2ZDIC

Crystal structure of prefoldin from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
b'MAQNNKELEKLAYEYQVLQAQAQILAQNLELLNLAKAEVQTVRETLENLKKIEEEKPEILVPIGAGSFLKGVIVDKNNAIVSVGSGYAVERSIDEAISFLEKRLKEYDEAIKKTQGALAELEKRIGEVARKAQEVQQKQSMTSFKVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin subunit beta
publication title Structure and molecular dynamics simulation of archaeal prefoldin: the molecular mechanism for binding and recognition of nonnative substrate proteins
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Chaperone
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02996 Prefoldin Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zdiC00
2ZDIA 1FXKA 2ZQMA 1FXKB 3AEIA 2ZDIC 1FXKC
chains in the Genus database with same CATH superfamily
3JAKB 4WF9V 1CP9A 4ZOLA 3L9DA 4DYLA 1SC5B 3C3SA 3T4ZA 4CZZA 4FLYA 1MSDA 3EFFK 4DV4O 1KUQA 1NR7A 3AEIA 4MVRA 1SZTA 1R1BA 3JAMN 5E79Z 5JCOC 4PA9A 4BIZA 5KA6A 2Q0AA 2V7QG 4I4TB 1PV0A 2Q67A 3MHHC 4G28B 5H2FZ 3FAVA 4JAUA 4YIOA 3H1JH 4AHCA 1MNGA 5L3CA 4DR7B 5KMGA 4F6RB 3B8MA 3PN1A 2Y0IA 4O4JA 1XUQA 4I9WA 3CS5A 1AP5A 2P22C 2UXXA 3G80A 3K0DA 4B3SB 5LGTA 2UUCO 2M7WA 1NH2B 3RVZA 1EZVH 1WB7A 1HDJA 2X7RB 3FX7A 1QBZA 4DV2B 3ZCCA 3I56V 4UV9A 2QE7G 3WFVA 4D7SA 1YIJV 2Y4UA 1TVKB 3ZHSA 2B1IA 4QE7A 5A2QN 3SPHA 2KG7B 2PI4A 2UU9B 4TOIA 2ARHA 3RYCB 2QKCA 1NJIW 5CA0B 4TQDA 5FLXN 1R3JC 3BABA 3AG2C 3UO3A 4X1IA 1GM7A 3BVOA 3LNNA 4ZI7B 4H44B 3DC6A 5IWAO 3SJCC 3ETDA 4LF7O 3FYIB 1P4RA 5C8YB 3RYFA 1DK1A 2CTQA 1OCRB 3JD3A 1EN6A 2YICA 1FJGB 1SA0A 3E8FA 4MVOA 4KXRA 1VQKV 2LW1A 3ZHUA 1B6QA 4DV3O 1TUBB 2Q68A 4JI5O 1QR8A 2Q7HA 5LHGA 3S3WA 2CTPA 3SPCA 3IJ4A 2NNUA 3HKEB 1OCOC 2EIJC 3APQA 3OM3B 2ZR2A 1JCHA 2ZE6A 2GUZA 3L72H 2QWPB 4H33A 1DTOA 3JCZA 2LW7A 4FPPA 4JI3B 1EBOA 1JJOA 1JVMA 4I50B 3SGIA 5B3SB 4O2BB 3FKSG 4BW9A 3M7MX 1KP3A 5KAFZ 2XTAA 3AG1B 1BHBA 5CBHA 1H2MA 2EINC 5ITZB 1Y76A 1URFA 3SDLA 4JPRA 1XDCA 4FFBA 2QTSA 3L75H 1HP8A 5BXZA 3B77A 1K4CC 5J2TA 1QVFU 1V55C 1JA8A 2Q69A 4A5UB 1J5EO 4IYIA 1VQ4V 5KHHA 4UCRA 2NR5A 1LUWA 4RQEA 3OEEG 4NTYA 1Y67A 2EZOA 3FFQA 1Q86W 4R6ZA 5IT9N 3CMAV 5CBGA 1Z2GA 4DW1A 1VIBA 1ZLZA 5JWPA 1ZUQA 1KMIZ 3CX5F 4K8XA 4I7ZB 2P5OA 2Q6AA 3JATA 2P90A 3CSXA 3JCUZ 3C90A 2ZM6O 2HR3A 1FS0G 3BA8A 5LMUO 1K9MW 4WCEV 4JI1B 4EB6B 3JYCA 1AI5A 4NXMO 2DQ0A 4JI6B 3ZS8C 2CTWA 4O4LA 1I7FA 4LF5O 3JSLA 3U11A 4RQFA 3CP1A 4P9OA 3HKCA 4YY3O 4JI8O 3CB2A 2GTSA 4O4HB 4QPKA 2F93B 1Y74A 1KYOF 5B1AC 5BMVA 4OX9B 3CWBH 2EIMC 4U3JA 3SYAA 3ASNB 4B3RB 1S5LZ 2OTLV 4H13B 1I5YA 3RGBA 1DGSA 1AB3A 2ZD9A 1BL8A 3ZIAG 3RBZA 4ZOLB 1XMQB 2N04A 4JYAO 1K5QA 4J9ZB 3VQVA 3T1HO 4ABMA 2BSKA 1MABG 1NBMG 5C93A 3DSQA 2LGQA 2ADQB 3FB6C 4JI4O 2UUBB 5DM6V 1ZAUA 2W0FC 4J9YB 3FAVB 5EK0A 1HR0B 2PI5A 3TJTA 1DF4A 2M6YA 1US6A 3CMEV 4X1YA 5KMGB 1W59A 2A9HA 2EJ7A 1WP7A 4O4JB 2QTOA 5IJ9A 4GKJO 1PNKA 2X0LA 3A0BZ 5LP6A 1YVWA 3K03A 1S76D 4QGPA 3RVYA 1QQCA 4X65O 4JI2O 4NB5A 1SQVH 1AI6A 3WB0A 1YXBA 3CCEV 2DJVA 3OD4A 2JDIG 1XEQA 2DWDC 4J7KA 2YIDA 1FAFA 1EFRG 3AG3B 4MT8A 3T2MA 3TGUH 2AW9A 3ZRXA 2ZINA 1VQMV 3LDEA 4LH7A 3A8TA 4ZIBA 4GKKO 4TUYA 1G4YB 4NTWA 4QIWF 2OYQA 5KHIA 1GM8A 2FTKA 3BRCA 1GO3F 2Q4PA 3OUFA 4DR1O 1MA1A 3QG5A 3QO5A 1N0JA 1TGOA 2JS3A 4X1IB 3DTUB 2X6CA 2AGAA 2IM9A 4LF9B 4DV1O 1G1XB 4MTOA 2H3OA 3CRMA 3D3IA 3LDCA 3RYFB 2VQFO 2OT5A 3AK3A 1XQ8A 2QM7A 3L73H 3T1CA 4DV0B 1XNQB 1SA0B 4P30A 2P67A 4GX2A 1YCIA 2Q73A 2DOSA 4TSFG 1PKXA 1GN4A 1SQFA 2PF4E 3T1YO 2B5UA 2YXYA 5GONA 2QSAA 4JASA 1YDXA 1OCRC 1VQ9V 5H5NA 1PNMA 3ZRVA 3BY6A 4PELA 1EN5A 4GUNA 4WBNA 5LGNA 3W7UA 1IBMB 1PNLA 1GK9A 1N0NA 2GUZB 1AP6A 1E1QG 4WFEA 3OMAB 3RT3C 3ZRWA 4I9QA 1EM1A 4FIPC 4HAMA 4JZGA 4UFZA 2YC0A 1AJQA 2HFEC 1P84F 5F2VO 2DQ3A 4BWAA 4NR1A 2HVJC 3U10A 3KCXA 1Y76B 4MW8A 4R50A 2ZT9B 1N33O 1I5XA 2F1MA 4FFBB 4HYOA 2ZCEA 1JR9A 2ZNJA 3U0ZA 3BAAA 4R7CA 4LFCB 3A0HZ 2WLLA 3F7VC 3ICXA 5J2TB 1U97A 4KL1A 4PA6A 4QJFB 5LOVA 2HJDA 2D3OW 2XUMA 4DV6B 4EEQA 1O9GA 3CRRA 4Z1MG 2OCCB 1ZWIC 5CA1A 1SF9A 2JJ2G 5DN6G 4DR7O 1SQPH 2OTJV 1FXKA 2Q5ZA 3A2FA 1UFIA 3JALA 1PD3A 1OCCC 3K79A 4O2AA 1FXKC 1N32B 3ABLB 1YTFD 1KB9F 1IXBA 3ETQA 1VQPV 1SQBH 3TXSA 2CTRA 2IU0A 3JATB 2YIAA 3ZMTA 2XAFA 4B3SO 4MVSA 1YITV 1S5HC 5H6RA 1K34A 1KKDA 1K4DC 1MOFA 2ZR3A 5LXTA 5KHJA 2EILB 1GRJA 4YJ2A 1QR9A 3SYOA 4O4LB 4DR5B 2KSDA 1NTKH 3QVNA 5JVDA 4MTXA 3CPWU 4WFHA 3G4SV 2RNBA 4DR4B 3HKCB 5JQGA 2UU9O 4FZ0A 1XILA 5B1AB 1Y74B 5BMVB 2EIMB 4UCSA 1HNXO 2QM4A 1I0HA 2QWRB 4NTXA 4U3JB 3CRAA 2Q9LA 4G27B 4IYHA 1H8EG 3ABTA 3EXAA 1N36B 2WLKA 1BT8A 1FJGO 3ASNC 2KB1A 3CCVV 4RUEA 2YSUB 2GSMB 5D5PA 2BSKB 1FXHA 4X8AA 1M93A 4LF8B 4GYCB 1N8RW 1I08A 2OCHA 1YZBA 1IURA 3UM7A 4B08A 2V1DA 1XREA 1N4CA 2K9PA 4X1YB 4X1KA 4JI3O 1SQQH 1EN4A 4PDVA 4JV5O 5IJ9B 4AILC 5LP6B 2HVKC 2JK5C 2ZXWB 1KP2A 4UCTA 3E22A 5J9PC 1IXMA 2OIEA 1VF7A 4YHHB 3E8BA 2MW2B 3FB5C 2YI9A 2L6LA 1GN6A 4FLTA 5EBLC 2LO1A 4CH6A 4U7OA 5EBMC 4TUYB 4J10A 3AG3C 2CGNA 2X6BA 2ZQMA 5JJJB 4J41A 2ZE5A 2VRZA 2UXCB 1Z5WA 3OTOB 2WPDG 3O9OA 2E5LB 3ZN0A 2E76B 1XI1A 2IJKA 3OGCC 1AVMA 2P6JA 4PJ0Z 1SZXA 1AJPA 3SYPA 3X2QB 1Q6UA 2A0LA 4UCOA 2DW4A 2RDCA 1WJZA 1L8DA 2Q7EA 3H1HH 3K04A 3TXQA 3STLC 5KHGA 3I5DA 1KBHA 3NR7A 3VQXA 3J81N 4JI1O 5GONB 1Q3EA 2A7WA 2AZ2A 4JI6O 4DR6B 