2ZDIA

Crystal structure of prefoldin from pyrococcus horikoshii ot3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
101
structure length
101
Chain Sequence
b'AMLGQLDTYQQQLQLVIQQKQKVQADLNEAKKALEEIETLPDDAQIYKTVGTLIVKTTKEKAVQELKEKIETLEVRLNALNRQEQKINEKVKELTQKIQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin subunit beta
publication title Structure and molecular dynamics simulation of archaeal prefoldin: the molecular mechanism for binding and recognition of nonnative substrate proteins
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Chaperone
total genus 39
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zdiA00
2ZDIC 3AEIA 1FXKA 1FXKC 1FXKB 2ZQMA 2ZDIA
chains in the Genus database with same CATH superfamily
2YSUB 2QTOA 2IM9A 1AVMA 2AHZA 2P6JA 5H9CA 4O4HA 2E74B 1QQCA 2PYJA 5DEDA 4UV8A 5KX5A 2Y4TA 3JALB 1XHZA 2P90A 2HLDG 2A79B 2Y48A 4GKKO 1HWYA 1GH6A 2WWWA 4O4LB 1N33B 3LSQA 2EIMC 4HBNA 1TUBA 1AP5A 5BR8B 4JYAB 1SZXA 5IJ9B 2YIDA 2W0XA 4LFBB 1ZL8B 2FB5A 3OE7G 2IW5A 3J81N 2YI8A 4PA6A 2ITDC 1Q90D 4AHCA 5FL7G 2A3QA 5LGUA 3ICXA 3OFNG 1JCHA 3SPCA 5C8YA 4NXNB 5J9PC 1JVMA 1KUQA 5KMGB 2DMXA 5IYCO 2LJ2A 3M99B 5L3CA 1JJ2U 5C93A 4GX2A 3ABTA 1G6UA 3OTOO 3K3WA 2UXBO 3W7TA 1THZA 1XNQO 1VQ9V 1B06A 3RYCB 4MVUA 1J5EB 2BTQB 4GX1A 1XL4A 4CC6A 4HYOA 5CA0B 1YITV 4LF6B 4LCUC 2R9AA 2CE4A 3N2KB 5K1XA 4QPKA 2NNUA 3JAKB 2E5LB 3TJTA 5D5PA 5FPRA 3E8HA 4MW8A 1M56B 1XILA 3DXRB 4DYLA 4K3AA 4X1IB 4J9YB 4JYCA 3ZIAG 1H2NA 1WLEA 4KHPB 1LNQA 4TUYB 4JI8O 1H8HG 4K35A 4MVZA 3JAWB 1M9NA 3SR2C 4JI5O 2WA4A 4KUMA 3D36C 3E8BA 3TXQA 4B3SB 2EIMB 1FJGB 1K4CC 4DV7B 1VQ7V 2Z3YA 2LFRA 2ZR3A 3K03A 3AG4C 3ZN0A 3UQ8A 2VQEB 3CCMV 4FLZA 1XMOO 1OZ0A 5LL6Y 3RW0A 4P9OA 4FLYA 3T1HO 5EIBC 3K5OA 4X66B 4JI7O 2A9HA 2GV9A 2H94A 5JVDB 4JZGA 4GX0A 5DM6V 5IYZB 4CH4A 2F66C 3K9SA 1WA8A 3BAAA 1CXZB 3H1IH 3ABKB 4WBNA 2WPDG 2QWNB 3KCYA 4JZ2A 1KD1W 3P3PA 1R1BA 5KAFZ 2W6IG 2IH3C 3PJSK 4B3MO 2QE7G 3ZBHA 4QNHB 1BQ0A 4NTWA 1N36O 1V55B 5H2FZ 5B3SC 5LOVA 1QCEA 3UT5A 2F43G 4W4KA 3C3SA 5JCOA 2BTOA 3X2QB 1HR0O 2X6AA 2P4KA 4JI0B 1NH2D 4ZBMA 3ZRWA 4N21A 3PN1A 4LC1A 1IBMB 3JASB 2GTAA 2UUAO 2EINC 4L8JA 1NH2B 3KG2A 3SGIA 3H9VA 1WP7A 4K0KB 2EX3A 2ZIOA 3W7XA 1VIBA 4B3TO 3BA9A 2ZQMA 2DWEC 2WLIB 3FB5C 1FFTB 3QG5A 5LGTA 4WF9V 5EIBD 3T1YO 3AG4B 4J11A 2M6YA 4IGGA 1OJHA 5JJEB 2JRIA 3CCEV 3L75H 1Z5WA 3CC7V 4U3FH 3CC2V 3G67A 4G2KA 4UUJC 3RBZA 1KKCA 4BIUA 2A0LA 3D3IA 4RUEA 4X1YB 3ETEA 1K3EA 2QWQB 1E79G 1Y67A 4F6RB 2WLLA 4FLVA 2YXHA 2Q0AA 5CMUA 5BR8O 1JMKC 5J2TA 4JYAO 4R6ZA 2YI9A 4UB8Z 2JVDA 4FIPC 2UU9B 4MVOA 4LFBO 3S3WA 4DV1B 2GHYA 2QWRB 1QU7A 5LXTA 2EBOA 2PZSA 3QF7A 2GUZA 1MG1A 4X20B 1WPXA 1I7FA 2ARHA 2R9IA 2XAJA 4NXNO 3EFFK 5B3SB 4BIOA 4O4IA 1W0JG 1F23A 3CRQA 1SQGA 4NVPA 4JASA 2FL4A 2RJZA 2B1IA 1F4MA 2IBZH 1NI8A 3ZN1A 4Z1VA 3L70H 3ASOC 5KHJA 4YIOA 1BE3H 2LQTA 1J5EO 4I50B 5KUMA 1K33A 3SYOA 2XTAA 2C2AA 4LF6O 3T4DA 4O4JA 1JFFB 3JD4A 3CCUV 1ZTEA 4DV3B 4ICGA 2HEPA 3CPWU 2FKXA 2E5LO 4LF8B 4FLXA 1MSWD 1DF4A 1XHXA 1EFRG 1SZTA 4CH5A 1N8RW 3GB7C 4DV4B 1K9MW 2NLJC 3RYHB 3WFVA 2AZ2A 1BMFG 4O2AA 1JPXA 5TISZ 3RGBA 5LA6B 1I5XA 2PUSA 3ABMC 1H38A 4LF4B 1AI5A 4KHPO 1PKXA 4I0XB 1OCCC 5ITZB 1WN7A 4MT8A 4J41A 4C7UA 4KXRA 5L3FA 1EM1A 3CC4V 2ZINA 3TCUA 2YUAA 4B3SO 1YF2A 2KG7B 4DV7O 2JJ1G 3SPIA 2E76B 2UXNA 2X6CA 1RPOA 2VQEO 2ZIMA 1Q81W 3FAVA 3HKDB 1Q82W 5J2UB 3P30A 1WJZA 5GTHZ 3ZMZA 4X66O 3ASNC 3H01A 2CK3G 4YHHB 4FFBB 2Y0PA 4FLTA 4TV9A 1B04A 2RNBA 5KUKA 5B1AC 2DN9A 4ZOLA 2NR5A 1SRYA 3ZMSA 2ZNIA 3CEIA 3DC5A 1K8AW 1S72V 2DJVA 2CDYA 3LDCA 2L35A 3CSXA 2EULA 4YXWG 3AG1C 4JI2B 1XEQA 1MOFA 3IFXA 1VQPV 1Z2GA 2YXLA 1OHHG 2ZDIA 5KHKA 5LHGA 1Y6XA 3JCZA 3K5LA 4IHJA 4DV5B 3K06A 5JH7A 1W59A 3GWKC 2AHYA 4FFKA 2OCCC 4JI0O 1GM7A 5BY1A 3JD0A 1WB8A 1QLEC 4JYYA 1KECA 3JSLA 5GTIZ 4TSFG 2JEUA 1IBMO 3RFRA 3TETA 4TV8B 1X59A 4ZI7B 4I55B 3FFQA 1WB7A 1IVSA 4K0KO 5BMVA 5DECA 2LP7A 5E79Z 1RPRA 5EYPB 4FMTA 4Q6GA 1K34A 5GW7A 1SERA 1VQ6V 4GKJO 1TVKA 3VQXA 3T4ZA 4LFAO 4YIPA 2OT5A 4IIJA 5CB4A 4P9PA 1SETA 3ASNB 3E2EA 1NBMG 4LBEC 4J7JA 1XREA 3L72H 4NKGB 4PDLA 3HKBB 2XAQA 2QEXV 3STLC 2K9PA 2XAFA 2IJKA 5IWAB 5B1AB 1FXKB 2Q69A 4QPJA 1IXBA 2H8PC 2OIEA 4LNUA 5KAIZ 1BS3A 1VF6C 4ZHQB 2UU9O 1F51A 1K97A 1Q6IA 1WAZA 1RM1C 4DV1O 1P7BA 3JATB 5LGNA 4YY3B 5IY5C 4PDRA 1FKAO 3WB0A 2AW9A 2CTRA 3WU2Z 2Q6AA 3W7WA 2Q0OC 5LP6C 2FMLA 1XDCA 4BW9A 3FD9A 3DTUB 3STZC 1Q6HA 2Y0IA 4MVSA 3UO2A 1S5JA 3FB7C 2ZE7A 2WAMA 1TAEA 2OCCB 4DV0B 1OCZB 3VQYA 3DSQA 4NTYA 2JGUA 4PA9A 1QLEB 3OAAG 5CBGA 3OTFA 1SC5B 1H2MA 1Q6UA 3JALA 1YJNV 3CB2A 1EZJA 3ZHSA 2F95B 2QM8A 1IBLB 1GMGA 4O4LA 4HAMA 4DV3O 2UXDB 3CE2A 1PNMA 1N34B 4MVMA 1LUVA 1DTOA 1AP6A 4DV4O 2F1MA 3CCRV 1PD3A 2UXCB 3HPLC 4H13B 5IJ9A 5D5QA 2E3CA 3UM7A 4UCVA 3Q4HB 1EN4A 1DK1A 3QNEA 1AJNA 1ZL8A 4LF4O 4H0LB 1RP3B 2DQ0A 5LYJB 4MVRA 3B8MA 1R3IC 1Y74B 4X1KB 4DW0A 4GCZA 2HVJC 4B7KA 4B08A 4P30A 1VF6A 2UUBB 1O9GA 2H3OA 5KMGA 3F7YC 1Q43A 1Q8IA 3MHSC 4E4EA 2N04A 1AI4A 2A06H 3QO5A 5DN6G 1NKDA 1XMQB 1VQ5V 5LHHA 3OM3B 3RYCA 1TUBB 1I0HA 2LGQA 2BTQA 1RM1B 3O65A 3ABKC 4YHHO 1YVWA 1AILA 2OTJV 3CCVV 5CA0A 5IY5B 3K0GA 1GN2A 3N2KA 3JAKA 1WPBA 5LP6B 1OCRB 3TGUH 2QGNA 1YJWV 4DR2B 1SF9A 4MTGA 1Y66A 5H6RA 2Q7HA 1V55C 3DXRA 