2ZDIC

Crystal structure of prefoldin from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
MAQNNKELEKLAYEYQVLQAQAQILAQNLELLNLAKAEVQTVRETLENLKKIEEEKPEILVPIGAGSFLKGVIVDKNNAIVSVGSGYAVERSIDEAISFLEKRLKEYDEAIKKTQGALAELEKRIGEVARKAQEVQQKQSMTSFKVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and molecular dynamics simulation of archaeal prefoldin: the molecular mechanism for binding and recognition of nonnative substrate proteins
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Chaperone
molecule keywords Prefoldin subunit beta
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02996 Prefoldin Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zdiC00
1FXKA 1FXKB 3AEIA 2ZDIC 2ZDIA 1FXKC 2ZQMA
chains in the Genus database with same CATH superfamily
1FFTB 4DUZO 4JZ2A 2Y69B 4RWUA 4CZZA 2UUCO 2PUSA 2AHZA 3F5WC 1NTMH 1BS3A 2CTPA 5KHJA 4XDLA 1VQ9V 1R6TA 4UVBA 3EHBB 2GDSA 4JI6B 4X64O 1IBLB 2UXBB 3B09A 1ZL8A 2RDCA 2DW4A 3D3IA 3TXQA 3N2GB 4FM1A 2KQXA 1L1FA 3AG1C 4IYIA 3WU2Z 4MTXA 3JALB 1YF2A 1H2LA 3VQXA 1HNXO 1BZKA 5JH7A 2N04A 3KG2A 4B3MB 2QA4V 1B06A 1SZTA 4QE9A 4WBNA 3JAKA 1Q8IA 4DV2B 1NU1H 4LF8B 5EIBD 1N32O 3CCVV 3JD1A 5D5QA 2D2CB 1GM8A 3DGEA 3U11A 4JGSA 3E8HA 2P22C 4CH4A 3TK1A 1XMOB 1AR4A 1HP8A 3RYFB 4DO2A 5LMNO 4U3JA 3CRQA 1WN7A 2A79B 4WBNB 1OCCB 4NTWA 5ITZB 1K92A 4JPRA 5KHGA 5LYJA 1Q3EA 2UUCB 1Z5WA 2Q69A 1EBOA 1QNMA 2BSKA 3OGIB 1IBMB 3IJ4A 1Q81W 3P3PA 5LHIA 2HJDA 2IJJA 1K4DC 4RO2A 1RP3B 4E4EA 3K9SA 2E75B 1FS0G 1L0LH 2ZDIC 2IBZH 2XAQA 4BW5A 3L74H 1L8DA 4IL6Z 3CCMV 3ZRVA 5IYCO 2CH7A 2OYQA 1F7YA 2EJRA 3OMAB 1LUWA 2ILMA 1YZBA 2Y0PA 3F7YC 2ITCC 3M7MX 4UCRA 3WB2A 1AI4A 3ZHTA 4GX5A 3OD4A 1TUBB 1VARA 2AGAA 2CTWA 4X89A 2UUBB 4O4LB 4FM2A 4CH6A 2WLLA 1SQVH 2H94A 3WB1A 2YEVB 4RQEA 1JQ0A 2P6JA 3JARA 4GUNA 5H6QA 5EBWC 2Q7EA 1SQPH 2X7RB 1SETA 3UCSC 3FKSG 3L72H 1Y67A 1J5EO 4WCEV 3LDEA 3JYCA 4TQDA 2QGNA 3RGBA 3ABMB 3FB8C 3IGAC 3ABTA 4NTYA 4YIOA 4D7TA 1HWYA 1QVGU 1ZLZA 4FLWA 2N74A 4AI8A 3AG2B 5H2FZ 1V54B 5BZBA 2F1MA 4LF7O 5JQGA 3ZMSA 4U3JB 1PM9A 3VQWA 5IJ0A 3N27A 5EBLC 1KU9A 1AR5A 3SJQC 4XDKA 4TOIA 2IJIA 3RYHB 3RYIB 4JV5O 3A0BZ 2R70A 4H33A 2F66C 2LQTA 4JV5B 4LCUC 3L73H 3T1CA 1FKAO 1BT8A 1KUQA 4DRXB 4X8AA 2QTOA 4KHPO 4JI8O 4JZGA 1GK9A 1N36B 3RBZA 2OT5A 5BR8B 3JALA 3E89A 1O9HA 4O4JA 4WFGA 3S3XA 4MT8A 4BIZA 1JJ2U 3AG3B 1TA8A 4LF6B 3UKMA 5IJ9B 2HVJC 1YEWA 1HNZO 3ZHRA 2WLLB 3RYHA 4FLYA 1Y74A 1L0NH 1WPXA 4ZBMA 4Q20A 1BCCH 3BABA 4J9YB 1XNQO 4BW9A 3CYOA 4UB8Z 1VQ4V 5IJ9A 2NLJC 3LDDA 4FK5C 4G28B 3T1HB 3C3SA 4EB6A 1XNQB 1NS1A 3AG4C 4RAIA 4DV4O 4UXNA 3QO7A 4LP8A 4DV3O 5CA0B 4X1KB 5LYJB 4NXNB 2FB5A 2EIJB 1YJ9V 1N34B 3CHXA 3K57A 1QLEC 3A0HZ 3T2MA 3FB6C 2ZM6B 1F51A 2W0XA 2CK3G 4NTXA 3T1HO 2UXCO 3SYPA 2JDIG 4LF4B 4XBFA 4MVZA 3EVKA 1VQ8V 4JTAB 2Q7GA 4PDRA 4NYKA 1SESA 4MTGA 2EIMC 3DSQA 1TUBA 3G6BA 5LMUO 3IC9A 3W7UA 2WLIB 3ZRSA 2ZT9B 4FM0A 2AZ0A 1OCCC 2Z0AA 2RQ6A 3RYCA 1RM1B 1P7GA 1HNXB 2NN4A 5L3DA 1SERA 3H1KH 2B9ZA 4MVQA 4FZ0A 2DN9A 1NT2B 2EX3A 2DQ0A 4PA6A 5JCOA 2WSSG 4GKKO 3MDSA 4IT5A 1W0JG 5B1BC 1NQTA 4WFEA 2EIJC 3ETQA 3ETGA 2KKWA 1AP5A 1QQCA 5EIBC 2YIAA 4FJCC 3RVZA 5F2VO 2JEXA 3IAYA 4O4IB 2HEPA 2LFRA 1VF7A 4ZHQB 1H2KA 3FYIB 5KUMA 2PI4A 1RSOA 1H2SB 1JCHA 2V7QG 1MZFA 5KMGB 1I0HA 4H37A 4LFAO 3ZMZA 3DC5A 2UU9O 3OTFA 5BY1A 1JMKC 1IXMA 4N21A 3HB3B 4FLTA 2Q5ZA 5CN0A 2X6AA 5B1NA 1XMQO 1R3LC 1AJQA 2UXBO 1MG1A 4JI2B 2WA4A 1FPOA 5FL7G 1V55B 2EULA 5ITZA 3R66A 5IYBO 1AR1B 2BSKB 3BHPA 1HNWB 3SPCA 1VQPV 3CD6V 3K08A 1ZL8B 1AB3A 5E79Z 2E74B 3WFVA 1OCZB 3H1JH 1UJWB 5TISZ 1EM1A 3PJSK 1THZA 4KFMA 2R9IA 2WLIA 1SZXA 3BY6A 3SR2C 3FX7A 4CH3A 2CGOA 2UXXA 5DM6V 4JI4O 5JQGB 1NKDA 1YTFB 1U96A 4LBEC 4FFBB 1G1XB 1GRJA 1ZAUA 4DR4O 4DV0B 4LFCB 5B5EZ 3BRCA 1BGYH 3W7TA 3CRAA 2FTKA 1G6UA 5JJEB 1I7FA 4U7OA 2PF4E 5L3CA 1GAXA 2UXNA 4K8XA 1B6QA 1VP7A 4JI3O 4FLUA 4FFKA 2JIZG 4X65B 3GWKC 3CRRA 2ZKOA 2UU9B 3ZHSA 1WP8A 4W4LA 4J9ZB 4KL1A 2LP7A 4ZOLB 1XBLA 1XL4A 3ICXA 3OEEG 2QM7A 4CBCA 4EEQA 1Y66A 4X66O 2DJVA 3OGCC 4D7SA 3FFQA 1SQQH 1QHTA 4LF5B 1NR1A 1Q6IA 2WLKA 4P30A 4DV0O 3QF7A 3ZHUA 1P7BA 4DV6O 5CA1A 1GMGA 4EB6B 1CPYA 1S5HC 4PDMA 4JI0O 2DWDC 3OUFA 3F5TA 2W6IG 1JX9A 1RSOB 5K1XA 1ZX3A 4GX0A 2JS3A 2HHHO 1IBKO 3ABUA 2QKCA 4P9PA 1FYJA 2CTQA 1MOFA 3ZN1A 1RM1C 3CCLV 3SPIA 4LF4O 1S5JA 2KSDA 2LFSA 1D2DA 4JI5O 1COWG 2BTQB 4WF9V 1FFXB 4ZKIA 4RQFA 4F6RB 5B3SB 2XTAA 2C2AA 2WAMA 5LGTA 1RPOA 1I5XA 1HR0O 1YCIA 1PV0A 5CBHA 3CWBH 1K3EA 5GTHZ 2WPDG 3VOUA 5JH7B 5JCOC 5KHIA 3MAQA 3G71V 4I55B 1CEZA 5IYZA 4DUYB 3A2FA 1K33A 1N36O 1FJGB 1ZUQA 2DE0X 2QM4A 4O2AA 1SA0B 1K7DA 3CC2V 1VIBA 4FLXA 2XOKG 1EFRG 3OUSA 1S72V 1VQ7V 3SGIA 2YI8A 2Q7HA 4LH7A 4J7KA 5B1OA 1GH6A 2EIKC 2YXYA 4FLVA 4I55A 2RNBA 2Q0OC 4Z1MG 3CJHA 5BMVA 2ZCEA 2EBOA 4YIPA 1HDJA 2YIBA 2DOSA 3JARB 2ZNJA 5LL6Y 4BAYA 5C8YA 5LHHA 2ZE5A 2VQEO 4I4TB 2OIEA 2GTAA 2IM9A 4DV5O 5LOVA 2JVDA 5IY5C 3H9VA 5CB4B 4OPAA 4DK0A 1FXKA 3ZRWB 3JATA 4X62O 2E76B 3C3TA 3ABLC 3QVNA 4GKJO 3D3QA 1VQOV 2RCVA 1WLEA 5FLXN 4R7CA 4L87A 4Q6GA 3CMEV 1HR0B 1XILA 1KQSU 3JASA 4JI4B 4ABMA 1BE3H 4DR5O 4I0XB 4MSWC 5L3FA 1XNRB 1JFFA 1Q6UA 1S0VA 2Z3YA 5LGNA 3N2KA 1UFIA 4DR6B 2LW7A 2Y4TA 1Q90D 3E35A 4J7JA 3THOA 1M57B 2M7WA 3APQA 2WLHA 1HW7A 3QG5A 1VF6A 4NXNO 