2ZDGA

Crystal structure of d-alanine:d-alanine ligase with adp from thermus thermophius hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
319
structure length
302
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 85
structure length 302
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdgA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdgA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdgA01
3ETHA 5KX5F 5I47A 4GGMX 2YS7A 2W6NA 3BG5A 3TINA 4I55F 4O86A 3JRWA 4FFLA 3VPDA 1CE8A 3VA7A 3G8DA 3AW8A 4NYEA 4O2BF 1KJ9A 4O82A 4DIMA 3LP8A 3KAJA 2VHEA 1GSHA 2VR1A 4C5BA 1IOWA 2W6QA 3BSSA 1UC9A 3ETJA 3G8CA 3LWBA 3WO0A 4QSHA 2X0SA 5DMXA 4FE2A 5LP6F 4HQ6A 2CQYA 2WYOA 3RUPA 2YRWA 1B6RA 3E5NA 1GGOA 4FFNA 2YRXA 4HNTA 4EA7A 4HR7A 5CA0F 3JZFA 2V58A 1AUVA 3JZIA 2YZMA 2DIKA 5JVLA 2NU9B 2C00A 3VOTA 1Z2PX 2R84A 1KBLA 2W6MA 2SCUB 4O7ZA 4I50F 2W6OA 2HJWA 3R9RA 4M9CA 2OLSA 1EUCB 5HV6A 1EYZA 4M9UA 2GQRA 2R85A 2NU7B 3HBLA 3TQTA 3N8DA 3N6RA 4YAKB 1I7NA 2QK4A 3AX6A 2NUAB 3K3PA 2FPIB 3UFXB 3V4ZA 2PBZA 1ULZA 4ME6A 2I80A 2YZGA 1Z2NX 1KEEA 4IWYA 3HB9A 3KAKA 1T36A 4YAJB 4Y8VB 4E4TA 1EZ1A 4EA8A 4EGQA 2YS6A 2GLTA 3RFCA 4DLKA 2YYAA 3U9TA 3SE7A 4MV1A 4O7TA 2IP4A 3BSYA 3BSWA 1KJIA 2PVPA 2R7KA 1W96A 1GLVA 3MWEA 4O7NA 1IOVA 2CNQA 1AUXA 2NU6B 4HNVA 5LYJF 5EZYF 4MV8A 4IZOA 3VMMA 3TW6A 1EUDB 1M0WA 4FFMA 5J2TF 4O7RA 3U9SA 2CZGA 2R86A 5C8YF 3R5HA 2W6ZA 4O84A 2DWCA 4FFRA 4M99A 3ORQA 4IWXA 3KALA 4C5AA 3OUUA 2R87A 2I87A 3OUZA 3Q2OA 1JDBB 4O7WA 4O4IF 4O7SA 2J9GA 4EABA 2PN1A 3QFFA 2NPOA 1A48A 3TIGA 1VBGA 2QF7A 2NU8B 4L1KA 4RZQA 1KJQA 1JLLB 4O2AF 3U55A 3JRXA 4O7LA 4EGJA 3HO8A 4O4LF 5FNVF 5J2UF 5JVDF 1UC8A 3U54A 4I4TF 4MV4A 1DIKA 4FFPA 4ZHQF 4YJ3F 3Q1KA 5JQGF 2ZDGA 3WNZA 2FPGB 5BPHA 2I8CA 3ORRA 2R7NA 1KJ8A 4WD3A 2FPPB 2GPSA 4MA0A 3GIDA 3I12A 3VPCA 5C1PA 4FU0A 3R23A 3V4SA 5CA1F 3R5XA 2YW2A 1KJJA 2ZDHA 2V59A 3GLKA 1VBHA 1E4EA 2GQSA 4O4JF 3RV4A 5BMVF 3NUAA 4ZOLF 5IYZF 5GONF 2R6FA 1VKZA 4O83A 2HGSA 1CQIB 2P0AA 4IHJF 1PX2A 2VQDA 4O4HF 2W70A 3TIIA 5BPFA 3MWDA 1C30A 5LA6F 4YJ2F 4FFOA 4YB8B 5KKNB 2V5AA 5CB4F 2YL2A 4MA5A 1GSOA 1CS0A 2XCLA 5JH7F 4MV7A 1BNCA 2VPQA 2R82A 4XYLB 5C1OA 4EG0A 1OBGA 4O81A 2W71A 3WO1A 2ZDQA 4MV6A 3MJFA 5D8DA 4WBNF 1WR2A 3K5HA 2Z02A 4IIJF 3R5FA 2CNUA 4ZQIA 2DLNA 5K2MA 1JKJB 1PK8A 4HNUA 4ZI7F 2DZDA 1W93A 2W6PA 4O7YA 5HBRB 1OBDA 4MAMA 3K5IA 4C5CA 5LXTF 1C3OA 4TV8F 4TV9F 1BXRA 1M6VA 4J6EA 1SCUB 2FP4B 4O7VA 3RV3A 2XD4A 1DV2A 4MV9A 1Z2OX 2FB9A 4XZ3B 1KC7A 2CNVA 2Z04A 4YBZB 1JDEA 1EHIA 4XYMB 5JQWA 2YWVA 1B6SA 2R7MA 1KUTA 2YZLA 5H80A 2R7LA 5LOVF 4EA9A 1I7LA 4M98A 5CAEB 4FGRA 3BFPA 3VPBA 1E4EB 1M0TA 4EAAA 1DV1A 1A9XA 1CQJB 1GSAA 3DF7A 4TUYF 4MV3A 3KREA 4XX0B 2YZNA 2GPWA
chains in the Genus database with same CATH superfamily
5BWCA 4RA6A 5BSHA 1HY3A 3GUUA 3A6EA 1EFLA 4X85A 4UPVA 5KFMA 5KT2A 3I58A 1O6CA 3D6AA 1TUIA 3VO2A 1HFJA 3GG9A 2H16A 4HDKB 1ZI8A 3QVTA 1E92A 5AIAA 2YN4A 3SVZA 1YQUA 2FRDA 2VA9A 3GDGA 1CS0B 3A4TA 2HRCA 3FI0A 1W5AA 4L74A 5EJMA 4DE5A 2A9FA 2O3SA 3S27A 3OOSA 4Q12A 3BWMA 4LMYA 2GUGA 3AV0B 4HFNA 3LUBA 4WA7A 3QV1A 4IX9A 3TIXB 1E5QA 1QFJA 2NU9B 3O1IC 1T8UA 3KQHA 1ML3A 4MVJE 2SCUB 1DJNA 3DTFA 2IFTA 4Z6KA 4C76A 2BZSA 3FB1A 5L45A 3MG9A 4EY4A 1LI7A 2QSYA 4IJMA 3VPSA 1F0YA 3LX4A 2X0IA 1KPIA 3C70A 3T7IA 2YASA 1SKUA 5JS8A 2Z4RA 1MIOA 3T5HA 1NI4B 3TGWA 4IJUA 1GP2A 5LYJB 5EZYB 2O0LA 1BZYA 5ENZA 1MDBA 4OK5A 1EMDA 1RYNA 1YS6A 2H07A 4JHXA 3RYHA 5EMLA 5FOVA 5EUBA 3E3NA 3OTIA 5HJEA 2VTEA 5F64A 3T7AA 3HB0A 3BXOA 1S0OA 5JDIC 4JBNA 1AN0A 3QVGA 4ENRA 2WTUA 5FXMA 1IY2A 1S2GA 1ACLA 3VC2A 1T8WA 2QLFA 5I7EA 1E3WB 3IMGA 1UPFA 2UVVA 3TQCA 2VN8A 3PLNA 1KDOA 5JT1A 1B42A 1EWKA 2NZ2A 2BYTA 4AG6A 1E1MA 1IN4A 3DBOB 3UCXA 4UD2A 2WINI 4JEUA 4FMDF 1NJ2A 4B7UA 3Q15C 3MTQA 3PNMA 5K8CA 3ZLTA 3NDPA 3ZCPA 1KRHA 3D1VA 1Y3IA 5F3DA 4H1UA 3T5GA 1JKJA 3CONA 1PAUA 4AI6A 2MWMA 1PSDA 2QGFA 1GSIA 4EG1A 1Z16A 2Q5LA 3WVNA 2CCJA 4BE9A 1VL1A 2XQIA 4DAAA 1SUSA 3SSAA 2RKBA 2Z2XA 2IV7A 2IOFK 4P08A 1Y8QA 3Q1KA 1LPBB 3TRDA 5AVWA 4D9NA 4L8VA 1OZ0A 5AFSA 2AKYA 3STYA 4J7UA 1KJ8A 2FPPB 4A0QA 2XPCA 4ZYUA 3HLTA 3TJMA 3RVPA 5IUNC 1HEYA 1EBUA 4F4ZA 3UT6A 3NHJA 5GONF 4CMDA 2VUIB 1BG6A 2XUQA 3HFRA 4XGQA 3NW9A 1DC4A 3PP8A 2LP4Y 1V2GA 5C32A 5GVSA 1I1KA 1NUQA 4IV5A 5FYDA 1BGVA 1NNI1 4GNKA 2ZXFA 1CW2B 2VPTA 3I4MG 4EG0A 1HKUA 4WOBA 1R37A 4OHYA 1YKSA 4O1MA 4QRDA 4E31A 2N47A 3CX3A 3L7KA 3JZAA 3GMSA 1N78A 1J09A 5LQDA 3QMWA 4NS4A 3NQ41 5JWRA 2I7DA 4ZFNA 1EVYA 1SCNE 1XP5A 4XUEA 4B3RB 3RC8A 1BHJA 5ADVA 3VNAA 2JGDA 4ARUA 4MTEA 2D62A 4JWKA 3F8NA 5HNKA 4RTQA 1G291 2GDJA 2B7LA 4UCFA 4FM9A 3IHKA 5TQVA 2BTQB 3K9FC 1YA8A 1IWPB 2IA5A 1PSZA 4JDPA 2W2VA 3ZUGA 4MV9A 2CHFA 5IWAB 5GGYA 2GJAA 2CVQA 4GC5A 1G5HA 2V7PA 4A3SA 4EUFA 3J81k 2ECPA 1GUDA 4REOA 2TS1A 1ORIA 4L4SA 4QECA 4R84A 3B38A 3LMLA 2GR9A 4NNPA 5JS6A 1GKYA 1W19A 2PU7A 1Q0RA 4XX0B 3DYVA 5BUSA 3FZGA 3AU8A 2PE5A 3NC1C 3KYCA 5KJ6A 4QIWE 3VH1A 3LF1A 1GY8A 4RXMA 4M1ZA 1RYSA 1LSUA 2QRQA 4A3LG 1GAWA 3HGQA 4EQ5A 2ZYUX 3DWGA 2XMQA 3QX7A 2C77A 2B4KA 1WR8A 2F8MA 