHA 4MP3A 1QGAA 3CEBA 4BFTA 4HZUB 3H5LA 3ZHZA 2B20A 4M9ZA 4DTCA 1SOUA 2J87A 3B89A 2GQRA 2AOXA 3G5TA 4EEZA 5A7FA 3TPZA 3HJTA 1DELA 2ZW9A 4RK7A 3SF0A 2B1GA 3A05A 2ZETA 4J9VA 3RSZA 5LZ9A 1PDWA 3M89A 3PFWO 2CVQA 3B3JA 3ESZA 4QREA 2WY2D 1YBAA 1ARZA 2GVNA 3E7FA 4FHFA 5AK5A 2X1LA 1UP6A 3OOSA 2IUUA 1P2BA 1TIBA 1JG7A 2FGJA 5T6BA 5B55A 7ADHA 4MR8A 1EVLA 3BXFA 1KRHA 1SVWA 1Z0ZA 4INAA 3CVXA 5HZGA 2QW0X 2NIPA 1EKXA 4L3OA 1RI1A 1J07A 2H59A 4TVOA 1V2HE 3BIOA 4GL4A 4MB6A 4Z4CA 1GIAA 2B92A 5JI2E 2HQOA 1P81A 3NS7A 4P80A 1QVZA 4FJ1A 5HF8A 4Y7DA 2YZNA 4DAEA 4M0CA 2VRCD 2EQBA 4IVNA 2FMKA 1QFXA 2EW1A 3GFTA 1Q1NA 3QX8A 1STOA 4MJ3A 1GPDG 3MELA 1MOPA 1OFTA 4RPIA 1RFGE 3RANA 2Y05A 1RYHA 2CVHA 4HR7A 4Q3EA 3UB2A 4ZGBA 4X7PA 4DBLE 1AGXA 4LBWA 3E0XA 4ARZB 1QE5A 5IWAH 3MWEB 3O7MA 4GRAA 2XDQA 1KOLA 1V8ZA 1MG0A 1VJCA 2OR3A 3W3ZB 4A2WA 4B7CA 5GJBA 2OK7A 3VOSA 4GRIA 1P9WA 2GNAA 1HT2E 1RHQA 4H3VA 3TBKA 3GOHA 3WGZA 4O4IA 4C1NA 1EPUA 3CRVA 1COWA 1P6XA 2FFAA 2G04A 5DOZA 2J85A 5HS6A 4KGVA 4YMSA 5AMXA 1X7HA 2R1TA 3HSYA 2V7QA 1ODLA 5J5CA 2LIVA 5A02A 3R7LA 4BNVA 1BEUB 1P72A 4N3BA 1XE3A 4HXYA 5H9VA 1HLDA 2BH9A 4Q7JB 5I7OA 3JATA 3UN1A 4D0SA 1YZVA 4IDQA 2W9BA 1LBIA 4M0PA 1XRLA 4XD2A 5EXXA 5K6AC 3WAGA 5CDTA 4W1SA 1PR6A 4LMRA 3RSHA 2NAFA 3F73A 2PJUA 3PLAE 5EIOA 2YWJA 3WDMA 5LXTF 3TMYA 1KK1A 1RE0A 2IBMA 5EINA 1SK9A 2QQEA 1GLNA 3O3MB 4FCCA 4GI3A 4OHMA 4XWWA 3KSBC 4IWXA 1KZYC 4YIKA 4Z54A 3QEJA 1YI1A 2QTNA 1ZFNA 2X4IA 4PGFA 3KCNA 2AGOA 4ESEA 2GD2A 1CC1S 3E3NA 1E79D 3WIDA 4X41A 5HV6A 4KHZA 4TS3A 3RSLA 3VKGA 5JATA 1JHYA 1DSSG 2VJCA 4UC0A 3WMRA 4L08A 1HR0B 4BNDB 3DHEA 3RFCA 3C7DB 4FI3C 1KU6A 4F38A 3ER9A 5HK9A 1WABA 5DGCA 3BJRA 2R87A 1BCRB 3SVTA 1JR6A 1TTTA 4BECA 1UM9A 2RD2A 2XX3A 3KLOA 4HVCA 3HKZE 3OFNA 4KDCA 1JMVA 1DEOA 4CDGA 4DEVA 5BR8B 1KDTA 2JJ1D 2VA3A 4UCXA 3V6LA 5CLFA 1LX7A 3ID6C 4FFSA 4CTOA 2RBEA 4QULA 4AJOA 4LDNA 1SG9A 1DBVO 1KQOA 1X1EA 5LZ4A 2JAXA 3FNGA 4JUZA 1AQUA 4C43A 1W0KA 1QIJA 2CD7A 4OA8A 5HSGA 