4H0LB 2O57A 1OCZC 4PA3A 1KKCA 4MVSA 2QDOA 4R8CA 1D5AA 2YS8A 1RFYA 3GVMA 4I50A 2JEUA 2H8PC 1YITV 3ZJZA 1Y74B 1XHZA 1N33O 1IBMO 1S77D 2DWEC 4CC5A 3DXRA 3CCUV 4GZRB 1KBHA 4Z2WA 5JWPA 4WFAV 1SF9A 4I4TA 1SKVA 4LFAB 2ZIOA 4LF5O 4JAUA 2M6YA 1OJHA 1AVMA 2MK3A 2QTSA 2KG7A 3AK3A 5KX5B 3CXHF 5A9GA 5IY5B 1H2NA 1SC5B 3FB5C 4X62B 1YHQV 3CRMA 1V9PA 4K0KB 1Y76A 2QWRB 4J7ZA 3CSXA 1H8EG 2BOCC 3DXRB 3ETDA 3E86A 4PDLA 3RYFA 4AHCA 4U3FH 4JI1B 1N0NA 4O4HB 2DQ3A 4O2AB 1BSMA 3ASOC 4EKWA 2WWWA 5EK0A 3AG4B 3JD3A 3KZIZ 1K73W 5GONA 5KAFZ 1SQBH 2ZDIA 1QLEB 3H1HH 1ZWIC 3JAMN 1F23A 4TV8A 3JD0A 1PNMA 5IDJA 1Q86W 1IDSA 2YDEA 2ZE8A 4EFBA 5KA5A 5LGUA 1K34A 3TETA 1KKDA 4DR1B 1G4YB 1ZSPA 1FFXA 2XAGA 2OTLV 4O4LA 4R6ZA 2CTRA 2ZINA 2P4VA 3RVYA 3K5LA 2R72A 1A32A 5AG2A 3OR6C 1OV9A 3FD9A 1KYOF 2QKSA 1N33B 3G80A 5CBFA 1K4CC 2IW5A 2XASA 4O4IA 3ZN0A 1EN6A 4DR4B 4JYAO 3T4ZA 5LXTB 4IYHA 4JI2O 1BMFG 2Q9LA 5C93A 3B40A 5GW7A 2F23A 2FL4A 4XDJA 4LC1A 2PI5A 5JJNB 2A9HA 3LDCA 3APOA 2UUBO 1NVPD 5JVDA 4G2KA 2PY5A 2UXDB 1N0JA 1E1QG 1BQ0A 3HKCB 3GWOA 3CXCU 5LBQA 5LP6A 3I55V 3CCEV 1D5NA 1WB7A 3A8TA 2JGDA 3D36A 1M93A 2QKAA 3H1LH 4JAAA 4JI1O 2CE4A 4RUEA 3RYIA 4TV9B 1PL4A 3HKEB 3AG3C 1SRYA 3QO8A 3B8NA 3LNNA 1P49A 2OIGA 4X20A 4G27B 4JYYA 4GKJB 4AQYB 4GKKB 5KA6A 4LNUB 2D3OW 4NKGB 3HKCA 2K1EA 1GN2A 1K8AW 2YIBD 1VEWA 4EFEA 3CE2A 4YHHB 4DRXA 3ASOB 1NTKH 5EC1C 1J95A 4QGPA 4LF8O 3TGUH 4JI3B 4CS4A 1NTZH 2ZNIA 4WFFA 3STZC 3HKDA 5KUKA 4X65O 2DYRC 3CC7V 2Y0IA 3OT7A 2YUAA 2F93B 4I0XA 4AILC 2NNUA 1MMMA 1WP7A 2Y4UA 1M4UA 2LGWA 1OCRB 4DUYO 3ZHQA 4LFCO 3ZMUA 1FAFA 2VS0A 3CS5A 5CB4A 4JF3A 3S3WA 4PI2A 2EZPA 2P90A 3HKBA 3E22B 1FXKB 4J10A 4K8ZA 4JAVA 1PNLA 2CUGA 2YIDA 4X1YA 4TSFG 3W7SA 3FB7C 4TV8B 5KHHA 2ARHA 2ZE6A 2CDYA 1V55C 1NBMG 3L71H 1CXZB 4B3RB 3K0GA 1PL0A 2A0LA 4B3TO 3K5NA 1W0KG 2P7TC 2XUMA 2B1GA 4DR1O 1XI1A 1MZEA 3NR7A 4JI0B 4JYCA 1PP9H 4LF6O 4MTFA 4FZ1A 3CCQV 3AG2C 3OMIB 5DN6G 4B7KA 1Y76B 3T1YB 5LP6C 4QE7A 2VQFO 3IC7A 2HHHB 4J80A 5JJJB 3LSQA 5LMNB 1YIJV 5B3SC 1AILA 1YSCA 1BL8A 3UT5B 2ADPA 1KECA 2V4DA 3EXAA 5IWAO 3K5MA 4CS2A 4I9WA 3K58A 4I5SA 5GONB 2EIKB 3RW0A 4TQFA 1VQMV 5D5PA 3ZIAG 2JRIA 2XAHA 3W7WA 3OAAG 4LF9O 3CCJV 2ZE7A 1OCRC 3RFRA 1M56C 3OFNG 5HFMA 1AJNA 1M9NA 1M56B 1Q6HA 4DW0A 3BA9A 3FAVA 4TWKA 3CRCA 2W6JG 4GLXA 4I7ZB 3UM7A 1XOUA 2OCCC 5CBGA 4YJ3A 1JJOA 3WG7B 1H2MA 2IU0A 4P2ZA 3SPGA 2ZIMA 1M1KW 2OWOA 4LF7B 5J2UB 2UXDO 5A2QN 2G38A 3G67A 4FIPC 1P4RA 1M5IA 3LSSA 1Y6XA 3T4DA 3CJHB 1SQXH 4TT3G 4YJ2A 4F6RA 4DR3O 1YJNV 4B3TB 1T5EA 2LO1A 2YXHA 3Q4HA 1K5SA 5BMVB 2QEXV 2F43G 2Q73A 2RJZA 4TUYB 4DV4B 2ZR2A 4I50B 2PGGA 1QCEA 2CGNA 5L3GA 2ITDC 4X88A 4BIOA 2IU3A 4HNAB 1TVKB 3OTOO 2OTJV 2F95B 4DR5B 2Q6AA 1XMQB 1AI6A 1GN4A 3HKEA 4QNHB 2P06A 1VQ5V 1E79G 1VQ6V 3KKYA 1IXBA 3K0DA 1AI5A 3UO2A 3RT3C 1Z5VA 1JFFB 2PTMA 4O2BA 1I08A 4UVCA 4PA9A 4L8JA 4X66B 4IIJA 3MHHC 4PD4F 2EILB 2ZXWB 3U0ZA 1LR1A 2Q0AA 3CC4V 4KHPB 1TVKA 2HJFC 4NVPA 1R3IC 2BE3A 4DR7B 3JSNA 4I9QA 1FXVA 3SJBC 4J41A 4YY3O 3BPZA 4K0KO 3ABKB 1R73A 1VF6C 1KC8W 1IZ3A 1JPXA 5L3BA 5LP6B 4QPKA 1F4NA 3WB0A 2DYSB 1PKXA 2PZSA 2P4KA 3CP1A 3VQYA 5KX5A 3A0RA 2LJ2A 4B3SB 2OCHA 2PYLA 2LGQA 3VBBA 2LW1A 3OEHG 1JR9A 1WNSA 3TXSA 5H5NA 3E22A 3E83A 1B3QA 1LNQA 2GTSA 1TAEA 1Q5OA 2BTQA 3CEIA 4DV7O 1SA0A 5IJ0B 4UCUA 2WLJA 3X2QC 4GCZA 4HAMA 4YJ3B 3BEHA 4Z1VA 3E2EA 4GX1A 3ABLB 4QPJA 1Q43A 2Z5UA 3G6EV 2FYUH 1XL6A 4DYLA 4NR1A 3I5DA 4YXWG 1DK1A 2XNDG 4ZHQA 1R6KA 3JATB 3BA8A 3SDLA 2YC0A 5B1AC 2P67A 2FKXA 4DR6O 1NR7A 3ML0A 5LOVB 2MW2B 3ZHVA 1M90W 1XUQA 5HFLA 3T1YO 5CA1B 4IIJB 2GV9A 1PNKA 4HZ3A 4F4LA 2UUAO 4ASUG 2DYRB 3N2GA 2GUZB 2DMXA 3STLC 2UUAB 2L6LA 3TCUA 1QU7A 1YI2V 3CB2A 3P30A 4ZI7A 1XNRO 3ABKC 3C90A 3GB7C 2QWPB 2E5LO 1BHBA 4RUFA 2XAJA 3I56V 1R6NA 1URFA 2AHYA 4KXRA 3HKDB 4DV1B 1KP2A 3ZS8C 2R9RB 5CA0A 5B66Z 5KHKA 3CX5F 3DTUB 5IE9A 5BR8O 3K59A 4QJFB 2EJ7A 1N32B 1R3JC 4E2LA 4X1KA 4K3AA 3M8AA 4O2BB 2ODMA 5IT9N 4OX9O 2AZ2A 3L75H 1N8RW 2BCCH 2VQEB 4JTDB 4DV6B 3JD2A 3B77A 5LHGA 4LH6A 2EIMB 4UCOA 3J7AU 1YTFD 1ROPA 4ICGA 1N4CA 2IJKA 4R50A 1H38A 2QWQB 2XT9A 4B3SO 2ZR3A 4PA4A 2X0LA 1F4MA 4JASA 3SJCC 1MSWD 2Y48A 4OGQB 1NH2B 4GT1A 5K1PA 5E1AC 1ENVA 3NXSA 1QR9A 3SYCA 1J5EB 4OX9B 3AG1B 4DR2B 3H1IH 4UFZA 2HR3A 4PDVA 4QIWF 4UCSA 1SQGA 3K3WA 5GTIZ 3B4SA 4MVRA 4N23A 1X59A 3OR7C 1Y4MA 4WFBV 2YI9A 4CC6A 1FXHA 1HNZB 5EZYA 4BR6A 2HVKC 1FXKC 3OE7G 4JI5B 2WA3A 5J9PC 4PV1B 1O9GA 2B5UA 4F6EA 1KMIZ 2X6BA 2P5OA 5B1AB 4JI7B 4B08A 3ZX6A 3ZMVA 4UB6Z 1GM9A 4DK1A 3OTOB 4C7UA 3BAAA 4KUMA 1Z2GA 2E3CA 3ZRXA 1MSDA 5J2TB 4MVUA 5EBMC 1GKFA 4MVMA 4B3RO 1GM7A 2YSUB 3D8CA 1HNWO 3OW2U 1EZVH 5JVDB 1IX9A 3JCZA 2WLMA 2Q67A 3MHSC 4UVAA 3H01A 1DF5A 4J42A 3QO5A 3LUTB 3L9DA 2R9AA 3AK1A 2GUZA 1OZ0A 5DEDA 2BTOA 2DYSC 5IWAB 2IH3C 3UQ8A 1S5LZ 3BCCH 1AI7A 1R3KC 2ADQB 2EINB 2QE7G 4CH5A 1DLBA 3K79A 4LWSB 2A06H 1NI8A 4UV8A 5IYZB 2H3OA 1R1BA 2Q8VA 2VQFB 3JCUZ 1EN4A 4KP4A 2JGUA 4X64B 1IBLO 4JI6O 1G8MA 4PJ0Z 3P3NA 1AJPA 5BXZA 4LR3A 4MW3A 2ZQMA 1WB8A 4FLZA 2XHBA 2W0FC 2A3QA 1VMGA 4DV3B 1W2BU 4FMTA 1VQKV 1QLNA 3BFRA 2QSAA 5H9CA 1PD3A 1YJWV 3FAVB 2QR4A 1GTOA 1I94B 4HNAA 2L35A 1OHHG 1IVSA 2QJ1A 1NZ6A 3SYQA 2B1IA 3ZBHA 1WA8A 2YICA 1JOYA 2Q4PA 2HP8A 1DTOA 1WPBA 1VF5B 2HG5C 4PI0A 4HBNA 3OMNB 5CMUA 