2ZDIC

Crystal structure of prefoldin from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
MAQNNKELEKLAYEYQVLQAQAQILAQNLELLNLAKAEVQTVRETLENLKKIEEEKPEILVPIGAGSFLKGVIVDKNNAIVSVGSGYAVERSIDEAISFLEKRLKEYDEAIKKTQGALAELEKRIGEVARKAQEVQQKQSMTSFKVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and molecular dynamics simulation of archaeal prefoldin: the molecular mechanism for binding and recognition of nonnative substrate proteins
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Chaperone
molecule keywords Prefoldin subunit beta
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02996 Prefoldin Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zdiC00
2ZDIC 3AEIA 1FXKC 2ZQMA 1FXKA 1FXKB 2ZDIA
chains in the Genus database with same CATH superfamily
3MAQA 4UCRA 4X65O 5B1BB 4R6ZA 4K0KB 2QSAA 2RCVA 1WNSA 5LXTA 3CCUV 1WJZA 1B06A 2PGGA 3CRCA 1N32B 3QG5A 1K33A 4PI0A 3K06A 4O2AA 4FIPC 1AI7A 3OMAB 2EULA 5E1AC 3SR2C 5CB4B 5KX5B 3C3TA 3JALB 4IGGA 4X65B 2EILC 2VQFB 3A0BZ 3EFFK 1AR5A 5C8YB 5IJ9B 3DGEA 3HR0A 1T5EA 4GKJB 2KQXA 3HKCA 3VBBA 3BY6A 3F7VC 1PP9H 5IYBO 4XDJA 3CMEV 1MNGA 4LCUC 1PD3A 1FXVA 1ZL8A 2QTOA 1F4MA 2DJVA 1AB3A 2HR3A 1P7GA 4LFAO 4KHPB 4O4LB 2ZE7A 2XAFA 4TV8B 3UCSC 1WAZA 1QVGU 4X88A 3T4DA 1XMOB 1EBOA 2ZIMA 3WFVA 2X6AA 1VQ7V 1Q6IA 1E79G 4L87A 1NVPB 2LJ2A 3JAKB 1OCRC 4OXSA 1BCCH 3AK3A 4LF7B 2LFRA 4DV7B 4X1IA 2BOCC 3O65A 4RQEA 4JV5O 2YXHA 4I9QA 2JJ1G 4DK1A 4YJ2B 1SQFA 5EZYB 3LUTB 4JYYA 4B3MO 2L6LA 2W6JG 3RYIA 1WA8B 4MVUA 4PA9A 4B7EA 1R73A 3SYAA 1AJQA 3ZRWB 2HP8A 3B40A 1K73W 1MZEA 3JCZA 4I4TB 3HPLC 2QWRB 2N04A 4CZZA 4LH7A 4UB8Z 3IAYA 5JH7B 4JYAO 5IY5B 4TSFG 1TGOA 1DF5A 2DQ0A 2K9PA 2A0LA 4P9OA 3CP1A 4GKKB 4J80A 2WLHA 5BMVA 4LNUB 1GM8A 3M8AA 2F66C 2BTOA 3K5MA 1ENVA 3CEIA 3FB8C 4ZHQA 5B1OA 2CUGA 5IWAB 4R50A 1GH6A 2GSMB 1KC8W 1SQGA 2ZNIA 4NTYA 2UXBB 5E79Z 2UUAO 4JI3O 2A9HA 2GDSA 1ZX3A 2HKOA 1GO3F 2K1EA 1OHHG 2E5LB 5LGTA 4H0LB 2NR5A 2JRIA 3TCUA 1IBMO 3ABTA 4CH3A 4XDKA 4H13B 1JMKC 3HKDA 3IC7A 1M56C 1YITV 3CCVV 4FMTA 3K5NA 5EK0A 5GW7A 2LQTA 5IYDO 3W7TA 1G4YB 4E2LA 4EKWA 4PD4F 2Y69C 2EIMB 1THZA 4X66B 4MVSA 3ZHRA 2JEUA 3VQWA 1E1RG 3H1HH 1XILA 1V54C 1YVWA 3BABA 4FZ0A 1LNQA 1DGSA 4QE7A 3K08A 2YIDA 3APOA 1ORQC 2V4DA 4PELA 4RAIA 4LF9B 2DQ3A 4HAMA 4UB6Z 1KYOF 4X66O 2F1MA 1M56B 3TXSA 1ZL8B 1BS3A 5KLVH 2YEVB 4DR3B 1GMGA 1WA8A 5BR8O 1R3LC 2QWPB 2DMXA 3L73H 2GV9A 5C93A 4I0XA 2YUAA 3W7UA 2L35A 2VWKA 4FLUA 1SZTA 5LMNO 4X64O 3JALA 1VIBA 4CS3A 5CA1B 5LP6A 3CCSV 1SQXH 3OEHG 4DV5B 2JS5A 3D36C 2ITDC 4K3AA 1GM9A 3G80A 3K9AA 3VQYA 2PTMA 5AG2A 4DR7B 2EIJC 3ZJZA 2Q0OC 2VWJA 1H2NA 2WLJA 4KP4A 4ZI7A 2CE4A 3CCEV 1NZ6A 4BR6A 4WBNB 1SERA 1R3JC 2WPDG 2X7RB 5LMUO 4PV1B 1P49A 3CC2V 5A2QN 3L74H 4J41A 1QR8A 3OM3B 5A9GA 4X20A 1BQZA 2KG7B 4X89A 1Q6HA 3TETA 1Q86W 1M5IA 4UCTA 5B1BC 1AILA 3T1YB 2NN4A 1SZXA 2XAJA 1UJWB 4O4IB 4JI6B 1TVKB 3ZX6A 2DYSC 1PL0A 3JARA 5KHHA 2EZPA 4KL1A 1XHZA 2EIKB 4FM0A 1NH2D 5ITZB 1YIJV 2W0XA 5IWAO 3CWBH 3OFNG 1V55C 2QR4A 1XOUA 3I56V 5CBGA 1H2LA 4UCOA 3JD1A 2JGUA 4NXNO 4LF6O 2QWQB 1QNMA 2XHBA 1CPYA 1JPXA 1YF2A 1IBLO 2R9AA 3U0ZA 3QO7A 3P32A 1Q6UA 3OUFA 3WU2Z 3F7YC 4I5SA 4DR5B 1YJ9V 1Q81W 4GT1A 3QO8A 4UUJC 4ZKIA 1GKFA 3GWOA 5IYCO 2CAZC 1PNMA 4H33A 3RT3C 3G6EV 4OPAA 5TISZ 1KU9A 4IHJA 2Q6AA 4PA7A 3BFRA 4UVCA 2CH7B 5JQGB 2E76B 1FXKA 1BE3H 2DYRC 1S72V 2NLJC 3SPHA 1AP5A 1OCRB 4DV0O 4G27B 5B1AC 4JI0B 2A06H 2AHZA 1DTOA 4GCZA 2LW1A 3ABLB 1JQ0A 5J2TB 5CB4A 4DO2A 2GTSA 4MT8A 5D5QA 4ZI7B 2UU9B 1Q43A 3ETEA 1S5JA 3UKMA 5LHIA 5FNVA 1JCHA 4ZOLA 3MDSA 4I7ZB 1YJWV 2PYLA 4CC6A 2JJ2G 2BTQB 2LGWA 3W7SA 1JX9A 1TUBB 4IIJB 3A8TA 1QHTA 1Y76A 2EJ7A 1NS1A 2QKAA 2GTAA 1YTFB 5JVDB 4WBNA 2QA4V 1P84F 5JH7A 2ZE6A 5LMNB 3JAWA 5JJEB 3E8HA 5EYPA 2DWEC 5GONB 1X4TA 2Y0PA 4U3JA 1N34B 3STZC 3QNEA 3I5DA 4U3FH 4JI5O 1CXZB 3N2GA 3CPWU 2EX3A 4JI7B 3KKYA 1U97A 1N34O 3CRAA 1XBLA 3CHXA 1PPJH 1MA1A 1B3QA 1FFXA 2M6YA 1NJIW 2ADQB 3D3IA 4D6TH 2KSDA 2AZ0A 1IBKB 3RYHB 5JCOC 3RYHA 5L3BA 4PDVA 1M57C 1OCOC 2ADPA 4MTOA 3RN4A 2WLKA 1BQ0A 4TUYB 1JFFB 5IJ0A 2UXNA 2WA4A 5LA6B 4DR2B 4WF9V 2ZIOA 3AG3C 4GKJO 1KMIZ 3AEIA 3UO3A 1MSDA 1N4CA 3U11A 3SYCA 1HNXO 4Q20A 1BHBA 1VQPV 2EBOA 2YEVA 5JCOA 3JCUZ 3DC6A 3OMNB 1Q7YW 5LMUB 4X1YA 4ABMA 4MSWC 3A0RA 4JZ2A 3H1KH 3P3PA 3E35A 4D7SA 1M4UA 3HKBA 3WB2A 3GWKC 4OGQB 1O9HA 4ZHQB 5LOVB 4DV7O 4DV2O 3H1IH 4GX5A 3GVMA 4DUZB 4JYCA 4UV8A 5GTHZ 5L3CA 2B9ZA 3KCYA 4HYOA 2XASA 4YXWG 2EIMC 3U10A 2UUCB 5B5EZ 4QJFB 5KUMA 1K8AW 2Q73A 2D2CB 1IX9A 5KA6A 1QR9A 3MHSC 5BY1A 2WAMA 4IIJA 4O2AB 2YXYA 4DV6O 3CCJV 2PUSA 3B09A 1JJOA 2HHHB 2XUMA 1NT2B 1M90W 3B8MA 2PYJA 4I50B 1P4RA 4FJCC 4LF9O 4FM2A 1URFA 1HW7A 1XNQB 4TQFA 1XNQO 2W0FC 2QM4A 2Y69B 2ZT9B 4YJ3A 3LSUA 1M1KW 2A79B 2F23A 1KKCA 2OTLV 2IW5A 4NYKA 2JIZG 4HNAB 5B3SC 4P2ZA 3TJTA 4TWKA 4NKGB 2OIEA 4TV8A 2EZOA 1VQ9V 5CBHA 1Y74A 5KA5A 1WB8A 1MSWD 2B1IA 3SJBC 4CS4A 4LC1A 3ZRSA 4Z2WA 4DUYB 1W59A 4N21A 1QLEC 4H44B 1XMOO 1FYJA 3ML0A 4JZGA 5KHKA 3CRRA 3ZN0A 2WLIA 1OCCB 1RFYA 1XNRO 1IXMA 3TXQA 1V9PA 3PN1A 1NBMG 2LP7A 4PHZA 5KMGB 4YHHB 1US6A 2P4VA 3C90A 1KBHA 4BIUA 3D8CA 2CGNA 4B3TO 1VF7A 4CBCA 4DXWA 3T1YO 3CX5F 4MVMA 3RYCA 2Q7EA 3UO2A 1K34A 1GN4A 1OCCC 3HKDB 2RDCA 3H9VA 2B1GA 4X20B 1WP7A 2FMLA 4JTDB 