5DJ5A 1GQSA 4KQCA 1V8ZA 1E0JA 2P3SA 1OZAA 1SHLA 3HN7A 1G18A 1IBRA 1Y7HA 1UP4A 2RC5A 2GBLA 4EEKA 4ETIA 4U3JB 1XVAA 3IQZA 2RGWA 2G80A 4HY3A 1GPYA 4LE2A 3DE3X 4S2EA 3LQ1A 3K4QA 2W2OA 1G5QA 1HL3A 1B26A 1SVOA 5BRAA 1SVLA 2H65A 4W5WA 4GLXA 4BNLA 3OTWA 2XUHA 5DDIP 3OCYA 2NQTA 5F76A 4IJ6A 1ZGHA 4UTXA 5DGTA 5HG0A 3Q10A 2D1FA 2JFFA 1UBFA 2VP4A 3T3EA 2OXFA 2PBZA 1FFEA 2X1VA 1T1JA 4I6EA 4P92A 5KMGB 2G88A 2ZKIA 1N5KA 2VF7A 2EZ8A 3CSUA 3W5CA 3HY3A 2CYBA 3EB9A 3GRZA 2NZUG 2WA1A 3PZBA 2CNKA 2XWBF 4XQCA 4OGFA 2A0UA 3DWIA 2ESRA 3PE6A 5DEOA 3GIQA 3BRCA 2H8GA 2G36A 3W9UA 4L72A 2R8HA 3O9MA 4KK4A 1COZA 3QP9A 4V0NA 4L08A 5DEIA 4JENA 4N0MA 3ET4A 1ESZA 1GT6A 1II0A 3LT4A 2FLKA 2N1MA 2EL9A 4I81A 4C2TA 2NO9A 2GXQA 2FRXA 2G83A 3FNRA 3IP1A 2O2IA 2NSLA 2GAJA 2P6RA 3W05A 2Q1YA 2RH8A 1YS1X 4TMZA 4FE4A 4UNRA 5M04A 4IOJA 1GNLA 1KZHA 1L4GA 2EHJA 2I3ZA 3Q9UA 5K0GA 3O26A 4LZNA 5BWNA 4WHMA 4BZXA 3M9WA 5BN4A 3TB6A 4XZ3A 2KPOA 1CZUA 2ZUVA 3J80A 5TMDA 1L4MA 5EI5A 3C87A 3PUXA 4P80A 6REQB 4K3UA 4L8GA 3HADA 4E2FA 1NPTO 4YJ2B 3MR6A 4B3JA 2VWQA 3LQSA 1QONA 4CMIB 4RZSA 3U3KA 1WKVA 1JNXX 4YCJA 4RFLA 4GBGA 3P4YA 1QIFA 4YIKA 5AVUA 4Y1EA 1U6IA 2NZJA 4JP8A 3I2KA 4ZICA 5G1NA 5CA0A 4QWMA 1O8BA 3IUSA 2EQAA 1Z68A 4FOOA 5FF9A 4S35A 2X2EA 1F3LA 4LFCH 3OFVA 5LMNB 1KJNA 3KR1A 4AQYB 3OX4A 3LX8A 1ST2A 4LDAA 2BBOA 2J33A 4HVCA 4BQOA 5T5QA 1UM9B 5IF3A 3CH4B 2ZJOA 3GUHA 4F2PA 2QN9A 1UOPA 2VRWA 1YS7A 3CHYA 5BVHA 3ER8A 1N1MA 3EUEA 5JAPA 1SQ5A 2IYNA 3KKLA 3QWAA 1FL9A 2JASA 4P6VF 3TNLA 3CZCA 5HBRB 5AHWA 3BXHA 4BRUA 1XMOH 2AN9A 1P75A 1AS2A 5JD4A 3FMGA 4ZMRA 4HLDA 3NPAA 4ECUA 2RG1A 3HCEA 4Y2UA 2C9ZA 3KL2A 1ONPA 4DV5H 5CGZA 3QFSA 4M1WA 3AVUA 5DTIA 4ED3A 3PD0A 2GFIA 2G04A 3IRVA 4HAYA 3NT2A 1NYRA 4HNQA 1HG1A 4HADA 4BLVA 2Q5FA 4LXQA 3W8DA 3GJXC 4GOMD 1VE9A 3ZE0B 3M83A 1PZNA 4LXGA 3H04A 4GMXA 1KQOA 1G41A 1EB9A 4PHTA 2MCFA 3VKHA 4K9MA 3P27A 5HA5A 5TS3A 1UBNA 1RLUA 4S1WA 3UATA 3PWTA 1Y37A 1SKYB 3QQ5A 4K9QA 2QTBA 4DMLA 3CH6A 5ICFA 2ZE8A 4YQZA 3AR6A 4FFBB 1Y5NA 3OT5A 4FILA 1MFZA 5DQHA 4O4LA 1G7SA 3SDBA 2A14A 4TS3A 2IYTA 1RT9A 1KI4A 1IBLB 5FFMA 5TV2A 1P2FA 1G9TA 1YOBA 3EG9A 4ACAA 2ZEJA 4PZAA 3RSOA 3PDJA 4YCSA 2GZ3A 4HD8A 2O8BB 3D2AA 4KODA 3WLFA 4GIBA 6CHYA 3DFZA 1FFBA 4YY3H 4C0QC 2DGDA 2BFWA 4A2AA 2WP0A 3N8DA 1AUQA 4MGIR 3I4NG 3FYUB 4PYNA 1XCMA 2Z98A 3NMUF 4CF3A 3E27A 3UK0A 2GBPA 4UC0A 4IXMA 2PCJA 5B64A 2JH8A 3OM8A 2XDWA 1QANA 3ZTTA 3OZXA 1OH7A 3KPJA 4B8YA 5H4GA 4RA9B 2PH7A 5JY6A 4JKYA 1LVUA 3V6HA 4DV7B 3ZDXB 4DL7A 5H3LA 1IQRA 1JA0A 3Q98A 3M9XA 2DHCA 4LGVA 1VHWA 2X8JA 4J0HA 1MG0A 4KPUA 3GB8B 1RAGA 3LUHA 3D81A 2Q3CA 2UUOA 3LLCA 1RZVA 3MC1A 1JEAA 2WEKA 4LNUB 2UXDH 3QVVA 2ZPAA 4CEJA 3R3UA 4LJRA 5JUMA 3PQ8A 3DBHB 4PAWA 5AK3A 3MCWA 3ZJUA 3PHLA 4Y1RA 3PD1A 4R2XA 4HPXB 4EJ6A 3D8TA 1RKBA 1RJGA 2RI1A 4HXEB 4JCOA 3AH8A 4WW0A 2XI4A 1Z28A 4TV8A 4JI3B 1P9LA 3NM5A 4DJEC 2DRIA 3OZDA 1FDTA 1Y7TA 5AJHA 4CTNA 1UBMS 1WZCA 1G6HA 5I7FA 3LW7A 3JZDA 3OCXA 4XR9A 2R6GA 2R5FA 3T9FA 1BEZA 1O57A 5JFTA 3O4HA 2BEVA 2AQIA 2XBLA 1E6LA 1V9PA 3RB3A 1XFAA 3AIOA 3SS7X 3PXCX 3TEMA 1BX3A 1XKQA 3GVCA 4XYMA 3ZY2A 2R8BA 1XVLA 3ZVNA 1CK4A 3WQQA 3F5DA 2H1IA 1WM1A 1QCCA 1SH7A 1UBRS 2OXRA 4TQGA 4LKOA 3IVCA 3B2NA 2XEXA 3ZWQA 3M3PA 4EVSA 3BX1A 3S7TA 3SAJA 4B34A 3HGTA 2KQUA 3TIIA 2HLDA 3PS9A 1GZ6A 2O1WA 4ZN6A 1ZI9A 3HB1A 1XDDA 1LPAB 3JTMA 4ADSG 5AI4A 5DCLA 1C1YA 1P45A 4ALIA 1KYVA 2Z9CA 4ZI7B 3N2IA 2IHTA 3BGIA 1YMUA 4A9AA 3LYUA 1MHTA 2ZJ5A 1R9MA 2YVLA 2NO5A 3HDQA 4Q16A 1Y7PA 1FPMA 3A4NA 2E1RA 1U1CA 4ZQIA 3REOA 3ZDYB 5IBPA 4NYIR 4LY9A 2HF8A 4X91A 5DCYA 4J0JA 5KCZA 5I3CA 3D4OA 2DE0X 3RTDA 1UT8A 3T5TA 4AMBA 3RJ9A 1C3OA 1XEAA 2OYRA 3Q0TA 1AO3A 3GJ8A 2J07A 1Z5OA 5CLGA 4TUYB 2J3MA 4KDEA 1GM5A 3JD3A 1JI0A 3VO1A 4UULA 2WV9A 1JMYA 5JZ9A 2Y1OA 3TR5A 4H08A 1NXVA 1HTBA 1RQPA 4UVHA 3CG4A 2F3UA 2V7VA 2VWGA 5LDHA 5HM6A 3O8OB 3EXHC 4H27A 4YUVA 1LD3A 1YE8A 3JQRA 3TX6A 1HLPA 3CINA 2JFUA 1OREA 4QVIA 4UFPA 1JXLA 2N46A 1GPBA 4B2YA 5LU9A 2P4EA 2JAWA 2DUNA 3PGXA 3OKAA 2TMDA 4D45A 4NYEA 1SXJA 5F1OA 1PT9A 2X15A 3M81A 1FY2A 1P1BA 2P9TA 1P74A 1XTVA 1LBTA 4RK1A 5AKXA 2ZYRA 4RL6A 4NV1A 1E9AA 2O4UX 1ZONA 3HRKA 4TSRA 2NV6A 5JXHA 2J4DA 2JKYA 3KHKA 4ZJZA 1L4EA 3LQYA 5AKYA 1PZEA 4R1TA 3T41A 3FFBA 3LE8A 3D5TA 1W1WA 3HA2A 4AS3A 4POAA 1HNXB 5JO9A 4I50F 1UMDB 1PGOA 2W6OA 1F8XA 4FXPA 2ET6A 2Z3ZA 2C9MA 1BXRB 4S1OA 5KFTA 4RJ2A 1X7WA 1N9ZA 3VTAA 1ZGZA 2CV2A 1W4BA 3NRJA 5KVCA 1WV1A 1X19A 1B14A 3OKFA 2F43B 5E9AA 2QROA 3LY7A 3BAAA 1DXYA 1R0YA 2P5SA 2W37A 4HZUB 4D3XA 2FXVA 2FR0A 1PI3A 4B4OA 3GTMA 2FFQA 1NSTA 2P9JA 2ILTA 1JB9A 2NO0A 1YDEA 4J1SA 1H05A 3L1HA 3W2HA 1S7GA 5JECA 3HOVG 3LY9A 3L93A 3PPXA 2AF3C 1QOQB 3L6CA 1SD1A 4QUEA 3MIZA 1M2GA 2YVKA 1C9MA 4RKYA 2YJ3A 1GAXA 4TM8A 3CPHA 2CF5A 2C2DA 3DMDA 2J46A 4ISBA 1JI3A 4GYJA 1CXZA 2VATA 1FW6A 3QX8A 1DRKA 2XUAA 1E9EA 4YRJA 2XEDA 2GKOA 4BX0A 3H2SA 3P9SA 1WHTA 3PEUA 1HTTA 5AW2A 4DLAA 4KR7A 3TW8A 4BU0A 4OQQA 3SP1A 4M8SA 1R9TA 2C1XA 2C78A 4P22A 3ROMA 3DZFA 4Y30A 1L4BA 4OV6B 5HDBB 4BO5A 2O2DA 3AGPA 1TPYA 2IUTA 1VLHA 2AZXA 1BIFA 1TX4B 1T36B 