2QM8A 5H6RA 4NB5A 3QTCA 5EYPB 3AK2A 4YJ2B 2QWNB 3ASNB 1QVFU 1VQNV 1NVPB 1KD1W 3K06A 3SYOA 1FD9A 2FMLA 1N34O 1MA1A 2WLNA 1IURA 1XMOO 1V54C 3EFFK 2HLDG 3SYAA 4DR2O 4JYBA 3K04A 2VRZA 3O65A 1WA8B 4X1IB 3RYCB 4NXMB 1YXBA 1SQFA 2JJ2G 5LXTA 3CMAV 3ABMC 2KB1A 5EC2C 5EZYB 4DV2O 3FYEB 3HPLC 3JAKB 4K35A 2CH7B 1XQ8A 4DXWA 1I94O 1S76D 2HFEC 3ASNC 4WFHA 3D36C 4AQYO 4LFBB 2RN9A 1W59A 1Q7YW 1EZJA 4DV7B 3K5OA 2PYJA 2K9PA 3JASB 3M99B 2ATKC 3P32A 3UT5A 2VWJA 1XREA 4DW1A 4OXSA 1FJGO 1OCOB 4GX2A 2YEVA 5FPOA 5KMGA 2IJHA 4YY3B 1TGOA 4HYOA 3HKBB 3G4SV 4CS3A 3J80N 4GYCB 4TV9A 2Y69C 1K9MW 3E8GA 5LA6A 5CA3A 2ZM6O 2OCCB 1PPJH 1H2GA 3CPWU 3CCSV 4LFBO 1U97A 4YHHO 3ZEDA 5B1BB 5LMUB 4FPPA 3WG7C 1BHAA 1ORQC 3JSLA 1AP6A 1WJZA 2E5LB 3PN1A 2JK5C 3U10A 4LF9B 2IH1C 2JJ1G 4DV1O 1UPGA 5EYPA 2EILC 1X4TA 4FVMA 2A7WA 1XEQA 5C8YB 4DR7O 2UXCB 3B8MA 5J2UA 1M57C 5J2TA 4FFBA 3ZMTA 4IHJB 2GSMB 3R65A 4UCTA 3AG7A 2RMKB 2EZOA 2XAFA 5FNVB 1XHXA 1TUEB 2F4VO 3QNEA 3LSUA 4X1IA 1I5YA 1DGSA 4X20B 3E8BA 1XDCA 1JVMA 2F4VB 1ZTEA 1QR8A 3IFXA 4TUYA 4MVOA 4JTCB 1SS3A 2JS5A 3RN4A 4IHJA 4IGGA 2Q68A 3N2KB 3CCRV 4JYAB 4ZIBA 1VQLV 4X1YB 1B04A 2AXTZ 2AW9A 1YDXA 5FPRA 2HKOA 1K97A 2VWKA 5IYDO 3VQVA 1E1RG 1MNGA 2QWOB 4X9QA 1IBKB 3JD4A 1MABG 1RPRA 4H13B 4DR3B 4U7NA 2BOBC 3X2QB 1KB9F 4UUJC 3ZRWA 1OCOC 3KCYA 4W4KA 2JGDB 4MW8A 1QBZA 4MS2A 4OPHA 2GHYA 3UO3A 1P84F 3W7XA 1GN6A 1DF4A 3OM3B 3ZCCA 3SPHA 5DECA 4O4JB 3RWRD 4PA7A 2ZXWC 3F7VC 2KG7B 1CP9A 1GN3A 3Q4HB 1JA8A 3J81N 4DV5B 3HR0A 5KAIZ 5L3EA 3E8FA 4A5UB 4UCVA 3SPJA 4NXMO 4PELA 1KP3A 3K9AA 1YVWA 3MD0A 3ETEA 1EN5A 1WAZA 4PHZA 4B3MO 4LWSA 4LNUA 3O9OA 3AEIA 4D6TH 5FNVA 4ZOLA 2EINC 3TJTA 4O4HA 5LA6B 1US6A 1K5QA 4ZI7B 1Q82W 4P9OA 2V1DA 1GO3F 2CAZC 3JAWA 2ETNA 1H8HG 4B7EA 3BVOA 3KCXA 1LUVA 4JI7O 1NH2D 2N05A 5KLVH 1AROP 4J11A 1BQZA 2NR5A 4H44B 4BIUA 3B2EE 3SJAC 4UV9A 4DUZB 3L70H 2X6CA 2YXLA 2GBOA 3JAWB 3DC6A 4MTOA 3LNMB 2ZD9A 1NJIW 4JI8B 3K03A 1S3JA 4BWAA
chains in the Genus database with same CATH topology
2NNUA 3K3WA 1FFTB 2JIZG 4MVRA 1OCRB 2Y69B 4N23A 3OR7C 1Y4MA 4WFBV 1FXHA 4J9ZB 4CZZA 3ZMUA 2AHZA 2HVKC 1FXKC 3F5WC 3OE7G 2LP7A 5J9PC 4XDLA 1VQ9V 2B5UA 4UVBA 1XL4A 3EHBB 4JF3A 2X6BA 2EZPA 5B1AB 3OEEG 2QM7A 2P90A 1FXKB 3ZMVA 4CBCA 3D3IA 1GM9A 1Y66A 2DW4A 4JAVA 1L1FA 1PNLA 3AG1C 3OGCC 4KUMA 4MTXA 4TSFG 3ZRXA 3W7SA 4MVUA 5EBMC 1NR1A 1GKFA 3FB7C 4MVMA 1GM7A 2YSUB 2WLKA 3KG2A 4P30A 1P7BA 1V55C 2QA4V 3OW2U 1GMGA 1NBMG 1CPYA 1S5HC 1SZTA 4QE9A 4PDMA 2DWDC 3OUFA 3JCZA 3K0GA 1PL0A 2WLMA 2Q67A 2A0LA 1W0KG 2W6IG 3MHSC 1JX9A 4UVAA 3H01A 3CCVV 2P7TC 1DF5A 4GX0A 3JD1A 2B1GA 3QO5A 3LUTB 3ABUA 1GM8A 4JYCA 3DGEA 4JGSA 3E8HA 4MTFA 4P9PA 3TK1A 3CCQV 3AG2C 1MOFA 3OMIB 1OZ0A 3ZN1A 5DN6G 4DO2A 2DYSC 2IH3C 2A79B 1AI7A 1R3KC 3CCLV 1RM1C 3SPIA 2EINB 4QE7A 2QE7G 1OCCB 3IC7A 1DLBA 2LFSA 3K79A 1K92A 1COWG 4JPRA 3LSQA 4WF9V 1YIJV 4ZKIA 4RQFA 2Q69A 1EBOA 5B3SC 4UV8A 1YSCA 5B3SB 1BL8A 1Q81W 2C2AA 2WAMA 5LGTA 1RPOA 1KECA 5LHIA 1I5XA 2IJJA 4KP4A 1K4DC 4I9WA 5CBHA 1G8MA 4RO2A 4I5SA 1K3EA 2EIKB 2WPDG 3RW0A 1VQMV 3VOUA 3ZIAG 2XAHA 1FS0G 2ZDIC 1AJPA 3W7WA 2XAQA 4MW3A 4BW5A 2ZQMA 3G71V 3OAAG 1CEZA 3CCJV 1OCRC 1M56C 3OFNG 3CCMV 5HFMA 1AJNA 1M9NA 3ZRVA 5IYCO 1K33A 1M56B 2EJRA 3OMAB 2W0FC 4TWKA 2W6JG 3F7YC 1W2BU 2ITCC 4FMTA 1VQKV 1QLNA 3UM7A 1AI4A 4GX5A 5H9CA 1PD3A 2OCCC 5CBGA 1YJWV 1GTOA 4X89A 3WG7B 1OHHG 1K7DA 3CC2V 2IU0A 2B1IA 4P2ZA 3SPGA 2XOKG 3SYQA 1M1KW 2WLLA 1JOYA 2H94A 1EFRG 3OUSA 1S72V 1VQ7V 2YEVB 4FIPC 4RQEA 1P4RA 5B1OA 1JQ0A 2P6JA 2EIKC 3LSSA 5H6QA 1DTOA 5EBWC 3T4DA 2HG5C 4TT3G 4Z1MG 2X7RB 2EBOA 1YJNV 3OMNB 1SETA 5CMUA 2QM8A 4BAYA 5LHHA 5H6RA 3FKSG 1K5SA 4WCEV 3ASNB 2QEXV 3LDEA 2F43G 3JYCA 5IY5C 1QVFU 3ABMB 1VQNV 3FB8C 1NVPB 3IGAC 3ABTA 1KD1W 3K06A 1HWYA 3SYOA 1QVGU 2WLNA 2ZR2A 1V54C 3EFFK 1FXKA 3AG2B 2HLDG 3SYAA 3ZRWB 4JYBA 1V54B 3K04A 1QCEA 5BZBA 3ZMSA 3ABLC 2JJ2G 5L3GA 3CMAV 1VQOV 3ABMC 2KB1A 1WLEA 2ITDC 4X88A 2IU3A 5EC2C 4R7CA 5EBLC 2OTJV 4L87A 3SJQC 2Q6AA 3FYEB 1AI6A 3HPLC 4XDKA 3CMEV 4QNHB 2IJIA 1KQSU 1VQ5V 4DXWA 1S76D 4H33A 1E79G 4MSWC 5L3FA 1S0VA 1VQ6V 2HFEC 3ASNC 4WFHA 2Z3YA 3K0DA 1AI5A 4LCUC 5LGNA 1Q7YW 3T1CA 1EZJA 4X8AA 4UVCA 2QTOA 4PA9A 3E35A 1GK9A 3M99B 3RBZA 2OT5A 2ATKC 3MHHC 3P32A 1M57B 2M7WA 2EILB 2ZXWB 3E89A 2WLHA 4OXSA 4WFGA 1OCOB 1JJ2U 4MT8A 4GX2A 2YEVA 3AG3B 4BIZA 3CC4V 2HJFC 2IJHA 3UKMA 2HVJC 1OCZC 4HYOA 1R3IC 4PA3A 2WLLB 4MVSA 3G4SV 4R8CA 1FXVA 2Y69C 1K9MW 3E8GA 5CA3A 1WPXA 2JEUA 2OCCB 4Q20A 3ABKB 2H8PC 4ZBMA 1H2GA 1R73A 4J9YB 3CPWU 3CCSV 3ZJZA 1YITV 1KC8W 1JPXA 1S77D 2DWEC 5B1BB 3CCUV 3CYOA 5L3BA 4WFAV 4QPKA 1VQ4V 1F4NA 4FPPA 3WG7C 1BHAA 1ORQC 2DYSB 2NLJC 4JAUA 1PKXA 2JK5C 3CP1A 3LDDA 4FK5C 4G28B 2IH1C 2JJ1G 2MK3A 3A0RA 3AG4C 2EILC 4RAIA 5IY5B 4UXNA 3VBBA 3QO7A 4LP8A 3B8MA 2EIJB 3OEHG 1YJ9V 3FB5C 1M57C 1YHQV 1QLEC 3T2MA 3ZMTA 3E83A 3FB6C 2GSMB 3R65A 1F51A 1LNQA 2CK3G 3SYPA 2EZOA 1H8EG 2WLJA 3X2QC 4GCZA 4HAMA 3BEHA 2BOCC 2XAFA 3E2EA 2JDIG 4GX1A 3ABLB 4XBFA 4MVZA 1TUEB 3ETDA 3QNEA 3E86A 1VQ8V 4JTAB 4PDLA 1I5YA 4QPJA 2Z5UA 4PDRA 3G6EV 1SESA 4MTGA 2EIMC 1XL6A 2DQ3A 3E8BA 3W7UA 2WLIB 4YXWG 3ZRSA 1JVMA 3ASOC 2XNDG 1OCCC 1R6KA 1QR8A 1RM1B 4EKWA 5B1AC 2WWWA 2P67A 3IFXA 5L3DA 1SERA 5EK0A 3AG4B 1NR7A 3JD3A 4MVOA 4JTCB 1K73W 