5H6QA 1AROP 3RYIB 3H1LH 3OMAB 4X1IA 2JJ2G 5KA6A 4TUYA 1KYOF 3X2QC 4PJ0Z 1K5QA 3JAWA 3MAQA 1PNLA 1Q3EA 3OEHG 4JI2O 1M1KW 1BL8A 2MK3A 4LP8A 4DV5O 1W2BU 3E22A 2F4VB 2DE0X 2BSKB 4PELA 1CEZA 4J9ZB 4DR4B 1BQZA 2QWPB 4WCEV 4W4LA 1SA0B 1YIJV 1HP8A 1NR7A 2VWKA 1MMMA 3L73H 4X64B 5IJ0B 5K1PA 3CYOA 4CC5A 1IBKB 4FLUA 1X4TA 3MHHC 5JVDA 5IYZA 2P22C 4JV5B 2BCCH 3ZHTA 1AI6A 1PM9A 2QSAA 2BOBC 3G4SV 3K9AA 4GT1A 1VF5B 4QE7A 1SKVA 5KA5A 1HW7A 1SQQH 3D3QA 4I4TB 2R70A 2KSDA 2Q7GA 1FXHA 1H2SB 3P32A 4J10A 1VEWA 3FB8C 4TT3G 1GN3A 1G4YB 1S5HC 2R9RB 3F7VC 2XNDG 1Q7YW 5LMNO 2RQ6A 3HKCB 2OCHA 4R50A 3CWBH 5KHGA 1B3QA 5IWAO 1ROPA 4U3JB 4JI1B 4I5SA 2Y4UA 4KL1A 5H5NA 1YCIA 1AJPA 1L0LH 4LH6A 1Y76B 2Q8VA 2LW7A 1Q5OA 2KQXA 1P7GA 1KC8W 3L71H 4JI4B 5GONB 4YY3O 5HFMA 3BHPA 2JK5C 3JASA 1NR1A 4IYHA 2M7WA 3E86A 3D36A 1JQ0A 4UCRA 5KHIA 4DRXB 1BZKA 3AG2C 2CUGA 3FYIB 3A0RA 4JGSA 4PI2A 3A0HZ 3H1KH 4UCSA 3BY6A 1JOYA 3OGCC 4WFFA 1V54B 4X1YA 2DYSC 1YHQV 1IBLO 3IC9A 1AR4A 2UXDO 1FPOA 3ZRWB 4F6RA 2JIZG 4QE9A 1GO3F 1N34O 4AILC 1QHTA 3BA8A 2UXCO 1U97A 1N33O 1YZBA 1XL6A 3BVOA 2DW4A 5LHIA 3JYCA 3ABUA 5B5EZ 1PL0A 4JI6B 1NTZH 1NZ6A 4UVAA 4DO2A 1PL4A 4X20A 3CXHF 1GAXA 2ZCEA 1QNMA 4UVCA 2WSSG 5CA3A 4ZIBA 2UUBO 2N74A 3THOA 2Q73A 4A5UB 3B2EE 1AB3A 3AG7A 1XI1A 4FK5C 4PA7A 4PDMA 2CH7B 1XBLA 3CJHB 1XMQO 1D5AA 3OGIB 4GYCB 4JTCB 4I50A 3JCUZ 3M8AA 4JTAB 4NYKA 2XAGA 1VQ8V 2YEVA 3RWRD 3BABA 2GDSA 3D8CA 1JFFA 1QLNA 4FLWA 4MS2A 2QTSA 1XNRB 2WLNA 2WA3A 4DR3B 1A32A 2A7WA 3CCQV 4EB6B 3CP1A 2ZE6A 3G6EV 2AGAA 3AG2B 3B09A 3E35A 4G27B 2IH1C 1L8DA 2CGOA 2IJJA 3KKYA 4B3RB 1L1FA 2VQFB 2YIAA 4MW3A 2G38A 5LA6A 4H37A 4X65B 2XOKG 2KKWA 1BSMA 2QDOA 4I0XA 5ITZA 2UUCB 4LWSB 1M57C 1R6TA 3FB6C 2DYSB 1NU1H 1MZFA 1SQBH 1NVPD 3RN4A 5FNVA 2KG7A 1VQMV 5AG2A 5A9GA 1VQKV 1YTFD 2F4VO 2GTSA 2PYLA 3WG7C 3OR7C 2PTMA 1EZVH 1NVPB 1G1XB 1MSDA 2QJ1A 3CCLV 4D7SA 1FJGO 3HKDA 4PA4A 4DR4O 2FTKA 4J42A 3SJBC 3SYPA 4F6EA 3W7SA 1IURA 5J2UA 1YTFB 2YIBD 1I94B 1NS1A 4X64O 1IBKO 2OYQA 3IGAC 4FFBA 1DGSA 4LF7B 4JV5O 3IC7A 4OX9B 1H2KA 2HJFC 3ZMVA 1GN6A 3VQVA 1HDJA 1KBHA 4BAYA 3ZCCA 4H33A 1N32B 2FYUH 2EJ7A 2RMKB 4PDVA 4UCTA 1ZWIC 1FXKC 3RYFB 4UXNA 5KLVH 2WLKA 5JJJB 1FYJA 2DYRB 1DLBA 1WP8A 3CD6V 4OPHA 5CBHA 3TK1A 1ZUQA 4HNAA 3BCCH 4YJ3B 1F7YA 1T5EA 4PHZA 1LUWA 3JARB 2EIKB 4K8XA 3GWOA 4JI1O 1UJWB 4DV6B 4U7NA 4UB6Z 1H2GA 3QTCA 1YDXA 4U7OA 5IT9N 2F93B 3SYQA 4I7ZB 1MABG 1R3JC 4E2LA 4UV9A 4JI4O 1M57B 3CS5A 1FXVA 4P2ZA 1OCZC 3E8GA 3NXSA 4TV8A 1YI2V 4ZI7A 4I55A 4XBFA 1TGOA 3JAMN 3L9DA 5EYPA 4CH3A 5CN0A 4WFGA 3EXAA 2D3OW 2B1GA 3TXSA 3WG7B 3APOA 3N2GB 3BRCA 4F4LA 4UCUA 5JQGA 1ORQC 4ABMA 1VMGA 3WB1A 2WLHA 4TQFA 4O2BB 1NT2B 5IDJA 4TWKA 4X88A 2Z5UA 1IZ3A 2OIGA 2QM4A 5L3EA 3HKBA 2P4VA 1K4DC 2WLMA 1N0JA 3SPJA 3SYAA 4MVQA 4R7CA 1H8EG 2RN9A 4DR6B 1YEWA 4DR7B 3T1YB 3L74H 1E1QG 3CRCA 4ZHQA 4IT5A 4MTOA 3LUTB 4J7KA 5B1NA 4EFEA 4JI6O 2V1DA 3SYCA 1GM8A 4I9WA 3JATA 3ZHVA 1L0NH 1YXBA 4BR6A 3SPGA 4MTFA 5EZYB 5CB4B 2Q7EA 3HKEB 2X7RB 3UO3A 2X6BA 4PV1B 1KB9F 1QVFU 4NTXA 2P5OA 1OCRC 4YJ2A 3CHXA 3ZRSA 4OPAA 4H44B 1IDSA 2CAZC 3ETDA 3ZMUA 3QO8A 4IL6Z 1FAFA 3DC6A 1YSCA 1FD9A 2PI5A 2E75B 1N0NA 2AXTZ 1ZX3A 3VQWA 5EBLC 1XNRO 4N23A 4DR3O 3OUFA 4X89A 1M93A 3OEEG 1S3JA 1JA8A 4EFBA 1E1RG 2EILB 2JGDB 3DGEA 5LMUB 3B77A 1B6QA 4LF8O 2LGWA 3E89A 3LNNA 1RSOB 1URFA 2P67A 3S3XA 4DV2B 3Q4HA 2VQFO 4X65O 2EZOA 3W7UA 1FFXB 4QJFB 3H1HH 3WB2A 2UUCO 5LYJA 2W0FC 3N27A 4EEQA 5CA1B 1EN5A 1Y74A 3AG3B 4X1KA 2P06A 1GKFA 1M4UA 1CP9A 1JR9A 2ZM6B 3RVZA 1R6NA 2CTPA 2L6LA 4O4HB 4ASUG 4KFMA 2Q9LA 3A2FA 1COWG 3I5DA 4NXMB 1P4RA 5KX5B 4JAAA 2GSMB 3B4SA 3C90A 4JAUA 4XDKA 4XDJA 5EC2C 1I94O 5B1BB 2HVKC 2PI4A 4RWUA 4LF7O 2BE3A 3ABLC 3QVNA 4OX9O 1S0VA 3JSNA 5LP6A 3ZS8C 3OW2U 1S77D 4LF9B 3B40A 3VBBA 4RO2A 1N32O 1KU9A 3RYIA 2QA4V 1KP2A 2QKAA 3ZMTA 2YDEA 2ETNA 4FVMA 1QVGU 2IJIA 5C8YB 3CCJV 2X0LA 4WFHA 1NTKH 4CH6A 2ZE8A 2YICA 4DR5B 2ZE5A 3FYEB 4JYBA 3ML0A 1K7DA 1XQ8A 4LH7A 2PGGA 3OR6C 4DV6O 2BSKA 4FPPA 5KHHA 3UCSC 1MNGA 3ETQA 4AQYB 1QBZA 2XHBA 4OGQB 1SA0A 3CRAA 3IJ4A 5IJ0A 1SQFA 4NB5A 1UFIA 5B1OA 4UFZA 2QWOB 2YS8A 5EBWC 1QR8A 3OD4A 4NR1A 5JCOC 2B5UA 1K73W 4LF5B 4QGPA 2ZR2A 4TOIA 1V54C 1NQTA 3AEIA 4WFEA 3FKSG 3OMNB 4I4TA 2Y69C 2K1EA 1ZLZA 1LR1A 3E22B 2O57A 5JJNB 4J7ZA 2CTWA 4CS3A 4LFCB 1ZSPA 3ABLB 2QKCA 4PA3A 3VOUA 3JD1A 3HKCA 1N4CA 4DUYB 2Q5ZA 5L3GA 3F5WC 3T2MA 4DR6O 4U3JA 2OWOA 3SJCC 4DR7O 1D2DA 1PNKA 1VQOV 2KB1A 3J7AU 1GRJA 4X62B 5IYBO 4CS4A 1Y76A 3SDLA 3ZEDA 1FS0G 1SQXH 2DQ3A 3T1CA 4DK0A 1UPGA 3KCXA 2YC0A 4TQDA 1S76D 5GONA 1R6KA 1SESA 1WNSA 1S5LZ 4DK1A 1VQLV 3E8FA 1WA8B 3HB3B 4XDLA 3CMAV 1RFYA 4WBNB 3KZIZ 1JX9A 1KKDA 4DRXA 3SJAC 1Y4MA 3QO7A 1TUEB 1AJQA 2D2CB 2MW2B 1K5SA 2WLIA 4MSWC 4FM0A 2QKSA 5F2VO 2ATKC 2ODMA 1XOUA 4DV0O 1KP3A 1J95A 5BXZA 5LOVB 5IYDO 3BFRA 3UT5B 2LW1A 2HJDA 1JJOA 3FX7A 2ILMA 2JDIG 2NN4A 5LMUO 4JF3A 3G80A 2AZ0A 2Y69B 4WFBV 4DV2O 2IJHA 3LDEA 4R8CA 3HR0A 5HFLA 4D6TH 2PY5A 4GKJB 4PI0A 3CXCU 4LFAB 1HNWB 5EK0A 4UCOA 2ZM6O 1BT8A 2HHHB 4GUNA 2LFSA 3O9OA 3ZHRA 1US6A 1W0KG 5EBMC 2CH7A 4NXMO 2CGNA 3CJHA 4DXWA 4RUFA 5LBQA 4LR3A 4DR1B 1I08A 3K0DA 1K92A 4DUZB 2WLLB 3CMEV 3AK1A 3ZHQA 2P7TC 4FZ1A 2EZPA 1I5YA 2HP8A 3RVYA 2XAHA 2YXYA 3ZHUA 3I56V 5J2TB 1HNXB 1IX9A 