1Y66A 5K1PA 3EHBB 1G1XB 5LGNA 2OCHA 2UUBB 1Q5OA 2OTJV 1I7FA 1K9MW 1JR9A 1X59A 5B1NA 4DR5O 4P30A 1M93A 5FL7G 1TUBA 5K1XA 1OJHA 4FFBB 5H2FZ 3OGIB 1UFIA 2A7WA 1Z2GA 4DV1B 2ZINA 1XREA 1GN2A 4X9QA 3JASB 3NXSA 3RGBA 4X64B 3K5LA 2OCCB 1Q90D 3FAVA 1VQKV 1N0NA 1QCEA 3NR7A 4E4EA 2Z5UA 1K4DC 2ZCEA 1VQ8V 4BW5A 5IE9A 2XT9A 2YS8A 2IBZH 3AG1B 4GX1A 1WN7A 3BA9A 4LH6A 3ASNC 4AI8A 2O57A 1OCZC 1LUVA 4WFAV 5LOVA 3SPIA 4JASA 1BHAA 3AG2C 4Q6GA 1YDXA 1H2SB 3K0DA 1AP6A 5LP6B 5KHJA 3E8GA 5KUKA 3CB2A 4F6RB 2ZXWC 2FTKA 5J9PC 1YCIA 1FXHA 5KHIA 3IFXA 1A32A 3L70H 2Z0AA 1SQVH 4LF5O 4RWUA 4YHHO 1XEQA 1AROP 1YTFD 1V54B 2XTAA 1H8EG 1Q8IA 3CRQA 3CC7V 5LHHA 4JAUA 4DR1O 1E1QG 4I0XB 4BIZA 2R72A 2DYSB 3JATA 5J2UA 2YSUB 3FB7C 4MW3A 4DR6B 2UUCO 5IYZA 2Y4TA 2KG7A 2GUZA 4HZ3A 4AHCA 1VQNV 1FS0G 4GLXA 1HP8A 3E83A 3E22A 2HVKC 3VOUA 4DW1A 3BHPA 3G4SV 1FFXB 3BRCA 3HB3B 1NTZH 5KAIZ 4BIOA 2Q5ZA 4WCEV 4QPKA 4ICGA 4IT5A 2RMKB 3E8FA 1M57B 1OCOB 2HVJC 2R70A 4DR4O 5JWPA 5BMVB 4B3MB 2IJJA 2X0LA 3OGCC 5FPOA 1CP9A 3GB7C 4DR4B 1I94O 1VF6A 4K8ZA 4NXMB 2Q67A 1HNZO 1GK9A 2HFEC 4FZ1A 4IYIA 1V55B 4PA4A 3ABKC 4O2BB 2RN9A 3AK2A 5H6RA 1WP8A 1K97A 1J5EB 1XNRB 3D36A 2YICA 1S76D 1B04A 1XDCA 1I5YA 1F51A 4J9ZB 3G67A 1K5SA 4FLWA 1EM1A 2IU0A 2H8PC 4NXMO 2BSKB 3JD4A 1OCZB 4NVPA 1YEWA 3ZMVA 4X1KA 1KD1W 4F6RA 3ASOC 1KKDA 4PDRA 2P90A 3DSQA 1NU1H 3I55V 2AW9A 2RNBA 3KG2A 2QGNA 3L75H 5KAFZ 2VQFO 2R9RB 4TV9A 3AG3B 2XAHA 2PI5A 3ABLC 1XQ8A 4GKKO 4O4LA 1SQPH 4TOIA 5JVDA 1TA8A 1XMQO 5C8YA 1RM1C 4J7JA 1IVSA 5CBFA 3JAKA 4JYAB 5DN6G 4LF7O 2IU3A 1IDSA 4BWAA 1H38A 4EFBA 2CGOA 2Q9LA 3N2KA 5L3FA 3IGAC 4UCUA 4DV0B 1OZ0A 3M7MX 2ARHA 4W4KA 4XDLA 4B3TB 5LHGA 1L1FA 3JAMN 1N33B 4DV4O 2DW4A 4FFBA 4F4LA 3FYIB 1YI2V 2CDYA 3IJ4A 4PDLA 3J81N 3ZMUA 2B5UA 2YIAA 5B66Z 1SS3A 3B8NA 4Z1VA 4U3JB 4OX9B 3ZS8C 1J5EO 3OD4A 3QF7A 3BA8A 4O4JA 4DR1B 1IBKO 3E86A 2OCCC 1IXBA 2ZQMA 3MD0A 4X8AA 2Y4UA 4LF8O 3JD3A 1SC5B 5IJ9A 5EBMC 4DV3B 3X2QB 2JS3A 1MG1A 1GM7A 1M9NA 3WB1A 1SA0A 3CSXA 1FXKB 3OR6C 1LUWA 4K35A 4NB5A 3RYIB 4CS2A 2WLMA 2M7WA 3CRMA 4UVAA 3S3XA 4JI4B 2ILMA 3CE2A 1S3JA 4B3RO 2OWOA 3L9DA 3STLC 2P67A 1Z5VA 4DV3O 1FXKC 3RVYA 1H8HG 1L0NH 4FPPA 2UXCO 4AQYB 1RP3B 5FPRA 1WB7A 1BMFG 2BCCH 5KHGA 1S5LZ 3DXRB 3H1LH 3H1JH 4GYCB 4X62O 3T1HB 3AG1C 1XI1A 5JQGA 3D3QA 3TK1A 1QVFU 3G6BA 3LSQA 2V7QG 1I5XA 4GZRB 3AG7A 3K0GA 2EINC 2MK3A 2WLNA 3LDEA 4GUNA 2WWWA 2WLIB 3ZMSA 2ZDIA 3PJSK 3F5WC 1YXBA 3RYFA 5L3GA 4LF4O 3RYFB 3ABKB 1K7DA 5BXZA 4I50A 3J7AU 4LFBO 3FAVB 1TVKA 4DR3O 3A0HZ 5DEDA 2E74B 2ZDIC 1FPOA 1PNLA 4JI2O 4DRXA 1AI5A 5FLXN 4JYBA 1JA8A 3OTOO 2QE7G 4R8CA 4WFEA 5H6QA 5CA0B 3RW0A 3OAAG 4K0KO 4LFBB 1L8DA 5DM6V 4NXNB 4B3RB 1VEWA 4IL6Z 5H9CA 1EN4A 4WFHA 1H2KA 1N32O 4MTXA 1ZUQA 3DTUB 2IJIA 4G2KA 2OIGA 4B3SB 2R9IA 2FKXA 4YIPA 2XAGA 1ZTEA 4WFBV 4FLTA 4LFCO 1O9GA 1I0HA 1F4NA 4I9WA 3R66A 4MVRA 1HR0B 5LYJA 5CA1A 5GTIZ 5KMGA 3HKBB 1VARA 3E89A 4YY3O 3JYCA 2YI9A 4J10A 4J7KA 2VQEB 4O4JB 3CCQV 2ITCC 5IYZB 4YY3B 1AI4A 1VQOV 3UM7A 4MTFA 3ASOB 4KFMA 2DOSA 5B3SB 1NI8A 2IJKA 4ZIBA 3W7WA 5EZYA 1SRYA 3BEHA 2ZKOA 4DV1O 1PKXA 1I08A 1R3IC 1WPXA 3K03A 2QKCA 4TV9B 2E3CA 4BW9A 1FFTB 3WG7C 1GAXA 4RUEA 1IBLB 3B2EE 2UXDB 4TUYA 3SPJA 1QQCA 2HLDG 2UXBO 2WLLA 1VQLV 3JSNA 4C7UA 1W0JG 2RQ6A 2P06A 2BSKA 1N8RW 3MHHC 3IC9A 4JAAA 3J80N 4MTGA 3N2GB 2VQEO 1IBMB 3LNNA 2W6IG 5LL6Y 2QEXV 4EEQA 4YJ2A 1XL6A 2Q69A 4FK5C 3VQVA 2AGAA 1AR1B 1N36B 1JFFA 2YIBA 1K92A 4J9YB 2CTWA 1VP7A 4EB6A 4ASUG 4DV2B 4MVOA 1R6NA 4CH4A 1N0JA 1YSCA 4K8XA 1R1BA 1VQMV 4EFEA 3ZRVA 1I94B 3JD0A 1DLBA 2WA3A 1TUEB 2UUBO 4MVQA 3JARB 5IT9N 3JASA 2F43G 1EFRG 2ETNA 1P7BA 2HEPA 2YXLA 4L8JA 1NKDA 1VMGA 2ZXWB 2DWDC 1SA0B 1NQTA 1F7YA 1UPGA 2EIJB 3K58A 3K9SA 2DN9A 2G38A 4FLZA 1BL8A 1FD9A 3E2EA 5CA0A 4O4HB 3SYOA 1AR4A 1XUQA 1EZVH 4OX9O 1XHXA 3OTOB 1NVPD 1NH2B 1SKVA 1MMMA 2IM9A 2VS0A 4H37A 1NTMH 3ZHSA 1PV0A 3OMIB 3B77A 3FB5C 5EC2C 4JI5B 4X1IB 4LNUA 3BPZA 3AG2B 2H3OA 4Z1MG 4CH6A 4X62B 2FL4A 3N2KB 3CCRV 3RVZA 2Q68A 2YIBD 1RM1B 1AJNA 4TQDA 1MOFA 2Q8VA 1K4CC 3T4ZA 4GX2A 2XNDG 4QIWF 3JATB 5J2UB 2CH7A 1GTOA 3RBZA 4FLXA 1D2DA 4DUZO 2ZD9A 5HFMA 5JJJB 1N33O 3LSSA 1GN3A 2QKSA 3DXRA 2X6BA 3FX7A 1TAEA 3WG7B 1R6TA 4W4LA 1W2BU 3SPGA 1PL4A 2ZE5A 2HHHO 4WFGA 2FYUH 4AILC 3C3SA 4LF4B 4JV5B 2IJHA 4NTXA 2CTRA 4LBEC 3K57A 1HNWO 2Z3YA 1G6UA 2HJFC 2YC0A 2BTQA 3ZIAG 1Y6XA 3OR7C 4PA3A 1WPBA 2ZNJA 5EBLC 3ABUA 2UXXA 4UV9A 1PM9A 3THOA 3JAWB 3TGUH 3ZEDA 3K5OA 3FFQA 4O2BA 1Y76B 1JVMA 2JK5C 2DYRB 1VQ4V 2XOKG 4MW8A 2IH1C 4QE9A 3SJCC 4CC5A 2BOBC 4JI7O 3F5TA 3ZHVA 4I55B 3RFRA 3ETGA 1RSOA 4MS2A 3ZHUA 1S0VA 2UXDO 3WB0A 4FM1A 2PZSA 2D3OW 5KX5A 1F23A 1DF4A 1HNZB 1HDJA 5IY5C 1B6QA 3P3NA 1NTKH 1HNWB 3R65A 3AK1A 2AZ2A 4DK0A 4N23A 1H2MA 3T1HO 1S5HC 2KKWA 5LP6C 4LF5B 4NR1A 2P6JA 2QWNB 4XBFA 4I55A 3ZMTA 3UT5A 3ETDA 4FVMA 1HWYA 2LGQA 2PY5A 2EJRA 3HKEB 3CXCU 4JAVA 4DV6B 4DR2O 4UXNA 3FYEB 3ABMB 3B4SA 4JTCB 3A2FA 2DE0X 3K79A 3ZBHA 5IDJA 5JJNB 1MABG 5L3DA 1IURA 1ZLZA 1Y67A 4UVBA 1KECA 1KP2A 3ABMC 1IZ3A 2ZR2A 4RUFA 2ZE8A 1BZKA 2N74A 3UT5B 1JJ2U 1EZJA 2V1DA 3CD6V 3BAAA 5L3EA 2OYQA 2PI4A 3W7XA 3SYPA 1N36O 3ICXA 2KB1A 3OTFA 2F4VB 2QWOB 3CJHB 4U7NA 1YHQV 4WFFA 2E75B 1Y74B 2UU9O 2Y0IA 3T1CA 1MZFA 5EYPB 2MW2B 2Q0AA 2ZR3A 1YZBA 3K04A 2UXCB 2QDOA 