4MVQA 3ML0A 2DQ0A 2ZDIA 2Q68A 4PA6A 3CCRV 2WSSG 1M90W 1QLEB 1VQLV 5HFLA 1ZWIC 1W0JG 5B1BC 1NQTA 4WFEA 1F23A 2EIJC 3JD0A 2HKOA 1PNMA 3ETGA 5IDJA 1Q86W 1K97A 5KA5A 1PNKA 5LGUA 1K34A 4HZ3A 4F4LA 5IYDO 3TETA 1E1RG 1KKDA 4ASUG 1G4YB 3JD4A 2DYRB 1MABG 2XAGA 2OTLV 1RPRA 4R6ZA 4FJCC 4U7NA 3RVZA 2BOBC 2JEXA 3RVYA 3STLC 2LFRA 3TCUA 3X2QB 1YI2V 3OR6C 3P30A 2QKSA 5CBFA 1K4CC 3FYIB 5KUMA 2IW5A 4UUJC 3ZRWA 2XASA 2PI4A 3ABKC 1OCOC 1JCHA 3GB7C 2V7QG 3ZN0A 4H37A 3T4ZA 1BHBA 3ZMZA 4MW8A 4RUFA 1BMFG 2XAJA 1QBZA 1R6NA 4MS2A 5C93A 3I56V 2AHYA 5GW7A 2GHYA 4XDJA 1KP2A 1IXMA 4LC1A 4N21A 3W7XA 2R9RB 2PI5A 1DF4A 2A9HA 3OM3B 3ZCCA 3SPHA 3LDCA 3HB3B 5CN0A 4PA7A 2X6AA 1NVPD 5B1NA 2ZXWC 1R3LC 1AJQA 3DTUB 3F7VC 4G2KA 1MG1A 1CP9A 4QJFB 1R3JC 4E2LA 5L3EA 1E1QG 3E8FA 5FL7G 1V55B 3GWOA 3CXCU 3SPJA 5LBQA 3I55V 4PELA 3CCEV 1KP3A 3K9AA 1N8RW 3MD0A 5IYBO 3D36A 1AR1B 3ETEA 4JTDB 3SPCA 3JD2A 3B77A 1VQPV 3CD6V 3K08A 5LHGA 2EIMB 4RUEA 3WFVA 1OCZB 1ROPA 3AEIA 1UJWB 1YTFD 2IJKA 3PJSK 1THZA 4KFMA 2R9IA 3AG3C 1SRYA 2WLIA 3QO8A 2EINC 3BY6A 3B8NA 4R50A 4G27B 2UXXA 5DM6V 1H38A 1K5QA 1Q82W 2ZR3A 4PA4A 4P9OA 2X0LA 1NKDA 1YTFB 1F4MA 1GO3F 2V1DA 4LBEC 5KA6A 1H8HG 4JASA 2D3OW 1MSWD 2K1EA 2Y48A 1K8AW 1NH2B 4GT1A 1NH2D 5E1AC 1ENVA 3NXSA 1AROP 3ASOB 3W7TA 1QR9A 3SYCA 2FTKA 5EC1C 4BIUA 1J95A 4U7OA 3AG1B 4UV9A 5L3CA 2X6CA 2UXNA 2HR3A 4WFFA 3STZC 5KUKA 2DYRC 4MTOA 3LNMB 4PDVA 4QIWF 3CC7V 1B6QA 2ZD9A 1NJIW 3K03A 1S3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK A;  1FXK B;  3AEI A;  2ZDI C;  2ZDI A;  1FXK C;  2ZQM A; 
#chains in the Genus database with same CATH topology
 1FFT B;  4DUZ O;  4JZ2 A;  2Y69 B;  4RWU A;  4CZZ A;  2UUC O;  2PUS A;  2AHZ A;  3F5W C;  1NTM H;  1BS3 A;  2CTP A;  5KHJ A;  4XDL A;  1VQ9 V;  1R6T A;  4UVB A;  3EHB B;  2GDS A;  4JI6 B;  4X64 O;  1IBL B;  2UXB B;  3B09 A;  1ZL8 A;  2RDC A;  2DW4 A;  3D3I A;  3TXQ A;  3N2G B;  4FM1 A;  2KQX A;  1L1F A;  3AG1 C;  4IYI A;  3WU2 Z;  4MTX A;  3JAL B;  1YF2 A;  1H2L A;  3VQX A;  1HNX O;  1BZK A;  5JH7 A;  2N04 A;  3KG2 A;  4B3M B;  2QA4 V;  1B06 A;  1SZT A;  4QE9 A;  4WBN A;  3JAK A;  1Q8I A;  4DV2 B;  1NU1 H;  4LF8 B;  5EIB D;  1N32 O;  3CCV V;  3JD1 A;  5D5Q A;  2D2C B;  1GM8 A;  3DGE A;  3U11 A;  4JGS A;  3E8H A;  2P22 C;  4CH4 A;  3TK1 A;  1XMO B;  1AR4 A;  1HP8 A;  3RYF B;  4DO2 A;  5LMN O;  4U3J A;  3CRQ A;  1WN7 A;  2A79 B;  4WBN B;  1OCC B;  4NTW A;  5ITZ B;  1K92 A;  4JPR A;  5KHG A;  5LYJ A;  1Q3E A;  2UUC B;  1Z5W A;  2Q69 A;  1EBO A;  1QNM A;  2BSK A;  3OGI B;  1IBM B;  3IJ4 A;  1Q81 W;  3P3P A;  5LHI A;  2HJD A;  2IJJ A;  1K4D C;  4RO2 A;  1RP3 B;  4E4E A;  3K9S A;  2E75 B;  1FS0 G;  1L0L H;  2ZDI C;  2IBZ H;  2XAQ A;  4BW5 A;  3L74 H;  1L8D A;  4IL6 Z;  3CCM V;  3ZRV A;  5IYC O;  2CH7 A;  2OYQ A;  1F7Y A;  2EJR A;  3OMA B;  1LUW A;  2ILM A;  1YZB A;  2Y0P A;  3F7Y C;  2ITC C;  3M7M X;  4UCR A;  3WB2 A;  1AI4 A;  3ZHT A;  4GX5 A;  3OD4 A;  1TUB B;  1VAR A;  2AGA A;  2CTW A;  4X89 A;  2UUB B;  4O4L B;  4FM2 A;  4CH6 A;  2WLL A;  1SQV H;  2H94 A;  3WB1 A;  2YEV B;  4RQE A;  1JQ0 A;  2P6J A;  3JAR A;  4GUN A;  5H6Q A;  5EBW C;  2Q7E A;  1SQP H;  2X7R B;  1SET A;  3UCS C;  3FKS G;  3L72 H;  1Y67 A;  1J5E O;  4WCE V;  3LDE A;  3JYC A;  4TQD A;  2QGN A;  3RGB A;  3ABM B;  3FB8 C;  3IGA C;  3ABT A;  4NTY A;  4YIO A;  4D7T A;  1HWY A;  1QVG U;  1ZLZ A;  4FLW A;  2N74 A;  4AI8 A;  3AG2 B;  5H2F Z;  1V54 B;  5BZB A;  2F1M A;  4LF7 O;  5JQG A;  3ZMS A;  4U3J B;  1PM9 A;  3VQW A;  5IJ0 A;  3N27 A;  5EBL C;  1KU9 A;  1AR5 A;  3SJQ C;  4XDK A;  4TOI A;  2IJI A;  3RYH B;  3RYI B;  4JV5 O;  3A0B Z;  2R70 A;  4H33 A;  2F66 C;  2LQT A;  4JV5 B;  4LCU C;  3L73 H;  3T1C A;  1FKA O;  1BT8 A;  1KUQ A;  4DRX B;  4X8A A;  2QTO A;  4KHP O;  4JI8 O;  4JZG A;  1GK9 A;  1N36 B;  3RBZ A;  2OT5 A;  5BR8 B;  3JAL A;  3E89 A;  1O9H A;  4O4J A;  4WFG A;  3S3X A;  4MT8 A;  4BIZ A;  1JJ2 U;  3AG3 B;  1TA8 A;  4LF6 B;  3UKM A;  5IJ9 B;  2HVJ C;  1YEW A;  1HNZ O;  3ZHR A;  2WLL B;  3RYH A;  4FLY A;  1Y74 A;  1L0N H;  1WPX A;  4ZBM A;  4Q20 A;  1BCC H;  3BAB A;  4J9Y B;  1XNQ O;  4BW9 A;  3CYO A;  4UB8 Z;  1VQ4 V;  5IJ9 A;  2NLJ C;  3LDD A;  4FK5 C;  4G28 B;  3T1H B;  3C3S A;  4EB6 A;  1XNQ B;  1NS1 A;  3AG4 C;  4RAI A;  4DV4 O;  4UXN A;  3QO7 A;  4LP8 A;  4DV3 O;  5CA0 B;  4X1K B;  5LYJ B;  4NXN B;  2FB5 A;  2EIJ B;  1YJ9 V;  1N34 B;  3CHX A;  3K57 A;  1QLE C;  3A0H Z;  3T2M A;  3FB6 C;  2ZM6 B;  1F51 A;  2W0X A;  2CK3 G;  4NTX A;  3T1H O;  2UXC O;  3SYP A;  2JDI G;  4LF4 B;  4XBF A;  4MVZ A;  3EVK A;  1VQ8 V;  4JTA B;  2Q7G A;  4PDR A;  4NYK A;  1SES A;  4MTG A;  2EIM C;  3DSQ A;  1TUB A;  3G6B A;  5LMU O;  3IC9 A;  3W7U A;  2WLI B;  3ZRS A;  2ZT9 B;  4FM0 A;  2AZ0 A;  1OCC C;  2Z0A A;  2RQ6 A;  3RYC A;  1RM1 B;  1P7G A;  1HNX B;  2NN4 A;  5L3D A;  1SER A;  3H1K H;  2B9Z A;  4MVQ A;  4FZ0 A;  2DN9 A;  1NT2 B;  2EX3 A;  2DQ0 A;  4PA6 A;  5JCO A;  2WSS G;  4GKK O;  3MDS A;  4IT5 A;  1W0J G;  5B1B C;  1NQT A;  4WFE A;  2EIJ C;  3ETQ A;  3ETG A;  2KKW A;  1AP5 A;  1QQC A;  5EIB C;  2YIA A;  4FJC C;  3RVZ A;  5F2V O;  2JEX A;  3IAY A;  4O4I B;  2HEP A;  2LFR A;  1VF7 A;  4ZHQ B;  1H2K A;  3FYI B;  