3MDSA 1M90W 1DF5A 2DYRC 4L87A 4EB6A 4OXSA 4LF9O 2VS0A 3F5TA 1P84F 1GN4A 5LXTB 1HNZB 4DR2O 2GUZB 4JI3B 2EIKC 3M7MX 5L3BA 3A8TA 4X9QA 4RQEA 3RYHA 4LWSA 4O4IB 2EJRA 1CPYA 3K57A 2JS3A 2WLJA 1BHAA 4UVBA 4DR5O 1TA8A 2YEVB 1VQ4V 3ZJZA 3ZRXA 3K59A 3H1JH 2EINB 1V9PA 1MZEA 2DWDC 4BWAA 3BPZA 4Z1MG 4EKWA 5B66Z 1VF7A 4Z2WA 2JEXA 4MTXA 4GKKB 4AQYO 4O4JB 1R3LC 4D7TA 2IU0A 1VQNV 2ZDIC 5BZBA 2HG5C 1R3KC 1Z5VA 2RCVA 1O9HA 4FJCC 2YIBA 2ZKOA 3JD3A 3CCSV 4LF5O 3CRMA 3U0ZA 4O2AB 1ZAUA 1VARA 1BCCH 1R73A 2ZXWC 4G28B 4JAVA 5FNVB 1OV9A 3SPHA 3AK3A 4FZ0A 3I55V 1KMIZ 3OT7A 1QR9A 2V7QG 2ADQB 3K79A 3RYFA 2W6JG 2ZD9A 4LFCO 2ZNJA 1G8MA 2XUMA 3NR7A 2XT9A 3R65A 1OCOC 2Q4PA 1AR1B 4YJ3A 1EN6A 1BHBA 3LDDA 3OTOB 2EIJC 4DUYO 3FAVB 2UXBB 3JARA 1XNQB 1NTMH 4I9QA 4FM2A 4BW5A 5IE9A 4ZKIA 3ETGA 5FPOA 5EC1C 4B7EA 3APQA 4X62O 4TV9B 4GX5A 4KP4A 2VRZA 3R66A 3ASOB 4CZZA 1EBOA 4ZOLB 3B8NA 3K04A 3LSSA 2UXXA 3RT3C 3EVKA 4K8ZA 2B9ZA 1NJIW 2RDCA 3U10A 4JTDB 4HNAB 4GZRB 4WFAV 3N2GA 4JI8B 1M5IA 3LSUA 5L3DA 3SJQC 1PPJH 2EILC 4JI5B 2XASA 4O2BA 4DW1A 3BEHA 1PV0A 4AI8A 1GM9A 2N05A 1AI7A 5FLXN 3K5MA 4HZ3A 3IAYA 4IHJB 3ABMB 2Q68A 5JH7B 1OCCB 2F23A 3ZX6A 5E1AC 1Q86W 1VP7A 4FM1A 3G6BA 1XMOB 3AG3C 3T1HB 2HKOA 2ZXWB 1IXMA 2ZT9B 3CRRA 4JI7B 3K58A 1FXKA 3J80N 2HR3A 1D5NA 3A0BZ 2OTLV 5JWPA 5BMVB 3G71V 2ADPA 1H2LA 3MD0A 1HNWO 4CS2A 5JQGB 5EZYA 1OCOB 2HHHO 3HKEA 1ENVA 2EIJB 1PP9H 2Q67A 1TVKB 4X8AA 5B1BC 1GTOA 2V4DA 2Z0AA 2CTQA 5LMNB 1AR5A 4IIJB 3OMIB 1U96A 2DOSA 4RQFA 2PF4E 3EHBB 4DR1O 4B3MB 5A2QN 4PD4F 1KQSU 1SQPH 3U11A 2BOCC 4DUZO 1N36B 3UKMA 1SS3A 3P3NA 1GK9A 2GBOA 4RAIA 1SQVH 1HNXO 4LNUB 4GLXA 3JD2A 1XUQA 1HR0B 5CBFA 3K5NA 2QM7A 2R72A 4Q20A 4J80A 3C3TA 2LO1A 2JGDA 3AG1B 4BIZA 2VWJA 4CBCA 1HNZO 3GVMA 1RSOA 4JPRA 3OUSA 3ZRVA 4JI3O 3AK2A 2QR4A 1P49A 3K08A 2UUAB 1FFXA 1BGYH 2IU3A 1YJ9V 4QIWF 2HFEC 4YJ2B 4B3RO 5CA1A 4B3TB 2ITCC 3CX5F 4IYIA 1F4NA 3LNMB 2JS5A 1MA1A 1M56C 3E83A
chains in the Genus database with same CATH topology
2YSUB 2QTOA 4FK5C 4YXWG 4PA7A 4PDMA 2AHZA 2P6JA 5H9CA 3AG1C 1MOFA 3IFXA 4UV8A 1VQPV 4JTCB 3ABLB 4PA3A 3VOUA 1OHHG 3JD1A 2ZDIA 4JTAB 2P90A 2HLDG 5LHGA 2A79B 2XAGA 3JCZA 2Y48A 1HWYA 3K06A 1VQ8V 2YEVA 5L3GA 3F5WC 2WWWA 3T2MA 2AHYA 2OCCC 1GM7A 1PNKA 1VQOV 1QLNA 3LSQA 2EIMC 2KB1A 3JD0A 1QLEC 4MS2A 1KECA 2WLNA 5IYBO 3CCQV 4TSFG 2JEUA 3CP1A 1FS0G 3TETA 2DQ3A 3G6EV 3T1CA 3AG2B 1S76D 3E35A 4G27B 1R6KA 1SESA 2IH1C 2IJJA 2LP7A 1RPRA 3E8FA 1L1FA 4FMTA 1VQLV 3OE7G 4MW3A 4H37A 2XOKG 1K34A 2IW5A 3HB3B 4XDLA 3CMAV 5GW7A 4PA6A 2ITDC 1JX9A 5FL7G 1KKDA 5LGUA 1SERA 3SPCA 3OFNG 1JCHA 1M57C 1VQ6V 1Y4MA 3FB6C 3QO7A 3T4ZA 2DYSB 1TUEB 5J9PC 1AJQA 1JVMA 1NVPD 2OT5A 5IYCO 3M99B 5L3CA 4P9PA 1JJ2U 1K5SA 1SETA 2WLIA 3ASNB 4GX2A 4MSWC 5C93A 1VQMV 3ABTA 1VQKV 2QKSA 3E2EA 1NBMG 1YTFD 3K3WA 2ATKC 4LBEC 3W7TA 1THZA 3WG7C 3OR7C 1VQ9V 4MVUA 1NVPB 1KP3A 1J95A 3CCLV 4PDLA 4GX1A 1XL4A 4PA4A 5IYDO 2XAQA 2FTKA 2QEXV 3STLC 3SYPA 3W7SA 1YTFB 4HYOA 2XAFA 2IJKA 5B1AB 1FXKB 2Q69A 4QPJA 1YITV 2H8PC 2JDIG 4LCUC 3IGAC 4JF3A 4QPKA 2NNUA 1F51A 1K97A 3IC7A 2Y69B 1RM1C 4WFBV 2IJHA 2HJFC 3ZMVA 1P7BA 3E8HA 4MW8A 3LDEA 1M56B 4R8CA 5LGNA 5HFLA 4BAYA 5IY5C 4PDRA 3ZCCA 4H33A 4J9YB 4JYCA 2Q6AA 3CXCU 3ZIAG 3W7WA 4PDVA 1ZWIC 1WLEA 5EK0A 1LNQA 1H8HG 1FXKC 4MVZA 3DTUB 4UXNA 3STZC 2LFSA 4MVSA 3FB7C 2WLKA 1M9NA 2WAMA 2DYRB 1DLBA 1W0KG 3CD6V 4KUMA 2OCCB 5EBMC 1OCZB 3E8BA 5CBHA 3TK1A 2EIMB 4PA9A 4DXWA 1K4CC 1QLEB 3OAAG 4RUFA 5CBGA 5LBQA 1VQ7V 2Z3YA 2LFRA 2ZR3A 3K03A 3AG4C 1EZJA 2EIKB 3K0DA 1YJNV 1K92A 3ZN0A 3GWOA 3CCMV 1OZ0A 2QM8A 2WLLB 3RW0A 1UJWB 1GMGA 4P9OA 3CMEV 4HAMA 2P7TC 4U7NA 2EZPA 1I5YA 1H2GA 1PNMA 3RVYA 2XAHA 4U7OA 3I56V 4MVMA 1M90W 3SYQA 1DTOA 2A9HA 1MABG 1DF5A 1R3JC 1PD3A 3CCRV 4E2LA 2H94A 2DYRC 4UV9A 4L87A 1M57B 3HPLC 1FXVA 4GX0A 4OXSA 1OCZC 4P2ZA 5DM6V 3E8GA 3NXSA 3UM7A 1YI2V 4XBFA 3QNEA 1AJNA 5CN0A 4WFGA 2DQ0A 2D3OW 2EIKC 2B1GA 5L3BA 4MVRA 3ABKB 4RQEA 3B8MA 1R3IC 2WPDG 3WG7B 4GCZA 2EJRA 2HVJC 4F4LA 1CPYA 4P30A 1KD1W 1BHAA 2WLJA 4UVBA 1ORQC 3F7YC 2W6IG 2IH3C 2WLHA 2YEVB 3PJSK 1VQ4V 3ZJZA 3ZRXA 2QE7G 4QNHB 5IDJA 3MHSC 2EINB 4TWKA 4X88A 1AI4A 2Z5UA 3QO5A 1V55B 1NKDA 5DN6G 2DWDC 1VQ5V 5LHHA 5B3SC 3OM3B 4Z1MG 4EKWA 1QCEA 5L3EA 1RM1B 1K4DC 2JEXA 2WLMA 4MTXA 3ABKC 3SPJA 2OTJV 3SYAA 2F43G 1R3LC 4MVQA 3CCVV 4R7CA 1H8EG 3X2QB 2IU0A 5IY5B 2X6AA 1VQNV 3K0GA 1NH2D 1E1QG 2ZDIC 4ZBMA 5BZBA 2HG5C 1R3KC 4MTOA 3LUTB 1OCRB 3ZRWA 4FJCC 1YJWV 5B1NA 4N21A 4LC1A 3JD3A 2V1DA 3CCSV 3SYCA 1GM8A 2EINC 4MTGA 1Y66A 3KG2A 4I9WA 5H6RA 1NH2B 1V55C 5H6QA 1AROP 3W7XA 3OMAB 1R73A 4MTFA 3SPGA 2ZXWC 4G28B 4JAVA 2ZQMA 2DWEC 3SPHA 2WLIB 3I55V 3FB5C 2JJ2G 2X7RB 5KA6A 1FFTB 5LGTA 4WF9V 1QR9A 2V7QG 2X6BA 3AG4B 3X2QC 3K79A 2W6JG 1K5QA 2ZD9A 1PNLA 3OEHG 1G8MA 1QVFU 3CCEV 1OCRC 3CC7V 1M1KW 3CC2V 3R65A 1OCOC 4G2KA 3ZRSA 4UUJC 1AR1B 3RBZA 1BL8A 2MK3A 2A0LA 3LDDA 4LP8A 4BIUA 1BHBA 2EIJC 1W2BU 3D3IA 4RUEA 3ETDA 3ZMUA 3QO8A 3ETEA 1CEZA 4PELA 1K3EA 4BW5A 1E79G 1YSCA 2WLLA 2PI5A 4ZKIA 3ETGA 4J9ZB 5EC1C 5EBLC 4WCEV 5CMUA 4N23A 1YIJV 1NR7A 3OUFA 4X89A 3OEEG 1S3JA 3CYOA 4GX5A 4R6ZA 1E1RG 2EILB 4KP4A 3DGEA 3MHHC 4FIPC 3B77A 3ASOB 1B6QA 4CZZA 4MVOA 3E89A 2P67A 1AI6A 1EBOA 2GHYA 2BOBC 3G4SV 2EZOA 3B8NA 2EBOA 3K04A 3LSSA 3W7UA 3K9AA 