9LDBA 1CRPA 1PT9A 1GRVA 4YT5A 4Q8FA 1F48A 2HDHA 4N3AA 2E1RA 3GB8B 3A11A 4HLNA 4HUQA 1OGYA 3KT8A 2BTQA 4BLRA 1DCTA 3JD3A 1PVOA 3H9CA 3HV2A 2NVXA 1XLTA 4RF5A 4LFAH 1HFJA 1V5FA 3FPGA 4TKUB 5CT4A 5D5QA 1FNDA 3VPBA 4GKAA 1RYEA 1BXZA 4BO3A 5DYNA 1K9SA 1S8OA 3RF7A 1ZOIA 1AZLA 3WG9A 2H54A 1JVNA 3DEJA 2BYTA 3SY8A 2H4HA 2X0IA 2BGUA 3GD5A 3VNSA 4B3HA 4FZVA 5ICEA 5J3JA 2NT4A 5AVYA 3OURA 2CJXA 3GVXA 4OB7A 3V4LA 3F9RA 3T1TA 4PG8A 3U3JA 2WM3A 3LW8A 3HDYA 4WLFA 1IBCA 3M81A 5CCDA 4GPD1 3V80A 1W44A 1J90A 1E1NA 3EIFA 3E5NA 5F7OA 5JNSA 4URWR 2JAPA 3DLPX 3L46A 4R9VA 2NXCA 1UR5A 7MDHA 1JA9A 2IW1A 3PUJA 3VVLA 5I51A 1QV6A 2PD4A 1Y6QA 4EKYA 4FHZA 2WPNA 4RTKA 2GZ1A 2XA9A 1E2EA 2GAJA 5DXFA 5KVAA 1TLLA 4UHFA 1XMOH 1YZYA 3HMQA 2QQ5A 4Z99A 3VR2A 1G1MA 1AUPA 1R5JA 2J5BA 1AQIA 1AX9A 2BDTA 2FMHA 3OX2A 3B48A 4B44A 1IZYA 4BQRA 4XVCA 1O8BA 1ZD1A 3R74A 1JPJA 2FWNA 3PENA 4NR0A 4S1TA 5CXQA 2XAAA 3V8RA 4AD8A 2MSNA 1CG6A 3CR7A 4AP5A 1U04A 4P08A 4UCFA 1LV7A 3TZEA 1M73E 3O8BA 4K0KH 1GL3A 4H0NA 4U6NA 1CUAA 3VR5A 5H16A 3SJZA 4DMHA 5FA6A 4DQNA 3E61A 2OOSA 4J7CA 3TLGA 1PZEA 4RTJA 4DR3B 2FVXA 3R6LA 1HNXH 1EBUA 1F5NA 2YJZA 3JSXA 4WBSA 3FFAA 3T5MA 1E6UA 2VTBB 1RM3A 4ZHQA 3G5AA 2VA2A 1DJOA 1QZTA 2OC4A 2PTHA 3UV3A 4CETA 3SM3A 2QAJA 3ZHRA 4KO2S 1M2VB 4RADA 3SC2B 4ARIA 2QU8A 3I0MA 4HQRA 4KFUA 3RUPA 3DJFA 4EEXA 3RVJA 3MLAA 3K6SB 1LRLA 2OPHA 1K6JA 3O3NB 1P73A 4Q4AB 3IQXA 3W78A 2OWOA 4JLJA 1D6JA 4GW3A 2R4TA 4HMQA 4XWYA 2BFWA 1MOQA 4KC0A 1SUPA 2IYZA 3ON5A 3AF1A 4QGHA 4ZOLB 3EX7C 1FPMA 1ZXXA 1CP2A 3DC7A 3KJNA 2BF7A 4NS4A 3F47A 1WG8A 4AN0A 1Q0UA 2ZJFA 2DTEA 1NONA 3DG9A 2XGQA 5L6MB 3CRRA 2DFLA 2CQYA 1P4GA 2WSMA 3MGAA 2IPLA 5B2ZA 5K0LA 3F4BA 1PAUA 3BS4A 3SLKA 3TIFA 4F06A 4BY1G 1U1CA 1Z5VA 3KE8A 4ISCA 1DAOA 3TY5A 4MDHA 3V8VA 1BS1A 3FCXA 3UMCA 1UMCA 4Q4HB 3KEGA 4AMUA 3OJLA 4BU1A 2J9GA 2O2ZA 1PJTA 4CMIB 3QPDA 3AL0C 3VDXA 2EKDA 4KACA 1XI2A 4EI8A 1K8RA 4I8XA 2L19A 3IQIX 4CIWA 1ZGCA 2W6ID 3DBVO 2XF8A 1M6WA 1SOMA 3FD8A 