5KUM A;  2PI4 A;  1RSO A;  1H2S B;  1JCH A;  2V7Q G;  1MZF A;  5KMG B;  1I0H A;  4H37 A;  4LFA O;  3ZMZ A;  3DC5 A;  2UU9 O;  3OTF A;  5BY1 A;  1JMK C;  1IXM A;  4N21 A;  3HB3 B;  4FLT A;  2Q5Z A;  5CN0 A;  2X6A A;  5B1N A;  1XMQ O;  1R3L C;  1AJQ A;  2UXB O;  1MG1 A;  4JI2 B;  2WA4 A;  1FPO A;  5FL7 G;  1V55 B;  2EUL A;  5ITZ A;  3R66 A;  5IYB O;  1AR1 B;  2BSK B;  3BHP A;  1HNW B;  3SPC A;  1VQP V;  3CD6 V;  3K08 A;  1ZL8 B;  1AB3 A;  5E79 Z;  2E74 B;  3WFV A;  1OCZ B;  3H1J H;  1UJW B;  5TIS Z;  1EM1 A;  3PJS K;  1THZ A;  4KFM A;  2R9I A;  2WLI A;  1SZX A;  3BY6 A;  3SR2 C;  3FX7 A;  4CH3 A;  2CGO A;  2UXX A;  5DM6 V;  4JI4 O;  5JQG B;  1NKD A;  1YTF B;  1U96 A;  4LBE C;  4FFB B;  1G1X B;  1GRJ A;  1ZAU A;  4DR4 O;  4DV0 B;  4LFC B;  5B5E Z;  3BRC A;  1BGY H;  3W7T A;  3CRA A;  2FTK A;  1G6U A;  5JJE B;  1I7F A;  4U7O A;  2PF4 E;  5L3C A;  1GAX A;  2UXN A;  4K8X A;  1B6Q A;  1VP7 A;  4JI3 O;  4FLU A;  4FFK A;  2JIZ G;  4X65 B;  3GWK C;  3CRR A;  2ZKO A;  2UU9 B;  3ZHS A;  1WP8 A;  4W4L A;  4J9Z B;  4KL1 A;  2LP7 A;  4ZOL B;  1XBL A;  1XL4 A;  3ICX A;  3OEE G;  2QM7 A;  4CBC A;  4EEQ A;  1Y66 A;  4X66 O;  2DJV A;  3OGC C;  4D7S A;  3FFQ A;  1SQQ H;  1QHT A;  4LF5 B;  1NR1 A;  1Q6I A;  2WLK A;  4P30 A;  4DV0 O;  3QF7 A;  3ZHU A;  1P7B A;  4DV6 O;  5CA1 A;  1GMG A;  4EB6 B;  1CPY A;  1S5H C;  4PDM A;  4JI0 O;  2DWD C;  3OUF A;  3F5T A;  2W6I G;  1JX9 A;  1RSO B;  5K1X A;  1ZX3 A;  4GX0 A;  2JS3 A;  2HHH O;  1IBK O;  3ABU A;  2QKC A;  4P9P A;  1FYJ A;  2CTQ A;  1MOF A;  3ZN1 A;  1RM1 C;  3CCL V;  3SPI A;  4LF4 O;  1S5J A;  2KSD A;  2LFS A;  1D2D A;  4JI5 O;  1COW G;  2BTQ B;  4WF9 V;  1FFX B;  4ZKI A;  4RQF A;  4F6R B;  5B3S B;  2XTA A;  2C2A A;  2WAM A;  5LGT A;  1RPO A;  1I5X A;  1HR0 O;  1YCI A;  1PV0 A;  5CBH A;  3CWB H;  1K3E A;  5GTH Z;  2WPD G;  3VOU A;  5JH7 B;  5JCO C;  5KHI A;  3MAQ A;  3G71 V;  4I55 B;  1CEZ A;  5IYZ A;  4DUY B;  3A2F A;  1K33 A;  1N36 O;  1FJG B;  1ZUQ A;  2DE0 X;  2QM4 A;  4O2A A;  1SA0 B;  1K7D A;  3CC2 V;  1VIB A;  4FLX A;  2XOK G;  1EFR G;  3OUS A;  1S72 V;  1VQ7 V;  3SGI A;  2YI8 A;  2Q7H A;  4LH7 A;  4J7K A;  5B1O A;  1GH6 A;  2EIK C;  2YXY A;  4FLV A;  4I55 A;  2RNB A;  2Q0O C;  4Z1M G;  3CJH A;  5BMV A;  2ZCE A;  2EBO A;  4YIP A;  1HDJ A;  2YIB A;  2DOS A;  3JAR B;  2ZNJ A;  5LL6 Y;  4BAY A;  5C8Y A;  5LHH A;  2ZE5 A;  2VQE O;  4I4T B;  2OIE A;  2GTA A;  2IM9 A;  4DV5 O;  5LOV A;  2JVD A;  5IY5 C;  3H9V A;  5CB4 B;  4OPA A;  4DK0 A;  1FXK A;  3ZRW B;  3JAT A;  4X62 O;  2E76 B;  3C3T A;  3ABL C;  3QVN A;  4GKJ O;  3D3Q A;  1VQO V;  2RCV A;  1WLE A;  5FLX N;  4R7C A;  4L87 A;  4Q6G A;  3CME V;  1HR0 B;  1XIL A;  1KQS U;  3JAS A;  4JI4 B;  4ABM A;  1BE3 H;  4DR5 O;  4I0X B;  4MSW C;  5L3F A;  1XNR B;  1JFF A;  1Q6U A;  1S0V A;  2Z3Y A;  5LGN A;  3N2K A;  1UFI A;  4DR6 B;  2LW7 A;  2Y4T A;  1Q90 D;  3E35 A;  4J7J A;  3THO A;  1M57 B;  2M7W A;  3APQ A;  2WLH A;  1HW7 A;  3QG5 A;  1VF6 A;  4NXN O;  4H0L B;  2O57 A;  1OCZ C;  4PA3 A;  1KKC A;  4MVS A;  2QDO A;  4R8C A;  1D5A A;  2YS8 A;  1RFY A;  3GVM A;  4I50 A;  2JEU A;  2H8P C;  1YIT V;  3ZJZ A;  1Y74 B;  1XHZ A;  1N33 O;  1IBM O;  1S77 D;  2DWE C;  4CC5 A;  3DXR A;  3CCU V;  4GZR B;  1KBH A;  4Z2W A;  5JWP A;  4WFA V;  1SF9 A;  4I4T A;  1SKV A;  4LFA B;  2ZIO A;  4LF5 O;  4JAU A;  2M6Y A;  1OJH A;  1AVM A;  2MK3 A;  2QTS A;  2KG7 A;  3AK3 A;  5KX5 B;  3CXH F;  5A9G A;  5IY5 B;  1H2N A;  1SC5 B;  3FB5 C;  4X62 B;  1YHQ V;  3CRM A;  1V9P A;  4K0K B;  1Y76 A;  2QWR B;  4J7Z A;  3CSX A;  1H8E G;  2BOC C;  3DXR B;  3ETD A;  3E86 A;  4PDL A;  3RYF A;  4AHC A;  4U3F H;  4JI1 B;  1N0N A;  4O4H B;  2DQ3 A;  4O2A B;  1BSM A;  3ASO C;  4EKW A;  2WWW A;  5EK0 A;  3AG4 B;  3JD3 A;  3KZI Z;  1K73 W;  5GON A;  5KAF Z;  1SQB H;  2ZDI A;  1QLE B;  3H1H H;  1ZWI C;  3JAM N;  1F23 A;  4TV8 A;  3JD0 A;  1PNM A;  5IDJ A;  1Q86 W;  1IDS A;  2YDE A;  2ZE8 A;  4EFB A;  5KA5 A;  5LGU A;  1K34 A;  3TET A;  1KKD A;  4DR1 B;  1G4Y B;  1ZSP A;  1FFX A;  2XAG A;  2OTL V;  4O4L A;  4R6Z A;  2CTR A;  2ZIN A;  2P4V A;  3RVY A;  3K5L A;  2R72 A;  1A32 A;  5AG2 A;  3OR6 C;  1OV9 A;  3FD9 A;  1KYO F;  2QKS A;  1N33 B;  3G80 A;  5CBF A;  1K4C C;  2IW5 A;  2XAS A;  4O4I A;  3ZN0 A;  1EN6 A;  4DR4 B;  4JYA O;  3T4Z A;  5LXT B;  4IYH A;  4JI2 O;  1BMF G;  2Q9L A;  5C93 A;  3B40 A;  5GW7 A;  2F23 A;  2FL4 A;  4XDJ A;  4LC1 A;  2PI5 A;  5JJN B;  2A9H A;  3LDC A;  3APO A;  2UUB O;  1NVP D;  5JVD A;  4G2K A;  2PY5 A;  2UXD B;  1N0J A;  1E1Q G;  1BQ0 A;  3HKC B;  3GWO A;  3CXC U;  5LBQ A;  5LP6 A;  3I55 V;  3CCE V;  1D5N A;  1WB7 A;  3A8T A;  2JGD A;  3D36 A;  1M93 A;  2QKA A;  3H1L H;  4JAA A;  4JI1 O;  2CE4 A;  4RUE A;  3RYI A;  4TV9 B;  1PL4 A;  3HKE B;  3AG3 C;  1SRY A;  3QO8 A;  3B8N A;  3LNN A;  1P49 A;  2OIG A;  4X20 A;  4G27 B;  4JYY A;  4GKJ B;  4AQY B;  4GKK B;  5KA6 A;  4LNU B;  2D3O W;  4NKG B;  3HKC A;  2K1E A;  1GN2 A;  1K8A W;  2YIB D;  1VEW A;  4EFE A;  3CE2 A;  4YHH B;  4DRX A;  3ASO B;  1NTK H;  5EC1 C;  1J95 A;  4QGP A;  4LF8 O;  3TGU H;  4JI3 B;  4CS4 A;  1NTZ H;  2ZNI A;  4WFF A;  3STZ C;  3HKD A;  5KUK A;  4X65 O;  