1K7DA 2JGDA 1E1RG 4HBNA 4NVPA 2FKXA 2Z5UA 4UVCA 4LF4B 1BZKA 3R66A 1GM9A 5L3DA 3SPGA 4WBNB 4DUZB 1Q90D 4AQYB 1FFXA 1LUVA 5GTIZ 3CC4V 5IY5C 3ZRWB 2F4VB 3QTCA 1H38A 2L35A 3ZHVA 4OX9O 3JAWA 4B7KA 4LC1A 1K97A 3E8GA 2WLMA 4B3RO 2NN4A 1AI7A 4Z1VA 5H9CA 1VEWA 1HWYA 3H1IH 5KHKA 1S77D 3B4SA 3E86A 4YXWG 2Z3YA 4D7TA 1XMQO 1HNWO 2XAHA 5EIBD 4YIPA 2XAGA 4MVUA 4IIJA 4PA4A 4FJCC 1M5IA 1S3JA 2WLLB 3SPJA 2AZ0A 2ZIMA 2YXHA 3CCLV 3P3PA 5LOVB 3JARA 4GCZA 2CGOA 2UUBO 1D5NA 2GBOA 1KECA 1LR1A 4DR2B 5CA1B 1AROP 1RFYA 4YJ3A 1HR0O 5D5QA 2R9RB 2CE4A 3ZRSA 4P9PA 1OCCB 3H1LH 1FXKB 3JALB 3OR6C 4O2AB 4CH3A 2IH1C 1M9NA 1FFTB 2OCCC 1Y66A 1VF6A 2RQ6A 3LDDA 1MZEA 4I5SA 3CEIA 3K5NA 1X59A 3ABLC 1H2LA 2DE0X 5KX5A 3UKMA 4B7EA 3G71V 4EFEA 5LXTB 4TV8A 1GAXA 4F4LA 1WLEA 4YJ2B 1V54B 4X89A 2BTOA 3F5WC 5JVDB 1Q6HA 2LJ2A 3SJBC 1IBKB 2RJZA 2OIGA 3M8AA 1T5EA 1YEWA 2EILC 2LQTA 5JQGB 3WG7B 2RN9A 1ROPA 4NXNB 1U96A 2IJIA 2JEUA 2PGGA 2W0XA 2JIZG 3ABKB 5KAIZ 2PYLA 3IGAC 1XBLA 1P7BA 1Q8IA 4LF9O 5JJEB 3ZHRA 4E2LA 2C2AA 1IBLO 3KG2A 4J11A 4PA7A 4CC5A 1YTFB 5IYCO 1H2NA 4FLVA 1XNQO 2ETNA 3D8CA 2PY5A 1YHQV 2IJJA 2ODMA 4LH6A 2R9AA 3E2EA 1S0VA 1JMKC 4DV5O 3LSSA 5IYBO 5B5EZ 3TCUA 4FVMA 1XHXA 2QJ1A 1Y4MA 3ZMUA 4DR3B 1MMMA 1S5JA 1IBMO 1D2DA 1SKVA 4X1KB 4IT5A 1CXZB 4CS3A 4LCUC 2JEXA 4OGQB 5CB4A 4AI8A 3B2EE 3GB7C 1H8HG 2ADPA 5EZYA 1ORQC 1B06A 1N34B 3CXHF 3H1KH 3E22B 4U7NA 4B3TB 5LMNO 1RM1B 5LP6C 1ENVA 1E79G 2ZXWC 3AK2A 2Q7GA 2IH3C 1XL6A 1M90W 3TK1A 4GZRB 4CC6A 1FYJA 4LFCO 4MTGA 3BCCH 4J7JA 2IU3A 1WB8A 3MHSC 1K3EA 5A9GA 2UXBB 4N23A 2FL4A 3QF7A 3W7XA 4DV6O 1HNZB 1HW7A 1BCCH 5KA5A 1XMOB 3T4DA 5BR8O 2UXDO 4FK5C 4P2ZA 2QWQB 1NU1H 1GN2A 1KU9A 1VF5B 3BA9A 1N32O 4NYKA 5IYZA 3K5LA 4JYCA 3PJSK 2ZKOA 3K9AA 1TA8A 1A32A 1Q43A 2E74B 3MDSA 1Q82W 3H9VA 3GVMA 1MZFA 4X20A 3E35A 1SETA 1TAEA 3RW0A 4CH4A 1RSOA 3R65A 1V9PA 3X2QC 1PPJH 4XDKA 2WLNA 1SRYA 3N2KA 4JTDB 4JI7B 4YY3B 2JGDB 3A0RA 4JI8B 1AR5A 2CDYA 4PA3A 4DR5O 1BE3H 1GN3A 1R73A 5FPRA 1Q81W 4HNAA 1VQLV 3CD6V 5IY5B 1FFXB 1IX9A 1F51A 4K3AA 4LNUA 1ZX3A 4Q6GA 4B3MB 1SS3A 2KQXA 2WLJA 3JAWB 1QCEA 1AI4A 3N27A 1NKDA 2GDSA 4LWSA 2EIKC 4X66B 1WP8A 2UXNA 1MG1A 5B1BB 3UCSC 3HKDA 5BY1A 4PD4F 4JZ2A 1R6KA 4DUYB 4CS2A 1NT2B 4IIJB 1R3KC 2N74A 5FNVA 1Y6XA 1ZL8A 3OFNG 4PDLA 3JSNA 3HPLC 3B8NA 3JARB 2IBZH 4LF8O 5KUKA 4KP4A 1Q6IA 2V4DA 4KFMA 1GH6A 4BW5A 3CCSV 3OT7A 4DV7B 2P7TC 1Z5VA 4YJ3B 2YS8A 3VQWA 2GTAA 3SYQA 3CJHA 4X65B 3EVKA 3OGIB 3JD1A 1PM9A 4PDRA 4FLWA 4BIUA 4C7UA 2CH7A 3CYOA 3KCYA 4DK0A 4MVQA 3UT5A 4GLXA 4YHHO 4CH5A 3BPZA 4XDJA 4TV9A 5KX5B 3Q4HA 1M56B 3AG4B 4I55A 5FPOA 3LSQA 4K0KB 4TV8B 4G2KA 3B09A 4O4IA 3CC2V 4DR1B 1QLNA 1WA8A 1QU7A 4DV2O 3CHXA 4X64B 1W2BU 3ABUA 3BHPA 1JOYA 4KHPB 3ASOC 1W0KG 1XOUA 1V54C 2UXCO 3OTOO 3CCRV 4LP8A 1I94B 4LF6B 1VMGA 1JX9A 1OCZB 2Y0PA 2HKOA 4RWUA 4X9QA 1UJWB 2XHBA 4LFBB 3WG7C 5IJ0A 4UVBA 2A79B 4DW0A 2PYJA 1NTMH 2UUAB 2JGUA 2DMXA 4OPHA 1YJNV 4UB8Z 3ABKC 1BQZA 1EZJA 5L3FA 1H2GA 1P7GA 1W0JG 2AHZA 2W6IG 4GX0A 2WWWA 3P30A 1KC8W 2DYRB 3LUTB 1TUEB 4DR6O 3VOUA 1GTOA 3SJQC 4Z2WA 4ZHQA 4K35A 4DUZO 1VQ5V 4AQYO 2IJHA 3FB7C 2VQEB 4WFBV 3MAQA 1NR1A 2F4VO 4W4LA 1DLBA 1Q5OA 4IGGA 5CB4B 3CXCU 1THZA 5EZYB 4W4KA 5CBFA 1BS3A 3RN4A 1QVGU 3MD0A 3SR2C 5LA6A 1N33B 3JD0A 2YI8A 2QEXV 4IL6Z 2VWJA 4J80A 3QNEA 4FLZA 1XNRB 2LFRA 4MVZA 3DC5A 5JCOA 2CAZC 3ABMB 2Y69B 2EBOA 2WA3A 3RYHA 1XL4A 3SPIA 3JASA 2JRIA 4XBFA 1IVSA 4MSWC 4ASUG 3K08A 4LFAB 3G6BA 1FKAO 2WA4A 1KKCA 3K5OA 4J42A 3ZBHA 1RM1C 4L87A 2Y48A 4X62B 4D6TH 1PL0A 5H6QA 4DK1A 4DR2O 5EBWC 3FB8C 5LBQA 1JFFA 4WFGA 2R70A 4QE9A 2ZE8A 3AG7A 3WU2Z 1BQ0A 1UPGA 4JYYA 4UCVA 3APOA 5IYZB 2VWKA 1COWG 2LGWA 1SESA 4JGSA 4X20B 5GW7A 3ML0A 2H8PC 4GX1A 1GMGA 5LGUA 1O9HA 1RSOB 1H2KA 1RPRA 2YUAA 4UUJC 2DYSB 2VS0A 1D5AA 3N2KB 3K3WA 1PP9H 4KUMA 2DN9A 1M1KW 3RYIA 1K8AW 4NKGB 1IBKO 2YDEA 3JD4A 5BZBA 4FM2A 1IZ3A 1HNXB 2LP7A 5KUMA 3K59A 3CCJV 2RCVA 2QR4A 4HNAB 4JAAA 4FM1A 4MW3A 2QKSA 4NXNO 1BSMA 4LNUB 2HHHB 2WLHA 1BGYH 3AK1A 3B40A 5IDJA 2EIKB 4LWSB 3OMNB 1R6TA 1WAZA 2X6AA 4JI0B 5J2UA 4FMTA 4XDLA 3HKBA 2XAQA 3S3XA 3ZX6A 1OHHG 2Y4TA 3JD2A 3HB3B 2GHYA 3HKDB 3NXSA 3ZMSA 4LBEC 4DV4B 1G8MA 5EYPA 3L70H 1SQGA 4MVMA 5IYDO 4MS2A 4OPAA 3KKYA 5B1BC 5FNVB 2QA4V 4N21A 1ZL8B 5L3BA 4CS4A 3DXRA 3GWOA 2KKWA 4JYBA 3K58A 4PI2A 4I0XA 2YEVA 3M99B 3ZEDA 4JF3A 5HFLA 4DR3O 1YJ9V 2W6JG 4JV5B 1L0LH 2N05A 2ZNIA 4GT1A 2ZIOA 3OE7G 3CJHB 1R3LC 1YI2V 4Q20A 2GV9A 3ZHQA 2P06A 1RPOA 2EZPA 5DEDA 2EX3A 5LYJA 5K1XA 1G6UA 5AG2A 3UO2A 5FL7G 3K06A 1N34O 1FD9A 1NI8A 2QGNA 1NVPD 2CH7B 2F66C 3UT5B 2UUCB 4X88A 4B3TO 1AILA 4TV9B 3Q4HB 4HZ3A 4I55B 3OEHG 4BIOA 2FYUH 5LHHA 1VF6C 1LNQA 2XOKG 4UV8A 3G67A 4IHJA 3WB1A 2CK3G 4O4IB 2FB5A 2H94A 2WSSG 3P32A 2PUSA 5JH7A 1WA8B 1KD1W 2UXBO 1M56C 3AG4C 1FXVA 2K1EA 3ASOB 4DRXA 4QNHB 1JPXA 2R9IA 4RUFA 1HNZO 3CE2A 2WLIA 5EIBC 3D3QA 1XMOO 2Q8VA 2BE3A 2BTQA 3RWRD 2ITDC 1QLEB 5IWAB 2A3QA 2DWEC 2FMLA 4LF7B 3W7SA 3F5TA 5IJ0B 1M4UA 1NS1A 3D36A 1VQ7V 1VQOV 1OCZC 3BEHA 4ZKIA 2ITCC 3D36C 5L3GA 4PDMA 4FLUA 2BCCH 1S72V 2MK3A 3K0GA 3L74H 1BMFG 4QPJA 4DV3B 2XT9A 4PV1B 2CUGA 1MSWD 4DV0O 4JI7O 4JI5B 3ZJZA 2R72A 2JJ1G 2XAJA 2HP8A 5B66Z 3K5MA 3OAAG 4ZHQB 5B1NA 1K5SA 2DYRC 4UXNA 5CN0A 4RAIA 2G38A 4E4EA 1M57B 2QWNB 1NZ6A 4BAYA 