3BVOA 3ZMZA 2EIKC 3OT7A 4OPHA 4HNAA 4JI0O 1XMQB 4YJ3B 5HFLA 4ZOLB 2QM7A 3H01A 3KZIZ 1S77D 4DUYO 3L71H 1SF9A 1PNKA 4J7ZA 1H2GA 2WSSG 3FKSG 3AG4C 2JGDB 4GX0A 3JSLA 4JI1O 1JOYA 1BT8A 2IH3C 3ZN1A 4QNHB 4DR6O 4DV4B 2LW7A 4UCVA 4U7OA 1GRJA 3LDCA 2AHYA 3CXHF 3CC4V 4B3SO 5LXTB 2LFSA 3FB6C 3AG4B 2VRZA 1VQ5V 4QPJA 5EIBC 2F93B 1EN6A 5B1AB 2RJZA 4X1YB 4IYHA 1KP3A 3ETQA 1R6KA 4LR3A 3S3WA 5BZBA 1RPRA 1SESA 4JI2B 1W0KG 3P30A 2CTPA 3G71V 2CK3G 3JD2A 1ZWIC 4NTWA 3T2MA 3CS5A 3RYCB 3FD9A 2YDEA 4MVZA 5IJ0B 1QBZA 4QGPA 2WLLB 1AVMA 2GBOA 4LWSB 4DR7O 2JEXA 1VF6C 2A3QA 1FKAO 2QM8A 3Q4HA 2GHYA 1BSMA 1SQBH 2N05A 3K59A 1KUQA 4HBNA 1AI6A 2C2AA 2AXTZ 4LF6B 1D5NA 4EB6B 4JPRA 1KQSU 1L0LH 1QU7A 2Q7GA 4FLVA 1SETA 4PI2A 1Y4MA 5F2VO 4CH5A 3APQA 4LFCB 3SYQA 1GN6A 4DV5O 4KXRA 2X6CA 4JI8O 3HKCB 4X1KB 1VQ6V 2PF4E 4PDMA 5EIBD 3CCLV 3QO5A 1AJPA 4RO2A 1VF5B 4JI6O 1R3KC 2NNUA 1Q82W 4O4HA 4J42A 5LYJB 2F95B 1FJGB 3LNMB 3K3WA 5CMUA 5EBWC 1CEZA 5D5PA 4LFAB 4KHPO 3SDLA 4JI1B 3SPCA 3E8BA 3EVKA 4RQFA 4G28B 1WLEA 4JTAB 2P7TC 3CMAV 2JGDA 3QVNA 3N27A 4JF3A 2LO1A 2P5OA 5J2TA 2Y48A 4AQYO 3L72H 3E22B 4JI3B 3ZRXA 5H5NA 3CYOA 4LP8A 5FNVB 4FLYA 4JI8B 1OV9A 4A5UB 2FB5A 2UUAB 3ZRWA 5BR8B 4PJ0Z 4DRXB 3CCMV 3CJHA 1ZSPA 1FJGO 4BAYA 2QTSA 1RSOB 1ZAUA 3EXAA 2Q7HA 1SQQH 1ROPA 2QJ1A 3OUSA 1EN5A 3ASNB 2ATKC 2GUZB 3SJQC 4UCSA 2CTQA 3M99B 2BE3A 4UFZA 3DC5A 5CN0A 3LDDA 2XAQA 1XL4A 4F6EA 3UQ8A 1J95A 4I4TA 1Q3EA 3SGIA 2Q4PA 3OW2U 1DK1A 1FAFA 2ZM6O 1U96A 2OT5A 5LGUA 2ODMA 2P4KA 4JI4O 3HKEA 2ZM6B 3KCXA 3ZCCA 5ITZA 4R7CA 4P9PA 4KUMA 1LR1A 3QTCA 5LA6A 4IHJB 4B08A 1HNXB 1QLEB 2HG5C 1K3EA 2HJDA 1QLNA 1RPOA 3Q4HB 1NR1A 2P22C 5LBQA 4JGSA 4LWSA 3RWRD 4LF8B 3BCCH 4FFKA 1D5AA 3OE7G 4ZBMA 1K5QA 2H94A 2YI8A 1Z5WA 4O4IA 2JDIG 3SJAC 3VQXA 5EC1C 3ZHTA 5CA3A 4DW0A 4B7KA 2E5LO 4YIOA 1NR7A 3OEEG 3ZHQA 2F4VO 5GONA 4TT3G 4D7TA 5DECA 2EINB 4DYLA 4PA6A 2JVDA 1BGYH 3X2QC 2EILB 1KB9F 1COWG 1YJNV 3O9OA 1HR0O 1G8MA 4J11A
chains in the Genus database with same CATH topology
4LBEC 1YTFB 2Z3YA 4PDRA 2HJFC 2P90A 4R6ZA 5B1BB 2QA4V 3CCUV 3ZIAG 3E8HA 3I55V 3OR7C 4PA3A 3KG2A 2DWEC 5EBLC 3ABUA 2UXXA 4UV9A 3STZC 2R9RB 3QNEA 3AG3B 2XAHA 2PI5A 3CPWU 3ABLC 1K33A 3K06A 4FIPC 1AI7A 3OMAB 1NJIW 3D3IA 5E1AC 1RM1C 1JVMA 2JK5C 2DYRB 1VQ4V 2EILC 2XOKG 4MW8A 2IH1C 4QE9A 5L3BA 4PDVA 5CBFA 3EFFK 2BOBC 1M57C 1OCOC 3DGEA 4MTOA 2WLKA 5DN6G 2IU3A 1H38A 3ETGA 2UXNA 4MS2A 1S0VA 5L3FA 3IGAC 3VBBA 2D3OW 4XDLA 3BY6A 4WF9V 3F7VC 5IYBO 1L1FA 4XDJA 3AG3C 5LHGA 3CMEV 1F23A 1DF4A 4LCUC 1PD3A 1FXVA 5IY5C 2QTOA 3AEIA 1F4MA 1B6QA 2DW4A 2HR3A 4F4LA 3R65A 3FYIB 1YI2V 4PDLA 3SYCA 3ZMUA 4Q20A 2B5UA 1BHBA 2XAFA 2EBOA 2YEVA 1VQPV 3B8NA 4N23A 1QVGU 4X88A 3OMNB 3T4DA 1S5HC 1EBOA 3E86A 1Q7YW 2OCCC 3WFVA 2P6JA 4XBFA 2ZQMA 3MD0A 4X8AA 2X6AA 1VQ7V 3ZMTA 3JD3A 3ETDA 4MSWC 1E79G 4L87A 1HWYA 1NVPB 3A0RA 1OCRC 2EJRA 4OXSA 5EBMC 3X2QB 4JAVA 3CXCU 2LFRA 3E35A 1MG1A 1GM7A 2BOCC 4RQEA 1M9NA 2JJ1G 3LUTB 4UXNA 3FYEB 1FXKB 3ABMB 4JTCB 2W6JG 3OR6C 4GX5A 3K79A 4MVUA 4PA9A 4JYCA 1R73A 2WLMA 4UV8A 3SYAA 5IDJA 1AJQA 2M7WA 3ZRWB 5L3CA 4HYOA 1MABG 4UVAA 3JCZA 1K73W 2XASA 5L3DA 4YXWG 1S3JA 2EIMC 3HPLC 3STLC 4QJFB 5KUMA 4CZZA 2P67A 1K8AW 4UVBA 1KECA 1KP2A 1FXKC 3ABMC 3RVYA 1H8HG 2ZR2A 4FPPA 4RUFA 5IY5B 4TSFG 5KA6A 1JJ2U 1EZJA 2V1DA 1DF5A 3CD6V 5L3EA 1QR9A 3MHSC 2DQ0A 1BMFG 2A0LA 2WAMA 3CP1A 4P9OA 2PI4A 3W7XA 3SYPA 2WLHA 2KB1A 3AG1C 1GM8A 4U7NA 3TK1A 1YHQV 1QVFU 4WFFA 1KKDA 3LSQA 3CCJV 2V7QG 1I5XA 1M90W 3K0GA 3B8MA 3T1CA 2EINC 2MK3A 1ENVA 2WLNA 3LDEA 1P4RA 3FB8C 4FJCC 2ZR3A 3K04A 5B1OA 2WWWA 2WLIB 2EIKC 3ZMZA 4R50A 2GSMB 3ZMSA 1KC8W 2ZDIA 3PJSK 2A9HA 3F5WC 2HKOA 2K1EA 1GO3F 1OHHG 2W0FC 2Y69B 5L3GA 3ABKB 5LGTA 1M1KW 1K7DA 2A79B 3TCUA 5HFLA 2OTLV 2IW5A 2QM7A 3ABTA 2JIZG 3H01A 4XDKA 3IC7A 5B3SC 1M56C 1YITV 4P2ZA 1S77D 3CCVV 4FMTA 4TWKA 5EK0A 5GW7A 1PNKA 5IYDO 3W7TA 1H2GA 2WSSG 1G4YB 2EZOA 3AG4C 3FKSG 4E2LA 2Y69C 2EIMB 4EKWA 1VQ9V 4GX0A 1JOYA 2ZDIC 1THZA 4MVSA 1PNLA 2IH3C 3ZN1A 5CBHA 4QNHB 2JEUA 5KA5A 1MSWD 4U7OA 1AI5A 2B1IA 1E1RG 2AHYA 3LDCA 4JYBA 3CC4V 2QE7G 4R8CA 4WFEA 5H6QA 1V54C 1LNQA 4LC1A 4QE7A 3ZRSA 3K08A 4N21A 3RW0A 1QLEC 2LFSA 3FB6C 3OAAG 3AG4B 1VQ5V 5DM6V 1ORQC 3ML0A 4QPJA 5B1AB 3ZN0A 4PELA 4RAIA 2WLIA 2DQ3A 1OCCB 1KP3A 1R6KA 5H9CA 1IXMA 4HAMA 1NBMG 2LP7A 4WFHA 5BZBA 1RPRA 1M56B 1SESA 2IJIA 1W0KG 3DTUB 3P30A 4MTXA 3G71V 2CK3G 3JD2A 4G2KA 1ZWIC 4BIUA 2R9IA 2YEVB 4CBCA 4DXWA 2XAGA 1GMGA 3T2MA 4MVMA 4WFBV 1K34A 1OCCC 1R3LC 4MVZA 1F4NA 1QBZA 4I9WA 4MVRA 2B1GA 5C93A 2WLLB 4JTDB 1Y66A 3W7UA 3EHBB 2JEXA 5LGNA 3E89A 1SZTA 2OTJV 3JYCA 2QM8A 2GHYA 3CCQV 2ITCC 1K9MW 5B1NA 1AI4A 1VQOV 3UM7A 4P30A 3CCSV 1AI6A 3OEHG 5FL7G 2C2AA 4MTFA 3ASOB 4KFMA 5B3SB 2IJKA 2ITDC 4JPRA 1KQSU 1GM9A 3W7WA 3K9AA 1SRYA 2EIJC 3ZJZA 3BEHA 1SETA 2WLJA 1PKXA 3NXSA 4KP4A 1Y4MA 1R3IC 1WPXA 3K03A 2OCCB 3SYQA 3CCEV 1SERA 1FFTB 1R3JC 3WG7C 1VQKV 2X6CA 2WPDG 1QCEA 1VQ6V 4RUEA 2X7RB 2Z5UA 4PDMA 1K4DC 3CCLV 3QO5A 1AJPA 4RO2A 1VQ8V 1R3KC 2NNUA 3SPJA 1Q82W 2HLDG 3CC2V 4BW5A 2WLLA 1QR8A 3OM3B 1VQLV 3LNMB 3K3WA 5CMUA 5EBWC 1CEZA 1W0JG 3AG1B 4X89A 4GX1A 1N8RW 3MHHC 3TETA 1Q86W 3ASNC 4MTGA 1OCZC 3SPCA 2W6IG 3E8BA 5B1BC 4RQFA 4G28B 4WFAV 1WLEA 4JTAB 2QEXV 2P7TC 3CMAV 3SPIA 1XL6A 4JASA 1BHAA 