4QJFB 4GT1A 1MG1A 2UXXA 4QE7A 1WPXA 2W0FC 5KA5A 2R9IA 2XAJA 3AG3B 1NJIW 3EFFK 5B3SB 4JTDB 1GKFA 1W0JG 4WFAV 1F23A 1CP9A 1FXHA 3P32A 3RVZA 1R6NA 4JASA 5L3DA 3FB8C 2B1IA 1S5HC 1F4MA 1G4YB 4TT3G 3SJQC 2R9RB 3ZN1A 2EILC 3F7VC 4ASUG 4KFMA 2XASA 2XNDG 1COWG 3ASOC 1Q7YW 3BEHA 1P4RA 1GM9A 5KUMA 1AI7A 4HZ3A 2GSMB 1K33A 4R50A 3ABMB 4JAUA 4XDKA 2Q68A 3SYOA 1OCCB 4XDJA 1ROPA 5EC2C 5E1AC 1Q86W 2C2AA 3T4DA 3AG3C 4I5SA 5B1BB 3JD4A 2HVKC 3CCUV 2PI4A 3CPWU 2HKOA 1MSWD 2ZXWB 1AJPA 1IXMA 1DF4A 3ABLC 1EFRG 1SZTA 1S0VA 1N8RW 3GB7C 1K9MW 2NLJC 3OW2U 1KC8W 1FXKA 2HR3A 1S77D 5HFMA 2JK5C 3WFVA 2OTLV 1BMFG 3VBBA 1NR1A 3G71V 4RO2A 1JPXA 2M7WA 1I5XA 3MD0A 2QA4V 3E86A 1KP2A 3D36A 3ABMC 3ZMTA 1JQ0A 1H38A 1AI5A 1PKXA 1OCCC 1OCOB 4MT8A 1ENVA 1QVGU 2EIJB 2IJIA 2Q67A 4X8AA 5B1BC 1GTOA 5L3FA 3AG2C 3CCJV 2X0LA 3FYIB 3A0RA 4WFHA 4JGSA 3TCUA 3CC4V 3OMIB 4RQFA 2JJ1G 3EHBB 3FYEB 4JYBA 3SPIA 3BY6A 3ML0A 2UXNA 2X6CA 1K7DA 1JOYA 3OGCC 1RPOA 1KQSU 2BOCC 3OR6C 4WFFA 3UKMA 1Q81W 1V54B 1YHQV 2DYSC 1Q82W 1GK9A 4FPPA 3P30A 3ZRWB 2JIZG 4QE9A 1GO3F 4RAIA 3ZMZA 3ASNC 3H01A 2CK3G 1QBZA 3JD2A 5CBFA 1XL6A 2QM7A 4Q20A 2DW4A 5LHIA 3JYCA 3AG1B 4BIZA 5B1OA 3ABUA 5KUKA 4CBCA 1PL0A 5EBWC 1QR8A 4JPRA 3OUSA 3ZRVA 5B1AC 2B5UA 1K73W 3K08A 4UVAA 1SRYA 2ZR2A 4DO2A 3ZMSA 1V54C 2IU3A 1NQTA 1YJ9V 3AEIA 4WFEA 3FKSG 3OMNB 4QIWF 2HFEC 4UVCA 2WSSG 5CA3A 2ITCC 2Y69C 1K8AW 1F4NA 1S72V 2K1EA 3LNMB 3LDCA 1M56C 3E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI C;  3AEI A;  1FXK A;  1FXK C;  1FXK B;  2ZQM A;  2ZDI A; 
#chains in the Genus database with same CATH topology
 2YSU B;  2QTO A;  2IM9 A;  1AVM A;  2AHZ A;  2P6J A;  5H9C A;  4O4H A;  2E74 B;  1QQC A;  2PYJ A;  5DED A;  4UV8 A;  5KX5 A;  2Y4T A;  3JAL B;  1XHZ A;  2P90 A;  2HLD G;  2A79 B;  2Y48 A;  4GKK O;  1HWY A;  1GH6 A;  2WWW A;  4O4L B;  1N33 B;  3LSQ A;  2EIM C;  4HBN A;  1TUB A;  1AP5 A;  5BR8 B;  4JYA B;  1SZX A;  5IJ9 B;  2YID A;  2W0X A;  4LFB B;  1ZL8 B;  2FB5 A;  3OE7 G;  2IW5 A;  3J81 N;  2YI8 A;  4PA6 A;  2ITD C;  1Q90 D;  4AHC A;  5FL7 G;  2A3Q A;  5LGU A;  3ICX A;  3OFN G;  1JCH A;  3SPC A;  5C8Y A;  4NXN B;  5J9P C;  1JVM A;  1KUQ A;  5KMG B;  2DMX A;  5IYC O;  2LJ2 A;  3M99 B;  5L3C A;  1JJ2 U;  5C93 A;  4GX2 A;  3ABT A;  1G6U A;  3OTO O;  3K3W A;  2UXB O;  3W7T A;  1THZ A;  1XNQ O;  1VQ9 V;  1B06 A;  3RYC B;  4MVU A;  1J5E B;  2BTQ B;  4GX1 A;  1XL4 A;  4CC6 A;  4HYO A;  5CA0 B;  1YIT V;  4LF6 B;  4LCU C;  2R9A A;  2CE4 A;  3N2K B;  5K1X A;  4QPK A;  2NNU A;  3JAK B;  2E5L B;  3TJT A;  5D5P A;  5FPR A;  3E8H A;  4MW8 A;  1M56 B;  1XIL A;  3DXR B;  4DYL A;  4K3A A;  4X1I B;  4J9Y B;  4JYC A;  3ZIA G;  1H2N A;  1WLE A;  4KHP B;  1LNQ A;  4TUY B;  4JI8 O;  1H8H G;  4K35 A;  4MVZ A;  3JAW B;  1M9N A;  3SR2 C;  4JI5 O;  2WA4 A;  4KUM A;  3D36 C;  3E8B A;  3TXQ A;  4B3S B;  2EIM B;  1FJG B;  1K4C C;  4DV7 B;  1VQ7 V;  2Z3Y A;  2LFR A;  2ZR3 A;  3K03 A;  3AG4 C;  3ZN0 A;  3UQ8 A;  2VQE B;  3CCM V;  4FLZ A;  1XMO O;  1OZ0 A;  5LL6 Y;  3RW0 A;  4P9O A;  4FLY A;  3T1H O;  5EIB C;  3K5O A;  4X66 B;  4JI7 O;  2A9H A;  2GV9 A;  2H94 A;  5JVD B;  4JZG A;  4GX0 A;  5DM6 V;  5IYZ B;  4CH4 A;  2F66 C;  3K9S A;  1WA8 A;  3BAA A;  1CXZ B;  3H1I H;  3ABK B;  4WBN A;  2WPD G;  2QWN B;  3KCY A;  4JZ2 A;  1KD1 W;  3P3P A;  1R1B A;  5KAF Z;  2W6I G;  2IH3 C;  3PJS K;  4B3M O;  2QE7 G;  3ZBH A;  4QNH B;  1BQ0 A;  4NTW A;  1N36 O;  1V55 B;  5H2F Z;  5B3S C;  5LOV A;  1QCE A;  3UT5 A;  2F43 G;  4W4K A;  3C3S A;  5JCO A;  2BTO A;  3X2Q B;  1HR0 O;  2X6A A;  2P4K A;  4JI0 B;  1NH2 D;  4ZBM A;  3ZRW A;  4N21 A;  3PN1 A;  4LC1 A;  1IBM B;  3JAS B;  2GTA A;  2UUA O;  2EIN C;  4L8J A;  1NH2 B;  3KG2 A;  3SGI A;  3H9V A;  1WP7 A;  4K0K B;  2EX3 A;  2ZIO A;  3W7X A;  1VIB A;  4B3T O;  3BA9 A;  2ZQM A;  2DWE C;  2WLI B;  3FB5 C;  1FFT B;  3QG5 A;  5LGT A;  4WF9 V;  5EIB D;  3T1Y O;  3AG4 B;  4J11 A;  2M6Y A;  4IGG A;  1OJH A;  5JJE B;  2JRI A;  3CCE V;  3L75 H;  1Z5W A;  3CC7 V;  4U3F H;  3CC2 V;  3G67 A;  4G2K A;  4UUJ C;  3RBZ A;  1KKC A;  4BIU A;  2A0L A;  3D3I A;  4RUE A;  4X1Y B;  3ETE A;  1K3E A;  2QWQ B;  1E79 G;  1Y67 A;  4F6R B;  2WLL A;  4FLV A;  2YXH A;  2Q0A A;  5CMU A;  5BR8 O;  1JMK C;  5J2T A;  4JYA O;  4R6Z A;  2YI9 A;  4UB8 Z;  2JVD A;  4FIP C;  2UU9 B;  4MVO A;  4LFB O;  3S3W A;  4DV1 B;  2GHY A;  2QWR B;  1QU7 A;  5LXT A;  2EBO A;  2PZS A;  3QF7 A;  2GUZ A;  1MG1 A;  4X20 B;  1WPX A;  1I7F A;  2ARH A;  2R9I A;  2XAJ A;  4NXN O;  3EFF K;  5B3S B;  4BIO A;  4O4I A;  1W0J G;  1F23 A;  3CRQ A;  1SQG A;  4NVP A;  4JAS A;  2FL4 A;  2RJZ A;  2B1I A;  1F4M A;  2IBZ H;  1NI8 A;  3ZN1 A;  4Z1V A;  3L70 H;  3ASO C;  5KHJ A;  4YIO A;  1BE3 H;  2LQT A;  1J5E O;  4I50 B;  5KUM A;  1K33 A;  3SYO A;  2XTA A;  2C2A A;  4LF6 O;  3T4D A;  4O4J A;  1JFF B;  3JD4 A;  3CCU V;  1ZTE A;  4DV3 B;  4ICG A;  2HEP A;  3CPW U;  2FKX A;  2E5L O;  4LF8 B;  4FLX A;  1MSW D;  1DF4 A;  1XHX A;  1EFR G;  1SZT A;  4CH5 A;  1N8R W;  3GB7 C;  4DV4 B;  1K9M W;  2NLJ C;  3RYH B;  3WFV A;  2AZ2 A;  1BMF G;  4O2A A;  1JPX A;  5TIS Z;  3RGB A;  5LA6 B;  1I5X A;  2PUS A;  3ABM C;  1H38 A;  4LF4 B;  1AI5 A;  4KHP O;  1PKX A;  4I0X