4B3MO 3K57A 3LNMB 2BOCC 4UB6Z 2BOBC 1XHZA 1VP7A 1ZTEA 1NH2D 4X66O 3OW2U 1HNWB 5LA6B 4FFKA 3QO8A 4UCUA 3THOA 3N2GA 3JAKA 1KQSU 4BR6A 1K73W 2AXTZ 1R6NA 1SERA 1L0NH 2IW5A 3VQYA 3RYHB 4DUYO 3FD9A 3JASB 3CRQA 1P49A 4TWKA 3IC9A 1OV9A 2QM8A 3W7TA 3ABMC 2Y69C 1J95A 4I4TA 3CRCA 4PI0A 5IE9A 1J5EB 1QNMA 5L3EA 1WPBA 4UVAA 5JJNB 3BFRA 2F43G 2LFSA 1VQ6V 4DV7O 5E1AC 3IFXA 1OJHA 2EJRA 1JFFB 2B1GA 3E8HA 2Z0AA 1NTZH 3SJAC 4F6RA 2QDOA 4R8CA 5EC1C 3TETA 3ZMVA 1PL4A 2HLDG 1CPYA 1F23A 3STZC 1AJNA 1WNSA 1NQTA 2ZM6B 4JTAB 5LMUB 3CCMV 4K8ZA 3P3NA 3CC7V 4NXMB 5CMUA 3E83A 4K0KO 2ILMA 4LF5B 3EHBB 3VBBA 3RYIB 1TVKA 3AG2B 3HR0A 2JVDA 4X64O 2DYSC 4KHPO 2KG7A 5LHIA 3ETEA 3RYCA 2QKAA 5K1PA 4FLXA 2PTMA 5CA0A 1B04A 2QWOB 3UQ8A 1I94O 4LF6O 4DR4O 1YSCA 1QHTA 5CA3A 4ZI7A 1F7YA 2AHYA 1IBLB 3J80N 4DXWA 5J2UB 4LFBO 3HKBB 5C8YA 4WFAV 2UUAO 1CEZA 3C3TA 2HG5C 3E89A 1K33A 4ICGA 4JYAB 3KZIZ 5EYPB 3T1HB 3FYEB 1YJWV 3O65A 2B9ZA 2YXLA 1N36O 1GKFA 3CCQV 4DV5B 2P4KA 1TUBA 1OCOB 2EIJB 2XASA 1Q7YW 1JQ0A 1L1FA 4JI4B 3DXRB 1F4NA 4DO2A 4EFBA 2HJFC 4I0XB 2YEVB 5GTHZ 4J7ZA 4PHZA 3HKEA 3H01A 4RO2A 2EULA 2VQEO 2WAMA 1F4MA 2XNDG 4I50A 2P4VA 4O2BA 3ETGA 2F95B 5B3SC 2EINB 3WB2A 1ZSPA 5LYJB 4GKJB 4JTCB 5LMNB 4WFFA 4JI2B 3F7YC 2YIBD 4EKWA 3DGEA 3AG1C 1XNRO 4ZBMA 4GX5A 2ATKC 1JJ2U 5ITZA 1WPXA 3LSUA 1YF2A 1V55B 3I55V 3K9SA 3OUSA 4IHJB 1WN7A 4LFAO 5DECA 3L71H 3G6EV 5JH7B 4U3FH 4GKKB 4FZ1A 4TQFA 4TT3G 4DRXB 4OXSA 5BR8B 4X62O 2UXDB 2A06H 2JS5A 1R3IC 5B1OA 5TISZ 2WLIB 3IAYA 1AR1B 2BTQB 2HEPA 3GWKC 4F6EA 2PZSA 3ZHTA 2ZE7A 5EC2C 4DV1B 3OMIB 2E3CA 2E5LO 4FM0A 2VQFB 3OTFA 1DF5A 4MTFA 3CCUV 2O57A 1QLEC 4CBCA 5KLVH 1FPOA 1B3QA 2RMKB 1RP3B 3OR7C 4H0LB 3T1YB 2OWOA 1H2SB 4EB6A 2YIBA 1NVPB 3J7AU 1X4TA 2NLJC 3IC7A 1VQ8V 2E75B 5HFMA 1OZ0A 4L8JA 1BHAA 1SQXH 1VQNV 2D2CB 5LL6Y 1VARA 3ZN1A 1K92A 3ZMZA 1AR4A 2Q0OC 4O4HA 2ZDIA 2F23A 4LF4O 2ZDIC 2HHHO 1IDSA 3RFRA 4JAVA 4LR3A 3QO7A 3SYCA 4H37A 1M57C 4JI0O 3W7WA 3N2GB
chains in the Genus database with same CATH topology
3LSSA 5IYBO 4FIPC 4HAMA 4MS2A 5IYDO 3TCUA 4WF9V 1CP9A 1Y4MA 5B1BC 3ZMUA 2QA4V 4N21A 5L3BA 3T4ZA 4CZZA 1AJQA 3EFFK 3GWOA 4JYBA 2HFEC 1NR7A 3AEIA 2DQ3A 4MVRA 1SZTA 4LCUC 2YEVA 2JEXA 2HVJC 3M99B 4JF3A 3GB7C 5HFLA 1H8HG 1YJ9V 4MW8A 4R50A 4PA9A 4BIZA 5KA6A 2W6JG 1I5XA 2V7QG 1ORQC 4HYOA 4GT1A 2Q67A 3OE7G 1R3LC 3MHHC 1YI2V 4G28B 4R7CA 4JAUA 4Q20A 2WLLA 3F7VC 1RPOA 2EZPA 4PA6A 4QJFB 4U7NA 5L3CA 1RM1B 1ENVA 5FL7G 1E79G 3K06A 2ZXWC 2D3OW 2IH3C 1XL6A 1NVPD 3B8MA 3TK1A 1M90W 4MTGA 4X88A 2IU3A 4Z1MG 3MHSC 2OCCB 1ZWIC 4I9WA 2JJ2G 5DN6G 1K3EA 4HZ3A 2OTJV 2UXXA 3OEHG 1FXKA 4N23A 5LHHA 1PD3A 1OCCC 1LNQA 2XOKG 3K79A 4UV8A 3K0DA 1FXKC 3W7XA 5LGTA 3ABLB 1YTFD 2CK3G 2M7WA 1NH2B 2H94A 3RVZA 2WSSG 3P32A 2X7RB 5KA5A 3T4DA 1VQPV 1QBZA 1KD1W 4FK5C 1M56C 3AG4C 4P2ZA 1FXVA 2K1EA 3ASOB 2IU0A 3ZCCA 3ZMTA 1JPXA 4QNHB 3I56V 2XAFA 2R9IA 4RUFA 4UV9A 2QE7G 2WLIA 4MVSA 3WFVA 1YIJV 1YITV 1S5HC 4JYCA 3PJSK 2B1IA 5H6RA 1K34A 1KKDA 1K4DC 4QE7A 3K9AA 1MOFA 2ITDC 3SPHA 2ZR3A 1Q82W 2EILB 1QLEB 2PI4A 2DWEC 3E35A 1QR9A 3W7SA 1SETA 3SYOA 1NJIW 4MTXA 3CPWU 3RW0A 4WFHA 1R3JC 3G4SV 3R65A 3AG2C 3D36A 1VQ7V 3X2QC 1VQOV 1OCZC 4XDKA 1GM7A 2WLNA 1SRYA 3BEHA 2ITCC 4ZKIA 5L3GA 4JTDB 4PDMA 3ETDA 1S72V 3A0RA 5B1AB 2MK3A 3FYIB 4PA3A 1P4RA 3K0GA 2EIMB 1R73A 1BMFG 4QPJA 1MSWD 1OCRB 3JD3A 1Q81W 1VQLV 3CD6V 3E8FA 4MVOA 5IY5B 3ZJZA 1VQKV 1F51A 4G27B 2JJ1G 2XAJA 1H8EG 1B6QA 3ABTA 3OAAG 2WLJA 1QCEA 1AI4A 1NKDA 5B1NA 1K5SA 2WLKA 2DYRC 4UXNA 5CN0A 3ASNC 2EIKC 2Q68A 4RAIA 1M57B 2KB1A 2UXNA 3CCVV 1QR8A 1MG1A 4RUEA 2YSUB 2GSMB 4BAYA 5LHGA 5B1BB 3LNMB 2BOCC 3SPCA 2BOBC 1FXHA 2NNUA 4X8AA 1OCOC 2EIJC 1NH2D 3OM3B 1R6KA 2ZR2A 1JCHA 3OW2U 4H33A 1DTOA 3JCZA 4FPPA 3QO8A 1EBOA 1JVMA 1KQSU 5B3SB 1N8RW 3FKSG 1R3KC 1K73W 3UM7A 1KP3A 3OFNG 4PDLA 3HPLC 1R6NA 3B8NA 1SERA 2V1DA 2IW5A 5KUKA 3AG1B 4KP4A 1BHBA 4KFMA 5CBHA 4BW5A 4TWKA 3CCSV 2EINC 2QM8A 4PDVA 3W7TA 2P7TC 4JPRA 3ABMC 2Y69C 1J95A 2HVKC 2JK5C 2ZXWB 1KP2A 3SYQA 5L3EA 5J9PC 1IXMA 3B77A 1K4CC 4UVAA 1QVFU 2F43G 2LFSA 1VQ6V 5E1AC 3E8BA 3FB5C 3IFXA 1V55C 3JD1A 4PDRA 2EJRA 2Q69A 2B1GA 4BIUA 3E8HA 1VQ4V 3CYOA 4R8CA 4MVQA 5EBLC 4RQEA 4U7OA 3OEEG 5EC1C 2EZOA 4XDJA 1Q86W 4R6ZA 5EBMC 3TETA 1M56B 3AG4B 3ZMVA 2HLDG 3AG3C 2X6BA 2ZQMA 3LSQA 3CMAV 1CPYA 1F23A 3STZC 4G2KA 5CBGA 1AJNA 1NQTA 3CC2V 4JTAB 2WPDG 1QLNA 3CCMV 3CC7V 3ABUA 3ZN0A 1W2BU 1JOYA 2Q6AA 5CMUA 2P90A 3E83A 2IJKA 3ASOC 3OGCC 2P6JA 1W0KG 1V54C 1AJPA 2HR3A 1FS0G 3EHBB 3VBBA 3CCRV 4LP8A 3AG2B 1K9MW 3SYPA 4WCEV 3X2QB 1JX9A 1OCZB 2A0LA 2DYSC 3JYCA 1AI5A 2DW4A 2HKOA 2DQ0A 5LHIA 3ETEA 1UJWB 3K04A 3STLC 3WG7C 4UVBA 2A79B 4RQFA 1YJNV 3CP1A 1YSCA 3ABKC 1EZJA 4P9OA 5CA3A 2AHYA 5L3FA 1H2GA 1K7DA 1W0JG 4DXWA 4QPKA 1E1RG 2AHZA 2Z5UA 2W6IG 4UVCA 4GX0A 5B1AC 1GM9A 5L3DA 4WFAV 2WWWA 3SPGA 1CEZA 2EIMC 3P30A 1KC8W 2DYRB 3LUTB 3SYAA 3ASNB 2HG5C 3E89A 1TUEB 1K33A 2OTLV 3VOUA 1GTOA 1I5YA 3CC4V 3FYEB 5IY5C 1YJWV 3ZRWB 2ZD9A 1GKFA 3CCQV 1BL8A 1H38A 3SJQC 3ZIAG 4LC1A 3RBZA 1K97A 1OCOB 2EIJB 2WLMA 3E8GA 2XASA 1Q7YW 1JQ0A 1L1FA 1VQ5V 2IJHA 1K5QA 3FB7C 4J9ZB 1F4NA 1AI7A 4WFBV 4DO2A 5H9CA 2HJFC 1NR1A 1DLBA 1HWYA 2YEVB 1MABG 1S77D 3CXCU 1NBMG 3E86A 1THZA 3H01A 2Z3YA 4YXWG 5C93A 3FB6C 5CBFA 2XAHA 1QVGU 3MD0A 4RO2A 