2XAJA 2Q69A 3AG2C 1UJWB 4FK5C 1AR1B 4JF3A 3K0DA 1K92A 4J9YB 4ASUG 2DYSC 3E8GA 4MVOA 2Y48A 1PL0A 5KUKA 1R6NA 2ZXWC 1YSCA 2EZPA 2FTKA 5J9PC 1FXHA 1VQMV 3IFXA 2EIKB 3ZRXA 1NH2D 3ZRVA 3CYOA 3JD0A 1DLBA 1TUEB 1YIJV 1AROP 4MVQA 4LP8A 1YTFD 3OFNG 1V55C 1V54B 1H8EG 2F43G 3CC7V 5LHHA 4JAUA 3I56V 1EFRG 1E1QG 3ZRWA 4BIZA 5CBGA 3CCMV 1P7BA 2DYSB 3JD1A 1NKDA 2YSUB 2ZXWB 2DWDC 3FB7C 4BAYA 4MW3A 1CPYA 1JPXA 1NQTA 2EIJB 1ROPA 3OUSA 3OUFA 3P32A 3QO7A 3ASNB 1BL8A 3F7YC 4I5SA 2ATKC 4HZ3A 1VQNV 1YJ9V 1FS0G 1Q81W 3SJQC 3E2EA 3M99B 3E83A 4GT1A 3QO8A 4UUJC 2HVKC 3SYOA 1GKFA 5CN0A 3VOUA 4ZKIA 3G4SV 3GWOA 5IYCO 1PNMA 3LDDA 2XAQA 4H33A 3G6EV 1NVPD 1NH2B 1XL4A 3HB3B 2Q6AA 4H37A 1J95A 3OMIB 3OW2U 3B77A 3FB5C 4PA7A 5EC2C 4UVCA 2OT5A 5LGUA 4WCEV 4QPKA 3AG2B 1FXKA 4Z1MG 3ZCCA 3E8FA 1M57B 1OCOB 2HVJC 4R7CA 4P9PA 4KUMA 2DYRC 3CCRV 1S72V 2NLJC 2IJJA 3RVZA 2X0LA 3SPHA 3OGCC 1OCRB 2Q68A 1QLEB 2HG5C 1RM1B 1AJNA 1CP9A 3GB7C 1K3EA 1QLNA 1MOFA 1RPOA 4G27B 1NR1A 5B1AC 2Q67A 1K4CC 3T4ZA 4GX2A 2AHZA 5LBQA 2XNDG 4QIWF 1GK9A 2HFEC 1DTOA 4GCZA 4JGSA 3ABLB 1JQ0A 1V55B 4PA4A 3ABKC 1GTOA 3RBZA 4DO2A 3OE7G 4MT8A 4ZBMA 2ZD9A 5H6RA 1K5QA 2H94A 2JDIG 5HFMA 1K97A 5EC1C 3D36A 3ETEA 3LSSA 1S76D 5CA3A 3UKMA 2QKSA 5LHIA 1JCHA 1I5YA 1NR7A 1F51A 4J9ZB 3OEEG 2X6BA 1YJWV 3WG7B 4TT3G 1K5SA 1W2BU 2IU0A 2H8PC 3SPGA 2EINB 2JJ2G 3JD4A 1OCZB 4PA6A 3W7SA 1JX9A 3X2QC 2EILB 4WFGA 1G8MA 3ZMVA 1KD1W 1COWG 1YJNV 3ASOC 2IJHA 1OZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI C;  3AEI A;  1FXK C;  2ZQM A;  1FXK A;  1FXK B;  2ZDI A; 
#chains in the Genus database with same CATH topology
 3MAQ A;  4UCR A;  4X65 O;  5B1B B;  4R6Z A;  4K0K B;  2QSA A;  2RCV A;  1WNS A;  5LXT A;  3CCU V;  1WJZ A;  1B06 A;  2PGG A;  3CRC A;  1N32 B;  3QG5 A;  1K33 A;  4PI0 A;  3K06 A;  4O2A A;  4FIP C;  1AI7 A;  3OMA B;  2EUL A;  5E1A C;  3SR2 C;  5CB4 B;  5KX5 B;  3C3T A;  3JAL B;  4IGG A;  4X65 B;  2EIL C;  2VQF B;  3A0B Z;  3EFF K;  1AR5 A;  5C8Y B;  5IJ9 B;  3DGE A;  3HR0 A;  1T5E A;  4GKJ B;  2KQX A;  3HKC A;  3VBB A;  3BY6 A;  3F7V C;  1PP9 H;  5IYB O;  4XDJ A;  3CME V;  1MNG A;  4LCU C;  1PD3 A;  1FXV A;  1ZL8 A;  2QTO A;  1F4M A;  2DJV A;  1AB3 A;  2HR3 A;  1P7G A;  4LFA O;  4KHP B;  4O4L B;  2ZE7 A;  2XAF A;  4TV8 B;  3UCS C;  1WAZ A;  1QVG U;  4X88 A;  3T4D A;  1XMO B;  1EBO A;  2ZIM A;  3WFV A;  2X6A A;  1VQ7 V;  1Q6I A;  1E79 G;  4L87 A;  1NVP B;  2LJ2 A;  3JAK B;  1OCR C;  4OXS A;  1BCC H;  3AK3 A;  4LF7 B;  2LFR A;  4DV7 B;  4X1I A;  2BOC C;  3O65 A;  4RQE A;  4JV5 O;  2YXH A;  4I9Q A;  2JJ1 G;  4DK1 A;  4YJ2 B;  1SQF A;  5EZY B;  3LUT B;  4JYY A;  4B3M O;  2L6L A;  2W6J G;  3RYI A;  1WA8 B;  4MVU A;  4PA9 A;  4B7E A;  1R73 A;  3SYA A;  1AJQ A;  3ZRW B;  2HP8 A;  3B40 A;  1K73 W;  1MZE A;  3JCZ A;  4I4T B;  3HPL C;  2QWR B;  2N04 A;  4CZZ A;  4LH7 A;  4UB8 Z;  3IAY A;  5JH7 B;  4JYA O;  5IY5 B;  4TSF G;  1TGO A;  1DF5 A;  2DQ0 A;  2K9P A;  2A0L A;  4P9O A;  3CP1 A;  4GKK B;  4J80 A;  2WLH A;  5BMV A;  4LNU B;  1GM8 A;  3M8A A;  2F66 C;  2BTO A;  3K5M A;  1ENV A;  3CEI A;  3FB8 C;  4ZHQ A;  5B1O A;  2CUG A;  5IWA B;  4R50 A;  1GH6 A;  2GSM B;  1KC8 W;  1SQG A;  2ZNI A;  4NTY A;  2UXB B;  5E79 Z;  2UUA O;  4JI3 O;  2A9H A;  2GDS A;  1ZX3 A;  2HKO A;  1GO3 F;  2K1E A;  1OHH G;  2E5L B;  5LGT A;  4H0L B;  2NR5 A;  2JRI A;  3TCU A;  1IBM O;  3ABT A;  4CH3 A;  4XDK A;  4H13 B;  1JMK C;  3HKD A;  3IC7 A;  1M56 C;  1YIT V;  3CCV V;  4FMT A;  3K5N A;  5EK0 A;  5GW7 A;  2LQT A;  5IYD O;  3W7T A;  1G4Y B;  4E2L A;  4EKW A;  4PD4 F;  2Y69 C;  2EIM B;  1THZ A;  4X66 B;  4MVS A;  3ZHR A;  2JEU A;  3VQW A;  1E1R G;  3H1H H;  1XIL A;  1V54 C;  1YVW A;  3BAB A;  4FZ0 A;  1LNQ A;  1DGS A;  4QE7 A;  3K08 A;  2YID A;  3APO A;  1ORQ C;  2V4D A;  4PEL A;  4RAI A;  4LF9 B;  2DQ3 A;  4HAM A;  4UB6 Z;  1KYO F;  4X66 O;  2F1M A;  1M56 B;  3TXS A;  1ZL8 B;  1BS3 A;  5KLV H;  2YEV B;  4DR3 B;  1GMG A;  1WA8 A;  5BR8 O;  1R3L C;  2QWP B;  2DMX A;  3L73 H;  2GV9 A;  5C93 A;  4I0X A;  2YUA A;  3W7U A;  2L35 A;  2VWK A;  4FLU A;  1SZT A;  5LMN O;  4X64 O;  3JAL A;  1VIB A;  4CS3 A;  5CA1 B;  5LP6 A;  3CCS V;  1SQX H;  3OEH G;  4DV5 B;  2JS5 A;  3D36 C;  2ITD C;  4K3A A;  1GM9 A;  3G80 A;  3K9A A;  3VQY A;  2PTM A;  5AG2 A;  4DR7 B;  2EIJ C;  3ZJZ A;  2Q0O C;  2VWJ A;  1H2N A;  2WLJ A;  4KP4 A;  4ZI7 A;  2CE4 A;  3CCE V;  1NZ6 A;  4BR6 A;  4WBN B;  1SER A;  1R3J C;  2WPD G;  2X7R B;  5LMU O;  4PV1 B;  1P49 A;  3CC2 V;  5A2Q N;  3L74 H;  4J41 A;  1QR8 A;  3OM3 B;  5A9G A;  4X20 A;  1BQZ A;  2KG7 B;  4X89 A;  1Q6H A;  3TET A;  1Q86 W;  1M5I A;  4UCT A;  5B1B C;  1AIL A;  3T1Y B;  2NN4 A;  1SZX A;  2XAJ A;  1UJW B;  4O4I B;  4JI6 B;  1TVK B;  3ZX6 A;  2DYS C;  1PL0 A;  3JAR A;  5KHH A;  2EZP A;  4KL1 A;  1XHZ A;  2EIK B;  4FM0 A;  1NH2 D;  5ITZ B;  1YIJ V;  2W0X A;  5IWA O;  3CWB H;  3OFN G;  1V55 C;  2QR4 A;  1XOU A;  3I56 V;  5CBG A;  1H2L A;  4UCO A;  3JD1 A;  2JGU A;  4NXN O;  4LF6 O;  2QWQ B;  1QNM A;  2XHB A;  1CPY A;  1JPX A;  1YF2 A;  1IBL O;  2R9A A;  3U0Z A;  3QO7 A;  3P32 A;  1Q6U A;  3OUF A;  3WU2 Z;  3F7Y C;  4I5S A;  4DR5 B;  1YJ9 V;  1Q81 W;  4GT1 A;  3QO8 A;  4UUJ C;  4ZKI A;  