B;  1OCC C;  5ITZ B;  1WN7 A;  4MT8 A;  4J41 A;  4C7U A;  4KXR A;  5L3F A;  1EM1 A;  3CC4 V;  2ZIN A;  3TCU A;  2YUA A;  4B3S O;  1YF2 A;  2KG7 B;  4DV7 O;  2JJ1 G;  3SPI A;  2E76 B;  2UXN A;  2X6C A;  1RPO A;  2VQE O;  2ZIM A;  1Q81 W;  3FAV A;  3HKD B;  1Q82 W;  5J2U B;  3P30 A;  1WJZ A;  5GTH Z;  3ZMZ A;  4X66 O;  3ASN C;  3H01 A;  2CK3 G;  4YHH B;  4FFB B;  2Y0P A;  4FLT A;  4TV9 A;  1B04 A;  2RNB A;  5KUK A;  5B1A C;  2DN9 A;  4ZOL A;  2NR5 A;  1SRY A;  3ZMS A;  2ZNI A;  3CEI A;  3DC5 A;  1K8A W;  1S72 V;  2DJV A;  2CDY A;  3LDC A;  2L35 A;  3CSX A;  2EUL A;  4YXW G;  3AG1 C;  4JI2 B;  1XEQ A;  1MOF A;  3IFX A;  1VQP V;  1Z2G A;  2YXL A;  1OHH G;  2ZDI A;  5KHK A;  5LHG A;  1Y6X A;  3JCZ A;  3K5L A;  4IHJ A;  4DV5 B;  3K06 A;  5JH7 A;  1W59 A;  3GWK C;  2AHY A;  4FFK A;  2OCC C;  4JI0 O;  1GM7 A;  5BY1 A;  3JD0 A;  1WB8 A;  1QLE C;  4JYY A;  1KEC A;  3JSL A;  5GTI Z;  4TSF G;  2JEU A;  1IBM O;  3RFR A;  3TET A;  4TV8 B;  1X59 A;  4ZI7 B;  4I55 B;  3FFQ A;  1WB7 A;  1IVS A;  4K0K O;  5BMV A;  5DEC A;  2LP7 A;  5E79 Z;  1RPR A;  5EYP B;  4FMT A;  4Q6G A;  1K34 A;  5GW7 A;  1SER A;  1VQ6 V;  4GKJ O;  1TVK A;  3VQX A;  3T4Z A;  4LFA O;  4YIP A;  2OT5 A;  4IIJ A;  5CB4 A;  4P9P A;  1SET A;  3ASN B;  3E2E A;  1NBM G;  4LBE C;  4J7J A;  1XRE A;  3L72 H;  4NKG B;  4PDL A;  3HKB B;  2XAQ A;  2QEX V;  3STL C;  2K9P A;  2XAF A;  2IJK A;  5IWA B;  5B1A B;  1FXK B;  2Q69 A;  4QPJ A;  1IXB A;  2H8P C;  2OIE A;  4LNU A;  5KAI Z;  1BS3 A;  1VF6 C;  4ZHQ B;  2UU9 O;  1F51 A;  1K97 A;  1Q6I A;  1WAZ A;  1RM1 C;  4DV1 O;  1P7B A;  3JAT B;  5LGN A;  4YY3 B;  5IY5 C;  4PDR A;  1FKA O;  3WB0 A;  2AW9 A;  2CTR A;  3WU2 Z;  2Q6A A;  3W7W A;  2Q0O C;  5LP6 C;  2FML A;  1XDC A;  4BW9 A;  3FD9 A;  3DTU B;  3STZ C;  1Q6H A;  2Y0I A;  4MVS A;  3UO2 A;  1S5J A;  3FB7 C;  2ZE7 A;  2WAM A;  1TAE A;  2OCC B;  4DV0 B;  1OCZ B;  3VQY A;  3DSQ A;  4NTY A;  2JGU A;  4PA9 A;  1QLE B;  3OAA G;  5CBG A;  3OTF A;  1SC5 B;  1H2M A;  1Q6U A;  3JAL A;  1YJN V;  3CB2 A;  1EZJ A;  3ZHS A;  2F95 B;  2QM8 A;  1IBL B;  1GMG A;  4O4L A;  4HAM A;  4DV3 O;  2UXD B;  3CE2 A;  1PNM A;  1N34 B;  4MVM A;  1LUV A;  1DTO A;  1AP6 A;  4DV4 O;  2F1M A;  3CCR V;  1PD3 A;  2UXC B;  3HPL C;  4H13 B;  5IJ9 A;  5D5Q A;  2E3C A;  3UM7 A;  4UCV A;  3Q4H B;  1EN4 A;  1DK1 A;  3QNE A;  1AJN A;  1ZL8 A;  4LF4 O;  4H0L B;  1RP3 B;  2DQ0 A;  5LYJ B;  4MVR A;  3B8M A;  1R3I C;  1Y74 B;  4X1K B;  4DW0 A;  4GCZ A;  2HVJ C;  4B7K A;  4B08 A;  4P30 A;  1VF6 A;  2UUB B;  1O9G A;  2H3O A;  5KMG A;  3F7Y C;  1Q43 A;  1Q8I A;  3MHS C;  4E4E A;  2N04 A;  1AI4 A;  2A06 H;  3QO5 A;  5DN6 G;  1NKD A;  1XMQ B;  1VQ5 V;  5LHH A;  3OM3 B;  3RYC A;  1TUB B;  1I0H A;  2LGQ A;  2BTQ A;  1RM1 B;  3O65 A;  3ABK C;  4YHH O;  1YVW A;  1AIL A;  2OTJ V;  3CCV V;  5CA0 A;  5IY5 B;  3K0G A;  1GN2 A;  3N2K A;  3JAK A;  1WPB A;  5LP6 B;  1OCR B;  3TGU H;  2QGN A;  1YJW V;  4DR2 B;  1SF9 A;  4MTG A;  1Y66 A;  5H6R A;  2Q7H A;  1V55 C;  3DXR A;  5H6Q A;  1ARO P;  3RYI B;  3H1L H;  3OMA B;  4X1I A;  2JJ2 G;  5KA6 A;  4TUY A;  1KYO F;  3X2Q C;  4PJ0 Z;  1K5Q A;  3JAW A;  3MAQ A;  1PNL A;  1Q3E A;  3OEH G;  4JI2 O;  1M1K W;  1BL8 A;  2MK3 A;  4LP8 A;  4DV5 O;  1W2B U;  3E22 A;  2F4V B;  2DE0 X;  2BSK B;  4PEL A;  1CEZ A;  4J9Z B;  4DR4 B;  1BQZ A;  2QWP B;  4WCE V;  4W4L A;  1SA0 B;  1YIJ V;  1HP8 A;  1NR7 A;  2VWK A;  1MMM A;  3L73 H;  4X64 B;  5IJ0 B;  5K1P A;  3CYO A;  4CC5 A;  1IBK B;  4FLU A;  1X4T A;  3MHH C;  5JVD A;  5IYZ A;  2P22 C;  4JV5 B;  2BCC H;  3ZHT A;  1AI6 A;  1PM9 A;  2QSA A;  2BOB C;  3G4S V;  3K9A A;  4GT1 A;  1VF5 B;  4QE7 A;  1SKV A;  5KA5 A;  1HW7 A;  1SQQ H;  3D3Q A;  4I4T B;  2R70 A;  2KSD A;  2Q7G A;  1FXH A;  1H2S B;  3P32 A;  4J10 A;  1VEW A;  3FB8 C;  4TT3 G;  1GN3 A;  1G4Y B;  1S5H C;  2R9R B;  3F7V C;  2XND G;  1Q7Y W;  5LMN O;  2RQ6 A;  3HKC B;  2OCH A;  4R50 A;  3CWB H;  5KHG A;  1B3Q A;  5IWA O;  1ROP A;  4U3J B;  4JI1 B;  4I5S A;  2Y4U A;  4KL1 A;  5H5N A;  1YCI A;  1AJP A;  1L0L H;  4LH6 A;  1Y76 B;  2Q8V A;  2LW7 A;  1Q5O A;  2KQX A;  1P7G A;  1KC8 W;  3L71 H;  4JI4 B;  5GON B;  4YY3 O;  5HFM A;  3BHP A;  2JK5 C;  3JAS A;  1NR1 A;  4IYH A;  2M7W A;  3E86 A;  3D36 A;  1JQ0 A;  4UCR A;  5KHI A;  4DRX B;  1BZK A;  3AG2 C;  2CUG A;  3FYI B;  3A0R A;  4JGS A;  4PI2 A;  3A0H Z;  3H1K H;  4UCS A;  3BY6 A;  1JOY A;  3OGC C;  4WFF A;  1V54 B;  4X1Y A;  2DYS C;  1YHQ V;  1IBL O;  3IC9 A;  1AR4 A;  2UXD O;  1FPO A;  3ZRW B;  4F6R A;  2JIZ G;  4QE9 A;  1GO3 F;  1N34 O;  4AIL C;  1QHT A;  3BA8 A;  2UXC O;  1U97 A;  1N33 O;  1YZB A;  1XL6 A;  3BVO A;  2DW4 A;  5LHI A;  3JYC A;  3ABU A;  5B5E Z;  1PL0 A;  4JI6 B;  1NTZ H;  1NZ6 A;  4UVA A;  4DO2 A;  1PL4 A;  4X20 A;  3CXH F;  1GAX A;  2ZCE A;  1QNM A;  4UVC A;  2WSS G;  5CA3 A;  4ZIB A;  2UUB O;  2N74 A;  3THO A;  2Q73 A;  4A5U B;  3B2E E;  1AB3 A;  3AG7 A;  1XI1 A;  4FK5 C;  4PA7 A;  4PDM A;  2CH7 B;  1XBL A;  3CJH B;  1XMQ O;  1D5A A;  3OGI B;  4GYC B;  4JTC B;  4I50 A;  3JCU Z;  3M8A A;  4JTA B;  4NYK A;  2XAG A;  1VQ8 V;  2YEV A;  3RWR D;  3BAB A;  2GDS A;  3D8C A;  1JFF A;  1QLN A;  4FLW A;  