2XTZA 3EC1A 4O3OA 4EPVA 3VKUA 1RI4A 1BQ3A 4C0BA 3U16A 4PBCA 2NXJA 2WHRA 5K4HA 5KHLB 2JD1A 4MKFA 1L5HA 2HRZA 2X1LA 1TLTA 1Z6AA 4GBJA 1B43A 3L1VA 4X8OA 4TVOA 1O6ZA 4CLEA 4DLXA 4G26A 5T8KC 4KAXA 1P7WA 2HSWA 5KVSA 5CDTA 4MA5A 3GH1A 1NW4A 4PRZA 2RH9B 2OC4A 4PYIA 1HDIA 2D1YA 4ZVNA 1OFHA 1JDVA 2CJPA 2VYNA 1NQ5A 3IPRA 3KXLA 3R3ZA 1J39A 2XHZA 3I6ZA 3QUQA 3U7IA 5B58C 1R5NA 3OQNA 3BMCB 3KEOA 3DMHA 2N75A 4EFDA 2HVRA 1ZSYA 4EENA 4EHIA 4Q1AA 1LBIA 1V7ZA 1ILWA 5EJEA 1P6QA 2GRJA 1HO3A 3P0EA 3KWFA 5B58T 5AJYA 5AMXA 2ZJ7A 3EPPA 1OJ7A 5EE5B 1S8AA 3GGCA 3GZNB 2CBZA 3CVWA 5G40A 4MH0R 3AZQA 2G0NA 1AXEA 4MQFA 3DV0B 2FUCA 3DXFA 4WZBA 4QATA 3HYNA 1Z4KA 2I22A 3PHGA 4OHCA 4B3TH 2IEBA 2CFRA 3PQFA 4MCAA 3O8RA 4QYMA 4PYOA 3KX2A 2W2NA 1ACJA 2HSZA 4ZANA 4ED0A 4AAYA 4C7KA 3DHVA 4B87A 1DEHA 4Q7EA 2CLMB 3ENNA 4W9NC 4RIGA 3O0TA 1JG2A 4HPWA 3RLIA 2MTBA 1KI9A 1L5YA 2DFPA 3CVVA 8MHTA 5FL7D 5J40A 3BZWA 3PDHA 4K6GA 3MGGA 3BD6A 1DAPA 3E4CA 5EQJB 2E6KA 3G02A 4O3QA 5GINE 4Z53A 3JZFA 5EG5A 4M4SA 3OSUA 4F6LA 4W1RA 3WNVA 3TIVA 2YZMA 1FP4B 3IP8A 2J4CA 2DIKA 2QX8A 2X9VA 3STVA 3WBJA 1ZNQO 1E6CA 2FG7C 5B7NA 1VG1A 5AM5A 4CQLA 3EIQA 3VISA 3L7CA 2DERA 1L4YA 3LX6A 3IAAA 4MTDA 2A4MA 4CLRB 2HHLA 5J1SB 5HIKA 2HH9A 1HWYA 5H5JA 4BNVA 3ZCRA 1XFDA 3B9BA 1JR2A 3FETA 4N49A 5REQB 4BAUA 2W6JD 3KYBA 1U11A 4RHTA 1XPRA 4D4KA 4JYCA 3K1YA 3I9FA 1EQ2A 2WFLB 4NC9A 3LDGA 2IHVA 1VFNA 3DYBA 3GARA 4R0VA 2KWIA 4DAOA 2PCLA 3KB2A 3THWB 1NVMB 3PNBA 1I3LA 3KAQA 1J5EH 1Y3CE 5FOWA 2XKKA 3KR0A 4BN5A 1FXSA 4MEJA 1WULS 5KT6A 3KP1A 1ZH2A 2KSQA 3S1AA 1TD9A 2PS0A 2QTMA 1UH5A 3MWLA 2VCEA 1MUUA 3FSJX 2VOJA 2GJKA 3HUFA 3DZJA 3QEMA 3I8OA 3STTA 1B3BA 2VQFB 4OFWA 5AVZA 2WHEA 1J8MF 4AT1A 3DPIA 2PFGA 1HK7A 5DGBA 1MIHA 2NW6A 4Q1DA 2GZDA 4FONA 1L5RA 4F3YA 4ZC8A 4PWZA 2HU5A 2CB0A 2F1JA 1EZZA 1D09A 2X8LA 4MVJD 2QY6A 3OETA 1O1YA 1PFKA 4WEQA 1ET0A 1MV5A 3VZBA 4M1QA 1MAUA 3G2HA 4PLZA 3C3EA 1QHFA 3GJYA 2BKLA 3FHJA 4H0NA 1USUA 5FPPA 4PQRA 2YHAA 3KJHA 3FMOB 3TZEA 3A1VA 4JP3A 5C1PA 5L3SA 5CB6A 3K0FA 1NU8A 2A9OA 3A05A 1QQ5A 3HH8A 3BHNA 3GRKA 3WFJA 2GSWA 3EOAI 3RFFA 1A77A 4Q7QA 3W04A 4JB0A 2GZRA 3U0GA 2V98A 1MDFA 4PC1A 1P91A 1H0SA 4XD2A 4WBNB 4AJKA 3RGZA 2XIQA 4Z7NB 3JQ9C 4NFHA 3JYQA 4BWSC 2KE5A 1D0VA 2PGNA 3L7IA 3LDFA 4QBHA 1IEWA 2E85A 3R5TA 3QSGA 5IDVA 1QHYA 3SQDA 4O0LA 2B36A 3F7OA 2VPSA 3LO8A 1QRSA 4FQ5A 1E69A 3PEYA 3CZMA 3KEGA 1FEZA 2F00A 5C52B 1PJLA 1Z33A 3BMXA 1DC8A 1BD4A 1Q12A 5AK6A 5A5GA 2WWWA 4YECA 4ZCMA 4MJLA 1FNDA 1IRXA 1JDZA 2ZE5A 3R2JA 3SX0A 2ZGIA 4JLMA 4N65A 4CKWA 3KE8A 5LCXA 1G0OA 5GJVC 2OBNA 1CULC 3N0RA 4WCVA 1JGTA 4PC3A 3LUDA 2H11A 2CDBA 2YCHA 4K9OA 4EZBA 1RACA 3H87A 5KYWA 4B33A 1ND6A 3MHTA 2O05A 3UMRA 2X0DA 4HEA6 2WD9A 1P3JA 3GEEA 3L7YA 4BLSA 3ZHSA 4OXXA 1IHPA 1IN1A 2DBZA 3RUDA 2BGMA 2P91A 4DTIA 5DHTA 1T3HA 1H2YA 1U2DA 1QMPA 3ISVA 3GW8A 4MVXA 4F96A 2HLDD 5KOIA 1B0PA 4IHQA 4R40A 2WJJA 4NCXA 4WECA 2O57A 1A9TA 4G5HA 4GZ3A 1BFDA 4LTNA 1E2QA 2ZJ0A 3DAGA 3GNTA 1KDTA 4CQJA 1YJXA 4NZPA 1JWBB 2I6GA 1OW3B 1U2SA 1TPZA 3WS7A 1TC1A 3EGWA 4GR5A 2NO4A 4ZTZB 2QN3A 4G9BA 4MUNA 4IIFA 5EP4A 4CV0A 2FHPA 4RAOA 1G7RA 5CYPA 2E4AA 3E6AA 2C2RA 4D9FA 5GM1A 1KI6B 2EKQA 1G3IA 1OA0A 1CZRA 9ATCA 2CHEA 5FD8A 2GILA 2VL7A 1K7SN 3QU7A 2ZT8A 1WLSA 4K0KB 4JXXA 1UBSB 2CUNA 4AKIA 4D4LA 1HNZB 1GPKA 1NHWA 4D56A 1P6UA 1SUCA 2JBAB 8LDHA 3ZD6A 3VJRA 3TO5A 2LR0A 1SPXA 2Q7XA 5B5SA 1UPTA 1YDWA 1QGUB 4K9PA 4WLVA 1S3IA 4V0MA 3A4MA 2AGQA 4BAZA 4CMKA 4RMJA 3MQ2A 2CHQA 3QMMA 1GZSA 1YL6A 3HBJA 4RORA 5FPYA 3GJ7A 3Q3EA 3PHHA 3N53A 2FPLA 4MKGA 1JPUA 4KE6A 3WRWA 3LUFA 1RJ9A 1MTOA 3E18A 1JG4A 2WKWA 4UHDA 3OLQA 3G2NA 4PLVA 3HVHA 4MR9B 8ADHA 1VHTA 3KKZA 3EHEA 4MR8A 3Q8PB 1V37A 3UF0A 5KJFA 2IIVA 3ESQA 2W7OA 5LB2A 5AJTA 4BB9A 4CL0A 1U7ZA 5AHOA 2PRYA 1PF7E 4JJGA 3ZGXA 1E7WA 3NRCA 2WUGA 2X40A 4QC2A 2ZI4A 1QP7A 3STHA 1NWCA 1L7OA 1QRUA 4MRPA 2I29A 3D3KA 2A2ZA 2PWZA 4F2WA 4N6GA 3IDZA 4D9EA 4HMQA 4OB6A 1WZNA 1L7PA 5HMLA 1RYZA 3SVLA 4MIOA 3BTUA 4MITA 4GEGA 1O2DA 4MKXA 4O4JB 1QYIA 1EKPA 3E7XA 2RFLA 4MULA 3KHUA 2WIBA 5KEIA 2JFXA 5JD3A 4KOEC 2G76A 4M9ZA 5ICSA 4G1EB 3GIDA 4BFZA 4CKEB 3KD2A 5FBHA 4WESA 4LRWA 4PC7A 1KJJA 1BW9A 4F5YA 2MT9A 1P5RA 3W9SA 2VRCA 1ZVKA 5IXJA 1ILEA 1HRDA 1OIVA 3OAAD 5TVGA 1UWVA 1XEWX 3AP2A 1JPVA 1NQOA 3A04A 1RRPA 4BGVA 2J5RA 3AY3A 4ETMA 4FIZA 4CN9A 3WMWA 3DHWC 2Y4NA 3VSAA 5IVIA 1THGA 4GR4A 5LD2B 1R8JA 1VPTA 2ONJA 4MW6A 2XUPA 3SNOA 1KY5A 1OLXB 4LHWA 2IY9A 2HO4A 3ORHA 4EKEA 1P0QA 4X7RA 3TZLA 3RG8A 1PTKA 2D1TA 4IHAA 4PE5B 1OBGA 2VHZA 2EX1A 4LV8B 2OHHA 3KQOA 3S2UA 1IHUA 4TMTA 4V2IA 3DVRX 1UBEA 4Q3BA 1V43A 3TEJA 3FUTA 3D7RA 4CVNA 4HWPA 3X2EA 2M6KA 1R15A 2O7QA 4YCAA 2FSGA 1JR3D 4EATA 1S6YA 1Q7CA 1XAJA 4BUJA 3CWQA 2FUNB 1TJ3A 1ZINA 3T1VA 3P0HA 5I51A 3R3JA 3ZHRA 1VG0B 3KEQA 2CXHA 3A9UA 1NY5A 1J2YA 4EPRA 1DJQA 4PZPA 1ICIA 2VBFA 1LK5A 3P2OA 3L3BA 3B48A 1E2KA 5KJEA 1R10A 4V02A 4LZPA 3RF7A 1ZISA 4PFSA 1ZAYA 2C4TA 4LOLA 3ZE6A 1ZM7A 1N33B 2OBMA 2NSHA 3KTDA 3H7IA 4YHBA 4NZMA 5B2EA 3EUWA 1CE8A 1HLDA 4PWQA 4IBOA 1FSZA 4JCCA 5FX2A 2C97A 2ZAYA 3T1NA 2C1EA 3WBKA 2UZ0A 