2WAMA 5DM6V 1F4MA 2XAGA 3JD0A 2XNDG 4MVUA 2W0FC 2QEXV 4J9YB 3ETGA 4PA4A 3QNEA 4FJCC 1S3JA 5B3SC 2EINB 2WLLB 2LFRA 3SPJA 4MVZA 3CCLV 5EK0A 3ABMB 2Y69B 2PI5A 1DF4A 4GCZA 4JTCB 3CMEV 2EBOA 4WFFA 3F7YC 1XL4A 3SPIA 2A9HA 3DGEA 3AG1C 1KECA 4XBFA 4MSWC 4ZBMA 4EKWA 4GX5A 2ATKC 1JJ2U 4ASUG 3K08A 1WPXA 2QTOA 1PNKA 2X0LA 1AROP 1V55B 3K03A 2R9RB 1RM1C 1S76D 3RVYA 3ZRSA 3I55V 4P9PA 1OCCB 4L87A 3OUSA 1FXKB 2Y48A 3OR6C 1AI6A 1PL0A 2IH1C 1M9NA 5H6QA 1FFTB 3CCEV 2JDIG 2OCCC 5EBWC 3FB8C 2DWDC 3G6EV 1EFRG 1Y66A 5LBQA 4WFGA 3AG3B 3LDDA 4QE9A 4TT3G 4OXSA 4I5SA 4MT8A 1R3IC 3T2MA 3ABLC 5B1OA 2WLIB 3ZRXA 1VQMV 3LDEA 1COWG 1AR1B 1G4YB 3UKMA 3G71V 4QIWF 1SESA 4JGSA 1GM8A 2FTKA 4F4LA 1WLEA 1GO3F 5GW7A 1V54B 3ML0A 3OUFA 4X89A 5EC2C 3F5WC 2H8PC 4GX1A 3OMIB 1GMGA 5LGUA 3QO5A 1RPRA 4UUJC 1DF5A 2DYSB 4MTFA 3CCUV 3DTUB 2EILC 1QLEC 3K3WA 4CBCA 2X6CA 4KUMA 3WG7B 1ROPA 1M1KW 3OR7C 2IJIA 2JEUA 1K8AW 4MTOA 3D3IA 3LDCA 3JD4A 5BZBA 2JIZG 2OT5A 3ABKB 1NVPB 3IGAC 2LP7A 5KUMA 3CCJV 2QM7A 3T1CA 4P30A 2NLJC 2P67A 4MW3A 3IC7A 4GX2A 2QKSA 1VQ8V 5HFMA 1P7BA 1OZ0A 4TSFG 1BHAA 1VQNV 1PKXA 4E2LA 2WLHA 2B5UA 5IDJA 2C2AA 2EIKB 4JASA 3ZN1A 1OCRC 3OMNB 1VQ9V 3KG2A 1K92A 4PA7A 1YTFB 5IYCO 3ZMZA 2X6AA 1PNMA 2ZDIA 1YHQV 2IJJA 4FMTA 4XDLA 3ZRVA 2ZDIC 3BY6A 2XAQA 4PELA 1OHHG 4JAVA 3JD2A 3E2EA 3HB3B 2GHYA 3NXSA 3QO7A 3ZMSA 5LGNA 4LBEC 4H37A 3SYCA 1G8MA 1M57C 1GK9A 1PNLA 3W7UA 1S0VA 1E1QG 4WFEA 3W7WA 3OMAB 3ZRWA 4MVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI A;  1FXK A;  2ZQM A;  1FXK B;  3AEI A;  2ZDI C;  1FXK C; 
#chains in the Genus database with same CATH topology
 3JAK B;  4WF9 V;  1CP9 A;  4ZOL A;  3L9D A;  4DYL A;  1SC5 B;  3C3S A;  3T4Z A;  4CZZ A;  4FLY A;  1MSD A;  3EFF K;  4DV4 O;  1KUQ A;  1NR7 A;  3AEI A;  4MVR A;  1SZT A;  1R1B A;  3JAM N;  5E79 Z;  5JCO C;  4PA9 A;  4BIZ A;  5KA6 A;  2Q0A A;  2V7Q G;  4I4T B;  1PV0 A;  2Q67 A;  3MHH C;  4G28 B;  5H2F Z;  3FAV A;  4JAU A;  4YIO A;  3H1J H;  4AHC A;  1MNG A;  5L3C A;  4DR7 B;  5KMG A;  4F6R B;  3B8M A;  3PN1 A;  2Y0I A;  4O4J A;  1XUQ A;  4I9W A;  3CS5 A;  1AP5 A;  2P22 C;  2UXX A;  3G80 A;  3K0D A;  4B3S B;  5LGT A;  2UUC O;  2M7W A;  1NH2 B;  3RVZ A;  1EZV H;  1WB7 A;  1HDJ A;  2X7R B;  3FX7 A;  1QBZ A;  4DV2 B;  3ZCC A;  3I56 V;  4UV9 A;  2QE7 G;  3WFV A;  4D7S A;  1YIJ V;  2Y4U A;  1TVK B;  3ZHS A;  2B1I A;  4QE7 A;  5A2Q N;  3SPH A;  2KG7 B;  2PI4 A;  2UU9 B;  4TOI A;  2ARH A;  3RYC B;  2QKC A;  1NJI W;  5CA0 B;  4TQD A;  5FLX N;  1R3J C;  3BAB A;  3AG2 C;  3UO3 A;  4X1I A;  1GM7 A;  3BVO A;  3LNN A;  4ZI7 B;  4H44 B;  3DC6 A;  5IWA O;  3SJC C;  3ETD A;  4LF7 O;  3FYI B;  1P4R A;  5C8Y B;  3RYF A;  1DK1 A;  2CTQ A;  1OCR B;  3JD3 A;  1EN6 A;  2YIC A;  1FJG B;  1SA0 A;  3E8F A;  4MVO A;  4KXR A;  1VQK V;  2LW1 A;  3ZHU A;  1B6Q A;  4DV3 O;  1TUB B;  2Q68 A;  4JI5 O;  1QR8 A;  2Q7H A;  5LHG A;  3S3W A;  2CTP A;  3SPC A;  3IJ4 A;  2NNU A;  3HKE B;  1OCO C;  2EIJ C;  3APQ A;  3OM3 B;  2ZR2 A;  1JCH A;  2ZE6 A;  2GUZ A;  3L72 H;  2QWP B;  4H33 A;  1DTO A;  3JCZ A;  2LW7 A;  4FPP A;  4JI3 B;  1EBO A;  1JJO A;  1JVM A;  4I50 B;  3SGI A;  5B3S B;  4O2B B;  3FKS G;  4BW9 A;  3M7M X;  1KP3 A;  5KAF Z;  2XTA A;  3AG1 B;  1BHB A;  5CBH A;  1H2M A;  2EIN C;  5ITZ B;  1Y76 A;  1URF A;  3SDL A;  4JPR A;  1XDC A;  4FFB A;  2QTS A;  3L75 H;  1HP8 A;  5BXZ A;  3B77 A;  1K4C C;  5J2T A;  1QVF U;  1V55 C;  1JA8 A;  2Q69 A;  4A5U B;  1J5E O;  4IYI A;  1VQ4 V;  5KHH A;  4UCR A;  2NR5 A;  1LUW A;  4RQE A;  3OEE G;  4NTY A;  1Y67 A;  2EZO A;  3FFQ A;  1Q86 W;  4R6Z A;  5IT9 N;  3CMA V;  5CBG A;  1Z2G A;  4DW1 A;  1VIB A;  1ZLZ A;  5JWP A;  1ZUQ A;  1KMI Z;  3CX5 F;  4K8X A;  4I7Z B;  2P5O A;  2Q6A A;  3JAT A;  2P90 A;  3CSX A;  3JCU Z;  3C90 A;  2ZM6 O;  2HR3 A;  1FS0 G;  3BA8 A;  5LMU O;  1K9M W;  4WCE V;  4JI1 B;  4EB6 B;  3JYC A;  1AI5 A;  4NXM O;  2DQ0 A;  4JI6 B;  3ZS8 C;  2CTW A;  4O4L A;  1I7F A;  4LF5 O;  3JSL A;  3U11 A;  4RQF A;  3CP1 A;  4P9O A;  3HKC A;  4YY3 O;  4JI8 O;  3CB2 A;  2GTS A;  4O4H B;  4QPK A;  2F93 B;  1Y74 A;  1KYO F;  5B1A C;  5BMV A;  4OX9 B;  3CWB H;  2EIM C;  4U3J A;  3SYA A;  3ASN B;  4B3R B;  1S5L Z;  2OTL V;  4H13 B;  1I5Y A;  3RGB A;  1DGS A;  1AB3 A;  2ZD9 A;  1BL8 A;  3ZIA G;  3RBZ A;  4ZOL B;  1XMQ B;  2N04 A;  4JYA O;  1K5Q A;  4J9Z B;  3VQV A;  3T1H O;  4ABM A;  2BSK A;  1MAB G;  1NBM G;  5C93 A;  3DSQ A;  2LGQ A;  2ADQ B;  3FB6 C;  4JI4 O;  2UUB B;  5DM6 V;  1ZAU A;  2W0F C;  4J9Y B;  3FAV B;  5EK0 A;  1HR0 B;  2PI5 A;  3TJT A;  1DF4 A;  2M6Y A;  1US6 A;  3CME V;  4X1Y A;  5KMG B;  1W59 A;  2A9H A;  2EJ7 A;  1WP7 A;  4O4J B;  2QTO A;  5IJ9 A;  4GKJ O;  1PNK A;  2X0L A;  3A0B Z;  5LP6 A;  1YVW A;  3K03 A;  1S76 D;  4QGP A;  3RVY A;  1QQC A;  4X65 O;  4JI2 O;  4NB5 A;  1SQV H;  1AI6 A;  3WB0 A;  1YXB A;  3CCE V;  2DJV A;  3OD4 A;  2JDI G;  1XEQ A;  2DWD C;  4J7K A;  2YID A;  1FAF A;  1EFR G;  3AG3 B;  4MT8 A;  3T2M A;  3TGU H;  2AW9 A;  3ZRX A;  2ZIN A;  1VQM V;  3LDE A;  4LH7 A;  3A8T A;  4ZIB A;  4GKK O;  4TUY A;  1G4Y B;  4NTW A;  4QIW F;  2OYQ A;  5KHI A;  1GM8 A;  2FTK A;  3BRC A;  1GO3 F;  2Q4P A;  3OUF A;  4DR1 O;  1MA1 A;  3QG5 A;  3QO5 