4MS2 A;  2QTS A;  1XNR B;  2WLN A;  2WA3 A;  4DR3 B;  1A32 A;  2A7W A;  3CCQ V;  4EB6 B;  3CP1 A;  2ZE6 A;  3G6E V;  2AGA A;  3AG2 B;  3B09 A;  3E35 A;  4G27 B;  2IH1 C;  1L8D A;  2CGO A;  2IJJ A;  3KKY A;  4B3R B;  1L1F A;  2VQF B;  2YIA A;  4MW3 A;  2G38 A;  5LA6 A;  4H37 A;  4X65 B;  2XOK G;  2KKW A;  1BSM A;  2QDO A;  4I0X A;  5ITZ A;  2UUC B;  4LWS B;  1M57 C;  1R6T A;  3FB6 C;  2DYS B;  1NU1 H;  1MZF A;  1SQB H;  1NVP D;  3RN4 A;  5FNV A;  2KG7 A;  1VQM V;  5AG2 A;  5A9G A;  1VQK V;  1YTF D;  2F4V O;  2GTS A;  2PYL A;  3WG7 C;  3OR7 C;  2PTM A;  1EZV H;  1NVP B;  1G1X B;  1MSD A;  2QJ1 A;  3CCL V;  4D7S A;  1FJG O;  3HKD A;  4PA4 A;  4DR4 O;  2FTK A;  4J42 A;  3SJB C;  3SYP A;  4F6E A;  3W7S A;  1IUR A;  5J2U A;  1YTF B;  2YIB D;  1I94 B;  1NS1 A;  4X64 O;  1IBK O;  2OYQ A;  3IGA C;  4FFB A;  1DGS A;  4LF7 B;  4JV5 O;  3IC7 A;  4OX9 B;  1H2K A;  2HJF C;  3ZMV A;  1GN6 A;  3VQV A;  1HDJ A;  1KBH A;  4BAY A;  3ZCC A;  4H33 A;  1N32 B;  2FYU H;  2EJ7 A;  2RMK B;  4PDV A;  4UCT A;  1ZWI C;  1FXK C;  3RYF B;  4UXN A;  5KLV H;  2WLK A;  5JJJ B;  1FYJ A;  2DYR B;  1DLB A;  1WP8 A;  3CD6 V;  4OPH A;  5CBH A;  3TK1 A;  1ZUQ A;  4HNA A;  3BCC H;  4YJ3 B;  1F7Y A;  1T5E A;  4PHZ A;  1LUW A;  3JAR B;  2EIK B;  4K8X A;  3GWO A;  4JI1 O;  1UJW B;  4DV6 B;  4U7N A;  4UB6 Z;  1H2G A;  3QTC A;  1YDX A;  4U7O A;  5IT9 N;  2F93 B;  3SYQ A;  4I7Z B;  1MAB G;  1R3J C;  4E2L A;  4UV9 A;  4JI4 O;  1M57 B;  3CS5 A;  1FXV A;  4P2Z A;  1OCZ C;  3E8G A;  3NXS A;  4TV8 A;  1YI2 V;  4ZI7 A;  4I55 A;  4XBF A;  1TGO A;  3JAM N;  3L9D A;  5EYP A;  4CH3 A;  5CN0 A;  4WFG A;  3EXA A;  2D3O W;  2B1G A;  3TXS A;  3WG7 B;  3APO A;  3N2G B;  3BRC A;  4F4L A;  4UCU A;  5JQG A;  1ORQ C;  4ABM A;  1VMG A;  3WB1 A;  2WLH A;  4TQF A;  4O2B B;  1NT2 B;  5IDJ A;  4TWK A;  4X88 A;  2Z5U A;  1IZ3 A;  2OIG A;  2QM4 A;  5L3E A;  3HKB A;  2P4V A;  1K4D C;  2WLM A;  1N0J A;  3SPJ A;  3SYA A;  4MVQ A;  4R7C A;  1H8E G;  2RN9 A;  4DR6 B;  1YEW A;  4DR7 B;  3T1Y B;  3L74 H;  1E1Q G;  3CRC A;  4ZHQ A;  4IT5 A;  4MTO A;  3LUT B;  4J7K A;  5B1N A;  4EFE A;  4JI6 O;  2V1D A;  3SYC A;  1GM8 A;  4I9W A;  3JAT A;  3ZHV A;  1L0N H;  1YXB A;  4BR6 A;  3SPG A;  4MTF A;  5EZY B;  5CB4 B;  2Q7E A;  3HKE B;  2X7R B;  3UO3 A;  2X6B A;  4PV1 B;  1KB9 F;  1QVF U;  4NTX A;  2P5O A;  1OCR C;  4YJ2 A;  3CHX A;  3ZRS A;  4OPA A;  4H44 B;  1IDS A;  2CAZ C;  3ETD A;  3ZMU A;  3QO8 A;  4IL6 Z;  1FAF A;  3DC6 A;  1YSC A;  1FD9 A;  2PI5 A;  2E75 B;  1N0N A;  2AXT Z;  1ZX3 A;  3VQW A;  5EBL C;  1XNR O;  4N23 A;  4DR3 O;  3OUF A;  4X89 A;  1M93 A;  3OEE G;  1S3J A;  1JA8 A;  4EFB A;  1E1R G;  2EIL B;  2JGD B;  3DGE A;  5LMU B;  3B77 A;  1B6Q A;  4LF8 O;  2LGW A;  3E89 A;  3LNN A;  1RSO B;  1URF A;  2P67 A;  3S3X A;  4DV2 B;  3Q4H A;  2VQF O;  4X65 O;  2EZO A;  3W7U A;  1FFX B;  4QJF B;  3H1H H;  3WB2 A;  2UUC O;  5LYJ A;  2W0F C;  3N27 A;  4EEQ A;  5CA1 B;  1EN5 A;  1Y74 A;  3AG3 B;  4X1K A;  2P06 A;  1GKF A;  1M4U A;  1CP9 A;  1JR9 A;  2ZM6 B;  3RVZ A;  1R6N A;  2CTP A;  2L6L A;  4O4H B;  4ASU G;  4KFM A;  2Q9L A;  3A2F A;  1COW G;  3I5D A;  4NXM B;  1P4R A;  5KX5 B;  4JAA A;  2GSM B;  3B4S A;  3C90 A;  4JAU A;  4XDK A;  4XDJ A;  5EC2 C;  1I94 O;  5B1B B;  2HVK C;  2PI4 A;  4RWU A;  4LF7 O;  2BE3 A;  3ABL C;  3QVN A;  4OX9 O;  1S0V A;  3JSN A;  5LP6 A;  3ZS8 C;  3OW2 U;  1S77 D;  4LF9 B;  3B40 A;  3VBB A;  4RO2 A;  1N32 O;  1KU9 A;  3RYI A;  2QA4 V;  1KP2 A;  2QKA A;  3ZMT A;  2YDE A;  2ETN A;  4FVM A;  1QVG U;  2IJI A;  5C8Y B;  3CCJ V;  2X0L A;  4WFH A;  1NTK H;  4CH6 A;  2ZE8 A;  2YIC A;  4DR5 B;  2ZE5 A;  3FYE B;  4JYB A;  3ML0 A;  1K7D A;  1XQ8 A;  4LH7 A;  2PGG A;  3OR6 C;  4DV6 O;  2BSK A;  4FPP A;  5KHH A;  3UCS C;  1MNG A;  3ETQ A;  4AQY B;  1QBZ A;  2XHB A;  4OGQ B;  1SA0 A;  3CRA A;  3IJ4 A;  5IJ0 A;  1SQF A;  4NB5 A;  1UFI A;  5B1O A;  4UFZ A;  2QWO B;  2YS8 A;  5EBW C;  1QR8 A;  3OD4 A;  4NR1 A;  5JCO C;  2B5U A;  1K73 W;  4LF5 B;  4QGP A;  2ZR2 A;  4TOI A;  1V54 C;  1NQT A;  3AEI A;  4WFE A;  3FKS G;  3OMN B;  4I4T A;  2Y69 C;  2K1E A;  1ZLZ A;  1LR1 A;  3E22 B;  2O57 A;  5JJN B;  4J7Z A;  2CTW A;  4CS3 A;  4LFC B;  1ZSP A;  3ABL B;  2QKC A;  4PA3 A;  3VOU A;  3JD1 A;  3HKC A;  1N4C A;  4DUY B;  2Q5Z A;  5L3G A;  3F5W C;  3T2M A;  4DR6 O;  4U3J A;  2OWO A;  3SJC C;  4DR7 O;  1D2D A;  1PNK A;  1VQO V;  2KB1 A;  3J7A U;  1GRJ A;  4X62 B;  5IYB O;  4CS4 A;  1Y76 A;  3SDL A;  3ZED A;  1FS0 G;  1SQX H;  2DQ3 A;  3T1C A;  4DK0 A;  1UPG A;  3KCX A;  2YC0 A;  4TQD A;  1S76 D;  5GON A;  1R6K A;  1SES A;  1WNS A;  1S5L Z;  4DK1 A;  1VQL V;  3E8F A;  1WA8 B;  3HB3 B;  4XDL A;  3CMA V;  1RFY A;  4WBN B;  3KZI Z;  1JX9 A;  1KKD A;  4DRX A;  3SJA C;  1Y4M A;  3QO7 A;  1TUE B;  1AJQ A;  2D2C B;  2MW2 B;  1K5S A;  2WLI A;  4MSW C;  4FM0 A;  2QKS A;  5F2V O;  2ATK C;  2ODM A;  1XOU A;  4DV0 O;  1KP3 A;  1J95 A;  5BXZ A;  5LOV B;  5IYD O;  3BFR A;  3UT5 B;  2LW1 A;  2HJD A;  1JJO A;  3FX7 A;  2ILM A;  2JDI G;  2NN4 A;  5LMU O;  4JF3 A;  3G80 A;  2AZ0 A;  2Y69 B;  4WFB V;  4DV2 O;  2IJH A;  3LDE A;  4R8C A;  3HR0 A;  5HFL A;  4D6T H;  2PY5 A;  4GKJ B;  