4B75A 1OXSC 2EP7A 3L6UA 2VRBA 1NU6A 3H16A 5G2OA 2J0UB 3H5AA 5C4GB 3GXOA 2YIMA 3H5LA 2R00C 5LUBA 1NXTA 2QVYX 5GPBA 5IZ4A 4PSDA 4JUZA 2OFXA 4QLBA 2CFMA 4E5SA 4YN3A 2NUPB 4ZI5A 5KJCA 3H0EA 3I28A 3TUZC 2GXUA 1IN5A 4ND6A 1DAHA 5LFAA 2A94A 1UP7A 4BEVA 3Q8WA 2GF0A 4MVJM 2NU7B 2MSNA 2PZJA 1D4FA 3NDBB 3I76A 5GONA 2ZRPA 1NXOA 1SIWA 3PJDA 1W0JD 2AIRA 4Z1MA 5LMCA 4KK3A 3Q8RB 3KV3O 1MV8A 1P1RA 1OB5A 4FCVA 4M46A 1MOZA 2BFEA 1EINA 4KLRA 1JEOA 3TDNA 3NB0A 2AN5A 1P1KA 3MRSA 2B9VA 2XCAA 5JADA 1NDUA 1HDCA 1YKFA 3GLFB 5JZVA 1JSCA 3UCFA 1T94A 3HU5A 1GFWA 4H7JA 1Z08A 1TMGE 3S2ZA 4LOAA 1KAGA 4OAQA 4ENVA 3MINA 5B4UA 3KFXA 4GC6A 5A03A 1THZA 2JVIA 2RD2A 1CVLA 5EXDA 1QV9A 3GWZA 1XRQA 3RTCA 3O4RA 3A6LA 2Y93A 3PQ2A 4YPOA 3E0QA 4WK0B 4CC5A 4Q4HA 1W36B 5CFQA 4GOKA 1I3MA 5IABA 4N7JA 1ZGCA 4O2RA 4XEUA 4IDEA 4KN8A 3IP5A 4CC6A 1I9GA 2LXNA 5FPRA 1CKOA 5CLHA 3V6KA 1DZ3A 1N6IA 2D54A 2C42A 1I1LA 1ADFA 2YXDA 2PZFA 4PX5A 2JI8A 2QZ4A 3RJ0A 5T4BA 1W59A 3PPIA 1D4ZA 3R1IA 4NHEA 5DVZA 1P2GA 5F7OA 3PUVA 3D3EA 3FWPA 3O4JA 1KBOA 1CLUA 4R3WA 1IJEA 4MIEA 4OJQA 4F2GA 3FTQA 3PR4A 4O33A 1C50A 4IL5A 4GOXA 3DGEC 4RD1A 2WVGA 1EWVA 3FF4A 5D1NA 1W2GA 3H18A 3SZRA 3WLTA 4O8ZA 4NXNH 1PZHA 1IAQA 1PIWA 4A82A 5B3LA 2BISA 3M6VA 4MZXA 4DT1A 3ONFA 3GRFA 1NI5A 3PDIB 3K0CA 3P96A 2EGUA 2C96A 1XD2A 4J0IA 1TA0A 3AVQA 2C2YA 4V03A 2FUG6 4AUMA 3ZV6A 2OC9A 1KZGB 4GPTA 1CCWA 5CT8A 3W1EA 4JUAA 1H0RA 4R6XA 1OLUB 4WERA 4DMCA 4BTEA 2WAYA 3W5AA 4DL5A 2Q45A 4NF2A 2CNUA 1Z83A 5KSWB 3BYZA 2B61A 3DUFB 2G3YA 4DYDA 2JCXA 3U7RA 2JLUA 2QU7A 5NLLA 2RGGA 2WF7A 1SBYA 1Y6GA 3TD6A 1T6NA 1PFGA 4UQPA 1KGDA 1ZSVA 4A27A 5KFXA 1C9NA 4ZARA 1JJBA 1TECE 2RCNA 5HJ2A 4OF4A 3QUSA 1UPCA 2IBKA 4I55B 2HC9A 4BMDA 1M73E 4J9RA 3UH1A 1X1EA 4OG2A 1ODTC 1F8GA 3Q1LA 4HGPA 2IPLA 1W47A 1ZQ7A 3KQNA 2P9QA 4G89A 3DTVA 3KDSE 2W6NA 5G1PA 1G8GA 3UMJA 2L2QA 2OSBA 3VVBA 1E5DA 4O82A 3TAXA 3UENA 4OBXA 1PSWA 3FIUA 2CW8A 3A27A 1NF3A 3K94A 3NATA 3PIIA 2VHXA 2MDTA 3UPDA 4RWEA 3VYRB 1JT9A 4KQWA 5EFZA 3MUFA 1AZTA 2DKFA 3QPVA 4JK3A 4XEHA 4PDBA 3GP8A 2G4VA 4C20A 5F4BA 4D8XA 3U7HB 4QQKA 4C6TA 2PRSA 2FPSA 3Q9LA 2FRVA 4KPFC 5JVLA 1U2EA 2QDXA 4D3ZA 2HK9A 1Q0UA 1CEYA 4COKA 4Y0VA 4B9AA 3SSMA 2R79A 3DEKA 1M6VB 1I2KA 5GM2A 1JSLA 5FO0A 4H7HA 3U9LA 4HDAA 2P77A 1MHPA 3DLAA 1XRMA 5ED0A 1X38A 5L95A 5B3AA 2O0HA 4AB1A 2Q6VA 2VT3A 3OBBA 2ZU0C 1DTWB 2DR3A 3L6RA 2JKZA 3AHJA 4MW4A 5EJ8A 1EFVB 4DZZA 1KOFA 4EB6B 1IC6A 4UM9B 3NIDB 2Y1FA 1N1EA 3VJKA 2EKDA 4O7NA 3PICA 5IAJA 2HF7A 4OX9Y 4NBRA 3U3JA 3RE1A 1P1FA 2FPRA 2NYVA 3A1UA 3EVAA 4BECA 4DA8A 4C0WA 3M8KA 4ZOQI 4EEXA 5DLGA 1DSSG 2JCGA 2RBEA 1OLSA 3ORQA 4DUGD 1PLJA 2E2WA 4YREA 4NDAA 1K0UA 1U0NA 2P1ZA 5DXJA 3LKVA 3VYTB 3WAJA 1P6XA 4RXUA 2CXPA 4KYUA 4JOQA 4O3FA 5J59A 1X80A 2YQZA 1W4AA 1T2UA 2PRZA 2UXCB 4J0QA 5A7FA 1GN8A 2J7KA 5MDHA 3DVAA 4F3CA 1H93A 4KX3A 3PB3A 3IA7A 3FWYA 4PYQA 4K3VA 3EEIA 3HVJA 2PRKA 3T94A 3Q2KA 4F1KA 1NG9A 4K6CA 5EMMA 2YYYA 4ZI2A 5TEWA 1G0NA 2BSAA 3D3JA 7REQB 2KJQA 5CVUA 3BXEA 1VJGA 3N2NA 2ZDGA 1T9KA 3T3PB 4OHKA 2GPSA 4DR4B 3OOEA 4GYKA 2I1WA 2X19A 3OSNA 1GYRA 1R6XA 4HK4A 2JH3A 4MI9A 4JR1A 1VBFA 5E1DA 1SOUA 4GI5A 3GJ0A 2P8SA 4WUTA 4UHHA 1W76A 2B0CA 5CB4B 4R8MA 3HUEA 3W5JA 1LBSA 1OX4A 2R1TA 4Y6LA 2J9XB 3RTAA 5CR5A 2ZBEA 3BS4A 5IYCG 4RTLA 4UCWA 2YIJA 5K6RA 2ODAA 5AKKA 3TI7A 3HKCB 5GWXA 4JR0A 4PFQA 3T7SA 2IEYA 4ARZB 1KXJA 2ZE7A 2GZSA 3JVVA 3T3GA 5BN1A 1C3VA 3AM5A 5I7WA 5IFKA 2I65A 3K1JA 5HKOA 2Q3LA 2QRLA 1W85B 4M7WA 1SULA 2HV9A 3ESCA 5MFPA 1AGNA 5T7BA 5MN5A 3I30X 5FUBA 3VHXA 3DOOA 1J70A 3WLMA 3BJYA 2XLCA 4MS1A 2HK6A 1CSEE 1TM7E 1SKQA 3CO0S 1CDOA 2WAXA 3V33A 1QZZA 2QMYA 4UCXA 2YNMA 5KFLA 1PWEA 4TV9F 4HWOA 1P0CA 2BMDA 3BDAA 1I7QB 1UJ6A 2PLNA 8ATCA 2WM3A 3MS4A 1F1JA 4IW3B 4P7FA 4ND4A 2FEXA 1IU9A 4J7CA 1D7OA 5KKAA 1QZUA 4Q7JB 2G5GX 1ZGGA 4DXDA 4BRSA 3G68A 3T7RA 3L0DA 3GTOA 2QQ0A 4CYMA 1MAHA 2VZ0A 4QBTA 4I7HA 4BP1A 1KOGA 1VG8A 1EJ0A 4CCYA 4JYAB 1T9GR 2RHGB 4DVJA 4LC9A 2IQ5A 2UZ4A 2FMTA 2G67A 4FD3A 2FQXA 4C7XA 1A82A 2FF7A 1NOJA 5U9CA 5JAHA 5ALPA 2TMYA 2NVUB 3VSEA 3ZLVA 4XD7D 3OZCA 1K8YB 1YRWA 2GJ8A 4N7BA 1ZMOA 5IN5A 1DBVO 4HYEA 4DMKA 5L53A 4XJVA 4IJKA 2Z2KA 3SJ7A 2D4HA 1YCFA 2BFCB 4BUZA 1XYYA 4KSCA 1Z62A 2JB9A 3PR1A 3IAS6 4ZV9A 5K5EA 3W2GA 4C30A 3SKXA 2AHRA 1O5IA 1JR3E 1GYFA 1KK3A 1HA3A 1U98A 3VKVA 2BBWA 1E9CA 4MRMA 5IAKA 2FPGA 3WE7A 4LQLA 4DWJA 1CDDA 4P2BA 4II2A 4P83A 1BQ4A 1AS3A 5KYTA 2YZGA 2XMBA 3MUOA 1J00A 3GJRA 3HO6A 1KMQA 1TCVA 2EARA 3LUAA 1KI8A 3IR5A 3ZU6A 1M2OB 2JJ8A 2QENA 5AVSA 1Z34A 4LCEA 4DDVA 4C04A 2PUCA 1N34B 4JI4B 3SQWA 3HPQA 3PC8A 5C7YA 4MV8A 3ECCA 4E94A 1DFGA 4PZ9A 5DK4A 1GTL1 4Q3AA 1YB1A 1ODSA 4JQOA 1NN1A 4X6UA 1UFVA 1M8FA 1K4YA 4L6CA 1XDZA 1PP4A 3FZEA 1UXHA 1MTZA 4NJEA 1XD9A 4WWHA 1VB5A 3UGJA 4Y9TA 1HL7A 4V3CA 4D3FA 2VUHB 2ZS9A 4HS9A 4DKJA 4ECXA 4DBZA 3ICOA 2OA0A 3FVQA 2RHBA 1WBJB 2WAAA 3JR3A 2CCKA 3NNNA 4JV5B 2OCKA 2HV8A 4INJA 2DCUA 5I9BA 4P7GA 4YCMA 3OY2A 2BEWA 4N5DA 1TO6A 3VR5A 3BTVA 5TIIA 3VR5H 4K2HA 3ILYA 2IC5A 3W3ZB 4QW8A 4YLGA 5HSGA 5AXCA 3RVJA 3LL4A 3PJGA 2G1KA 3LC2O 2J6UA 1MF7A 