2DYR C;  3CC7 V;  2Y0I A;  3OT7 A;  2YUA A;  2F93 B;  4I0X A;  4AIL C;  2NNU A;  1MMM A;  1WP7 A;  2Y4U A;  1M4U A;  2LGW A;  1OCR B;  4DUY O;  3ZHQ A;  4LFC O;  3ZMU A;  1FAF A;  2VS0 A;  3CS5 A;  5CB4 A;  4JF3 A;  3S3W A;  4PI2 A;  2EZP A;  2P90 A;  3HKB A;  3E22 B;  1FXK B;  4J10 A;  4K8Z A;  4JAV A;  1PNL A;  2CUG A;  2YID A;  4X1Y A;  4TSF G;  3W7S A;  3FB7 C;  4TV8 B;  5KHH A;  2ARH A;  2ZE6 A;  2CDY A;  1V55 C;  1NBM G;  3L71 H;  1CXZ B;  4B3R B;  3K0G A;  1PL0 A;  2A0L A;  4B3T O;  3K5N A;  1W0K G;  2P7T C;  2XUM A;  2B1G A;  4DR1 O;  1XI1 A;  1MZE A;  3NR7 A;  4JI0 B;  4JYC A;  1PP9 H;  4LF6 O;  4MTF A;  4FZ1 A;  3CCQ V;  3AG2 C;  3OMI B;  5DN6 G;  4B7K A;  1Y76 B;  3T1Y B;  5LP6 C;  4QE7 A;  2VQF O;  3IC7 A;  2HHH B;  4J80 A;  5JJJ B;  3LSQ A;  5LMN B;  1YIJ V;  5B3S C;  1AIL A;  1YSC A;  1BL8 A;  3UT5 B;  2ADP A;  1KEC A;  2V4D A;  3EXA A;  5IWA O;  3K5M A;  4CS2 A;  4I9W A;  3K58 A;  4I5S A;  5GON B;  2EIK B;  3RW0 A;  4TQF A;  1VQM V;  5D5P A;  3ZIA G;  2JRI A;  2XAH A;  3W7W A;  3OAA G;  4LF9 O;  3CCJ V;  2ZE7 A;  1OCR C;  3RFR A;  1M56 C;  3OFN G;  5HFM A;  1AJN A;  1M9N A;  1M56 B;  1Q6H A;  4DW0 A;  3BA9 A;  3FAV A;  4TWK A;  3CRC A;  2W6J G;  4GLX A;  4I7Z B;  3UM7 A;  1XOU A;  2OCC C;  5CBG A;  4YJ3 A;  1JJO A;  3WG7 B;  1H2M A;  2IU0 A;  4P2Z A;  3SPG A;  2ZIM A;  1M1K W;  2OWO A;  4LF7 B;  5J2U B;  2UXD O;  5A2Q N;  2G38 A;  3G67 A;  4FIP C;  1P4R A;  1M5I A;  3LSS A;  1Y6X A;  3T4D A;  3CJH B;  1SQX H;  4TT3 G;  4YJ2 A;  4F6R A;  4DR3 O;  1YJN V;  4B3T B;  1T5E A;  2LO1 A;  2YXH A;  3Q4H A;  1K5S A;  5BMV B;  2QEX V;  2F43 G;  2Q73 A;  2RJZ A;  4TUY B;  4DV4 B;  2ZR2 A;  4I50 B;  2PGG A;  1QCE A;  2CGN A;  5L3G A;  2ITD C;  4X88 A;  4BIO A;  2IU3 A;  4HNA B;  1TVK B;  3OTO O;  2OTJ V;  2F95 B;  4DR5 B;  2Q6A A;  1XMQ B;  1AI6 A;  1GN4 A;  3HKE A;  4QNH B;  2P06 A;  1VQ5 V;  1E79 G;  1VQ6 V;  3KKY A;  1IXB A;  3K0D A;  1AI5 A;  3UO2 A;  3RT3 C;  1Z5V A;  1JFF B;  2PTM A;  4O2B A;  1I08 A;  4UVC A;  4PA9 A;  4L8J A;  4X66 B;  4IIJ A;  3MHH C;  4PD4 F;  2EIL B;  2ZXW B;  3U0Z A;  1LR1 A;  2Q0A A;  3CC4 V;  4KHP B;  1TVK A;  2HJF C;  4NVP A;  1R3I C;  2BE3 A;  4DR7 B;  3JSN A;  4I9Q A;  1FXV A;  3SJB C;  4J41 A;  4YY3 O;  3BPZ A;  4K0K O;  3ABK B;  1R73 A;  1VF6 C;  1KC8 W;  1IZ3 A;  1JPX A;  5L3B A;  5LP6 B;  4QPK A;  1F4N A;  3WB0 A;  2DYS B;  1PKX A;  2PZS A;  2P4K A;  3CP1 A;  3VQY A;  5KX5 A;  3A0R A;  2LJ2 A;  4B3S B;  2OCH A;  2PYL A;  2LGQ A;  3VBB A;  2LW1 A;  3OEH G;  1JR9 A;  1WNS A;  3TXS A;  5H5N A;  3E22 A;  3E83 A;  1B3Q A;  1LNQ A;  2GTS A;  1TAE A;  1Q5O A;  2BTQ A;  3CEI A;  4DV7 O;  1SA0 A;  5IJ0 B;  4UCU A;  2WLJ A;  3X2Q C;  4GCZ A;  4HAM A;  4YJ3 B;  3BEH A;  4Z1V A;  3E2E A;  4GX1 A;  3ABL B;  4QPJ A;  1Q43 A;  2Z5U A;  3G6E V;  2FYU H;  1XL6 A;  4DYL A;  4NR1 A;  3I5D A;  4YXW G;  1DK1 A;  2XND G;  4ZHQ A;  1R6K A;  3JAT B;  3BA8 A;  3SDL A;  2YC0 A;  5B1A C;  2P67 A;  2FKX A;  4DR6 O;  1NR7 A;  3ML0 A;  5LOV B;  2MW2 B;  3ZHV A;  1M90 W;  1XUQ A;  5HFL A;  3T1Y O;  5CA1 B;  4IIJ B;  2GV9 A;  1PNK A;  4HZ3 A;  4F4L A;  2UUA O;  4ASU G;  2DYR B;  3N2G A;  2GUZ B;  2DMX A;  3STL C;  2UUA B;  2L6L A;  3TCU A;  1QU7 A;  1YI2 V;  3CB2 A;  3P30 A;  4ZI7 A;  1XNR O;  3ABK C;  3C90 A;  3GB7 C;  2QWP B;  2E5L O;  1BHB A;  4RUF A;  2XAJ A;  3I56 V;  1R6N A;  1URF A;  2AHY A;  4KXR A;  3HKD B;  4DV1 B;  1KP2 A;  3ZS8 C;  2R9R B;  5CA0 A;  5B66 Z;  5KHK A;  3CX5 F;  3DTU B;  5IE9 A;  5BR8 O;  3K59 A;  4QJF B;  2EJ7 A;  1N32 B;  1R3J C;  4E2L A;  4X1K A;  4K3A A;  3M8A A;  4O2B B;  2ODM A;  5IT9 N;  4OX9 O;  2AZ2 A;  3L75 H;  1N8R W;  2BCC H;  2VQE B;  4JTD B;  4DV6 B;  3JD2 A;  3B77 A;  5LHG A;  4LH6 A;  2EIM B;  4UCO A;  3J7A U;  1YTF D;  1ROP A;  4ICG A;  1N4C A;  2IJK A;  4R50 A;  1H38 A;  2QWQ B;  2XT9 A;  4B3S O;  2ZR3 A;  4PA4 A;  2X0L A;  1F4M A;  4JAS A;  3SJC C;  1MSW D;  2Y48 A;  4OGQ B;  1NH2 B;  4GT1 A;  5K1P A;  5E1A C;  1ENV A;  3NXS A;  1QR9 A;  3SYC A;  1J5E B;  4OX9 B;  3AG1 B;  4DR2 B;  3H1I H;  4UFZ A;  2HR3 A;  4PDV A;  4QIW F;  4UCS A;  1SQG A;  3K3W A;  5GTI Z;  3B4S A;  4MVR A;  4N23 A;  1X59 A;  3OR7 C;  1Y4M A;  4WFB V;  2YI9 A;  4CC6 A;  1FXH A;  1HNZ B;  5EZY A;  4BR6 A;  2HVK C;  1FXK C;  3OE7 G;  4JI5 B;  2WA3 A;  5J9P C;  4PV1 B;  1O9G A;  2B5U A;  4F6E A;  1KMI Z;  2X6B A;  2P5O A;  5B1A B;  4JI7 B;  4B08 A;  3ZX6 A;  3ZMV A;  4UB6 Z;  1GM9 A;  4DK1 A;  3OTO B;  4C7U A;  3BAA A;  4KUM A;  1Z2G A;  2E3C A;  3ZRX A;  1MSD A;  5J2T B;  4MVU A;  5EBM C;  1GKF A;  4MVM A;  4B3R O;  1GM7 A;  2YSU B;  3D8C A;  1HNW O;  3OW2 U;  1EZV H;  5JVD B;  1IX9 A;  3JCZ A;  2WLM A;  2Q67 A;  3MHS C;  4UVA A;  3H01 A;  1DF5 A;  4J42 A;  3QO5 A;  3LUT B;  3L9D A;  2R9A A;  3AK1 A;  2GUZ A;  1OZ0 A;  5DED A;  2BTO A;  2DYS C;  5IWA B;  2IH3 C;  3UQ8 A;  1S5L Z;  3BCC H;  1AI7 A;  1R3K C;  2ADQ B;  2EIN B;  2QE7 G;  4CH5 A;  1DLB A;  3K79 A;  4LWS B;  2A06 H;  1NI8 A;  4UV8 A;  5IYZ B;  2H3O A;  1R1B A;  2Q8V A;  2VQF B;  3JCU Z;  1EN4 A;  4KP4 A;  2JGU A;  4X64 B;  1IBL O;  4JI6 O;  1G8M A;  4PJ0 Z;  3P3N A;  1AJP A;  5BXZ A;  4LR3 A;  