4PI0 A;  3CXC U;  4LFA B;  1HNW B;  5EK0 A;  4UCO A;  2ZM6 O;  1BT8 A;  2HHH B;  4GUN A;  2LFS A;  3O9O A;  3ZHR A;  1US6 A;  1W0K G;  5EBM C;  2CH7 A;  4NXM O;  2CGN A;  3CJH A;  4DXW A;  4RUF A;  5LBQ A;  4LR3 A;  4DR1 B;  1I08 A;  3K0D A;  1K92 A;  4DUZ B;  2WLL B;  3CME V;  3AK1 A;  3ZHQ A;  2P7T C;  4FZ1 A;  2EZP A;  1I5Y A;  2HP8 A;  3RVY A;  2XAH A;  2YXY A;  3ZHU A;  3I56 V;  5J2T B;  1HNX B;  1IX9 A;  3MDS A;  1M90 W;  1DF5 A;  2DYR C;  4L87 A;  4EB6 A;  4OXS A;  4LF9 O;  2VS0 A;  3F5T A;  1P84 F;  1GN4 A;  5LXT B;  1HNZ B;  4DR2 O;  2GUZ B;  4JI3 B;  2EIK C;  3M7M X;  5L3B A;  3A8T A;  4X9Q A;  4RQE A;  3RYH A;  4LWS A;  4O4I B;  2EJR A;  1CPY A;  3K57 A;  2JS3 A;  2WLJ A;  1BHA A;  4UVB A;  4DR5 O;  1TA8 A;  2YEV B;  1VQ4 V;  3ZJZ A;  3ZRX A;  3K59 A;  3H1J H;  2EIN B;  1V9P A;  1MZE A;  2DWD C;  4BWA A;  3BPZ A;  4Z1M G;  4EKW A;  5B66 Z;  1VF7 A;  4Z2W A;  2JEX A;  4MTX A;  4GKK B;  4AQY O;  4O4J B;  1R3L C;  4D7T A;  2IU0 A;  1VQN V;  2ZDI C;  5BZB A;  2HG5 C;  1R3K C;  1Z5V A;  2RCV A;  1O9H A;  4FJC C;  2YIB A;  2ZKO A;  3JD3 A;  3CCS V;  4LF5 O;  3CRM A;  3U0Z A;  4O2A B;  1ZAU A;  1VAR A;  1BCC H;  1R73 A;  2ZXW C;  4G28 B;  4JAV A;  5FNV B;  1OV9 A;  3SPH A;  3AK3 A;  4FZ0 A;  3I55 V;  1KMI Z;  3OT7 A;  1QR9 A;  2V7Q G;  2ADQ B;  3K79 A;  3RYF A;  2W6J G;  2ZD9 A;  4LFC O;  2ZNJ A;  1G8M A;  2XUM A;  3NR7 A;  2XT9 A;  3R65 A;  1OCO C;  2Q4P A;  1AR1 B;  4YJ3 A;  1EN6 A;  1BHB A;  3LDD A;  3OTO B;  2EIJ C;  4DUY O;  3FAV B;  2UXB B;  3JAR A;  1XNQ B;  1NTM H;  4I9Q A;  4FM2 A;  4BW5 A;  5IE9 A;  4ZKI A;  3ETG A;  5FPO A;  5EC1 C;  4B7E A;  3APQ A;  4X62 O;  4TV9 B;  4GX5 A;  4KP4 A;  2VRZ A;  3R66 A;  3ASO B;  4CZZ A;  1EBO A;  4ZOL B;  3B8N A;  3K04 A;  3LSS A;  2UXX A;  3RT3 C;  3EVK A;  4K8Z A;  2B9Z A;  1NJI W;  2RDC A;  3U10 A;  4JTD B;  4HNA B;  4GZR B;  4WFA V;  3N2G A;  4JI8 B;  1M5I A;  3LSU A;  5L3D A;  3SJQ C;  1PPJ H;  2EIL C;  4JI5 B;  2XAS A;  4O2B A;  4DW1 A;  3BEH A;  1PV0 A;  4AI8 A;  1GM9 A;  2N05 A;  1AI7 A;  5FLX N;  3K5M A;  4HZ3 A;  3IAY A;  4IHJ B;  3ABM B;  2Q68 A;  5JH7 B;  1OCC B;  2F23 A;  3ZX6 A;  5E1A C;  1Q86 W;  1VP7 A;  4FM1 A;  3G6B A;  1XMO B;  3AG3 C;  3T1H B;  2HKO A;  2ZXW B;  1IXM A;  2ZT9 B;  3CRR A;  4JI7 B;  3K58 A;  1FXK A;  3J80 N;  2HR3 A;  1D5N A;  3A0B Z;  2OTL V;  5JWP A;  5BMV B;  3G71 V;  2ADP A;  1H2L A;  3MD0 A;  1HNW O;  4CS2 A;  5JQG B;  5EZY A;  1OCO B;  2HHH O;  3HKE A;  1ENV A;  2EIJ B;  1PP9 H;  2Q67 A;  1TVK B;  4X8A A;  5B1B C;  1GTO A;  2V4D A;  2Z0A A;  2CTQ A;  5LMN B;  1AR5 A;  4IIJ B;  3OMI B;  1U96 A;  2DOS A;  4RQF A;  2PF4 E;  3EHB B;  4DR1 O;  4B3M B;  5A2Q N;  4PD4 F;  1KQS U;  1SQP H;  3U11 A;  2BOC C;  4DUZ O;  1N36 B;  3UKM A;  1SS3 A;  3P3N A;  1GK9 A;  2GBO A;  4RAI A;  1SQV H;  1HNX O;  4LNU B;  4GLX A;  3JD2 A;  1XUQ A;  1HR0 B;  5CBF A;  3K5N A;  2QM7 A;  2R72 A;  4Q20 A;  4J80 A;  3C3T A;  2LO1 A;  2JGD A;  3AG1 B;  4BIZ A;  2VWJ A;  4CBC A;  1HNZ O;  3GVM A;  1RSO A;  4JPR A;  3OUS A;  3ZRV A;  4JI3 O;  3AK2 A;  2QR4 A;  1P49 A;  3K08 A;  2UUA B;  1FFX A;  1BGY H;  2IU3 A;  1YJ9 V;  4QIW F;  2HFE C;  4YJ2 B;  4B3R O;  5CA1 A;  4B3T B;  2ITC C;  3CX5 F;  4IYI A;  1F4N A;  3LNM B;  2JS5 A;  1MA1 A;  1M56 C;  3E83 A; 
#chains in the Genus database with same CATH homology
 2YSU B;  2QTO A;  4FK5 C;  4YXW G;  4PA7 A;  4PDM A;  2AHZ A;  2P6J A;  5H9C A;  3AG1 C;  1MOF A;  3IFX A;  4UV8 A;  1VQP V;  4JTC B;  3ABL B;  4PA3 A;  3VOU A;  1OHH G;  3JD1 A;  2ZDI A;  4JTA B;  2P90 A;  2HLD G;  5LHG A;  2A79 B;  2XAG A;  3JCZ A;  2Y48 A;  1HWY A;  3K06 A;  1VQ8 V;  2YEV A;  5L3G A;  3F5W C;  2WWW A;  3T2M A;  2AHY A;  2OCC C;  1GM7 A;  1PNK A;  1VQO V;  1QLN A;  3LSQ A;  2EIM C;  2KB1 A;  3JD0 A;  1QLE C;  4MS2 A;  1KEC A;  2WLN A;  5IYB O;  3CCQ V;  4TSF G;  2JEU A;  3CP1 A;  1FS0 G;  3TET A;  2DQ3 A;  3G6E V;  3T1C A;  3AG2 B;  1S76 D;  3E35 A;  4G27 B;  1R6K A;  1SES A;  2IH1 C;  2IJJ A;  2LP7 A;  1RPR A;  3E8F A;  1L1F A;  4FMT A;  1VQL V;  3OE7 G;  4MW3 A;  4H37 A;  2XOK G;  1K34 A;  2IW5 A;  3HB3 B;  4XDL A;  3CMA V;  5GW7 A;  4PA6 A;  2ITD C;  1JX9 A;  5FL7 G;  1KKD A;  5LGU A;  1SER A;  3SPC A;  3OFN G;  1JCH A;  1M57 C;  1VQ6 V;  1Y4M A;  3FB6 C;  3QO7 A;  3T4Z A;  2DYS B;  1TUE B;  5J9P C;  1AJQ A;  1JVM A;  1NVP D;  2OT5 A;  5IYC O;  3M99 B;  5L3C A;  4P9P A;  1JJ2 U;  1K5S A;  1SET A;  2WLI A;  3ASN B;  4GX2 A;  4MSW C;  5C93 A;  1VQM V;  3ABT A;  1VQK V;  2QKS A;  3E2E A;  1NBM G;  1YTF D;  3K3W A;  2ATK C;  4LBE C;  3W7T A;  1THZ A;  3WG7 C;  3OR7 C;  1VQ9 V;  4MVU A;  1NVP B;  1KP3 A;  1J95 A;  3CCL V;  4PDL A;  4GX1 A;  1XL4 A;  4PA4 A;  5IYD O;  2XAQ A;  2FTK A;  2QEX V;  3STL C;  3SYP A;  3W7S A;  1YTF B;  4HYO A;  2XAF A;  2IJK A;  5B1A B;  1FXK B;  2Q69 A;  4QPJ A;  1YIT V;  2H8P C;  2JDI G;  4LCU C;  3IGA C;  4JF3 A;  4QPK A;  2NNU A;  1F51 A;  1K97 A;  3IC7 A;  2Y69 B;  1RM1 C;  4WFB V;  2IJH A;  2HJF C;  3ZMV A;  1P7B A;  3E8H A;  4MW8 A;  3LDE A;  1M56 B;  4R8C A;  5LGN A;  5HFL A;  4BAY A;  5IY5 C;  4PDR A;  3ZCC A;  4H33 A;  4J9Y B;  4JYC A;  2Q6A A;  3CXC U;  3ZIA