4UM5A 2BONA 3UPUA 1QF6A 1YQDA 3W2IA 2ABJA 2ISCA 2Z5FA 5LNK1 5EKSA 1BO6A 1CV2A 1VQ1A 5D01A 3WK5A 5CFNA 3BRQA 1CY0A 2QRMA 2HBRA 1P8AA 4E3ZA 2B6HA 5LA6F 3ONNA 4KQEA 5IJ9B 2AD1A 4FX2A 4XDYA 3ICPA 4ENTA 3C8ZA 2NX2A 1EGHA 3UGQA 3UWMA 1JHXA 2Q49A 3ED5A 4MKHA 4I50A 2GCNA 5DNEA 4DR7H 1C7FA 1LUAA 4G8JA 1OXUA 4E88A 1FS4A 3SBXA 3GVXA 2AN3A 2D13A 1RD4A 1Q57A 4UPDA 4OK6A 5JNLA 4JP5A 1KNQA 1ZC4A 4NCHA 1DG3A 4BYMA 4JB8A 4U4AA 3VJMA 4LTMA 2W5UA 4PG5A 4Y9DA 5CDFE 3U39A 1BMDA 3N6VA 2YUTA 4J6EA 2W7TA 2CVZA 4C0JA 2P2LA 2H0QA 2WBLC 2CSUA 3HJBA 2JFPA 1X2EA 2G77B 1TMYA 1Q0HA 3WIVA 2QTGA 3GT0A 1KAQA 3JRNA 4ZAVA 3UJ6A 1ZH8A 3ZU2A 1JF8A 3C3MA 3Q8MA 4O5OA 5B7QA 2PLWA 1JL3A 1YE5A 4Y8VA 1ECPA 3Q3JB 4GOOD 2HUNA 4LYGA 3LGAA 1JN0A 3V1UA 1F2UB 4C0HA 3TXAA 3OH8A 5IT4A 3RSFA 3I53A 2BMJA 2CNLA 1IZZA 1S8OA 5DXFA 3VA7A 4A2QA 5BUCA 1KP3A 2O7NA 2WFAA 3ZDRA 5ITZB 4LC1A 1N32B 2XVMA 4BKPA 3AF2A 5DP2A 3CLKA 2C5AA 3OO0A 4EO9A 4TZTA 1TM1E 1L7AA 3KG2A 4QBKA 2PGIA 3I2HA 4ML3A 4BFLA 4MYCA 4Y6RA 1A27A 3RVLA 4N7MA 5JWHA 4NE2A 4BXOB 4ZO9A 5KFQA 3JAWB 5JCJA 3PQ5A 4Z3KA 2XMGA 1GAJA 3GAZA 1RWPA 4LUCA 4M7PA 4ENPA 4K5QA 2AOTB 2P9BA 4MRAA 3ZDQA 5GQSA 4BMSA 1R0XA 2QUZA 3KB6A 1FJGH 1EEHA 3ZTWA 3DW1X 3H83A 1QWOA 4CT4B 1E4VA 5TQ0A 4ED8A 2BM0A 2P79A 4IRUB 5BWMA 2XVXA 4R1OA 5ILQA 4GMHA 4PU0A 2CLKB 1EXDA 3I6IA 1WXDA 4J94A 4B47A 4B5KA 3ZOKA 1EZ1A 4DSNA 5J2TB 2GLTA 4I9FA 4NLGA 3Q72A 1NIPA 1J2RA 3V2UA 1Z82A 1U8AA 1CZKA 1VTKA 1WL8A 4MUHA 2W93A 2AG0A 4RU1A 4EJSA 4CNQA 2INGX 4L5CA 2VQ6A 5HW0A 3SJUA 2G5TA 5C4MA 3AVVA 1NPDA 3VTFA 5CG2A 3AIMA 5JRJA 2D2FA 2WV7A 4HP8A 1DRVA 3KOMA 3VSDA 4HVAA 4KGZA 3AF4A 3TOXA 3IH5A 5LIPA 4OX9H 4Z9FA 1R4NA 1C4XA 1I4EB 1QXSA 3NBYB 5HE8A 5H82A 3L8ZA 2A7QA 1RVV1 3H2KA 3CX4A 2NPOA 3JQ7A 5C51B 3QU4A 3PWZA 4BMOB 3KIPA 1GGNA 4BVJA 1UQUA 4MYHA 3G5UA 2D8MA 5KBYA 1P4SA 4KV9A 1BFUA 4OHOA 4ZEWA 2C5SA 5AHXA 1ZCFA 4HBGA 1T25A 4DYHA 5DTMA 4FCTA 2B1JA 3AIKA 3SIWA 2R6HA 2VNJA 4A1OA 4FMCB 4P58A 6ADHA 3ED1A 4F7WA 2YW2A 1HR0H 4DNXA 2B78A 3OD5A 4ZZ2A 1V9CA 1FVFA 1XR3A 3U4GA 2OMKA 1CRPA 1M9NA 1FZQA 3WKEA 1ZJYA 1V1MA 2XWSA 2GN9A 5D1OA 3H2ZA 1RJWA 3DM5A 1H6BA 1PX2A 3ME5A 3Q9SA 1XN4A 2OLEA 1J0DA 3RVQA 1RPTA 3S5UA 1X70A 2ZJ2A 3X3HA 4RGQA 4K6HA 5A6SA 1T9DA 4ARSA 2JHGA 1GRVA 4YASA 4L8LA 4BJ5A 5BUQA 3WFIA 2XKBA 3PHCA 1ISSA 1XEXA 1GTRA 4RDXA 1KWKA 3NS7A 3FOCA 1Z7YA 1OTYA 5KYYA 4RV5A 4X1IB 3C7AA 1KE1A 5AOVA 3H0CA 2W42A 3SOPA 4WBXC 4OXNA 1US8A 2Q29A 2XNJA 4I5GA 3RRZA 5K3FB 3I73A 4W5NA 3BA6A 4J16A 2J45A 1Z39A 4HRXA 2HY7A 1TQDA 1G6OA 4N0DA 4PQFA 1KQFA 5HF5A 3HOYG 2QM3A 1W581 3GLHA 4J8PA 1U2GA 3M7IA 1KC7A 2C9BA 1T4CB 3PC6A 2VDWA 1TTHA 3FSGA 2DR2A 1MABA 3PBKA 1X6VA 4BLTA 5KG5A 4B7AA 4BFVA 3QLUA 3BFPA 2K6GA 3R9XA 1DKQA 4KFTA 3O2SB 2PNJA 4B7CA 4G6ZA 1D07A 1G9XA 4V0ME 3T3MB 3GT4A 3EGDB 5KYXB 2QB5A 1Y89A 3DE6X 1OAAA 1VYUA 2QTFA 5FT9A 2POQX 4G2TA 1PVOA 5DHSA 4MUGA 4XVRA 2QJOA 4WV3A 3RVOA 1B8PA 3O1LA 2FZCA 3EIUA 1EFKA 4C5BA 5BQFA 5EJFA 2EFGA 3WC4A 1FU7A 1U1EA 3HJGA 3RR2A 2VK1A 3D4LA 1EGMB 3A06A 1MLDA 1LI4A 4L27A 3PW2A 2ATXA 2ODNA 3B70A 4WT7A 1GG8A 4OMCA 1EP9A 1OWPA 3TQOA 1ZJ6A 4ZIRA 2HLPA 2F8SA 4JI6B 4WRRA 2YWBA 1XNQH 1Z06A 1T9BA 1EE1A 5FAXA 1Z5ZA 4JSYA 3ZXSA 1LSOA 2I4OA 2G7MC 2PL9A 1UXIA 3SS8A 2ZUFA 5DG9A 1VE1A 4ARIA 4IOMA 3SXUB 4B3XA 3C1UA 2O14A 1RYRA 2GWHA 5C7LO 2WJ6A 3ZLJA 2N0SA 4QW9A 2YR0A 1YHNA 3BE4A 3RRFA 2BR3A 1UINA 5LYYA 3VVLA 2I33A 2DCMA 4CF6A 4J0CA 3P45A 4G09A 1UBCA 1Y5IA 5L7TA 3DL7A 3KZOA 3UC5A 3JU3A 1WY5A 4E4YA 4KREA 4DEYA 3X44A 3NBMA 2VIIA 1D6JA 3LQ2A 4FFWA 4FLFA 2O6LA 5I9SA 5EJ7A 1RCUA 1YIOA 1CKEA 3R7DA 1E3MA 2YRFA 2A6PA 4L16A 2PMKA 2O3QA 5EFOA 2WTAA 1Q6YA 4X0EA 1YCHA 2R96A 4N48A 4Q1BA 4R1LA 3DULA 2AKEA 3CZRA 3HC7A 1NUSA 5KTMA 1ECBA 1EIWA 4PCLA 4ZU3A 2Q9CA 4ZOLB 1HNNA 1N92A 3TWOA 4JKOA 1AV7A 4X62H 4Z49A 1F8FA 1U7TA 1P4HA 3LSYA 1VKJA 3LK7A 3WLEA 4QODA 4OSOA 4G5OA 1RI1A 1AD2A 3ELWA 2SKCA 2CLIB 4RVOA 2Z30A 1G3MA 1ZUNA 2AFIB 4E33A 1WCWA 1D04A 4ON9A 2XDQB 4MUKA 3C1OA 2P67A 1C8BA 5KS2A 3VVCA 3I62A 2Y77A 2WWVD 3MMNA 4I7EA 2BE9A 1TUBA 1QYCA 2WWGA 1GV1A 4H0CA 1CUIA 1JG1A 2Z2ZA 2UVUA 1MB9A 3UEOA 4E15A 3O4FA 3GRCA 4RE5A 1SBQA 2CY0A 3LBIA 4ZP1A 3PXDA 4D8VA 1KKUA 1L5FA 4ZYXA 2HXYA 4DSZA 4FHZA 4JXKA 3HUTA 2H5JA 5FFFA 4JT8A 2C3YA 5FUYA 4HRVA 3BQ0A 1G16A 3ICCA 4MUBA 3OG9A 4DR2B 1DO0A 2Y68A 4POOA 1Y4AE 1EVQA 3IC5A 1IAVA 4IQFA 3TR0A 1FQOA 3HQ4O 2Q3JA 2GTPA 2DPIA 1YCGA 1OWNA 3TDKA 3EPRA 2JFNA 5KTOA 2W4QA 3ZBPA 2V7XA 2NIPA 5EY5B 5EWMB 3F78A 1J21A 1GXSA 3Q7PA 4MLDA 4DV4B 5DNDA 4WGGA 4E2XA 2MSLA 2AV6A 1T2NA 1ODCA 3GV5B 1HOTA 2DHEA 1DLJA 5D3MB 3SC4A 2ODPA 1M8KA 3PWSA 2BFMA 2VAXA 5FI1B 4V39A 1S68A 1YDHA 5CAEB 4EPYA 3HSKA 4DV2H 4M0EA 1K6XA 2CFCA 3Q3CA 2Y8EA 3ILVA 1DV1A 5C34B 1C9YA 2I8LA 1KU6A 1PG0A 1SQGA 2B1IA 4BWVA 1AB5A 3IL2A 2VJDA 1GQRA 1C8VB 3ZIUA 1RQGA 2PLAA 1QC5A 3GGOA 4GSYA 4QGFA 2Q27A 1L2ZA 4BNFA 3C3PA 3L4KA 3SZ3A 1ZM3A 1T0UA 4JX9A 1XU7A 3M6WA 4RLQA 1O97D 4RVFA 2BDUA 4YRMA 3ERCA 3WO0A 5K3SA 1NBEA 2XUDA 3BB3A 3L7DA 2W9BA 2WSYB 5HEKA 3A14A 5K3WA 5IZCA 4HDOB 3A9SA 1ZBQA 1T5HX 3FOAA 4PAQA 2NXWA 