4MW3 A;  2ZQM A;  1WB8 A;  4FLZ A;  2XHB A;  2W0F C;  2A3Q A;  1VMG A;  4DV3 B;  1W2B U;  4FMT A;  1VQK V;  1QLN A;  3BFR A;  2QSA A;  5H9C A;  1PD3 A;  1YJW V;  3FAV B;  2QR4 A;  1GTO A;  1I94 B;  4HNA A;  2L35 A;  1OHH G;  1IVS A;  2QJ1 A;  1NZ6 A;  3SYQ A;  2B1I A;  3ZBH A;  1WA8 A;  2YIC A;  1JOY A;  2Q4P A;  2HP8 A;  1DTO A;  1WPB A;  1VF5 B;  2HG5 C;  4PI0 A;  4HBN A;  3OMN B;  5CMU A;  2QM8 A;  5H6R A;  4NB5 A;  3QTC A;  5EYP B;  3AK2 A;  4YJ2 B;  2QWN B;  3ASN B;  1QVF U;  1VQN V;  1NVP B;  1KD1 W;  3K06 A;  3SYO A;  1FD9 A;  2FML A;  1N34 O;  1MA1 A;  2WLN A;  1IUR A;  1XMO O;  1V54 C;  3EFF K;  2HLD G;  3SYA A;  4DR2 O;  4JYB A;  3K04 A;  2VRZ A;  3O65 A;  1WA8 B;  4X1I B;  3RYC B;  4NXM B;  1YXB A;  1SQF A;  2JJ2 G;  5LXT A;  3CMA V;  3ABM C;  2KB1 A;  5EC2 C;  5EZY B;  4DV2 O;  3FYE B;  3HPL C;  3JAK B;  4K35 A;  2CH7 B;  1XQ8 A;  4DXW A;  1I94 O;  1S76 D;  2HFE C;  3ASN C;  4WFH A;  3D36 C;  4AQY O;  4LFB B;  2RN9 A;  1W59 A;  1Q7Y W;  1EZJ A;  4DV7 B;  3K5O A;  2PYJ A;  2K9P A;  3JAS B;  3M99 B;  2ATK C;  3P32 A;  3UT5 A;  2VWJ A;  1XRE A;  4DW1 A;  4OXS A;  1FJG O;  1OCO B;  4GX2 A;  2YEV A;  5FPO A;  5KMG A;  2IJH A;  4YY3 B;  1TGO A;  4HYO A;  3HKB B;  3G4S V;  4CS3 A;  3J80 N;  4GYC B;  4TV9 A;  2Y69 C;  1K9M W;  3E8G A;  5LA6 A;  5CA3 A;  2ZM6 O;  2OCC B;  1PPJ H;  1H2G A;  3CPW U;  3CCS V;  4LFB O;  1U97 A;  4YHH O;  3ZED A;  5B1B B;  5LMU B;  4FPP A;  3WG7 C;  1BHA A;  1ORQ C;  3JSL A;  1AP6 A;  1WJZ A;  2E5L B;  3PN1 A;  2JK5 C;  3U10 A;  4LF9 B;  2IH1 C;  2JJ1 G;  4DV1 O;  1UPG A;  5EYP A;  2EIL C;  1X4T A;  4FVM A;  2A7W A;  1XEQ A;  5C8Y B;  4DR7 O;  2UXC B;  3B8M A;  5J2U A;  1M57 C;  5J2T A;  4FFB A;  3ZMT A;  4IHJ B;  2GSM B;  3R65 A;  4UCT A;  3AG7 A;  2RMK B;  2EZO A;  2XAF A;  5FNV B;  1XHX A;  1TUE B;  2F4V O;  3QNE A;  3LSU A;  4X1I A;  1I5Y A;  1DGS A;  4X20 B;  3E8B A;  1XDC A;  1JVM A;  2F4V B;  1ZTE A;  1QR8 A;  3IFX A;  4TUY A;  4MVO A;  4JTC B;  1SS3 A;  2JS5 A;  3RN4 A;  4IHJ A;  4IGG A;  2Q68 A;  3N2K B;  3CCR V;  4JYA B;  4ZIB A;  1VQL V;  4X1Y B;  1B04 A;  2AXT Z;  2AW9 A;  1YDX A;  5FPR A;  2HKO A;  1K97 A;  2VWK A;  5IYD O;  3VQV A;  1E1R G;  1MNG A;  2QWO B;  4X9Q A;  1IBK B;  3JD4 A;  1MAB G;  1RPR A;  4H13 B;  4DR3 B;  4U7N A;  2BOB C;  3X2Q B;  1KB9 F;  4UUJ C;  3ZRW A;  1OCO C;  3KCY A;  4W4K A;  2JGD B;  4MW8 A;  1QBZ A;  4MS2 A;  4OPH A;  2GHY A;  3UO3 A;  1P84 F;  3W7X A;  1GN6 A;  1DF4 A;  3OM3 B;  3ZCC A;  3SPH A;  5DEC A;  4O4J B;  3RWR D;  4PA7 A;  2ZXW C;  3F7V C;  2KG7 B;  1CP9 A;  1GN3 A;  3Q4H B;  1JA8 A;  3J81 N;  4DV5 B;  3HR0 A;  5KAI Z;  5L3E A;  3E8F A;  4A5U B;  4UCV A;  3SPJ A;  4NXM O;  4PEL A;  1KP3 A;  3K9A A;  1YVW A;  3MD0 A;  3ETE A;  1EN5 A;  1WAZ A;  4PHZ A;  4B3M O;  4LWS A;  4LNU A;  3O9O A;  3AEI A;  4D6T H;  5FNV A;  4ZOL A;  2EIN C;  3TJT A;  4O4H A;  5LA6 B;  1US6 A;  1K5Q A;  4ZI7 B;  1Q82 W;  4P9O A;  2V1D A;  1GO3 F;  2CAZ C;  3JAW A;  2ETN A;  1H8H G;  4B7E A;  3BVO A;  3KCX A;  1LUV A;  4JI7 O;  1NH2 D;  2N05 A;  5KLV H;  1ARO P;  4J11 A;  1BQZ A;  2NR5 A;  4H44 B;  4BIU A;  3B2E E;  3SJA C;  4UV9 A;  4DUZ B;  3L70 H;  2X6C A;  2YXL A;  2GBO A;  3JAW B;  3DC6 A;  4MTO A;  3LNM B;  2ZD9 A;  1NJI W;  4JI8 B;  3K03 A;  1S3J A;  4BWA A; 
#chains in the Genus database with same CATH homology
 2NNU A;  3K3W A;  1FFT B;  2JIZ G;  4MVR A;  1OCR B;  2Y69 B;  4N23 A;  3OR7 C;  1Y4M A;  4WFB V;  1FXH A;  4J9Z B;  4CZZ A;  3ZMU A;  2AHZ A;  2HVK C;  1FXK C;  3F5W C;  3OE7 G;  2LP7 A;  5J9P C;  4XDL A;  1VQ9 V;  2B5U A;  4UVB A;  1XL4 A;  3EHB B;  4JF3 A;  2X6B A;  2EZP A;  5B1A B;  3OEE G;  2QM7 A;  2P90 A;  1FXK B;  3ZMV A;  4CBC A;  3D3I A;  1GM9 A;  1Y66 A;  2DW4 A;  4JAV A;  1L1F A;  1PNL A;  3AG1 C;  3OGC C;  4KUM A;  4MTX A;  4TSF G;  3ZRX A;  3W7S A;  4MVU A;  5EBM C;  1NR1 A;  1GKF A;  3FB7 C;  4MVM A;  1GM7 A;  2YSU B;  2WLK A;  3KG2 A;  4P30 A;  1P7B A;  1V55 C;  2QA4 V;  3OW2 U;  1GMG A;  1NBM G;  1CPY A;  1S5H C;  1SZT A;  4QE9 A;  4PDM A;  2DWD C;  3OUF A;  3JCZ A;  3K0G A;  1PL0 A;  2WLM A;  2Q67 A;  2A0L A;  1W0K G;  2W6I G;  3MHS C;  1JX9 A;  4UVA A;  3H01 A;  3CCV V;  2P7T C;  1DF5 A;  4GX0 A;  3JD1 A;  2B1G A;  3QO5 A;  3LUT B;  3ABU A;  1GM8 A;  4JYC A;  3DGE A;  4JGS A;  3E8H A;  4MTF A;  4P9P A;  3TK1 A;  3CCQ V;  3AG2 C;  1MOF A;  3OMI B;  1OZ0 A;  3ZN1 A;  5DN6 G;  4DO2 A;  2DYS C;  2IH3 C;  2A79 B;  1AI7 A;  1R3K C;  3CCL V;  1RM1 C;  3SPI A;  2EIN B;  4QE7 A;  2QE7 G;  1OCC B;  3IC7 A;  1DLB A;  2LFS A;  3K79 A;  1K92 A;  1COW G;  4JPR A;  3LSQ A;  4WF9 V;  1YIJ V;  4ZKI A;  4RQF A;  2Q69 A;  1EBO A;  5B3S C;  4UV8 A;  1YSC A;  5B3S B;  1BL8 A;  1Q81 W;  2C2A A;  2WAM A;  5LGT A;  1RPO A;  1KEC A;  5LHI A;  1I5X A;  2IJJ A;  4KP4 A;  1K4D C;  4I9W A;  5CBH A;  1G8M A;  4RO2 A;  4I5S A;  1K3E A;  2EIK B;  2WPD G;  3RW0 A;  1VQM V;  3VOU A;  3ZIA G;  2XAH A;  1FS0 G;  2ZDI C;  1AJP A;  3W7W A;  2XAQ A;  4MW3 A;  4BW5 A;  2ZQM A;  3G71 V;  3OAA G;  1CEZ A;  3CCJ V;  1OCR C;  1M56 C;  3OFN G;  3CCM V;  5HFM A;  1AJN A;  1M9N A;  3ZRV A;  5IYC O;  1K33 A;  1M56 B;  2EJR A;  3OMA B;  2W0F