1GKF A;  3GWO A;  5IYC O;  2CAZ C;  1PNM A;  4H33 A;  3RT3 C;  3G6E V;  4OPA A;  5TIS Z;  1KU9 A;  4IHJ A;  2Q6A A;  4PA7 A;  3BFR A;  4UVC A;  2CH7 B;  5JQG B;  2E76 B;  1FXK A;  1BE3 H;  2DYR C;  1S72 V;  2NLJ C;  3SPH A;  1AP5 A;  1OCR B;  4DV0 O;  4G27 B;  5B1A C;  4JI0 B;  2A06 H;  2AHZ A;  1DTO A;  4GCZ A;  2LW1 A;  3ABL B;  1JQ0 A;  5J2T B;  5CB4 A;  4DO2 A;  2GTS A;  4MT8 A;  5D5Q A;  4ZI7 B;  2UU9 B;  1Q43 A;  3ETE A;  1S5J A;  3UKM A;  5LHI A;  5FNV A;  1JCH A;  4ZOL A;  3MDS A;  4I7Z B;  1YJW V;  2PYL A;  4CC6 A;  2JJ2 G;  2BTQ B;  2LGW A;  3W7S A;  1JX9 A;  1TUB B;  4IIJ B;  3A8T A;  1QHT A;  1Y76 A;  2EJ7 A;  1NS1 A;  2QKA A;  2GTA A;  1YTF B;  5JVD B;  4WBN A;  2QA4 V;  1P84 F;  5JH7 A;  2ZE6 A;  5LMN B;  3JAW A;  5JJE B;  3E8H A;  5EYP A;  2DWE C;  5GON B;  1X4T A;  2Y0P A;  4U3J A;  1N34 B;  3STZ C;  3QNE A;  3I5D A;  4U3F H;  4JI5 O;  1CXZ B;  3N2G A;  3CPW U;  2EX3 A;  4JI7 B;  3KKY A;  1U97 A;  1N34 O;  3CRA A;  1XBL A;  3CHX A;  1PPJ H;  1MA1 A;  1B3Q A;  1FFX A;  2M6Y A;  1NJI W;  2ADQ B;  3D3I A;  4D6T H;  2KSD A;  2AZ0 A;  1IBK B;  3RYH B;  5JCO C;  3RYH A;  5L3B A;  4PDV A;  1M57 C;  1OCO C;  2ADP A;  4MTO A;  3RN4 A;  2WLK A;  1BQ0 A;  4TUY B;  1JFF B;  5IJ0 A;  2UXN A;  2WA4 A;  5LA6 B;  4DR2 B;  4WF9 V;  2ZIO A;  3AG3 C;  4GKJ O;  1KMI Z;  3AEI A;  3UO3 A;  1MSD A;  1N4C A;  3U11 A;  3SYC A;  1HNX O;  4Q20 A;  1BHB A;  1VQP V;  2EBO A;  2YEV A;  5JCO A;  3JCU Z;  3DC6 A;  3OMN B;  1Q7Y W;  5LMU B;  4X1Y A;  4ABM A;  4MSW C;  3A0R A;  4JZ2 A;  3H1K H;  3P3P A;  3E35 A;  4D7S A;  1M4U A;  3HKB A;  3WB2 A;  3GWK C;  4OGQ B;  1O9H A;  4ZHQ B;  5LOV B;  4DV7 O;  4DV2 O;  3H1I H;  4GX5 A;  3GVM A;  4DUZ B;  4JYC A;  4UV8 A;  5GTH Z;  5L3C A;  2B9Z A;  3KCY A;  4HYO A;  2XAS A;  4YXW G;  2EIM C;  3U10 A;  2UUC B;  5B5E Z;  4QJF B;  5KUM A;  1K8A W;  2Q73 A;  2D2C B;  1IX9 A;  5KA6 A;  1QR9 A;  3MHS C;  5BY1 A;  2WAM A;  4IIJ A;  4O2A B;  2YXY A;  4DV6 O;  3CCJ V;  2PUS A;  3B09 A;  1JJO A;  2HHH B;  2XUM A;  1NT2 B;  1M90 W;  3B8M A;  2PYJ A;  4I50 B;  1P4R A;  4FJC C;  4LF9 O;  4FM2 A;  1URF A;  1HW7 A;  1XNQ B;  4TQF A;  1XNQ O;  2W0F C;  2QM4 A;  2Y69 B;  2ZT9 B;  4YJ3 A;  3LSU A;  1M1K W;  2A79 B;  2F23 A;  1KKC A;  2OTL V;  2IW5 A;  4NYK A;  2JIZ G;  4HNA B;  5B3S C;  4P2Z A;  3TJT A;  4TWK A;  4NKG B;  2OIE A;  4TV8 A;  2EZO A;  1VQ9 V;  5CBH A;  1Y74 A;  5KA5 A;  1WB8 A;  1MSW D;  2B1I A;  3SJB C;  4CS4 A;  4LC1 A;  3ZRS A;  4Z2W A;  4DUY B;  1W59 A;  4N21 A;  1QLE C;  4H44 B;  1XMO O;  1FYJ A;  3ML0 A;  4JZG A;  5KHK A;  3CRR A;  3ZN0 A;  2WLI A;  1OCC B;  1RFY A;  1XNR O;  1IXM A;  3TXQ A;  1V9P A;  3PN1 A;  1NBM G;  2LP7 A;  4PHZ A;  5KMG B;  4YHH B;  1US6 A;  2P4V A;  3C90 A;  1KBH A;  4BIU A;  3D8C A;  2CGN A;  4B3T O;  1VF7 A;  4CBC A;  4DXW A;  3T1Y O;  3CX5 F;  4MVM A;  3RYC A;  2Q7E A;  3UO2 A;  1K34 A;  1GN4 A;  1OCC C;  3HKD B;  2RDC A;  3H9V A;  2B1G A;  4X20 B;  1WP7 A;  2FML A;  4JTD B;  1Y66 A;  5K1P A;  3EHB B;  1G1X B;  5LGN A;  2OCH A;  2UUB B;  1Q5O A;  2OTJ V;  1I7F A;  1K9M W;  1JR9 A;  1X59 A;  5B1N A;  4DR5 O;  4P30 A;  1M93 A;  5FL7 G;  1TUB A;  5K1X A;  1OJH A;  4FFB B;  5H2F Z;  3OGI B;  1UFI A;  2A7W A;  1Z2G A;  4DV1 B;  2ZIN A;  1XRE A;  1GN2 A;  4X9Q A;  3JAS B;  3NXS A;  3RGB A;  4X64 B;  3K5L A;  2OCC B;  1Q90 D;  3FAV A;  1VQK V;  1N0N A;  1QCE A;  3NR7 A;  4E4E A;  2Z5U A;  1K4D C;  2ZCE A;  1VQ8 V;  4BW5 A;  5IE9 A;  2XT9 A;  2YS8 A;  2IBZ H;  3AG1 B;  4GX1 A;  1WN7 A;  3BA9 A;  4LH6 A;  3ASN C;  4AI8 A;  2O57 A;  1OCZ C;  1LUV A;  4WFA V;  5LOV A;  3SPI A;  4JAS A;  1BHA A;  3AG2 C;  4Q6G A;  1YDX A;  1H2S B;  3K0D A;  1AP6 A;  5LP6 B;  5KHJ A;  3E8G A;  5KUK A;  3CB2 A;  4F6R B;  2ZXW C;  2FTK A;  5J9P C;  1YCI A;  1FXH A;  5KHI A;  3IFX A;  1A32 A;  3L70 H;  2Z0A A;  1SQV H;  4LF5 O;  4RWU A;  4YHH O;  1XEQ A;  1ARO P;  1YTF D;  1V54 B;  2XTA A;  1H8E G;  1Q8I A;  3CRQ A;  3CC7 V;  5LHH A;  4JAU A;  4DR1 O;  1E1Q G;  4I0X B;  4BIZ A;  2R72 A;  2DYS B;  3JAT A;  5J2U A;  2YSU B;  3FB7 C;  4MW3 A;  4DR6 B;  2UUC O;  5IYZ A;  2Y4T A;  2KG7 A;  2GUZ A;  4HZ3 A;  4AHC A;  1VQN V;  1FS0 G;  4GLX A;  1HP8 A;  3E83 A;  3E22 A;  2HVK C;  3VOU A;  4DW1 A;  3BHP A;  3G4S V;  1FFX B;  3BRC A;  3HB3 B;  1NTZ H;  5KAI Z;  4BIO A;  2Q5Z A;  4WCE V;  4QPK A;  4ICG A;  4IT5 A;  2RMK B;  3E8F A;  1M57 B;  1OCO B;  2HVJ C;  2R70 A;  4DR4 O;  5JWP A;  5BMV B;  4B3M B;  2IJJ A;  2X0L A;  3OGC C;  5FPO A;  1CP9 A;  3GB7 C;  4DR4 B;  1I94 O;  1VF6 A;  4K8Z A;  4NXM B;  2Q67 A;  1HNZ O;  1GK9 A;  2HFE C;  4FZ1 A;  4IYI A;  1V55 B;  4PA4 A;  3ABK C;  4O2B B;  2RN9 A;  3AK2 A;  5H6R A;  1WP8 A;  1K97 A;  1J5E B;  1XNR B;  3D36 A;  2YIC A;  1S76 D;  1B04 A;  1XDC A;  1I5Y A;  1F51 A;  4J9Z B;  3G67 A;  1K5S A;  4FLW A;  1EM1 A;  2IU0 A;  2H8P C;  4NXM O;  2BSK B;  3JD4 A;  1OCZ B;  4NVP A;  1YEW A;  3ZMV A;  4X1K A;  1KD1 W;  4F6R A;  3ASO C;  1KKD A;  4PDR A;  2P90 A;  3DSQ A;  1NU1 H;  3I55 V;  2AW9 A;  2RNB A;  3KG2 A;  2QGN A;  3L75 H;  5KAF Z;  2VQF O;  2R9R B;  4TV9 A;  3AG3 B;  2XAH A;  2PI5 A;  3ABL C;  1XQ8 A;  4GKK O;  4O4L A;  