A;  1N0J A;  1TGO A;  2JS3 A;  4X1I B;  3DTU B;  2X6C A;  2AGA A;  2IM9 A;  4LF9 B;  4DV1 O;  1G1X B;  4MTO A;  2H3O A;  3CRM A;  3D3I A;  3LDC A;  3RYF B;  2VQF O;  2OT5 A;  3AK3 A;  1XQ8 A;  2QM7 A;  3L73 H;  3T1C A;  4DV0 B;  1XNQ B;  1SA0 B;  4P30 A;  2P67 A;  4GX2 A;  1YCI A;  2Q73 A;  2DOS A;  4TSF G;  1PKX A;  1GN4 A;  1SQF A;  2PF4 E;  3T1Y O;  2B5U A;  2YXY A;  5GON A;  2QSA A;  4JAS A;  1YDX A;  1OCR C;  1VQ9 V;  5H5N A;  1PNM A;  3ZRV A;  3BY6 A;  4PEL A;  1EN5 A;  4GUN A;  4WBN A;  5LGN A;  3W7U A;  1IBM B;  1PNL A;  1GK9 A;  1N0N A;  2GUZ B;  1AP6 A;  1E1Q G;  4WFE A;  3OMA B;  3RT3 C;  3ZRW A;  4I9Q A;  1EM1 A;  4FIP C;  4HAM A;  4JZG A;  4UFZ A;  2YC0 A;  1AJQ A;  2HFE C;  1P84 F;  5F2V O;  2DQ3 A;  4BWA A;  4NR1 A;  2HVJ C;  3U10 A;  3KCX A;  1Y76 B;  4MW8 A;  4R50 A;  2ZT9 B;  1N33 O;  1I5X A;  2F1M A;  4FFB B;  4HYO A;  2ZCE A;  1JR9 A;  2ZNJ A;  3U0Z A;  3BAA A;  4R7C A;  4LFC B;  3A0H Z;  2WLL A;  3F7V C;  3ICX A;  5J2T B;  1U97 A;  4KL1 A;  4PA6 A;  4QJF B;  5LOV A;  2HJD A;  2D3O W;  2XUM A;  4DV6 B;  4EEQ A;  1O9G A;  3CRR A;  4Z1M G;  2OCC B;  1ZWI C;  5CA1 A;  1SF9 A;  2JJ2 G;  5DN6 G;  4DR7 O;  1SQP H;  2OTJ V;  1FXK A;  2Q5Z A;  3A2F A;  1UFI A;  3JAL A;  1PD3 A;  1OCC C;  3K79 A;  4O2A A;  1FXK C;  1N32 B;  3ABL B;  1YTF D;  1KB9 F;  1IXB A;  3ETQ A;  1VQP V;  1SQB H;  3TXS A;  2CTR A;  2IU0 A;  3JAT B;  2YIA A;  3ZMT A;  2XAF A;  4B3S O;  4MVS A;  1YIT V;  1S5H C;  5H6R A;  1K34 A;  1KKD A;  1K4D C;  1MOF A;  2ZR3 A;  5LXT A;  5KHJ A;  2EIL B;  1GRJ A;  4YJ2 A;  1QR9 A;  3SYO A;  4O4L B;  4DR5 B;  2KSD A;  1NTK H;  3QVN A;  5JVD A;  4MTX A;  3CPW U;  4WFH A;  3G4S V;  2RNB A;  4DR4 B;  3HKC B;  5JQG A;  2UU9 O;  4FZ0 A;  1XIL A;  5B1A B;  1Y74 B;  5BMV B;  2EIM B;  4UCS A;  1HNX O;  2QM4 A;  1I0H A;  2QWR B;  4NTX A;  4U3J B;  3CRA A;  2Q9L A;  4G27 B;  4IYH A;  1H8E G;  3ABT A;  3EXA A;  1N36 B;  2WLK A;  1BT8 A;  1FJG O;  3ASN C;  2KB1 A;  3CCV V;  4RUE A;  2YSU B;  2GSM B;  5D5P A;  2BSK B;  1FXH A;  4X8A A;  1M93 A;  4LF8 B;  4GYC B;  1N8R W;  1I08 A;  2OCH A;  1YZB A;  1IUR A;  3UM7 A;  4B08 A;  2V1D A;  1XRE A;  1N4C A;  2K9P A;  4X1Y B;  4X1K A;  4JI3 O;  1SQQ H;  1EN4 A;  4PDV A;  4JV5 O;  5IJ9 B;  4AIL C;  5LP6 B;  2HVK C;  2JK5 C;  2ZXW B;  1KP2 A;  4UCT A;  3E22 A;  5J9P C;  1IXM A;  2OIE A;  1VF7 A;  4YHH B;  3E8B A;  2MW2 B;  3FB5 C;  2YI9 A;  2L6L A;  1GN6 A;  4FLT A;  5EBL C;  2LO1 A;  4CH6 A;  4U7O A;  5EBM C;  4TUY B;  4J10 A;  3AG3 C;  2CGN A;  2X6B A;  2ZQM A;  5JJJ B;  4J41 A;  2ZE5 A;  2VRZ A;  2UXC B;  1Z5W A;  3OTO B;  2WPD G;  3O9O A;  2E5L B;  3ZN0 A;  2E76 B;  1XI1 A;  2IJK A;  3OGC C;  1AVM A;  2P6J A;  4PJ0 Z;  1SZX A;  1AJP A;  3SYP A;  3X2Q B;  1Q6U A;  2A0L A;  4UCO A;  2DW4 A;  2RDC A;  1WJZ A;  1L8D A;  2Q7E A;  3H1H H;  3K04 A;  3TXQ A;  3STL C;  5KHG A;  3I5D A;  1KBH A;  3NR7 A;  3VQX A;  3J81 N;  4JI1 O;  5GON B;  1Q3E A;  2A7W A;  2AZ2 A;  4JI6 O;  4DR6 B;  1K7D A;  2JGD A;  1E1R G;  4HBN A;  4NVP A;  2FKX A;  2Z5U A;  4UVC A;  4LF4 B;  1BZK A;  3R66 A;  1GM9 A;  5L3D A;  3SPG A;  4WBN B;  4DUZ B;  1Q90 D;  4AQY B;  1FFX A;  1LUV A;  5GTI Z;  3CC4 V;  5IY5 C;  3ZRW B;  2F4V B;  3QTC A;  1H38 A;  2L35 A;  3ZHV A;  4OX9 O;  3JAW A;  4B7K A;  4LC1 A;  1K97 A;  3E8G A;  2WLM A;  4B3R O;  2NN4 A;  1AI7 A;  4Z1V A;  5H9C A;  1VEW A;  1HWY A;  3H1I H;  5KHK A;  1S77 D;  3B4S A;  3E86 A;  4YXW G;  2Z3Y A;  4D7T A;  1XMQ O;  1HNW O;  2XAH A;  5EIB D;  4YIP A;  2XAG A;  4MVU A;  4IIJ A;  4PA4 A;  4FJC C;  1M5I A;  1S3J A;  2WLL B;  3SPJ A;  2AZ0 A;  2ZIM A;  2YXH A;  3CCL V;  3P3P A;  5LOV B;  3JAR A;  4GCZ A;  2CGO A;  2UUB O;  1D5N A;  2GBO A;  1KEC A;  1LR1 A;  4DR2 B;  5CA1 B;  1ARO P;  1RFY A;  4YJ3 A;  1HR0 O;  5D5Q A;  2R9R B;  2CE4 A;  3ZRS A;  4P9P A;  1OCC B;  3H1L H;  1FXK B;  3JAL B;  3OR6 C;  4O2A B;  4CH3 A;  2IH1 C;  1M9N A;  1FFT B;  2OCC C;  1Y66 A;  1VF6 A;  2RQ6 A;  3LDD A;  1MZE A;  4I5S A;  3CEI A;  3K5N A;  1X59 A;  3ABL C;  1H2L A;  2DE0 X;  5KX5 A;  3UKM A;  4B7E A;  3G71 V;  4EFE A;  5LXT B;  4TV8 A;  1GAX A;  4F4L A;  1WLE A;  4YJ2 B;  1V54 B;  4X89 A;  2BTO A;  3F5W C;  5JVD B;  1Q6H A;  2LJ2 A;  3SJB C;  1IBK B;  2RJZ A;  2OIG A;  3M8A A;  1T5E A;  1YEW A;  2EIL C;  2LQT A;  5JQG B;  3WG7 B;  2RN9 A;  1ROP A;  4NXN B;  1U96 A;  2IJI A;  2JEU A;  2PGG A;  2W0X A;  2JIZ G;  3ABK B;  5KAI Z;  2PYL A;  3IGA C;  1XBL A;  1P7B A;  1Q8I A;  4LF9 O;  5JJE B;  3ZHR A;  4E2L A;  2C2A A;  1IBL O;  3KG2 A;  4J11 A;  4PA7 A;  4CC5 A;  1YTF B;  5IYC O;  1H2N A;  4FLV A;  1XNQ O;  2ETN A;  3D8C A;  2PY5 A;  1YHQ V;  2IJJ A;  2ODM A;  4LH6 A;  2R9A A;  3E2E A;  1S0V A;  1JMK C;  4DV5 O;  3LSS A;  5IYB O;  5B5E Z;  3TCU A;  4FVM A;  1XHX A;  2QJ1 A;  1Y4M A;  3ZMU A;  4DR3 B;  1MMM A;  1S5J A;  1IBM O;  1D2D A;  1SKV A;  4X1K B;  4IT5 A;  1CXZ B;  4CS3 A;  4LCU C;  2JEX A;  4OGQ B;  5CB4 A;  4AI8 A;  3B2E E;  3GB7 C;  1H8H G;  2ADP A;  5EZY A;  1ORQ C;  1B06 A;  1N34 B;  3CXH F;  3H1K H;  3E22 B;  4U7N A;  4B3T B;  5LMN O;  1RM1 B;  5LP6 C;  1ENV A;  1E79 G;  2ZXW C;  3AK2 A;  2Q7G A;  2IH3 C;  1XL6 A;  1M90 W;  