C;  4TWK A;  2W6J G;  3F7Y C;  1W2B U;  2ITC C;  4FMT A;  1VQK V;  1QLN A;  3UM7 A;  1AI4 A;  4GX5 A;  5H9C A;  1PD3 A;  2OCC C;  5CBG A;  1YJW V;  1GTO A;  4X89 A;  3WG7 B;  1OHH G;  1K7D A;  3CC2 V;  2IU0 A;  2B1I A;  4P2Z A;  3SPG A;  2XOK G;  3SYQ A;  1M1K W;  2WLL A;  1JOY A;  2H94 A;  1EFR G;  3OUS A;  1S72 V;  1VQ7 V;  2YEV B;  4FIP C;  4RQE A;  1P4R A;  5B1O A;  1JQ0 A;  2P6J A;  2EIK C;  3LSS A;  5H6Q A;  1DTO A;  5EBW C;  3T4D A;  2HG5 C;  4TT3 G;  4Z1M G;  2X7R B;  2EBO A;  1YJN V;  3OMN B;  1SET A;  5CMU A;  2QM8 A;  4BAY A;  5LHH A;  5H6R A;  3FKS G;  1K5S A;  4WCE V;  3ASN B;  2QEX V;  3LDE A;  2F43 G;  3JYC A;  5IY5 C;  1QVF U;  3ABM B;  1VQN V;  3FB8 C;  1NVP B;  3IGA C;  3ABT A;  1KD1 W;  3K06 A;  1HWY A;  3SYO A;  1QVG U;  2WLN A;  2ZR2 A;  1V54 C;  3EFF K;  1FXK A;  3AG2 B;  2HLD G;  3SYA A;  3ZRW B;  4JYB A;  1V54 B;  3K04 A;  1QCE A;  5BZB A;  3ZMS A;  3ABL C;  2JJ2 G;  5L3G A;  3CMA V;  1VQO V;  3ABM C;  2KB1 A;  1WLE A;  2ITD C;  4X88 A;  2IU3 A;  5EC2 C;  4R7C A;  5EBL C;  2OTJ V;  4L87 A;  3SJQ C;  2Q6A A;  3FYE B;  1AI6 A;  3HPL C;  4XDK A;  3CME V;  4QNH B;  2IJI A;  1KQS U;  1VQ5 V;  4DXW A;  1S76 D;  4H33 A;  1E79 G;  4MSW C;  5L3F A;  1S0V A;  1VQ6 V;  2HFE C;  3ASN C;  4WFH A;  2Z3Y A;  3K0D A;  1AI5 A;  4LCU C;  5LGN A;  1Q7Y W;  3T1C A;  1EZJ A;  4X8A A;  4UVC A;  2QTO A;  4PA9 A;  3E35 A;  1GK9 A;  3M99 B;  3RBZ A;  2OT5 A;  2ATK C;  3MHH C;  3P32 A;  1M57 B;  2M7W A;  2EIL B;  2ZXW B;  3E89 A;  2WLH A;  4OXS A;  4WFG A;  1OCO B;  1JJ2 U;  4MT8 A;  4GX2 A;  2YEV A;  3AG3 B;  4BIZ A;  3CC4 V;  2HJF C;  2IJH A;  3UKM A;  2HVJ C;  1OCZ C;  4HYO A;  1R3I C;  4PA3 A;  2WLL B;  4MVS A;  3G4S V;  4R8C A;  1FXV A;  2Y69 C;  1K9M W;  3E8G A;  5CA3 A;  1WPX A;  2JEU A;  2OCC B;  4Q20 A;  3ABK B;  2H8P C;  4ZBM A;  1H2G A;  1R73 A;  4J9Y B;  3CPW U;  3CCS V;  3ZJZ A;  1YIT V;  1KC8 W;  1JPX A;  1S77 D;  2DWE C;  5B1B B;  3CCU V;  3CYO A;  5L3B A;  4WFA V;  4QPK A;  1VQ4 V;  1F4N A;  4FPP A;  3WG7 C;  1BHA A;  1ORQ C;  2DYS B;  2NLJ C;  4JAU A;  1PKX A;  2JK5 C;  3CP1 A;  3LDD A;  4FK5 C;  4G28 B;  2IH1 C;  2JJ1 G;  2MK3 A;  3A0R A;  3AG4 C;  2EIL C;  4RAI A;  5IY5 B;  4UXN A;  3VBB A;  3QO7 A;  4LP8 A;  3B8M A;  2EIJ B;  3OEH G;  1YJ9 V;  3FB5 C;  1M57 C;  1YHQ V;  1QLE C;  3T2M A;  3ZMT A;  3E83 A;  3FB6 C;  2GSM B;  3R65 A;  1F51 A;  1LNQ A;  2CK3 G;  3SYP A;  2EZO A;  1H8E G;  2WLJ A;  3X2Q C;  4GCZ A;  4HAM A;  3BEH A;  2BOC C;  2XAF A;  3E2E A;  2JDI G;  4GX1 A;  3ABL B;  4XBF A;  4MVZ A;  1TUE B;  3ETD A;  3QNE A;  3E86 A;  1VQ8 V;  4JTA B;  4PDL A;  1I5Y A;  4QPJ A;  2Z5U A;  4PDR A;  3G6E V;  1SES A;  4MTG A;  2EIM C;  1XL6 A;  2DQ3 A;  3E8B A;  3W7U A;  2WLI B;  4YXW G;  3ZRS A;  1JVM A;  3ASO C;  2XND G;  1OCC C;  1R6K A;  1QR8 A;  1RM1 B;  4EKW A;  5B1A C;  2WWW A;  2P67 A;  3IFX A;  5L3D A;  1SER A;  5EK0 A;  3AG4 B;  1NR7 A;  3JD3 A;  4MVO A;  4JTC B;  1K73 W;  4MVQ A;  3ML0 A;  2DQ0 A;  2ZDI A;  2Q68 A;  4PA6 A;  3CCR V;  2WSS G;  1M90 W;  1QLE B;  1VQL V;  5HFL A;  1ZWI C;  1W0J G;  5B1B C;  1NQT A;  4WFE A;  1F23 A;  2EIJ C;  3JD0 A;  2HKO A;  1PNM A;  3ETG A;  5IDJ A;  1Q86 W;  1K97 A;  5KA5 A;  1PNK A;  5LGU A;  1K34 A;  4HZ3 A;  4F4L A;  5IYD O;  3TET A;  1E1R G;  1KKD A;  4ASU G;  1G4Y B;  3JD4 A;  2DYR B;  1MAB G;  2XAG A;  2OTL V;  1RPR A;  4R6Z A;  4FJC C;  4U7N A;  3RVZ A;  2BOB C;  2JEX A;  3RVY A;  3STL C;  2LFR A;  3TCU A;  3X2Q B;  1YI2 V;  3OR6 C;  3P30 A;  2QKS A;  5CBF A;  1K4C C;  3FYI B;  5KUM A;  2IW5 A;  4UUJ C;  3ZRW A;  2XAS A;  2PI4 A;  3ABK C;  1OCO C;  1JCH A;  3GB7 C;  2V7Q G;  3ZN0 A;  4H37 A;  3T4Z A;  1BHB A;  3ZMZ A;  4MW8 A;  4RUF A;  1BMF G;  2XAJ A;  1QBZ A;  1R6N A;  4MS2 A;  5C93 A;  3I56 V;  2AHY A;  5GW7 A;  2GHY A;  4XDJ A;  1KP2 A;  1IXM A;  4LC1 A;  4N21 A;  3W7X A;  2R9R B;  2PI5 A;  1DF4 A;  2A9H A;  3OM3 B;  3ZCC A;  3SPH A;  3LDC A;  3HB3 B;  5CN0 A;  4PA7 A;  2X6A A;  1NVP D;  5B1N A;  2ZXW C;  1R3L C;  1AJQ A;  3DTU B;  3F7V C;  4G2K A;  1MG1 A;  1CP9 A;  4QJF B;  1R3J C;  4E2L A;  5L3E A;  1E1Q G;  3E8F A;  5FL7 G;  1V55 B;  3GWO A;  3CXC U;  3SPJ A;  5LBQ A;  3I55 V;  4PEL A;  3CCE V;  1KP3 A;  3K9A A;  1N8R W;  3MD0 A;  5IYB O;  3D36 A;  1AR1 B;  3ETE A;  4JTD B;  3SPC A;  3JD2 A;  3B77 A;  1VQP V;  3CD6 V;  3K08 A;  5LHG A;  2EIM B;  4RUE A;  3WFV A;  1OCZ B;  1ROP A;  3AEI A;  1UJW B;  1YTF D;  2IJK A;  3PJS K;  1THZ A;  4KFM A;  2R9I A;  3AG3 C;  1SRY A;  2WLI A;  3QO8 A;  2EIN C;  3BY6 A;  3B8N A;  4R50 A;  4G27 B;  2UXX A;  5DM6 V;  1H38 A;  1K5Q A;  1Q82 W;  2ZR3 A;  4PA4 A;  4P9O A;  2X0L A;  1NKD A;  1YTF B;  1F4M A;  1GO3 F;  2V1D A;  4LBE C;  5KA6 A;  1H8H G;  4JAS A;  2D3O W;  1MSW D;  2K1E A;  2Y48 A;  1K8A W;  1NH2 B;  4GT1 A;  1NH2 D;  5E1A C;  1ENV A;  3NXS A;  1ARO P;  3ASO B;  3W7T A;  1QR9 A;  3SYC A;  2FTK A;  5EC1 C;  4BIU A;  1J95 A;  4U7O A;  3AG1 B;  4UV9 A;  5L3C A;  2X6C A;  2UXN A;  2HR3 A;  4WFF A;  3STZ C;  5KUK A;  2DYR C;  4MTO A;  3LNM B;  4PDV A;  4QIW F;  3CC7 V;  1B6Q A;  2ZD9 A;  1NJI W;  3K03 A;  1S3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...