1SQP H;  4TOI A;  5JVD A;  1TA8 A;  1XMQ O;  5C8Y A;  1RM1 C;  4J7J A;  1IVS A;  5CBF A;  3JAK A;  4JYA B;  5DN6 G;  4LF7 O;  2IU3 A;  1IDS A;  4BWA A;  1H38 A;  4EFB A;  2CGO A;  2Q9L A;  3N2K A;  5L3F A;  3IGA C;  4UCU A;  4DV0 B;  1OZ0 A;  3M7M X;  2ARH A;  4W4K A;  4XDL A;  4B3T B;  5LHG A;  1L1F A;  3JAM N;  1N33 B;  4DV4 O;  2DW4 A;  4FFB A;  4F4L A;  3FYI B;  1YI2 V;  2CDY A;  3IJ4 A;  4PDL A;  3J81 N;  3ZMU A;  2B5U A;  2YIA A;  5B66 Z;  1SS3 A;  3B8N A;  4Z1V A;  4U3J B;  4OX9 B;  3ZS8 C;  1J5E O;  3OD4 A;  3QF7 A;  3BA8 A;  4O4J A;  4DR1 B;  1IBK O;  3E86 A;  2OCC C;  1IXB A;  2ZQM A;  3MD0 A;  4X8A A;  2Y4U A;  4LF8 O;  3JD3 A;  1SC5 B;  5IJ9 A;  5EBM C;  4DV3 B;  3X2Q B;  2JS3 A;  1MG1 A;  1GM7 A;  1M9N A;  3WB1 A;  1SA0 A;  3CSX A;  1FXK B;  3OR6 C;  1LUW A;  4K35 A;  4NB5 A;  3RYI B;  4CS2 A;  2WLM A;  2M7W A;  3CRM A;  4UVA A;  3S3X A;  4JI4 B;  2ILM A;  3CE2 A;  1S3J A;  4B3R O;  2OWO A;  3L9D A;  3STL C;  2P67 A;  1Z5V A;  4DV3 O;  1FXK C;  3RVY A;  1H8H G;  1L0N H;  4FPP A;  2UXC O;  4AQY B;  1RP3 B;  5FPR A;  1WB7 A;  1BMF G;  2BCC H;  5KHG A;  1S5L Z;  3DXR B;  3H1L H;  3H1J H;  4GYC B;  4X62 O;  3T1H B;  3AG1 C;  1XI1 A;  5JQG A;  3D3Q A;  3TK1 A;  1QVF U;  3G6B A;  3LSQ A;  2V7Q G;  1I5X A;  4GZR B;  3AG7 A;  3K0G A;  2EIN C;  2MK3 A;  2WLN A;  3LDE A;  4GUN A;  2WWW A;  2WLI B;  3ZMS A;  2ZDI A;  3PJS K;  3F5W C;  1YXB A;  3RYF A;  5L3G A;  4LF4 O;  3RYF B;  3ABK B;  1K7D A;  5BXZ A;  4I50 A;  3J7A U;  4LFB O;  3FAV B;  1TVK A;  4DR3 O;  3A0H Z;  5DED A;  2E74 B;  2ZDI C;  1FPO A;  1PNL A;  4JI2 O;  4DRX A;  1AI5 A;  5FLX N;  4JYB A;  1JA8 A;  3OTO O;  2QE7 G;  4R8C A;  4WFE A;  5H6Q A;  5CA0 B;  3RW0 A;  3OAA G;  4K0K O;  4LFB B;  1L8D A;  5DM6 V;  4NXN B;  4B3R B;  1VEW A;  4IL6 Z;  5H9C A;  1EN4 A;  4WFH A;  1H2K A;  1N32 O;  4MTX A;  1ZUQ A;  3DTU B;  2IJI A;  4G2K A;  2OIG A;  4B3S B;  2R9I A;  2FKX A;  4YIP A;  2XAG A;  1ZTE A;  4WFB V;  4FLT A;  4LFC O;  1O9G A;  1I0H A;  1F4N A;  4I9W A;  3R66 A;  4MVR A;  1HR0 B;  5LYJ A;  5CA1 A;  5GTI Z;  5KMG A;  3HKB B;  1VAR A;  3E89 A;  4YY3 O;  3JYC A;  2YI9 A;  4J10 A;  4J7K A;  2VQE B;  4O4J B;  3CCQ V;  2ITC C;  5IYZ B;  4YY3 B;  1AI4 A;  1VQO V;  3UM7 A;  4MTF A;  3ASO B;  4KFM A;  2DOS A;  5B3S B;  1NI8 A;  2IJK A;  4ZIB A;  3W7W A;  5EZY A;  1SRY A;  3BEH A;  2ZKO A;  4DV1 O;  1PKX A;  1I08 A;  1R3I C;  1WPX A;  3K03 A;  2QKC A;  4TV9 B;  2E3C A;  4BW9 A;  1FFT B;  3WG7 C;  1GAX A;  4RUE A;  1IBL B;  3B2E E;  2UXD B;  4TUY A;  3SPJ A;  1QQC A;  2HLD G;  2UXB O;  2WLL A;  1VQL V;  3JSN A;  4C7U A;  1W0J G;  2RQ6 A;  2P06 A;  2BSK A;  1N8R W;  3MHH C;  3IC9 A;  4JAA A;  3J80 N;  4MTG A;  3N2G B;  2VQE O;  1IBM B;  3LNN A;  2W6I G;  5LL6 Y;  2QEX V;  4EEQ A;  4YJ2 A;  1XL6 A;  2Q69 A;  4FK5 C;  3VQV A;  2AGA A;  1AR1 B;  1N36 B;  1JFF A;  2YIB A;  1K92 A;  4J9Y B;  2CTW A;  1VP7 A;  4EB6 A;  4ASU G;  4DV2 B;  4MVO A;  1R6N A;  4CH4 A;  1N0J A;  1YSC A;  4K8X A;  1R1B A;  1VQM V;  4EFE A;  3ZRV A;  1I94 B;  3JD0 A;  1DLB A;  2WA3 A;  1TUE B;  2UUB O;  4MVQ A;  3JAR B;  5IT9 N;  3JAS A;  2F43 G;  1EFR G;  2ETN A;  1P7B A;  2HEP A;  2YXL A;  4L8J A;  1NKD A;  1VMG A;  2ZXW B;  2DWD C;  1SA0 B;  1NQT A;  1F7Y A;  1UPG A;  2EIJ B;  3K58 A;  3K9S A;  2DN9 A;  2G38 A;  4FLZ A;  1BL8 A;  1FD9 A;  3E2E A;  5CA0 A;  4O4H B;  3SYO A;  1AR4 A;  1XUQ A;  1EZV H;  4OX9 O;  1XHX A;  3OTO B;  1NVP D;  1NH2 B;  1SKV A;  1MMM A;  2IM9 A;  2VS0 A;  4H37 A;  1NTM H;  3ZHS A;  1PV0 A;  3OMI B;  3B77 A;  3FB5 C;  5EC2 C;  4JI5 B;  4X1I B;  4LNU A;  3BPZ A;  3AG2 B;  2H3O A;  4Z1M G;  4CH6 A;  4X62 B;  2FL4 A;  3N2K B;  3CCR V;  3RVZ A;  2Q68 A;  2YIB D;  1RM1 B;  1AJN A;  4TQD A;  1MOF A;  2Q8V A;  1K4C C;  3T4Z A;  4GX2 A;  2XND G;  4QIW F;  3JAT B;  5J2U B;  2CH7 A;  1GTO A;  3RBZ A;  4FLX A;  1D2D A;  4DUZ O;  2ZD9 A;  5HFM A;  5JJJ B;  1N33 O;  3LSS A;  1GN3 A;  2QKS A;  3DXR A;  2X6B A;  3FX7 A;  1TAE A;  3WG7 B;  1R6T A;  4W4L A;  1W2B U;  3SPG A;  1PL4 A;  2ZE5 A;  2HHH O;  4WFG A;  2FYU H;  4AIL C;  3C3S A;  4LF4 B;  4JV5 B;  2IJH A;  4NTX A;  2CTR A;  4LBE C;  3K57 A;  1HNW O;  2Z3Y A;  1G6U A;  2HJF C;  2YC0 A;  2BTQ A;  3ZIA G;  1Y6X A;  3OR7 C;  4PA3 A;  1WPB A;  2ZNJ A;  5EBL C;  3ABU A;  2UXX A;  4UV9 A;  1PM9 A;  3THO A;  3JAW B;  3TGU H;  3ZED A;  3K5O A;  3FFQ A;  4O2B A;  1Y76 B;  1JVM A;  2JK5 C;  2DYR B;  1VQ4 V;  2XOK G;  4MW8 A;  2IH1 C;  4QE9 A;  3SJC C;  4CC5 A;  2BOB C;  4JI7 O;  3F5T A;  3ZHV A;  4I55 B;  3RFR A;  3ETG A;  1RSO A;  4MS2 A;  3ZHU A;  1S0V A;  2UXD O;  3WB0 A;  4FM1 A;  2PZS A;  2D3O W;  5KX5 A;  1F23 A;  1DF4 A;  1HNZ B;  1HDJ A;  5IY5 C;  1B6Q A;  3P3N A;  1NTK H;  1HNW B;  3R65 A;  3AK1 A;  2AZ2 A;  4DK0 A;  4N23 A;  1H2M A;  3T1H O;  1S5H C;  2KKW A;  5LP6 C;  4LF5 B;  4NR1 A;  2P6J A;  2QWN B;  4XBF A;  4I55 A;  3ZMT A;  3UT5 A;  3ETD A;  4FVM A;  1HWY A;  2LGQ A;  2PY5 A;  2EJR A;  3HKE B;  3CXC U;  4JAV A;  4DV6 B;  4DR2 O;  4UXN A;  3FYE B;  3ABM B;  3B4S A;  4JTC B;  3A2F A;  2DE0 X;  3K79 A;  3ZBH A;  5IDJ A;  5JJN B;  1MAB G;  5L3D A;  1IUR A;  1ZLZ A;  1Y67 A;  4UVB A;  