3JWEA 2ZYAA 3C8HA 4XIFA 4DM4A 4RHXA 4QQFA 2IP1A 1ZCZA 3IODA 3KJNA 2C5FA 4X1OA 1W8DA 1C9JA 1SVKA 2O48X 2PUVA 1IUPA 3K9HA 3KOYA 2IBTA 4IEEA 4II3A 2DHRA 3ZWMA 3LT2A 2A8YA 2JHAA 1IZ8A 2DPLA 3H99A 2O4CA 1R50A 5J4HA 3EOZA 4I1IA 3J81W 3WHKA 4J75A 3R0JA 1GLVA 1NC1A 2JS7A 4Q4CA 1NQWA 3L9WA 3HKBB 3IV7A 1CB0A 4QJ5A 4P8RA 1ZZEA 1FBTA 1W5SA 3WWEA 2QW8A 4OXIA 4GP7A 3K2EA 3TTTA 1JS1X 4WASA 4REQB 5L6MB 3ZWDA 3RJ5A 1P1HA 3F4LA 2AMLA 5F1PA 3SR4A 3Q8XB 4WFKA 4LJAA 4TTPA 5CG1A 2Z5VA 1SBZA 2XRYA 2E5WA 3R6WA 3OEHA 1L5KA 3GGDA 1XPUA 3LVFO 4ZT2A 2XECA 1RXYA 1K4KA 4KMRA 1SYXB 1EHCA 3KYDB 4KZPA 4IEIA 2YINC 1XI2A 2WD7A 2W7PA 1CKNA 3U55A 1OVMA 3T1OA 3HZHA 2X7HA 4BNIA 5L3ZA 1JBQA 5JANA 3REQB 3VI3B 3GJZA 5A4AA 2RH4A 4KSBA 4ALNA 5HP4A 1WU7A 1C1XA 2BOVA 4W8HA 2XC9A 2A1UB 3LLMA 3QQMA 2NYRA 4FGWA 3O4VA 1PLKA 2QUKA 3R5XA 2PQMA 2B25A 3C6QA 2ODEA 4JI7H 4YYZA 2HU2A 2QI9C 1CJSA 4ZV4A 1SVUA 1FXWF 4GR9A 1FNMA 1I4OA 3HCWA 1A5BB 1DWQA 2IZZA 3DSRA 1WUIS 2AA3A 5B7GA 3FTCA 1T0BA 2IODA 1NC3A 2WT4A 4R8UB 3MBIA 1TE2A 3SQNA 2J5KA 3EVZA 3EXFB 5G02A 3UTDA 4RPJA 2YL2A 3DAHA 3ZIDA 1NOIA 3RJMA 2XTAA 4I1SA 3IEVA 3GIJA 2EJTA 2REQA 4YHHH 4ZC1A 1DQYA 5E7QA 4WNYA 5AKHA 4Y2VA 4G2NA 3JAKA 2QNRA 1VXRA 5AQ1A 4DR3H 2AFVA 4KQ2A 1JILA 3BHJA 1CUUA 5C5CA 4NXMH 2OUKA 4BU1A 3UH0A 5JSKA 1OBCA 5E4TA 5BQXA 3V4PB 3KHTA 1LTKA 1I2AA 1H1LA 3N74A 1SN7A 1U9CA 3S2GA 4E7PA 3RQSA 4P4UA 5SYMA 4U39A 4JVLA 4GD3Q 5BOVA 4S05A 4Z9YA 1U0BB 3D7LA 2PJRA 1IMJA 2G5CA 2VZ8A 3WDLA 1S2MA 3RGWS 2B9EA 3PXEA 3JD4A 5E3IA 3JWPA 3GLIA 1DTEA 2FU5C 4AP5A 1XCBA 2FK7A 3AJ9A 1EVIA 5CEEA 2V6MA 2WTFA 1A2KC 5IBRA 1I3OA 4M1TA 4NPAA 3QKRA 5A7GA 5JIBA 3U3MA 1ZIYA 3P0JA 2GCEA 5T67A 2BFOA 1SXJD 4H4CA 1XP8A 1DJLA 4DPMA 1N25A 4YTEA 2NYUA 1BHSA 4N01A 2W57A 4PVCA 4AMUA 1ZU5A 2W98A 4JL6A 3QQPA 1IUOA 3U4CA 1MW9X 4WMLA 2WDTA 2Z2JA 5AVVA 1VJ1A 3R7NA 5C7IO 3A6HA 3AF3A 2DYKA 3GZJA 5I7VA 3UT5A 2RAVA 4JNCA 5I7HA 2IYXA 2HD4A 4JBGA 4F1JA 2A1TR 4O5AA 5CLFA 4EFLA 1Y7LA 3HA7A 1N2CA 4Z9BA 1QGZA 2HW8A 5H59A 3GPCA 3UJNA 4PAGA 2QNBA 3MQ4A 4QEZA 1G2WA 3RG2A 5F7ZA 3VGJA 4XJTA 2HIXA 3IVRA 5JG7A 3X43A 2O2HA 3PUYA 2BZGA 2FV8A 3A0UA 3K7EA 1FUEA 2NPIA 2H0RA 3EMKA 4W5HA 4CQMA 2GHTA 4JJ4A 4GKKH 4Z1OA 3EBPA 4US0R 1MT3A 5HTKA 2NZVG 1ENYA 4U0KA 1QHHA 1A7JA 5D51S 4BTVA 5HS4A 4Y7CA 2JD0A 1CZOA 3CXUA 2NTJA 4UNNA 5E9WA 2BBSA 1NNSA 2XB4A 1SURA 4NHOA 1TVKA 5DWDA 4O2AB 3UMBA 4GUAA 1IN7A 2Q5IA 4RK5A 2EHDA 5CD9A 4DUYH 2XZPA 5J2UB 3TW7A 1SHUX 5L9AA 2RF4A 2DG2A 3CVZA 5FQOA 3KHGA 4XRGA 4L1KA 4HNSA 2WJPA 2HHHH 2OAQ1 2P6MA 1L7MA 4FD2A 1QFYA 4EGSA 5KHOC 4TYNA 3IMFA 5CH5A 1FFYA 2FOLA 4BL5A 1WCMA 3F2IA 5CCDA 2FRDC 1VDMA 4WD3A 1XVUA 1B2LA 1XVTA 5G4KA 4CI0B 4NSNA 4DQDA 4GECA 1IQPA 3W8RA 4ZCQA 5FKJA 3A1SA 4Z86A 3WY9A 4LF6H 3WHLA 3H9EO 1V1JA 5FD5A 4L4ZA 3II6X 3AR2A 2OV1A 3GNSA 2G9UA 1N0VC 1K5GA 3SDSA 1MAAA 4QDKA 4D0SA 3BWEA 4RDIA 1S8FA 2ZWOA 4GPAA 5K7SA 3HPRA 4LF8H 4O4HF 4FBUA 2VDRB 2JFVA 1YAHA 3FCCA 1SOVA 3ODGA 4YB8B 4KQXA 4LSGA 5JI2E 3A6GA 3D6JA 3PQ4A 1PUJA 1OGJA 3I83A 9MHTA 4WH0A 2IELA 2VQSA 3ZV4A 1RXCA 1CHNA 4WHXA 2QAGA 4R71A 2RJ3A 2JI9A 2NN3C 5D8DA 4GOJA 1NT2A 5E8RA 5SZJA 4K87A 3KKPA 1QKJA 2VYND 3AOGA 3BE8A 3JQCA 3ZLBA 3EYWA 3BXZA 2W2MA 2HHCA 3DOHA 1NP6A 1ZH0A 3IOMA 2QW1A 1XK7A 4D8YA 2F4VB 3O4IA 3HDVA 3ETDA 2X2OA 2FSPA 2OAEA 3AKCA 4YAKA 4C7OA 2VHYA 3F6PA 2PGOA 2FB9A 2I6UA 3WJAA 1VJDA 3FPLA 3FNFA 4FGUA 2XYRA 1AZLA 1M5UA 4JEHA 4YAJA 1XYVA 2LCFA 5SZIA 1IM8A 1WMSA 5DHRA 4DAEA 3NBQA 5JATA 4HXGA 5K4GA 2Z95A 2HDNB 1HLFA 2DM6A 4YRQA 3TM4A 3TGLA 3DF9A 4B4VA 2JGFA 1KIAA 5FUQA 3ZK9A 1OKKA 1TWFA 2K5UA 1CUEA 2AFHB 1DB3A 4WZAA 4IUYA 4EJ0A 3E22B 4RHUA 1QTRA 4GAEA 3HCPA 2CUKA 3L7JA 1Y1KE 2O03A 2XWPA 3TVDA 2OBBA 2V1XA 2DPJA 2ZRNA 4RGYA 1NLUA 2ODQA 4H4DA 3W1VA 4LDNA 4CEIB 5BO5A 3W77A 3KZCA 2XB9A 2PMDA 1IHXA 2C0QA 3IVAA 3RM3A 4EG4A 1Q3TA 5ILGA 1LDNA 5DNAA 3AOEA 4EHKA 3COYA 3BHMA 2I99A 4PNZA 4BLUA 4KHPB 3G0OA 2FG5A 3WK4A 3NOVA 3NKLA 3HACA 3DTGA 2N1BA 1KOJA 3DAPA 2J7PA 1GGHA 3LY8A 4FB5A 3HBLA 2X77A 3SG0A 5FA6A 4HEHA 3MVEA 1LNQA 3R74A 4NOMA 2VNHA 3L7BA 4NEHB 4CEHA 2W0MA 4MWBA 1QZ3A 3MRVA 1JVNA 4GKBA 3ROEA 5HJ5A 4HGZA 1LLFA 4AWBA 4A6XA 3IQWA 4YFVA 2IY8A 4DVGA 1NUUA 1E3JA 4Y2TA 3VPHA 5AUNB 1U63A 1IOZA 2WYIA 2MJLA 2ERXA 4NH4A 1KKMA 1W4ZA 3UUEA 2PGAA 3SZOA 4TZ0A 1PGJA 2YJ4A 4M0LA 2WHPB 3OOHA 4PSCA 5JOQA 5LYJF 5EZYF 3P4UA 4LXHA 2V7WA 1HT1E 4DLTA 3ZBQA 1Z7EA 2HRBA 3NANA 4OQFA 5I3ZA 3A1TA 4JOSA 1FX1A 3OM9A 3MNFA 4F38A 4FZ5A 4MPJA 5B1HA 4NYMR 2R7ZG 2OAP1 3H5VA 3FXAA 4QOGA 4OIFA 4QDOA 3OUUA 4EYIB 3VZDA 2HYDA 2GASA 4TV9A 4OP1A 1DOAA 1JU4A 4JSRA 5T4EA 2HGZA 4QPZA 2RGCA 4TXNA 2D3TA 5MF6A 1FTQA 2ZPTX 4ZVLA 4BBSG 3I6YA 1ZIOA 3E0XA 3MF4A 3RFTA 3WYBA 2FDXA 3ZDEA 2YWXA 5KFBA 1N2IA 4RM2A 3PT9A 1NBWB 2RI6A 3SM3A 4CKCB 3AUJB 4Y9UA 1KDYA 2HMVA 1UT5A 2QLJA 2AC7A 2IOQA 4TTQA 1NDQA 3TLGA 3JD1A 1Q21A 3BE5A 5HF6A 2XLBA 2GBLC 5A4KA 4PZEA 1GADO 4CT0A 4OM8A 1A50B 4G0YA 1WMEA 2C7QA 2ZSFA 2VH2A 1GUFA 4M6WA 4JOCA 1J2TA 2XF2A 10MHA 5BPFA 2C2MA 1R27A 3ANTA 1YJQA 4HO1X 1IZYA 1E3SA 2BEUB 4AIIA 1LNSA 2ZJYA 2H4WA 1MX5A 4WBSA 