G;  3W7W A;  4PDV A;  1ZWI C;  1WLE A;  5EK0 A;  1LNQ A;  1H8H G;  1FXK C;  4MVZ A;  3DTU B;  4UXN A;  3STZ C;  2LFS A;  4MVS A;  3FB7 C;  2WLK A;  1M9N A;  2WAM A;  2DYR B;  1DLB A;  1W0K G;  3CD6 V;  4KUM A;  2OCC B;  5EBM C;  1OCZ B;  3E8B A;  5CBH A;  3TK1 A;  2EIM B;  4PA9 A;  4DXW A;  1K4C C;  1QLE B;  3OAA G;  4RUF A;  5CBG A;  5LBQ A;  1VQ7 V;  2Z3Y A;  2LFR A;  2ZR3 A;  3K03 A;  3AG4 C;  1EZJ A;  2EIK B;  3K0D A;  1YJN V;  1K92 A;  3ZN0 A;  3GWO A;  3CCM V;  1OZ0 A;  2QM8 A;  2WLL B;  3RW0 A;  1UJW B;  1GMG A;  4P9O A;  3CME V;  4HAM A;  2P7T C;  4U7N A;  2EZP A;  1I5Y A;  1H2G A;  1PNM A;  3RVY A;  2XAH A;  4U7O A;  3I56 V;  4MVM A;  1M90 W;  3SYQ A;  1DTO A;  2A9H A;  1MAB G;  1DF5 A;  1R3J C;  1PD3 A;  3CCR V;  4E2L A;  2H94 A;  2DYR C;  4UV9 A;  4L87 A;  1M57 B;  3HPL C;  1FXV A;  4GX0 A;  4OXS A;  1OCZ C;  4P2Z A;  5DM6 V;  3E8G A;  3NXS A;  3UM7 A;  1YI2 V;  4XBF A;  3QNE A;  1AJN A;  5CN0 A;  4WFG A;  2DQ0 A;  2D3O W;  2EIK C;  2B1G A;  5L3B A;  4MVR A;  3ABK B;  4RQE A;  3B8M A;  1R3I C;  2WPD G;  3WG7 B;  4GCZ A;  2EJR A;  2HVJ C;  4F4L A;  1CPY A;  4P30 A;  1KD1 W;  1BHA A;  2WLJ A;  4UVB A;  1ORQ C;  3F7Y C;  2W6I G;  2IH3 C;  2WLH A;  2YEV B;  3PJS K;  1VQ4 V;  3ZJZ A;  3ZRX A;  2QE7 G;  4QNH B;  5IDJ A;  3MHS C;  2EIN B;  4TWK A;  4X88 A;  1AI4 A;  2Z5U A;  3QO5 A;  1V55 B;  1NKD A;  5DN6 G;  2DWD C;  1VQ5 V;  5LHH A;  5B3S C;  3OM3 B;  4Z1M G;  4EKW A;  1QCE A;  5L3E A;  1RM1 B;  1K4D C;  2JEX A;  2WLM A;  4MTX A;  3ABK C;  3SPJ A;  2OTJ V;  3SYA A;  2F43 G;  1R3L C;  4MVQ A;  3CCV V;  4R7C A;  1H8E G;  3X2Q B;  2IU0 A;  5IY5 B;  2X6A A;  1VQN V;  3K0G A;  1NH2 D;  1E1Q G;  2ZDI C;  4ZBM A;  5BZB A;  2HG5 C;  1R3K C;  4MTO A;  3LUT B;  1OCR B;  3ZRW A;  4FJC C;  1YJW V;  5B1N A;  4N21 A;  4LC1 A;  3JD3 A;  2V1D A;  3CCS V;  3SYC A;  1GM8 A;  2EIN C;  4MTG A;  1Y66 A;  3KG2 A;  4I9W A;  5H6R A;  1NH2 B;  1V55 C;  5H6Q A;  1ARO P;  3W7X A;  3OMA B;  1R73 A;  4MTF A;  3SPG A;  2ZXW C;  4G28 B;  4JAV A;  2ZQM A;  2DWE C;  3SPH A;  2WLI B;  3I55 V;  3FB5 C;  2JJ2 G;  2X7R B;  5KA6 A;  1FFT B;  5LGT A;  4WF9 V;  1QR9 A;  2V7Q G;  2X6B A;  3AG4 B;  3X2Q C;  3K79 A;  2W6J G;  1K5Q A;  2ZD9 A;  1PNL A;  3OEH G;  1G8M A;  1QVF U;  3CCE V;  1OCR C;  3CC7 V;  1M1K W;  3CC2 V;  3R65 A;  1OCO C;  4G2K A;  3ZRS A;  4UUJ C;  1AR1 B;  3RBZ A;  1BL8 A;  2MK3 A;  2A0L A;  3LDD A;  4LP8 A;  4BIU A;  1BHB A;  2EIJ C;  1W2B U;  3D3I A;  4RUE A;  3ETD A;  3ZMU A;  3QO8 A;  3ETE A;  1CEZ A;  4PEL A;  1K3E A;  4BW5 A;  1E79 G;  1YSC A;  2WLL A;  2PI5 A;  4ZKI A;  3ETG A;  4J9Z B;  5EC1 C;  5EBL C;  4WCE V;  5CMU A;  4N23 A;  1YIJ V;  1NR7 A;  3OUF A;  4X89 A;  3OEE G;  1S3J A;  3CYO A;  4GX5 A;  4R6Z A;  1E1R G;  2EIL B;  4KP4 A;  3DGE A;  3MHH C;  4FIP C;  3B77 A;  3ASO B;  1B6Q A;  4CZZ A;  4MVO A;  3E89 A;  2P67 A;  1AI6 A;  1EBO A;  2GHY A;  2BOB C;  3G4S V;  2EZO A;  3B8N A;  2EBO A;  3K04 A;  3LSS A;  3W7U A;  3K9A A;  4QJF B;  4GT1 A;  1MG1 A;  2UXX A;  4QE7 A;  1WPX A;  2W0F C;  5KA5 A;  2R9I A;  2XAJ A;  3AG3 B;  1NJI W;  3EFF K;  5B3S B;  4JTD B;  1GKF A;  1W0J G;  4WFA V;  1F23 A;  1CP9 A;  1FXH A;  3P32 A;  3RVZ A;  1R6N A;  4JAS A;  5L3D A;  3FB8 C;  2B1I A;  1S5H C;  1F4M A;  1G4Y B;  4TT3 G;  3SJQ C;  2R9R B;  3ZN1 A;  2EIL C;  3F7V C;  4ASU G;  4KFM A;  2XAS A;  2XND G;  1COW G;  3ASO C;  1Q7Y W;  3BEH A;  1P4R A;  1GM9 A;  5KUM A;  1AI7 A;  4HZ3 A;  2GSM B;  1K33 A;  4R50 A;  3ABM B;  4JAU A;  4XDK A;  2Q68 A;  3SYO A;  1OCC B;  4XDJ A;  1ROP A;  5EC2 C;  5E1A C;  1Q86 W;  2C2A A;  3T4D A;  3AG3 C;  4I5S A;  5B1B B;  3JD4 A;  2HVK C;  3CCU V;  2PI4 A;  3CPW U;  2HKO A;  1MSW D;  2ZXW B;  1AJP A;  1IXM A;  1DF4 A;  3ABL C;  1EFR G;  1SZT A;  1S0V A;  1N8R W;  3GB7 C;  1K9M W;  2NLJ C;  3OW2 U;  1KC8 W;  1FXK A;  2HR3 A;  1S77 D;  5HFM A;  2JK5 C;  3WFV A;  2OTL V;  1BMF G;  3VBB A;  1NR1 A;  3G71 V;  4RO2 A;  1JPX A;  2M7W A;  1I5X A;  3MD0 A;  2QA4 V;  3E86 A;  1KP2 A;  3D36 A;  3ABM C;  3ZMT A;  1JQ0 A;  1H38 A;  1AI5 A;  1PKX A;  1OCC C;  1OCO B;  4MT8 A;  1ENV A;  1QVG U;  2EIJ B;  2IJI A;  2Q67 A;  4X8A A;  5B1B C;  1GTO A;  5L3F A;  3AG2 C;  3CCJ V;  2X0L A;  3FYI B;  3A0R A;  4WFH A;  4JGS A;  3TCU A;  3CC4 V;  3OMI B;  4RQF A;  2JJ1 G;  3EHB B;  3FYE B;  4JYB A;  3SPI A;  3BY6 A;  3ML0 A;  2UXN A;  2X6C A;  1K7D A;  1JOY A;  3OGC C;  1RPO A;  1KQS U;  2BOC C;  3OR6 C;  4WFF A;  3UKM A;  1Q81 W;  1V54 B;  1YHQ V;  2DYS C;  1Q82 W;  1GK9 A;  4FPP A;  3P30 A;  3ZRW B;  2JIZ G;  4QE9 A;  1GO3 F;  4RAI A;  3ZMZ A;  3ASN C;  3H01 A;  2CK3 G;  1QBZ A;  3JD2 A;  5CBF A;  1XL6 A;  2QM7 A;  4Q20 A;  2DW4 A;  5LHI A;  3JYC A;  3AG1 B;  4BIZ A;  5B1O A;  3ABU A;  5KUK A;  4CBC A;  1PL0 A;  5EBW C;  1QR8 A;  4JPR A;  3OUS A;  3ZRV A;  5B1A C;  2B5U A;  1K73 W;  3K08 A;  4UVA A;  1SRY A;  2ZR2 A;  4DO2 A;  3ZMS A;  1V54 C;  2IU3 A;  1NQT A;  1YJ9 V;  3AEI A;  4WFE A;  3FKS G;  3OMN B;  4QIW F;  2HFE C;  4UVC A;  2WSS G;  5CA3 A;  2ITC C;  2Y69 C;  1K8A W;  1F4N A;  1S72 V;  2K1E A;  3LNM B;  3LDC A;  1M56 C;  3E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...