1KEC A;  1KP2 A;  3ABM C;  1IZ3 A;  2ZR2 A;  4RUF A;  2ZE8 A;  1BZK A;  2N74 A;  3UT5 B;  1JJ2 U;  1EZJ A;  2V1D A;  3CD6 V;  3BAA A;  5L3E A;  2OYQ A;  2PI4 A;  3W7X A;  3SYP A;  1N36 O;  3ICX A;  2KB1 A;  3OTF A;  2F4V B;  2QWO B;  3CJH B;  4U7N A;  1YHQ V;  4WFF A;  2E75 B;  1Y74 B;  2UU9 O;  2Y0I A;  3T1C A;  1MZF A;  5EYP B;  2MW2 B;  2Q0A A;  2ZR3 A;  1YZB A;  3K04 A;  2UXC B;  2QDO A;  3BVO A;  3ZMZ A;  2EIK C;  3OT7 A;  4OPH A;  4HNA A;  4JI0 O;  1XMQ B;  4YJ3 B;  5HFL A;  4ZOL B;  2QM7 A;  3H01 A;  3KZI Z;  1S77 D;  4DUY O;  3L71 H;  1SF9 A;  1PNK A;  4J7Z A;  1H2G A;  2WSS G;  3FKS G;  3AG4 C;  2JGD B;  4GX0 A;  3JSL A;  4JI1 O;  1JOY A;  1BT8 A;  2IH3 C;  3ZN1 A;  4QNH B;  4DR6 O;  4DV4 B;  2LW7 A;  4UCV A;  4U7O A;  1GRJ A;  3LDC A;  2AHY A;  3CXH F;  3CC4 V;  4B3S O;  5LXT B;  2LFS A;  3FB6 C;  3AG4 B;  2VRZ A;  1VQ5 V;  4QPJ A;  5EIB C;  2F93 B;  1EN6 A;  5B1A B;  2RJZ A;  4X1Y B;  4IYH A;  1KP3 A;  3ETQ A;  1R6K A;  4LR3 A;  3S3W A;  5BZB A;  1RPR A;  1SES A;  4JI2 B;  1W0K G;  3P30 A;  2CTP A;  3G71 V;  2CK3 G;  3JD2 A;  1ZWI C;  4NTW A;  3T2M A;  3CS5 A;  3RYC B;  3FD9 A;  2YDE A;  4MVZ A;  5IJ0 B;  1QBZ A;  4QGP A;  2WLL B;  1AVM A;  2GBO A;  4LWS B;  4DR7 O;  2JEX A;  1VF6 C;  2A3Q A;  1FKA O;  2QM8 A;  3Q4H A;  2GHY A;  1BSM A;  1SQB H;  2N05 A;  3K59 A;  1KUQ A;  4HBN A;  1AI6 A;  2C2A A;  2AXT Z;  4LF6 B;  1D5N A;  4EB6 B;  4JPR A;  1KQS U;  1L0L H;  1QU7 A;  2Q7G A;  4FLV A;  1SET A;  4PI2 A;  1Y4M A;  5F2V O;  4CH5 A;  3APQ A;  4LFC B;  3SYQ A;  1GN6 A;  4DV5 O;  4KXR A;  2X6C A;  4JI8 O;  3HKC B;  4X1K B;  1VQ6 V;  2PF4 E;  4PDM A;  5EIB D;  3CCL V;  3QO5 A;  1AJP A;  4RO2 A;  1VF5 B;  4JI6 O;  1R3K C;  2NNU A;  1Q82 W;  4O4H A;  4J42 A;  5LYJ B;  2F95 B;  1FJG B;  3LNM B;  3K3W A;  5CMU A;  5EBW C;  1CEZ A;  5D5P A;  4LFA B;  4KHP O;  3SDL A;  4JI1 B;  3SPC A;  3E8B A;  3EVK A;  4RQF A;  4G28 B;  1WLE A;  4JTA B;  2P7T C;  3CMA V;  2JGD A;  3QVN A;  3N27 A;  4JF3 A;  2LO1 A;  2P5O A;  5J2T A;  2Y48 A;  4AQY O;  3L72 H;  3E22 B;  4JI3 B;  3ZRX A;  5H5N A;  3CYO A;  4LP8 A;  5FNV B;  4FLY A;  4JI8 B;  1OV9 A;  4A5U B;  2FB5 A;  2UUA B;  3ZRW A;  5BR8 B;  4PJ0 Z;  4DRX B;  3CCM V;  3CJH A;  1ZSP A;  1FJG O;  4BAY A;  2QTS A;  1RSO B;  1ZAU A;  3EXA A;  2Q7H A;  1SQQ H;  1ROP A;  2QJ1 A;  3OUS A;  1EN5 A;  3ASN B;  2ATK C;  2GUZ B;  3SJQ C;  4UCS A;  2CTQ A;  3M99 B;  2BE3 A;  4UFZ A;  3DC5 A;  5CN0 A;  3LDD A;  2XAQ A;  1XL4 A;  4F6E A;  3UQ8 A;  1J95 A;  4I4T A;  1Q3E A;  3SGI A;  2Q4P A;  3OW2 U;  1DK1 A;  1FAF A;  2ZM6 O;  1U96 A;  2OT5 A;  5LGU A;  2ODM A;  2P4K A;  4JI4 O;  3HKE A;  2ZM6 B;  3KCX A;  3ZCC A;  5ITZ A;  4R7C A;  4P9P A;  4KUM A;  1LR1 A;  3QTC A;  5LA6 A;  4IHJ B;  4B08 A;  1HNX B;  1QLE B;  2HG5 C;  1K3E A;  2HJD A;  1QLN A;  1RPO A;  3Q4H B;  1NR1 A;  2P22 C;  5LBQ A;  4JGS A;  4LWS A;  3RWR D;  4LF8 B;  3BCC H;  4FFK A;  1D5A A;  3OE7 G;  4ZBM A;  1K5Q A;  2H94 A;  2YI8 A;  1Z5W A;  4O4I A;  2JDI G;  3SJA C;  3VQX A;  5EC1 C;  3ZHT A;  5CA3 A;  4DW0 A;  4B7K A;  2E5L O;  4YIO A;  1NR7 A;  3OEE G;  3ZHQ A;  2F4V O;  5GON A;  4TT3 G;  4D7T A;  5DEC A;  2EIN B;  4DYL A;  4PA6 A;  2JVD A;  1BGY H;  3X2Q C;  2EIL B;  1KB9 F;  1COW G;  1YJN V;  3O9O A;  1HR0 O;  1G8M A;  4J11 A; 
#chains in the Genus database with same CATH homology
 4LBE C;  1YTF B;  2Z3Y A;  4PDR A;  2HJF C;  2P90 A;  4R6Z A;  5B1B B;  2QA4 V;  3CCU V;  3ZIA G;  3E8H A;  3I55 V;  3OR7 C;  4PA3 A;  3KG2 A;  2DWE C;  5EBL C;  3ABU A;  2UXX A;  4UV9 A;  3STZ C;  2R9R B;  3QNE A;  3AG3 B;  2XAH A;  2PI5 A;  3CPW U;  3ABL C;  1K33 A;  3K06 A;  4FIP C;  1AI7 A;  3OMA B;  1NJI W;  3D3I A;  5E1A C;  1RM1 C;  1JVM A;  2JK5 C;  2DYR B;  1VQ4 V;  2EIL C;  2XOK G;  4MW8 A;  2IH1 C;  4QE9 A;  5L3B A;  4PDV A;  5CBF A;  3EFF K;  2BOB C;  1M57 C;  1OCO C;  3DGE A;  4MTO A;  2WLK A;  5DN6 G;  2IU3 A;  1H38 A;  3ETG A;  2UXN A;  4MS2 A;  1S0V A;  5L3F A;  3IGA C;  3VBB A;  2D3O W;  4XDL A;  3BY6 A;  4WF9 V;  3F7V C;  5IYB O;  1L1F A;  4XDJ A;  3AG3 C;  5LHG A;  3CME V;  1F23 A;  1DF4 A;  4LCU C;  1PD3 A;  1FXV A;  5IY5 C;  2QTO A;  3AEI A;  1F4M A;  1B6Q A;  2DW4 A;  2HR3 A;  4F4L A;  3R65 A;  3FYI B;  1YI2 V;  4PDL A;  3SYC A;  3ZMU A;  4Q20 A;  2B5U A;  1BHB A;  2XAF A;  2EBO A;  2YEV A;  1VQP V;  3B8N A;  4N23 A;  1QVG U;  4X88 A;  3OMN B;  3T4D A;  1S5H C;  1EBO A;  3E86 A;  1Q7Y W;  2OCC C;  3WFV A;  2P6J A;  4XBF A;  2ZQM A;  3MD0 A;  4X8A A;  2X6A A;  1VQ7 V;  3ZMT A;  3JD3 A;  3ETD A;  4MSW C;  1E79 G;  4L87 A;  1HWY A;  1NVP B;  3A0R A;  1OCR C;  2EJR A;  4OXS A;  5EBM C;  3X2Q B;  4JAV A;  3CXC U;  2LFR A;  3E35 A;  1MG1 A;  1GM7 A;  2BOC C;  4RQE A;  1M9N A;  2JJ1 G;  3LUT B;  4UXN A;  3FYE B;  1FXK B;  3ABM B;  4JTC B;  2W6J G;  3OR6 C;  4GX5 A;  3K79 A;  4MVU A;  4PA9 A;  4JYC A;  1R73 A;  2WLM A;  4UV8 A;  3SYA A;  5IDJ A;  1AJQ A;  2M7W A;  3ZRW B;  5L3C A;  4HYO A;  1MAB G;  4UVA A;  3JCZ A;  1K73 W;  2XAS A;  5L3D A;  4YXW G;  1S3J A;  2EIM C;  3HPL C;  3STL C;  4QJF B;  5KUM A;  4CZZ A;  2P67 A;  1K8A W;  4UVB A;  1KEC A;  1KP2 A;  1FXK C;  3ABM C;  3RVY A;  1H8H G;  2ZR2 