4Q3LA 1KI1A 1U9ZA 1E0DA 2FK1A 4QYTA 3JARA 3A32A 3ECAA 1PVVA 3UUGA 4MV6A 3VNNA 1JSRA 5C8ZA 3KT0A 3N2GB 2GXAA 3N07A 2VNKA 2V45A 4HNUA 2VCHA 4G4JA 2P9GA 3OSZA 4TTIA 2EW1A 2KI5A 4UATA 3RYIB 2FN9A 1DKOA 1Z8HA 4DR5H 1GU1A 2P4QA 3MB8A 5NULA 4YI3A 4E22A 2P75A 3UWOA 2W8BB 4EGFA 5H7XA 2PUEA 5IN4A 3OVMA 3B3AA 1GGFA 2XQJA 5HQ3A 1ZRNA 4X00A 5C37A 3C6MA 3NG1A 5DGXA 1ZC3A 3GPLA 5FWXB 2L19A 2HB6A 3V3KA 3CA8A 3ETHA 2VLIA 5F9MA 3PZRA 3DNMA 1V7CA 3K71B 3AP3A 4KLCA 2VA3A 2QDKA 1V2HE 3NEJA 4RANA 2Q1TA 3K9CA 3I9V6 3RVBA 4FE2A 1XGKA 4UEJA 4CM5A 3MB5A 4NARA 3K6SB 4U00A 2FLWA 5BN3B 5BSKA 3F5FA 1MX3A 3DHNA 4QGHA 4A3EG 2XT6A 4DLSA 2OGUA 1T8TA 1VMIA 5CFZA 3H42B 4R2WA 1X92A 5KFVA 3BTOA 2LGJA 4M0JA 3IUPA 4PPGA 5CUQA 3LZ6A 3FGZA 2XYVA 3O3NB 2IA6A 3TQQA 3ACDA 4DV7H 4YNBA 5E3JA 1GAEO 1HEUA 5LA6A 3S8EA 1ZA1A 4Q43A 3HJUA 4Q9JA 1QQBA 3CZ5A 3TLBA 4Q4JB 1Z15A 1M2KA 1TWCA 4WOCA 2JCVA 1JQDA 3HSYA 4Y6PA 3H17A 4HYTA 3NZEA 1KH1A 4RCZA 4IDBA 4IDQA 1DT5A 3TMAA 5ES4B 2H4HA 3T3NA 1II8A 1VPLA 1ZUHA 4XUCA 1SXJE 3PXGA 3F8TA 3WL7A 1VSQA 4ZGGA 4A2BA 1OXBB 3LOQA 5D5PA 3WQSB 3MJDA 3M6FA 1OD6A 2OT3B 2C5HA 1GO2A 2VSXA 1GA6A 1NA5A 5BRJA 1UDBA 1PW5A 3RAQA 9LDBA 3HI4A 3VKWA 5I4BA 3GDEA 2IOHA 4G0WA 2DECA 5UKDA 5DSXA 1CNEA 5TMBA 4KKVA 4CL3A 3ZI4A 1M7HA 4JLJA 4NBVA 4TYQA 4WXYB 3WL5A 3L7OA 1O97C 4ZVSA 2FEPA 4OO3A 3UC9A 2YXPX 2HRDA 4ZQFA 2UUCH 1P7YA 4L6AA 5LU8A 3WMFA 2ZS7A 2FJUA 1S5PA 1UKVY 4LWQA 4MLPA 3ROXA 3GLHE 5JU6A 3GT3A 3KQQA 3WK9A 4FKMA 3BULA 1CEEA 3AR8A 2X7JA 2PX0A 4C89A 1V5EA 4H1TA 5D3ZA 1IXRC 1ODIA 5DMHA 5DFAA 4J03A 3FNBA 5I7OA 1QE5A 4IVPA 1F4PA 4RU9A 1TA4A 3GMDA 1UEIA 5JH7B 1RHRA 2OBFA 3HB7A 2VRCD 5KAPA 2GXSA 2C4MA 4UMEA 5AUOB 4XDHA 3EVNA 1M8GA 3AEZA 1NJ1A 2A84A 4YJ2F 2WNHA 1QAQA 3KWLA 4D9BA 2OM2A 1MZVA 4JI2H 4AXXA 5FD6A 4CDGA 3H4DA 1FKAH 4B6OA 1GNRA 1UC4B 1NVFA 3BC1A 2X41A 1R64A 3O38A 3DL2A 3D8HA 3TIFA 4A1FA 4XFJA 3OI7A 5C4XG 2II6A 4Y6OA 2JLXA 4ZGBA 1YUMA 3I0NA 3N3AC 1OTXA 3UW3A 2BKVA 3K31A 4QHSA 3AM1A 1IL0A 3D0QA 3NV9A 3OCJA 2YOGA 4HI0E 1DAKA 2WJGA 5ALEA 4R9SA 4TMVA 1EUCA 4QNNA 5FLEX 4O7VA 1H4TA 2YHIA 1JU9A 4OP3A 5C3MA 3OLYA 2YN2A 3F71A 1FLNA 3KYJB 1M74A 4MI6A 2HIAA 1EHIA 1B6SA 1BN6A 4EB3A 2UYCA 3O83A 1TJ4A 2HHFA 1NFFA 3DAAA 1R4AA 2HYIC 5DSZA 3EGCA 2XMDA 3VNUA 4E5VA 1PDVA 5DM60 2YZNA 2XKAA 4JBYA 2YBEA 1QU3A 3ROQA 3AXTA 3MGKA 1NUPA 3Q6IA 3H5TA 4JT9A 1KBZA 3R5JA 1XV5A 3DFIA 4FZRA 1N9GB 4Q7KA 3USCS 5LQAA 3HN6A 1DCFA 4DA6A 2GAOA 3O2QB 2D1RA 5FQNA 1I2LA 1DC5A 5KOJB 1V51A 4IZ6A 4BNUA 2CXNA 4J90A 3LGXA 2FZGA 3U19A 4A91A 1G6Q1 2HRQA 1T1RA 3BQMB 2PX8A 1XNRB 2C2WA 1X9NA 4EI8A 3OOJA 3AERA 1AMNA 2V58A 2PT7A 4X8HA 3QLVA 4NPHA 1HT2E 4QWWA 2IGBA 1DCKA 1LEHA 1J06A 1X7ZA 1D7AA 4QQ8A 4MVWA 3IMKA 3BM5A 1EGAA 1U2RA 4EUHA 2RHCA 1EFRA 1UJ5A 3V8VA 3EEBA 1QRAA 4CIAA 3W2FA 4OQ4A 5EQFA 1FB5A 3QA3E 4Z1MD 3REGA 5DBOA 1TLLA 1R4ZA 4L5JA 1HTWA 2J5BA 2ZGVA 1WW3A 2IHBA 1A9RA 4QRIA 3GO4A 4MW9A 4WZBE 5SY9A 3OTOH 2NO7A 4HAUA 2FWJA 1P8JA 2R60A 3W4JA 3I5MA 3MOGA 5HBGA 2W9CA 3CSSA 3N44B 1BGWA 3BQ9A 3CUVA 3KPUA 5ISMA 2BMWA 1WRVA 3EARA 2N9UA 4XWTA 3Q2OA 4OGLA 3TFQA 3AUSA 2UVWA 5C7OO 2XY4A 4PS0A 5AJUA 4TSFA 1NBOA 2P9EA 1PE0A 2ID8A 4CQNA 5DISC 3G89A 3IPXA 3BGVA 4DYVA 3H2BA 1TM2A 4WJZA 4ZQGA 1QIMA 1I6LA 2BJWA 1RBZA 3DO8A 1J2JA 3W34A 3M2TA 3MTJA 2CLFB 3O95A 3LXMA 3VR0A 5D84A 4YRSA 4Q9DA 2IW1A 1SXJC 3N86A 3H75A 3K6KA 1G21A 3I61A 4W9RA 1XZBA 1O9GA 4UCUA 4IIUA 1EFPB 1VYTA 1SC6A 4CW7A 4YBZA 1I7PA 5DHUA 3ANMA 2B1RA 4DQUA 4TWIA 4MA4A 1G8KA 5H8WA 1MD9A 1H5QA 1JDBC 4B3BA 1XAHA 2B2NA 4B74A 3VU3A 3E15A 3HYTA 5LQUA 5I7SA 4G0MA 2JBWA 3H0GA 4K88A 3WLNA 4ECSA 3H20A 5CFMA 1JHQA 1KYQA 5LQCA 3HVIA 4BLRA 5C9ZA 3I5AA 2EU8A 1NMSA 1A7UA 3OJOA 3QXJA 2OHOA 4ZQHA 3VV3A 1PR4A 2CMDA 2JK0A 4FYWA 1S2LA 3CV3A 3NIFB 2I6FA 5IT5A 1GSOA 4RVNA 1RRGA 4C2AA 4BZWA 1XZDA 4N41A 1VPEA 1BCSA 1IBSA 3ETEA 1MAVA 3E9DA 4F06A 4R7TA 3SYLA 5ER9A 3NOQA 4C21A 3IEUA 3T7DA 2Q46A 2PL1A 3IV9A 3EPJA 3ZY6A 4JT2A 4L78A 3LXRA 4ZI7F 1K9VF 4ZVPA 3INRA 1Y6FA 1GYPA 4GC7A 5CB0A 4FWIB 1V3VA 2PZLA 2J3DA 1C4OA 5BR8H 4AY4A 5CXSA 1GZVA 5I7RA 4EBEA 4AS2A 1SB8A 1YQEA 5E38A 5LKAA 1JIUA 5IM4F 1YMVA 5BT9A 3WGOA 1WMDA 5KHAA 4JI8H 2R7LA 3OA2A 2NQ2C 3ANNA 4MWSA 4XGRA 4KMMA 5KFIA 4N9QA 2COUA 3PCTA 5ECWA 3IIKA 5FHQA 2WWRA 4TUYF 3WB2A 4WX2B 1QIHA 3TNJA 1D2EA 1GL9B 4JYBA 1D6NA 3O1JC 1RAAA 3SYKA 3HZZA 2MINB 3W5DA 1FFWA 3DTVD 3ZHCA 3H6KA 2ZJ4A 4CM9A 5LBUA 5KINB 5D87A 5DHAA 4KVZA 2AJBA 3RS9A 1WNTA 1Y1VG 5K99A 2BFBB 1J1ZA 2FWMX 1M2EA 1YR7A 3NJRA 5DT9A 4NL4H 2FE3A 1VCMA 4Y2YA 4JMPA 1TZCA 3S7ZA 2HQRA 3KTFA 2A67A 5KYKA 1XVIA 3E9RA 2BGLA 3T99A 3GTQA 4KO1S 4BVLA 3DLIA 4M2LA 2WLTA 1JFTA 3VOTA 3EE6A 3UBMA 2KMLA 1R8XA 5A3JA 3C6BA 1VRWA 1BDJA 4LJ9A 2I6QA 5AICA 3E7FA 5ADHA 4C7JA 1Z7GA 1XL1A 2GO1A 4URUR 1U5BA 3DV9A 1X9GA 2Y1XA 4KUGA 4Y2XA 2FDRA 5EHNA 2IZOA 3DLPX 1YDFA 1AKVA 2Y1WA 2DWPA 4U7HA 4U9HS 1PZMA 3PCRB 3VAAA 1CQZA 2C8JA 5AH0A 4YMIA 4OOEA 4K6OA 2Q2WA 5TB5A 2LDBA 3HDYA 4RGVA 3A1DA 3VPAA 2B34A 1WJGA 3HZOA 3TSAA 4LJYA 2EW2A 2RHLA 5IH7A 1F6BA 1SUIA 5B12A 2VJPA 3T1HB 4G4GA 4W4TA 5JHHB 5AWFC 2R86A 