1Z5UA 1MBZA 1JE1A 2ACWA 4IUCS 1THZA 1P1HA 2B63A 1UFVA 1Z4OA 2C03A 2LTAA 3ICPA 4HGRA 2PKQO 4DV6B 3NHUA 3QPAA 3CEHA 1K97A 4RL6A 1F17A 4AP6A 1GM5A 1R4AA 2VC2B 1FFYA 1CZHA 2FWRA 2Z2KA 2JZOA 1QM5A 2A1UB 4K6GA 3M4XA 4UUNA 3O03A 2QIPA 1S7CA 1QB7A 2OGWA 1C3OA 2X2PA 4BWYA 1SKQA 3SEZA 4BQOA 5KYXA 3KWMA 5PGMA 1F5SA 1VE5A 4CQMA 3RODA 3MCUA 3PC6A 3W1GA 2DCUA 2DHQA 4U63A 3THXB 1GL6A 5HCIA 1R5OA 1IXSB 4JVLA 1SVSA 3VFDA 3HTXA 4NY1A 5CAEB 2E4UA 3AEQB 2BKVA 5FLXW 2XDYA 4LTNA 4YFYA 4FN4A 5IKEA 1GRQA 3DTGA 1YB6A 1MABB 3EXHB 4E07A 1ZK2A 4JUCA 2SICE 4HTAA 1KYQA 4MJLA 4RQTA 3A4IA 1MX1A 4JOSA 3SOZA 5JWHA 2RGRA 3LE8A 4FPXA 4GSYA 1B8VA 1EFDN 2ZSKA 3FZEA 4RORA 3DHYA 4LWQA 5EPUA 1JG1A 4Q6WA 4CG2A 1JEYA 5DGHA 3G6VA 4JIGA 4JA0A 2XSZD 3BMOB 4GYWA 4MKHA 4PLWA 3D4NA 4ZKEA 3ZYCA 4D44A 1UBOS 4DG5A 5B3JC 2FWPA 1GPAA 5CG2A 5DKFA 3PO2G 5T5QA 2KJQA 3C48A 2Z43A 2OYSA 3VR5D 4E5VA 2I55A 2ZTLA 4I8DA 1EGAA 1THGA 1WKCA 3DV0B 4JL5A 1Z13A 2AJCA 3P9IA 4F7WA 5BWWA 4E5NA 4V1CI 4D8XA 2CUKA 5CIWA 4M89A 2SKEA 4K8OA 1XMOB 4EMTA 3SNKA 4QGSA 1DWQA 3H1BA 1L4HA 5JD5A 3REFA 1VGVA 4NZOA 4JP2A 4P38A 2VTDA 4OK6A 4RSMA 4C08A 5KC9A 2GQ0A 3SQMA 4O7ZA 2BI4A 1J8QA 3H5OA 3HYSA 1N7JA 2CDAA 1WXFA 1YQTA 4NICA 2C92A 1NUSA 5IULC 3TTWA 1U3CA 3KJXA 1NL3A 4H9GA 2VYVA 3VVBA 3NP7A 3OX4A 4A3KG 4C7VA 4IVRA 4TUYA 4YRNA 2E4XA 5C46F 3BXEA 1WBBA 3PIIA 2WHEA 4EQZA 3AUAA 2OGUA 1GQQA 1RJEA 5FWXB 3HJRA 2DFTA 4HYKA 4C89A 4YV1A 1I7SB 1JYEA 5LB4A 3UW3A 3NVMB 3H86A 4MITA 5IT9A 1AV6A 1J6UA 1TWHA 1XZ8A 2H1RA 2Z6VA 2K7ZA 2ZTMA 3NBUA 3LWDA 3VJLA 5C4MA 1VSBA 2XECA 2ZIGA 5KHAA 1RIFA 3JWGA 1T9CA 4G9EA 1RBQA 5DX0A 5C8YA 2HZ7A 4DCTA 2Z30A 3AUSA 4YXFA 1Q91A 3RVMA 3ELWA 5KC8A 5JWOA 4G8CA 5HQ3A 4ZANA 5YASA 4RWZA 5KB3A 1Z0JA 1I7NA 1Q1AA 5ED4A 2G5GX 1ULZA 2GBLC 5HRCA 1KO7A 1SHJA 2WQZA 5DYWA 4BQSA 1E2PA 3EXG2 4EO7A 1KEEA 2CHQA 5F2NA 4WCFC 3I5UA 3AINA 2A5FA 3JW8A 4BKRA 3C4JA 4IOKA 1NPDA 1IN6A 1N8NA 1OVGA 4O4LA 5KYGA 1T15A 2LPMA 1U0RA 1K63A 1VXRA 5JJBA 1SBHA