A;  4FPP A;  4RUF A;  5IY5 B;  4TSF G;  5KA6 A;  1JJ2 U;  1EZJ A;  2V1D A;  1DF5 A;  3CD6 V;  5L3E A;  1QR9 A;  3MHS C;  2DQ0 A;  1BMF G;  2A0L A;  2WAM A;  3CP1 A;  4P9O A;  2PI4 A;  3W7X A;  3SYP A;  2WLH A;  2KB1 A;  3AG1 C;  1GM8 A;  4U7N A;  3TK1 A;  1YHQ V;  1QVF U;  4WFF A;  1KKD A;  3LSQ A;  3CCJ V;  2V7Q G;  1I5X A;  1M90 W;  3K0G A;  3B8M A;  3T1C A;  2EIN C;  2MK3 A;  1ENV A;  2WLN A;  3LDE A;  1P4R A;  3FB8 C;  4FJC C;  2ZR3 A;  3K04 A;  5B1O A;  2WWW A;  2WLI B;  2EIK C;  3ZMZ A;  4R50 A;  2GSM B;  3ZMS A;  1KC8 W;  2ZDI A;  3PJS K;  2A9H A;  3F5W C;  2HKO A;  2K1E A;  1GO3 F;  1OHH G;  2W0F C;  2Y69 B;  5L3G A;  3ABK B;  5LGT A;  1M1K W;  1K7D A;  2A79 B;  3TCU A;  5HFL A;  2OTL V;  2IW5 A;  2QM7 A;  3ABT A;  2JIZ G;  3H01 A;  4XDK A;  3IC7 A;  5B3S C;  1M56 C;  1YIT V;  4P2Z A;  1S77 D;  3CCV V;  4FMT A;  4TWK A;  5EK0 A;  5GW7 A;  1PNK A;  5IYD O;  3W7T A;  1H2G A;  2WSS G;  1G4Y B;  2EZO A;  3AG4 C;  3FKS G;  4E2L A;  2Y69 C;  2EIM B;  4EKW A;  1VQ9 V;  4GX0 A;  1JOY A;  2ZDI C;  1THZ A;  4MVS A;  1PNL A;  2IH3 C;  3ZN1 A;  5CBH A;  4QNH B;  2JEU A;  5KA5 A;  1MSW D;  4U7O A;  1AI5 A;  2B1I A;  1E1R G;  2AHY A;  3LDC A;  4JYB A;  3CC4 V;  2QE7 G;  4R8C A;  4WFE A;  5H6Q A;  1V54 C;  1LNQ A;  4LC1 A;  4QE7 A;  3ZRS A;  3K08 A;  4N21 A;  3RW0 A;  1QLE C;  2LFS A;  3FB6 C;  3OAA G;  3AG4 B;  1VQ5 V;  5DM6 V;  1ORQ C;  3ML0 A;  4QPJ A;  5B1A B;  3ZN0 A;  4PEL A;  4RAI A;  2WLI A;  2DQ3 A;  1OCC B;  1KP3 A;  1R6K A;  5H9C A;  1IXM A;  4HAM A;  1NBM G;  2LP7 A;  4WFH A;  5BZB A;  1RPR A;  1M56 B;  1SES A;  2IJI A;  1W0K G;  3DTU B;  3P30 A;  4MTX A;  3G71 V;  2CK3 G;  3JD2 A;  4G2K A;  1ZWI C;  4BIU A;  2R9I A;  2YEV B;  4CBC A;  4DXW A;  2XAG A;  1GMG A;  3T2M A;  4MVM A;  4WFB V;  1K34 A;  1OCC C;  1R3L C;  4MVZ A;  1F4N A;  1QBZ A;  4I9W A;  4MVR A;  2B1G A;  5C93 A;  2WLL B;  4JTD B;  1Y66 A;  3W7U A;  3EHB B;  2JEX A;  5LGN A;  3E89 A;  1SZT A;  2OTJ V;  3JYC A;  2QM8 A;  2GHY A;  3CCQ V;  2ITC C;  1K9M W;  5B1N A;  1AI4 A;  1VQO V;  3UM7 A;  4P30 A;  3CCS V;  1AI6 A;  3OEH G;  5FL7 G;  2C2A A;  4MTF A;  3ASO B;  4KFM A;  5B3S B;  2IJK A;  2ITD C;  4JPR A;  1KQS U;  1GM9 A;  3W7W A;  3K9A A;  1SRY A;  2EIJ C;  3ZJZ A;  3BEH A;  1SET A;  2WLJ A;  1PKX A;  3NXS A;  4KP4 A;  1Y4M A;  1R3I C;  1WPX A;  3K03 A;  2OCC B;  3SYQ A;  3CCE V;  1SER A;  1FFT B;  1R3J C;  3WG7 C;  1VQK V;  2X6C A;  2WPD G;  1QCE A;  1VQ6 V;  4RUE A;  2X7R B;  2Z5U A;  4PDM A;  1K4D C;  3CCL V;  3QO5 A;  1AJP A;  4RO2 A;  1VQ8 V;  1R3K C;  2NNU A;  3SPJ A;  1Q82 W;  2HLD G;  3CC2 V;  4BW5 A;  2WLL A;  1QR8 A;  3OM3 B;  1VQL V;  3LNM B;  3K3W A;  5CMU A;  5EBW C;  1CEZ A;  1W0J G;  3AG1 B;  4X89 A;  4GX1 A;  1N8R W;  3MHH C;  3TET A;  1Q86 W;  3ASN C;  4MTG A;  1OCZ C;  3SPC A;  2W6I G;  3E8B A;  5B1B C;  4RQF A;  4G28 B;  4WFA V;  1WLE A;  4JTA B;  2QEX V;  2P7T C;  3CMA V;  3SPI A;  1XL6 A;  4JAS A;  1BHA A;  2XAJ A;  2Q69 A;  3AG2 C;  1UJW B;  4FK5 C;  1AR1 B;  4JF3 A;  3K0D A;  1K92 A;  4J9Y B;  4ASU G;  2DYS C;  3E8G A;  4MVO A;  2Y48 A;  1PL0 A;  5KUK A;  1R6N A;  2ZXW C;  1YSC A;  2EZP A;  2FTK A;  5J9P C;  1FXH A;  1VQM V;  3IFX A;  2EIK B;  3ZRX A;  1NH2 D;  3ZRV A;  3CYO A;  3JD0 A;  1DLB A;  1TUE B;  1YIJ V;  1ARO P;  4MVQ A;  4LP8 A;  1YTF D;  3OFN G;  1V55 C;  1V54 B;  1H8E G;  2F43 G;  3CC7 V;  5LHH A;  4JAU A;  3I56 V;  1EFR G;  1E1Q G;  3ZRW A;  4BIZ A;  5CBG A;  3CCM V;  1P7B A;  2DYS B;  3JD1 A;  1NKD A;  2YSU B;  2ZXW B;  2DWD C;  3FB7 C;  4BAY A;  4MW3 A;  1CPY A;  1JPX A;  1NQT A;  2EIJ B;  1ROP A;  3OUS A;  3OUF A;  3P32 A;  3QO7 A;  3ASN B;  1BL8 A;  3F7Y C;  4I5S A;  2ATK C;  4HZ3 A;  1VQN V;  1YJ9 V;  1FS0 G;  1Q81 W;  3SJQ C;  3E2E A;  3M99 B;  3E83 A;  4GT1 A;  3QO8 A;  4UUJ C;  2HVK C;  3SYO A;  1GKF A;  5CN0 A;  3VOU A;  4ZKI A;  3G4S V;  3GWO A;  5IYC O;  1PNM A;  3LDD A;  2XAQ A;  4H33 A;  3G6E V;  1NVP D;  1NH2 B;  1XL4 A;  3HB3 B;  2Q6A A;  4H37 A;  1J95 A;  3OMI B;  3OW2 U;  3B77 A;  3FB5 C;  4PA7 A;  5EC2 C;  4UVC A;  2OT5 A;  5LGU A;  4WCE V;  4QPK A;  3AG2 B;  1FXK A;  4Z1M G;  3ZCC A;  3E8F A;  1M57 B;  1OCO B;  2HVJ C;  4R7C A;  4P9P A;  4KUM A;  2DYR C;  3CCR V;  1S72 V;  2NLJ C;  2IJJ A;  3RVZ A;  2X0L A;  3SPH A;  3OGC C;  1OCR B;  2Q68 A;  1QLE B;  2HG5 C;  1RM1 B;  1AJN A;  1CP9 A;  3GB7 C;  1K3E A;  1QLN A;  1MOF A;  1RPO A;  4G27 B;  1NR1 A;  5B1A C;  2Q67 A;  1K4C C;  3T4Z A;  4GX2 A;  2AHZ A;  5LBQ A;  2XND G;  4QIW F;  1GK9 A;  2HFE C;  1DTO A;  4GCZ A;  4JGS A;  3ABL B;  1JQ0 A;  1V55 B;  4PA4 A;  3ABK C;  1GTO A;  3RBZ A;  4DO2 A;  3OE7 G;  4MT8 A;  4ZBM A;  2ZD9 A;  5H6R A;  1K5Q A;  2H94 A;  2JDI G;  5HFM A;  1K97 A;  5EC1 C;  3D36 A;  3ETE A;  3LSS A;  1S76 D;  5CA3 A;  3UKM A;  2QKS A;  5LHI A;  1JCH A;  1I5Y A;  1NR7 A;  1F51 A;  4J9Z B;  3OEE G;  2X6B A;  1YJW V;  3WG7 B;  4TT3 G;  1K5S A;  1W2B U;  2IU0 A;  2H8P C;  3SPG A;  2EIN B;  2JJ2 G;  3JD4 A;  1OCZ B;  4PA6 A;  3W7S A;  1JX9 A;  3X2Q C;  2EIL B;  4WFG A;  1G8M A;  3ZMV A;  1KD1 W;  1COW G;  1YJN V;  3ASO C;  2IJH A;  1OZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...