3TK1 A;  4GZR B;  4CC6 A;  1FYJ A;  4LFC O;  4MTG A;  3BCC H;  4J7J A;  2IU3 A;  1WB8 A;  3MHS C;  1K3E A;  5A9G A;  2UXB B;  4N23 A;  2FL4 A;  3QF7 A;  3W7X A;  4DV6 O;  1HNZ B;  1HW7 A;  1BCC H;  5KA5 A;  1XMO B;  3T4D A;  5BR8 O;  2UXD O;  4FK5 C;  4P2Z A;  2QWQ B;  1NU1 H;  1GN2 A;  1KU9 A;  1VF5 B;  3BA9 A;  1N32 O;  4NYK A;  5IYZ A;  3K5L A;  4JYC A;  3PJS K;  2ZKO A;  3K9A A;  1TA8 A;  1A32 A;  1Q43 A;  2E74 B;  3MDS A;  1Q82 W;  3H9V A;  3GVM A;  1MZF A;  4X20 A;  3E35 A;  1SET A;  1TAE A;  3RW0 A;  4CH4 A;  1RSO A;  3R65 A;  1V9P A;  3X2Q C;  1PPJ H;  4XDK A;  2WLN A;  1SRY A;  3N2K A;  4JTD B;  4JI7 B;  4YY3 B;  2JGD B;  3A0R A;  4JI8 B;  1AR5 A;  2CDY A;  4PA3 A;  4DR5 O;  1BE3 H;  1GN3 A;  1R73 A;  5FPR A;  1Q81 W;  4HNA A;  1VQL V;  3CD6 V;  5IY5 B;  1FFX B;  1IX9 A;  1F51 A;  4K3A A;  4LNU A;  1ZX3 A;  4Q6G A;  4B3M B;  1SS3 A;  2KQX A;  2WLJ A;  3JAW B;  1QCE A;  1AI4 A;  3N27 A;  1NKD A;  2GDS A;  4LWS A;  2EIK C;  4X66 B;  1WP8 A;  2UXN A;  1MG1 A;  5B1B B;  3UCS C;  3HKD A;  5BY1 A;  4PD4 F;  4JZ2 A;  1R6K A;  4DUY B;  4CS2 A;  1NT2 B;  4IIJ B;  1R3K C;  2N74 A;  5FNV A;  1Y6X A;  1ZL8 A;  3OFN G;  4PDL A;  3JSN A;  3HPL C;  3B8N A;  3JAR B;  2IBZ H;  4LF8 O;  5KUK A;  4KP4 A;  1Q6I A;  2V4D A;  4KFM A;  1GH6 A;  4BW5 A;  3CCS V;  3OT7 A;  4DV7 B;  2P7T C;  1Z5V A;  4YJ3 B;  2YS8 A;  3VQW A;  2GTA A;  3SYQ A;  3CJH A;  4X65 B;  3EVK A;  3OGI B;  3JD1 A;  1PM9 A;  4PDR A;  4FLW A;  4BIU A;  4C7U A;  2CH7 A;  3CYO A;  3KCY A;  4DK0 A;  4MVQ A;  3UT5 A;  4GLX A;  4YHH O;  4CH5 A;  3BPZ A;  4XDJ A;  4TV9 A;  5KX5 B;  3Q4H A;  1M56 B;  3AG4 B;  4I55 A;  5FPO A;  3LSQ A;  4K0K B;  4TV8 B;  4G2K A;  3B09 A;  4O4I A;  3CC2 V;  4DR1 B;  1QLN A;  1WA8 A;  1QU7 A;  4DV2 O;  3CHX A;  4X64 B;  1W2B U;  3ABU A;  3BHP A;  1JOY A;  4KHP B;  3ASO C;  1W0K G;  1XOU A;  1V54 C;  2UXC O;  3OTO O;  3CCR V;  4LP8 A;  1I94 B;  4LF6 B;  1VMG A;  1JX9 A;  1OCZ B;  2Y0P A;  2HKO A;  4RWU A;  4X9Q A;  1UJW B;  2XHB A;  4LFB B;  3WG7 C;  5IJ0 A;  4UVB A;  2A79 B;  4DW0 A;  2PYJ A;  1NTM H;  2UUA B;  2JGU A;  2DMX A;  4OPH A;  1YJN V;  4UB8 Z;  3ABK C;  1BQZ A;  1EZJ A;  5L3F A;  1H2G A;  1P7G A;  1W0J G;  2AHZ A;  2W6I G;  4GX0 A;  2WWW A;  3P30 A;  1KC8 W;  2DYR B;  3LUT B;  1TUE B;  4DR6 O;  3VOU A;  1GTO A;  3SJQ C;  4Z2W A;  4ZHQ A;  4K35 A;  4DUZ O;  1VQ5 V;  4AQY O;  2IJH A;  3FB7 C;  2VQE B;  4WFB V;  3MAQ A;  1NR1 A;  2F4V O;  4W4L A;  1DLB A;  1Q5O A;  4IGG A;  5CB4 B;  3CXC U;  1THZ A;  5EZY B;  4W4K A;  5CBF A;  1BS3 A;  3RN4 A;  1QVG U;  3MD0 A;  3SR2 C;  5LA6 A;  1N33 B;  3JD0 A;  2YI8 A;  2QEX V;  4IL6 Z;  2VWJ A;  4J80 A;  3QNE A;  4FLZ A;  1XNR B;  2LFR A;  4MVZ A;  3DC5 A;  5JCO A;  2CAZ C;  3ABM B;  2Y69 B;  2EBO A;  2WA3 A;  3RYH A;  1XL4 A;  3SPI A;  3JAS A;  2JRI A;  4XBF A;  1IVS A;  4MSW C;  4ASU G;  3K08 A;  4LFA B;  3G6B A;  1FKA O;  2WA4 A;  1KKC A;  3K5O A;  4J42 A;  3ZBH A;  1RM1 C;  4L87 A;  2Y48 A;  4X62 B;  4D6T H;  1PL0 A;  5H6Q A;  4DK1 A;  4DR2 O;  5EBW C;  3FB8 C;  5LBQ A;  1JFF A;  4WFG A;  2R70 A;  4QE9 A;  2ZE8 A;  3AG7 A;  3WU2 Z;  1BQ0 A;  1UPG A;  4JYY A;  4UCV A;  3APO A;  5IYZ B;  2VWK A;  1COW G;  2LGW A;  1SES A;  4JGS A;  4X20 B;  5GW7 A;  3ML0 A;  2H8P C;  4GX1 A;  1GMG A;  5LGU A;  1O9H A;  1RSO B;  1H2K A;  1RPR A;  2YUA A;  4UUJ C;  2DYS B;  2VS0 A;  1D5A A;  3N2K B;  3K3W A;  1PP9 H;  4KUM A;  2DN9 A;  1M1K W;  3RYI A;  1K8A W;  4NKG B;  1IBK O;  2YDE A;  3JD4 A;  5BZB A;  4FM2 A;  1IZ3 A;  1HNX B;  2LP7 A;  5KUM A;  3K59 A;  3CCJ V;  2RCV A;  2QR4 A;  4HNA B;  4JAA A;  4FM1 A;  4MW3 A;  2QKS A;  4NXN O;  1BSM A;  4LNU B;  2HHH B;  2WLH A;  1BGY H;  3AK1 A;  3B40 A;  5IDJ A;  2EIK B;  4LWS B;  3OMN B;  1R6T A;  1WAZ A;  2X6A A;  4JI0 B;  5J2U A;  4FMT A;  4XDL A;  3HKB A;  2XAQ A;  3S3X A;  3ZX6 A;  1OHH G;  2Y4T A;  3JD2 A;  3HB3 B;  2GHY A;  3HKD B;  3NXS A;  3ZMS A;  4LBE C;  4DV4 B;  1G8M A;  5EYP A;  3L70 H;  1SQG A;  4MVM A;  5IYD O;  4MS2 A;  4OPA A;  3KKY A;  5B1B C;  5FNV B;  2QA4 V;  4N21 A;  1ZL8 B;  5L3B A;  4CS4 A;  3DXR A;  3GWO A;  2KKW A;  4JYB A;  3K58 A;  4PI2 A;  4I0X A;  2YEV A;  3M99 B;  3ZED A;  4JF3 A;  5HFL A;  4DR3 O;  1YJ9 V;  2W6J G;  4JV5 B;  1L0L H;  2N05 A;  2ZNI A;  4GT1 A;  2ZIO A;  3OE7 G;  3CJH B;  1R3L C;  1YI2 V;  4Q20 A;  2GV9 A;  3ZHQ A;  2P06 A;  1RPO A;  2EZP A;  5DED A;  2EX3 A;  5LYJ A;  5K1X A;  1G6U A;  5AG2 A;  3UO2 A;  5FL7 G;  3K06 A;  1N34 O;  1FD9 A;  1NI8 A;  2QGN A;  1NVP D;  2CH7 B;  2F66 C;  3UT5 B;  2UUC B;  4X88 A;  4B3T O;  1AIL A;  4TV9 B;  3Q4H B;  4HZ3 A;  4I55 B;  3OEH G;  4BIO A;  2FYU H;  5LHH A;  1VF6 C;  1LNQ A;  2XOK G;  4UV8 A;  3G67 A;  4IHJ A;  3WB1 A;  2CK3 G;  4O4I B;  2FB5 A;  2H94 A;  2WSS G;  3P32 A;  2PUS A;  5JH7 A;  1WA8 B;  1KD1 W;  2UXB O;  1M56 C;  3AG4 C;  1FXV A;  2K1E A;  3ASO B;  4DRX A;  4QNH B;  1JPX A;  2R9I A;  4RUF A;  1HNZ O;  3CE2 A;  2WLI A;  5EIB C;  3D3Q A;  1XMO O;  2Q8V A;  2BE3 A;  2BTQ A;  3RWR D;  2ITD C;  1QLE B;  5IWA B;  2A3Q A;  2DWE C;  2FML A;  4LF7 B;  3W7S A;  3F5T A;  5IJ0 B;  1M4U A;  1NS1 A;  3D36 A;  1VQ7 V;  1VQO V;  1OCZ C;  