3ER6A 2JPDA 1J0BA 2E5LB 3GVHA 4CLOA 4A3DG 4CV2A 1UQTA 5IPFA 4ZRNA 3TSYA 4ER6A 1MBZA 4M9SA 3HFGA 2WUVA 3D6UA 3RBDA 4BKUA 1P4JA 4ZHQB 3QX3A 3R0IA 1XD8A 4K0RA 5IVKA 4LY3A 3N7UA 2VUUA 2ZXEA 2O0KA 4LTDA 1JIXA 1QV7A 4O63O 2WNIA 3I4CA 3IEMA 4TKZA 4ZOEA 4WLNA 3NP7A 1P80A 3IQHX 5CHYA 1SVSA 5TF0A 5DW0A 4Q66C 3ZS9A 2WB1A 2FPWA 4BWYA 2J87A 1GUBA 2A9JA 2WIGA 1V41E 2W90A 4AJEA 1TT5B 3BH0A 3OQIA 2J9YB 4KR2A 2FJPA 2YDXA 3EXIB 1DUVG 4JC5A 5DTJA 3MD0A 5AM3A 4EUEA 4GPEA 3T34A 3T7KA 2ES4A 1J0EA 2H92A 3MOSA 1OPXA 1XEWY 1CX9B 1JBKA 1Z4MA 2OQIA 2QWXA 3GLIE 1PS0A 3GEGA 3JATB 1WMAA 2E4VA 4RZRA 5BNZA 3RK4A 5JNVA 4GGOA 4CCAA 5KREA 3X1MA 4L7QA 2ZBUA 3IIMA 5U1PA 3RNLA 1VL0A 5CU7A 1U9IA 3B52X 3BWYA 2X13A 1JH8A 1NULA 1U0HC 4FYVA 1RZRA 3QF4A 1OFGA 3MJFA 4A3FG 1TU0A 3R76A 4YO7A 1T9CA 4YDSA 1CJMA 3KD3A 2VXCA 1T3NA 4MAFA 4KH1A 3WSWA 1LRKA 3CPEA 5B55A 1WP4A 2WD8A 4IRMA 3W2EA 4KQMA 4ZEXA 5DI3A 2AXPA 2Q1UA 1N2SA 1PFWA 4LMRA 1G4AE 2YNMD 4PQYA 4C9BA 4MSUA 2Y1LA 2AI1A 4ZO8A 3B1XA 3SQXA 1I7LA 4LF5H 1JP7A 3CF2A 4F9FA 2HWYA 1GFIA 2DQSA 3LHFA 1FVHA 4C29A 3BJMA 3ENVA 4GI3A 4ECQA 3U2QA 4FUQA 1T5TA 4DSUA 1V4BA 3H7AA 1PR2A 2IYEA 4RK4A 2O54A 1E3QA 1E2HA 1IATA 1V1RB 4DDMA 2PLRA 1S02A 2ZUCA 3DMGA 1ECFA 2JCBA 3N1UA 1P3Y1 3WDMA 2YY5A 4LH7A 5CH3A 3H5OA 3WGNA 1W5BA 5CX1A 1X9IA 2UAGA 1PFYA 3JQPA 4BMCA 5EE0A 3M3HA 1TMOA 4FIDA 4PZYA 4MQUA 3A6FA 1Z3CA 5C2JB 2AC4A 1GIAA 4FGSA 1FDOA 5GV8A 3WTBA 4KXVA 2JLCA 3PUHA 4HNAB 3TOZA 2AXQA 4OQLA 5D7NA 5IEJA 3EDCA 1RM3A 4RGBA 2BGJA 2HJWA 5JZMA 1A9PA 2OLSA 3OQVA 1Y3HA 2PJUA 2RGYA 3ENQA 1FXWA 1V3TA 3BDVA 1Y1WA 1JDUA 3HJNA 1X7YB 3AI1A 4U9UA 1NP7A 2IU3A 1YRYE 1Z75A 3UMGA 4GKAA 1LX6A 5ALNA 4MGKR 5F35A 1H22A 4K9DA 3TLAA 3KRTA 3MZ0A 2KX7A 1SHZA 3S44A 1Y6JA 1K2VN 1UK8A 5LMUH 4FYPA 2CKMA 4MPDA 1E7QA 1W44A 3R3HA 2JIQA 4B4UA 1YSCA 1X7XA 2UVRA 2QW0X 721PA 2C2OA 4Z0TA 1UANA 4EY8A 5ERXA 4X66H 2BGIA 1X8JA 4EBCA 2D8AA 3KO8A 3OQBA 4G1VA 2HFJA 4ZALA 1JG3A 1TQ6A 4CG3A 1SXQA 1GTJ1 2Z2IA 3MHPA 2QYSA 2D5AA 4WJKB 4FDTA 5MN6A 4GX0A 4E6EA 3TTYA 1OJLA 1DAIA 3P2IA 2X4IA 1YBVA 1W1IA 1GU7A 1D1SA 3MRXA 1FDRA 1P73A 5JALA 3G2QA 4JV1A 3JQ8B 2V7GA 2OO3A 3UJ8A 3IJPA 4BO8A 2VC2B 1U2DC 1GNTA 1T26A 5SZHB 5E6SA 4Q6WA 1CP3A 1VL8A 3C3KA 3VR5D 3I2GA 3RVDA 5DGCA 4YCCA 3RGGA 5K8TA 4ND8B 1JLKA 3ILHA 1UBTS 3UJHA 1XTZA 4OM7A 1I9CA 3IP7A 1U1GA 2JLQA 1QX4A 2JA2A 5FEUA 4LF4B 4KWCA 5DF1A 3GLGA 2VP0A 4AWAA 2VUSA 2I2FA 4UDOA 1P60A 2P0AA 3UZUA 3THXA 2BGGA 5AM1A 1TKRA 1OH5A 1N2EA 2XDYA 2CMGA 3DP7A 1QG6A 1BNCA 3G9UA 2I2AA 4ZKDA 1ADGA 3KKEA 4DLYA 4BNNA 4YR2A 5A9TA 2H5LA 3Q5DA 4KPYA 3WLOA 4WBNF 4FYKA 2B63G 3H4TA 1GGJA 3RTXA 2WMYA 3QOXA 1VXOA 2FG6C 3CW8X 1ULUA 4CR8A 3COPA 3NYRA 1L7QA 2R92A 1N6HA 3EIOA 3P9KA 3GEHA 2BGKA 2I71A 4UHJA 4DM3A 1YCDA 1QO9A 5JW6A 3OZUA 3NXKA 4HQRA 4YACA 2FPMA 2OXCA 5IMSA 1QZTA 5TGZA 5L1IA 4Q3OA 1IB6A 2GCPA 1VRCA 3TPZA 2PVCA 1N6PA 1U1IA 3UK6A 1GSAA 3EJ6A 4E21A 1SCBA 2CVHA 4BKQA 4BVGA 4UE3S 2GRAA 2VHCA 1P1IA 221PA 1D1QA 1SKMA 1UK9A 2QN7A 4RVDA 2JGEA 4US1R 3GIMA 2ZSJA 3IT2A 3AEQB 4P4SB 2R8YA 2DF8A 1BGXT 1FDVA 4EMSA 1CY7A 3ZX4A 2XCQA 4P84A 4YV7A 2DUUA 3ZGZA 1YULA 4B6QA 1TGVA 3FLEA 3AR4A 1XEFA 3L79A 3PCXA 3U4QB 2HF2A 4D6YA 4I46A 1AUVA 5I45A 3OT1B 1C2TA 3N0WA 5JCJD 3OWOA 4C7MA 5JPDA 3ZQUA 4JBXA 4E5KA 4CM8A 1YR6A 5CVCA 4IM7A 4EF5A 3AL3A 2H2FA 3QU2A 3T3DA 3LFUA 2AEMA 1KAMA 3MR3A 2FSSA 4QLAA 1BMFA 1J7KA 1OE0A 2Q6LA 4JVSB 2D6FA 3RU3A 2NUTA 4ALJA 3WKBA 2FK2A 4DG5A 1LDGA 4HVTA 3D5QA 2MYNA 1Q92A 2H85A 2YYSA 3I6QA 2WQ6A 3NUZA 4O4HA 2E4UA 1QOPB 4Q9AA 4EL5A 1QSGA 2VCYA 5A06A 2F3TA 3QRWA 1U99A 3IUEA 3BMOA 1L5ZA 4X64H 2GOYA 2W83A 4TRMA 5AVRA 3R7WB 2WF5A 1NNLA 2P1RA 2ZCUA 3UYKA 1AUXA 1W0CA 5AI6A 3Q5GA 3A8TA 1LPMA 3WIUA 3R3WA 1SBNE 5J9FA 4PLGA 4B3GA 2XXBA 1DX6A 1KVSA 4DB4A 1N2BA 3RQIA 3B1JA 1AG9A 3PGMA 3IUBA 5AR1A 1EVKA 4MEBA 2D74A 3BA8A 4YP0A 2W11A 5LMZA 4AZVA 2E18A 4WNAA 3C2QA 3MMPA 1TCUA 2WMOB 5EZ6B 2POCA 1XLTA 3B1ZA 5CNIA 3ZQJA 2I8AA 2ZR0A 1QIIA 1XRRA 4H31A 3UJ9A 3W6PA 3EVDA 1MXFA 4WXRA 5H9WA 3RIXA 3JRXA 3EMDA 1PCXA 2IDZA 2O8DB 1NE2A 3FRIA 621PA 4MS4B 2PX6A 4HDSA 1Y5RA 2K4MA 1R0WA 4WI1A 2OV8A 4H3HB 1MQSA 1XZIA 3PFGA 3NWJA 1J5XA 2QAGC 3GFFA 1U94A 3SD7A 2B4TO 3GFPA 4HGYA 1QORA 3M4IA 3OQOA 2ONCA 3DZHA 3RW9A 4ER5A 4O4JF 1GV0A 3Q0IA 3CVYA 2CBXA 2P4UA 1OAOA 3E9CA 1JECA 3QOFA 3KC2A 4ZYTA 1K8RA 3D3NA 1ZR2A 1S8NA 3HSSA 1QIKA 2BC9A 2D0OB 4P7JA 3JZMA 4B3FX 2ZREA 4NI5A 5LR6A 4ALMA 1N0UA 1RP7A 2C61A 5BWOA 4HDKA 4OHZA 1YIAA 3V80A 3SZMA 1CS0A 1XKLA 1E9FA 4BMXA 1L3IA 4U63A 5HJ7A 2OGWA 1PZGA 4FS8A 5B3KA 1ZUWA 3PO2G 2C35B 3L0BA 3T52A 3OF5A 3CLHA 3KUCA 2JGLA 2XGPA 2OCBA 1WOYA 5AW4A 1VL6A 5GMOA 4L0CA 4B82A 4G86A 1M8PA 1XLWA 1MNQA 3TS1A 3E3OA 2JJYA 3PLRA 2NU9A 2G1PA 4RUCA 4CKBB 1C0LA 1GGKA 1ZR4A 2SCUA 3E9YA 1OBDA 1KDZA 1L0BA 5DYNA 2GK4A 4FI3F 2D0DA 3UICA 3I37X 3VQTA 3CW9A 3ZHXA 3UCEA 3MYYA 2P78A 4KG7A 3W8FA 2W8KA 1USVA 2YWHA 2ETXA 5IASA 1YI1A 5F2KA 3TBKA 3U1TA 1LU9A 5JS2A 2I62A 1SZCA 5CTJA 3DUWA 3GTJA 1MW8X 5EXEA 3TD9A 1NI4A 3RWOA 1CR6A 5LYJA 5EZYA 4DCUA 3FSGD 4BX2A 2HMAA 2WWIA 1CQJB 3K4HA 3V46A