3BEH A;  4ZKI A;  2ITC C;  3D36 C;  5L3G A;  4PDM A;  4FLU A;  2BCC H;  1S72 V;  2MK3 A;  3K0G A;  3L74 H;  1BMF G;  4QPJ A;  4DV3 B;  2XT9 A;  4PV1 B;  2CUG A;  1MSW D;  4DV0 O;  4JI7 O;  4JI5 B;  3ZJZ A;  2R72 A;  2JJ1 G;  2XAJ A;  2HP8 A;  5B66 Z;  3K5M A;  3OAA G;  4ZHQ B;  5B1N A;  1K5S A;  2DYR C;  4UXN A;  5CN0 A;  4RAI A;  2G38 A;  4E4E A;  1M57 B;  2QWN B;  1NZ6 A;  4BAY A;  4B3M O;  3K57 A;  3LNM B;  2BOC C;  4UB6 Z;  2BOB C;  1XHZ A;  1VP7 A;  1ZTE A;  1NH2 D;  4X66 O;  3OW2 U;  1HNW B;  5LA6 B;  4FFK A;  3QO8 A;  4UCU A;  3THO A;  3N2G A;  3JAK A;  1KQS U;  4BR6 A;  1K73 W;  2AXT Z;  1R6N A;  1SER A;  1L0N H;  2IW5 A;  3VQY A;  3RYH B;  4DUY O;  3FD9 A;  3JAS B;  3CRQ A;  1P49 A;  4TWK A;  3IC9 A;  1OV9 A;  2QM8 A;  3W7T A;  3ABM C;  2Y69 C;  1J95 A;  4I4T A;  3CRC A;  4PI0 A;  5IE9 A;  1J5E B;  1QNM A;  5L3E A;  1WPB A;  4UVA A;  5JJN B;  3BFR A;  2F43 G;  2LFS A;  1VQ6 V;  4DV7 O;  5E1A C;  3IFX A;  1OJH A;  2EJR A;  1JFF B;  2B1G A;  3E8H A;  2Z0A A;  1NTZ H;  3SJA C;  4F6R A;  2QDO A;  4R8C A;  5EC1 C;  3TET A;  3ZMV A;  1PL4 A;  2HLD G;  1CPY A;  1F23 A;  3STZ C;  1AJN A;  1WNS A;  1NQT A;  2ZM6 B;  4JTA B;  5LMU B;  3CCM V;  4K8Z A;  3P3N A;  3CC7 V;  4NXM B;  5CMU A;  3E83 A;  4K0K O;  2ILM A;  4LF5 B;  3EHB B;  3VBB A;  3RYI B;  1TVK A;  3AG2 B;  3HR0 A;  2JVD A;  4X64 O;  2DYS C;  4KHP O;  2KG7 A;  5LHI A;  3ETE A;  3RYC A;  2QKA A;  5K1P A;  4FLX A;  2PTM A;  5CA0 A;  1B04 A;  2QWO B;  3UQ8 A;  1I94 O;  4LF6 O;  4DR4 O;  1YSC A;  1QHT A;  5CA3 A;  4ZI7 A;  1F7Y A;  2AHY A;  1IBL B;  3J80 N;  4DXW A;  5J2U B;  4LFB O;  3HKB B;  5C8Y A;  4WFA V;  2UUA O;  1CEZ A;  3C3T A;  2HG5 C;  3E89 A;  1K33 A;  4ICG A;  4JYA B;  3KZI Z;  5EYP B;  3T1H B;  3FYE B;  1YJW V;  3O65 A;  2B9Z A;  2YXL A;  1N36 O;  1GKF A;  3CCQ V;  4DV5 B;  2P4K A;  1TUB A;  1OCO B;  2EIJ B;  2XAS A;  1Q7Y W;  1JQ0 A;  1L1F A;  4JI4 B;  3DXR B;  1F4N A;  4DO2 A;  4EFB A;  2HJF C;  4I0X B;  2YEV B;  5GTH Z;  4J7Z A;  4PHZ A;  3HKE A;  3H01 A;  4RO2 A;  2EUL A;  2VQE O;  2WAM A;  1F4M A;  2XND G;  4I50 A;  2P4V A;  4O2B A;  3ETG A;  2F95 B;  5B3S C;  2EIN B;  3WB2 A;  1ZSP A;  5LYJ B;  4GKJ B;  4JTC B;  5LMN B;  4WFF A;  4JI2 B;  3F7Y C;  2YIB D;  4EKW A;  3DGE A;  3AG1 C;  1XNR O;  4ZBM A;  4GX5 A;  2ATK C;  1JJ2 U;  5ITZ A;  1WPX A;  3LSU A;  1YF2 A;  1V55 B;  3I55 V;  3K9S A;  3OUS A;  4IHJ B;  1WN7 A;  4LFA O;  5DEC A;  3L71 H;  3G6E V;  5JH7 B;  4U3F H;  4GKK B;  4FZ1 A;  4TQF A;  4TT3 G;  4DRX B;  4OXS A;  5BR8 B;  4X62 O;  2UXD B;  2A06 H;  2JS5 A;  1R3I C;  5B1O A;  5TIS Z;  2WLI B;  3IAY A;  1AR1 B;  2BTQ B;  2HEP A;  3GWK C;  4F6E A;  2PZS A;  3ZHT A;  2ZE7 A;  5EC2 C;  4DV1 B;  3OMI B;  2E3C A;  2E5L O;  4FM0 A;  2VQF B;  3OTF A;  1DF5 A;  4MTF A;  3CCU V;  2O57 A;  1QLE C;  4CBC A;  5KLV H;  1FPO A;  1B3Q A;  2RMK B;  1RP3 B;  3OR7 C;  4H0L B;  3T1Y B;  2OWO A;  1H2S B;  4EB6 A;  2YIB A;  1NVP B;  3J7A U;  1X4T A;  2NLJ C;  3IC7 A;  1VQ8 V;  2E75 B;  5HFM A;  1OZ0 A;  4L8J A;  1BHA A;  1SQX H;  1VQN V;  2D2C B;  5LL6 Y;  1VAR A;  3ZN1 A;  1K92 A;  3ZMZ A;  1AR4 A;  2Q0O C;  4O4H A;  2ZDI A;  2F23 A;  4LF4 O;  2ZDI C;  2HHH O;  1IDS A;  3RFR A;  4JAV A;  4LR3 A;  3QO7 A;  3SYC A;  4H37 A;  1M57 C;  4JI0 O;  3W7W A;  3N2G B; 
#chains in the Genus database with same CATH homology
 3LSS A;  5IYB O;  4FIP C;  4HAM A;  4MS2 A;  5IYD O;  3TCU A;  4WF9 V;  1CP9 A;  1Y4M A;  5B1B C;  3ZMU A;  2QA4 V;  4N21 A;  5L3B A;  3T4Z A;  4CZZ A;  1AJQ A;  3EFF K;  3GWO A;  4JYB A;  2HFE C;  1NR7 A;  3AEI A;  2DQ3 A;  4MVR A;  1SZT A;  4LCU C;  2YEV A;  2JEX A;  2HVJ C;  3M99 B;  4JF3 A;  3GB7 C;  5HFL A;  1H8H G;  1YJ9 V;  4MW8 A;  4R50 A;  4PA9 A;  4BIZ A;  5KA6 A;  2W6J G;  1I5X A;  2V7Q G;  1ORQ C;  4HYO A;  4GT1 A;  2Q67 A;  3OE7 G;  1R3L C;  3MHH C;  1YI2 V;  4G28 B;  4R7C A;  4JAU A;  4Q20 A;  2WLL A;  3F7V C;  1RPO A;  2EZP A;  4PA6 A;  4QJF B;  4U7N A;  5L3C A;  1RM1 B;  1ENV A;  5FL7 G;  1E79 G;  3K06 A;  2ZXW C;  2D3O W;  2IH3 C;  1XL6 A;  1NVP D;  3B8M A;  3TK1 A;  1M90 W;  4MTG A;  4X88 A;  2IU3 A;  4Z1M G;  3MHS C;  2OCC B;  1ZWI C;  4I9W A;  2JJ2 G;  5DN6 G;  1K3E A;  4HZ3 A;  2OTJ V;  2UXX A;  3OEH G;  1FXK A;  4N23 A;  5LHH A;  1PD3 A;  1OCC C;  1LNQ A;  2XOK G;  3K79 A;  4UV8 A;  3K0D A;  1FXK C;  3W7X A;  5LGT A;  3ABL B;  1YTF D;  2CK3 G;  2M7W A;  1NH2 B;  2H94 A;  3RVZ A;  2WSS G;  3P32 A;  2X7R B;  5KA5 A;  3T4D A;  1VQP V;  1QBZ A;  1KD1 W;  4FK5 C;  1M56 C;  3AG4 C;  4P2Z A;  1FXV A;  2K1E A;  3ASO B;  2IU0 A;  3ZCC A;  3ZMT A;  1JPX A;  4QNH B;  3I56 V;  2XAF A;  2R9I A;  4RUF A;  4UV9 A;  2QE7 G;  2WLI A;  4MVS A;  3WFV A;  1YIJ V;  1YIT V;  1S5H C;  4JYC A;  3PJS K;  2B1I A;  5H6R A;  1K34 A;  1KKD A;  1K4D C;  4QE7 A;  3K9A A;  1MOF A;  2ITD C;  3SPH A;  2ZR3 A;  1Q82 W;  2EIL B;  1QLE B;  2PI4 A;  2DWE C;  3E35 A;  1QR9 A;  3W7S A;  1SET A;  3SYO A;  1NJI W;  4MTX A;  3CPW U;  3RW0 A;  4WFH A;  1R3J C;  3G4S V;  3R65 A;  3AG2 C;  3D36 A;  1VQ7 V;  3X2Q C;  1VQO V;  1OCZ C;  4XDK A;  1GM7 A;  2WLN A;  1SRY A;  3BEH A;  2ITC C;  4ZKI A;  5L3G A;  4JTD B;  4PDM A;  3ETD A;  1S72 V;  3A0R A;  5B1A B;  2MK3 A;  3FYI B;  4PA3 A;  1P4R A;  3K0G A;  2EIM B;  1R73 A;  1BMF G;  4QPJ A;  1MSW D;  1OCR B;  3JD3 A;  1Q81 W;  1VQL V;  3CD6 V;  3E8F A;  4MVO A;  5IY5 B;  3ZJZ A;  1VQK V;  1F51 A;  4G27 B;  2JJ1 G;  2XAJ A;  1H8E G;  1B6Q A;  3ABT A;  3OAA G;  2WLJ A;  1QCE A;  1AI4 A;  1NKD A;  5B1N A;  1K5S A;  2WLK A;  2DYR C;  4UXN A;  5CN0 A;  3ASN C;  2EIK C;  2Q68 A;  4RAI A;  1M57 B;  2KB1 A;  2UXN A;  3CCV V;  1QR8 A;  1MG1 A;  4RUE A;  2YSU B;  2GSM B;  4BAY A;  5LHG A;  5B1B B;  3LNM B;  2BOC C;  3SPC A;  2BOB C;  1FXH A;  2NNU A;  4X8A A;  1OCO C;  2EIJ C;  1NH2 D;  3OM3 B;  1R6K A;  2ZR2 A;  1JCH A;  3OW2 U;  4H33 A;  1DTO A;  3JCZ A;  4FPP A;  3QO8 A;  1EBO A;  1JVM A;  1KQS U;  5B3S B;  1N8R W;  3FKS G;  1R3K C;  1K73 W;  3UM7 A;  1KP3 A;  3OFN G;  4PDL A;  3HPL C;  1R6N A;  3B8N A;  1SER A;  2V1D A;  2IW5 A;  5KUK A;  3AG1 B;  4KP4 A;  1BHB A;  4KFM A;  5CBH A;  4BW5 A;  4TWK A;  3CCS V;  2EIN C;  2QM8 A;  4PDV A;  3W7T A;  2P7T C;  4JPR A;  3ABM C;  2Y69 C;  1J95 A;  2HVK C;  2JK5 C;  2ZXW B;  1KP2 A;  3SYQ A;  5L3E A;  5J9P C;  1IXM A;  3B77 A;  1K4C C;  4UVA A;  1QVF U;  2F43 G;  2LFS A;  1VQ6 V;  5E1A C;  3E8B A;  3FB5 C;  3IFX A;  1V55 C;  3JD1 A;  4PDR A;  2EJR A;  2Q69 A;  2B1G A;  4BIU A;  3E8H A;  1VQ4 V;  3CYO A;  4R8C A;  4MVQ A;  5EBL C;  4RQE A;  4U7O A;  3OEE G;  5EC1 C;  2EZO A;  4XDJ A;  1Q86 W;  4R6Z A;  5EBM C;  3TET A;  1M56 B;  3AG4 B;  3ZMV A;  2HLD G;  3AG3 C;  2X6B A;  2ZQM A;  3LSQ A;  3CMA V;  1CPY A;  1F23 A;  3STZ C;  4G2K A;  5CBG A;  1AJN A;  1NQT A;  3CC2 V;  4JTA B;  2WPD G;  1QLN A;  3CCM V;  3CC7 V;  3ABU A;  3ZN0 A;  1W2B U;  1JOY A;  2Q6A A;  5CMU A;  2P90 A;  3E83 A;  2IJK A;  3ASO C;  3OGC C;  2P6J A;  1W0K G;  1V54 C;  1AJP A;  2HR3 A;  1FS0 G;  3EHB B;  3VBB A;  3CCR V;  4LP8 A;  3AG2 B;  1K9M W;  3SYP A;  4WCE V;  3X2Q B;  1JX9 A;  1OCZ B;  2A0L A;  2DYS C;  3JYC A;  1AI5 A;  2DW4 A;  2HKO A;  2DQ0 A;  5LHI A;  3ETE A;  1UJW B;  3K04 A;  3STL C;  3WG7 C;  4UVB A;  2A79 B;  4RQF A;  1YJN V;  3CP1 A;  1YSC A;  3ABK C;  1EZJ A;  4P9O A;  5CA3 A;  2AHY A;  5L3F A;  1H2G A;  1K7D A;  1W0J G;  4DXW A;  4QPK A;  1E1R G;  2AHZ A;  2Z5U A;  2W6I G;  4UVC A;  4GX0 A;  5B1A C;  1GM9 A;  5L3D A;  4WFA V;  2WWW A;  3SPG A;  1CEZ A;  2EIM C;  3P30 A;  1KC8 W;  2DYR B;  3LUT B;  3SYA A;  3ASN B;  2HG5 C;  3E89 A;  1TUE B;  1K33 A;  2OTL V;  3VOU A;  1GTO A;  1I5Y A;  3CC4 V;  3FYE B;  5IY5 C;  1YJW V;  3ZRW B;  2ZD9 A;  1GKF A;  3CCQ V;  1BL8 A;  1H38 A;  3SJQ C;  3ZIA G;  4LC1 A;  3RBZ A;  1K97 A;  1OCO B;  2EIJ B;  2WLM A;  3E8G A;  2XAS A;  1Q7Y W;  1JQ0 A;  1L1F A;  1VQ5 V;  2IJH A;  1K5Q A;  3FB7 C;  4J9Z B;  1F4N A;  1AI7 A;  4WFB V;  4DO2 A;  5H9C A;  2HJF C;  1NR1 A;  1DLB A;  1HWY A;  2YEV B;  1MAB G;  1S77 D;  3CXC U;  1NBM G;  3E86 A;  1THZ A;  3H01 A;  2Z3Y A;  4YXW G;  5C93 A;  3FB6 C;  5CBF A;  2XAH A;  1QVG U;  3MD0 A;  4RO2 A;  2WAM A;  5DM6 V;  1F4M A;  2XAG A;  3JD0 A;  2XND G;  4MVU A;  2W0F C;  2QEX V;  4J9Y B;  3ETG A;  4PA4 A;  3QNE A;  4FJC C;  1S3J A;  5B3S C;  2EIN B;  2WLL B;  2LFR A;  3SPJ A;  4MVZ A;  3CCL V;  5EK0 A;  3ABM B;  2Y69 B;  2PI5 A;  1DF4 A;  4GCZ A;  4JTC B;  3CME V;  2EBO A;  4WFF A;  3F7Y C;  1XL4 A;  3SPI A;  2A9H A;  3DGE A;  3AG1 C;  1KEC A;  4XBF A;  4MSW C;  4ZBM A;  4EKW A;  4GX5 A;  2ATK C;  1JJ2 U;  4ASU G;  3K08 A;  1WPX A;  2QTO A;  1PNK A;  2X0L A;  1ARO P;  1V55 B;  3K03 A;  2R9R B;  1RM1 C;  1S76 D;  3RVY A;  3ZRS A;  3I55 V;  4P9P A;  1OCC B;  4L87 A;  3OUS A;  1FXK B;  2Y48 A;  3OR6 C;  1AI6 A;  1PL0 A;  2IH1 C;  1M9N A;  5H6Q A;  1FFT B;  3CCE V;  2JDI G;  2OCC C;  5EBW C;  3FB8 C;  2DWD C;  3G6E V;  1EFR G;  1Y66 A;  5LBQ A;  4WFG A;  3AG3 B;  3LDD A;  4QE9 A;  4TT3 G;  4OXS A;  4I5S A;  4MT8 A;  1R3I C;  3T2M A;  3ABL C;  5B1O A;  2WLI B;  3ZRX A;  1VQM V;  3LDE A;  1COW G;  1AR1 B;  1G4Y B;  3UKM A;  3G71 V;  4QIW F;  1SES A;  4JGS A;  1GM8 A;  2FTK A;  4F4L A;  1WLE A;  1GO3 F;  5GW7 A;  1V54 B;  3ML0 A;  3OUF A;  4X89 A;  5EC2 C;  3F5W C;  2H8P C;  4GX1 A;  3OMI B;  1GMG A;  5LGU A;  3QO5 A;  1RPR A;  4UUJ C;  1DF5 A;  2DYS B;  4MTF A;  3CCU V;  3DTU B;  2EIL C;  1QLE C;  3K3W A;  4CBC A;  2X6C A;  4KUM A;  3WG7 B;  1ROP A;  1M1K W;  3OR7 C;  2IJI A;  2JEU A;  1K8A W;  4MTO A;  3D3I A;  3LDC A;  3JD4 A;  5BZB A;  2JIZ G;  2OT5 A;  3ABK B;  1NVP B;  3IGA C;  2LP7 A;  5KUM A;  3CCJ V;  2QM7 A;  3T1C A;  4P30 A;  2NLJ C;  2P67 A;  4MW3 A;  3IC7 A;  4GX2 A;  2QKS A;  1VQ8 V;  5HFM A;  1P7B A;  1OZ0 A;  4TSF G;  1BHA A;  1VQN V;  1PKX A;  4E2L A;  2WLH A;  2B5U A;  5IDJ A;  2C2A A;  2EIK B;  4JAS A;  3ZN1 A;  1OCR C;  3OMN B;  1VQ9 V;  3KG2 A;  1K92 A;  4PA7 A;  1YTF B;  5IYC O;  3ZMZ A;  2X6A A;  1PNM A;  2ZDI A;  1YHQ V;  2IJJ A;  4FMT A;  4XDL A;  3ZRV A;  2ZDI C;  3BY6 A;  2XAQ A;  4PEL A;  1OHH G;  4JAV A;  3JD2 A;  3E2E A;  3HB3 B;  2GHY A;  3NXS A;  3QO7 A;  3ZMS A;  5LGN A;  4LBE C;  4H37 A;  3SYC A;  1G8M A;  1M57 C;  1GK9 A;  1PNL A;  3W7U A;  1S0V A;  1E1Q G;  4WFE A;  3W7W A;  3OMA B;  3ZRW A;  4MVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...