2ZDIC

Crystal structure of prefoldin from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
148
Chain Sequence
MAQNNKELEKLAYEYQVLQAQAQILAQNLELLNLAKAEVQTVRETLENLKKIEEEKPEILVPIGAGSFLKGVIVDKNNAIVSVGSGYAVERSIDEAISFLEKRLKEYDEAIKKTQGALAELEKRIGEVARKAQEVQQKQSMTSFKVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin subunit beta
publication title Structure and molecular dynamics simulation of archaeal prefoldin: the molecular mechanism for binding and recognition of nonnative substrate proteins
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Chaperone
total genus 33
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02996 Prefoldin Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zdiC00
1FXKC 2ZDIC 1FXKA 2ZQMA 2ZDIA 3AEIA 1FXKB
chains in the Genus database with same CATH superfamily
1SQGA 1VF5B 3E86A 3TXQA 4MS2A 4R8CA 4JI4B 1IXMA 3JASA 3WU2Z 1IBKO 4I9QA 4I7ZB 3ETEA 1CPYA 4MTGA 1K92A 2EILB 2Q9LA 5L3BA 3A8TA 3ICXA 3SPIA 2ZE6A 4GLXA 4XDLA 2LFSA 4DV4B 2ADQB 3K08A 4X66O 1NTKH 1KD1W 1JVMA 4MTOA 3WG7B 2HHHO 2DW4A 4DYLA 2ZIMA 5L3EA 2ZM6B 1WLEA 3CWBH 2P4VA 5FLXN 4FJCC 2WLMA 1BHBA 4LNUB 4J80A 3UT5B 5GTHZ 4DRXA 3L74H 4TUYB 4E4EA 4MT8A 1K4DC 2IJKA 3E89A 2WAMA 5H6QA 4X62B 5KHIA 1AI7A 2WLIB 3T4DA 3AK1A 5LGNA 2ZXWC 1QBZA 5K1XA 2JJ2G 5HFLA 3RYCA 4DV6O 5EZYB 4CS4A 3OUFA 2X0LA 1H2MA 1K9MW 3Q4HA 5LYJB 3OM3B 4NTXA 4MW8A 4G2KA 4LCUC 1Z5WA 3AG2C 2IM9A 3LNNA 2YI9A 1IBLO 3PJSK 1KKDA 5L3CA 5DN6G 4GKKB 3T1HO 2CGNA 5KAFZ 1Y76A 1SRYA 4UCOA 3VQXA 5IYCO 1AI6A 2JGDB 2F93B 3CRMA 2IBZH 3K5OA 5B1AB 2F43G 1P84F 1G6UA 4WFEA 3H1KH 4YHHO 1XILA 1DF4A 4TT3G 2JK5C 2ZE7A 1FXKB 3HKDA 1M1KW 4O4JB 4O4HA 4CC5A 4LF8O 4LFBO 3JD4A 5BXZA 4Z1VA 1IBKB 3IAYA 4HYOA 1V55B 3LSSA 4JTCB 4AI8A 2HJDA 4L87A 4LP8A 3BAAA 1R6NA 3AK2A 2EIMC 4UFZA 2LJ2A 4PDRA 3ABMC 5LHGA 1XL6A 1IDSA 2FYUH 2GBOA 1XMOO 2YI8A 4FZ0A 3SYOA 2UXCB 3I55V 1GM8A 4X66B 1ROPA 5FL7G 3C3TA 1J5EO 3QG5A 3TETA 2ADPA 3HKBA 1I08A 4EFEA 1S5JA 2HHHB 1HNWB 1O9GA 1R73A 2Q5ZA 4HNAB 2LO1A 1QLEC 3SYAA 3CEIA 1JCHA 4EFBA 2PUSA 2P06A 5L3GA 4GUNA 5IYZA 1ENVA 1W0KG 1LUVA 1AJNA 3G80A 1MG1A 2M6YA 1SZTA 3HKCA 2XTAA 4XDJA 5BZBA 2H3OA 4QJFB 3P3PA 1AP6A 3UT5A 3ABKB 5B3SC 1URFA 1LNQA 4ZI7B 3E8GA 4TUYA 1NI8A 4MTXA 5B1BB 1TVKB 2HVJC 4DV6B 3K03A 3CC4V 4QNHB 2JIZG 1OCZC 3MAQA 3QVNA 1AP5A 4Z2WA 1SQXH 1V54C 5CA1B 2ETNA 2A3QA 2WLIA 3OGIB 2ZNJA 3OTOO 1IBLB 1ORQC 1BHAA 3RYIB 2XT9A 4NXMO 2ITDC 3CCMV 1JJ2U 5EZYA 3T1HB 1US6A 4CH3A 3K06A 3GVMA 3E35A 4BIZA 5LYJA 3HR0A 1I94B 3LDDA 1L0NH 1HDJA 4I50B 2KQXA 1D2DA 5LMUO 4MVQA 2ZQMA 3ZRVA 3F7VC 2DMXA 2UUBO 1F23A 3G67A 3T1YO 4NYKA 4OX9O 1OCCC 2CGOA 4YHHB 4KP4A 1B6QA 4DV2O 4C7UA 1X4TA 4LF8B 4LFBB 2IJIA 4FZ1A 4MSWC 3KG2A 1KECA 4D7TA 5KLVH 3STZC 2JGDA 2XOKG 2JVDA 2O57A 4B3MO 1BGYH 4DR4O 2E74B 3MDSA 2PYLA 5BMVB 3WFVA 4N21A 2N05A 1XL4A 1B3QA 1SA0B 4O4JA 4WFHA 1MMMA 2Y69C 2WSSG 3G71V 3VQWA 1SETA 2Y4TA 5F2VO 2DYSC 5EBMC 1J5EB 2XAGA 1K34A 1AJPA 1YDXA 5A2QN 3D3IA 1FYJA 1M56B 1U97A 1RSOA 3MHSC 3CS5A 1WP7A 3RWRD 4MVMA 1F51A 1Q5OA 2KKWA 2EIKB 3IGAC 4FLYA 2WLLB 4AQYO 3SJQC 3IFXA 2XASA 2JGUA 2DE0X 2WLKA 2PI5A 4BIUA 3BA8A 1HWYA 2CTWA 3N2KB 3APOA 4X1KA 4UCSA 4YJ3B 4FFBB 2V4DA 3UCSC 1MSDA 2QSAA 4FMTA 3K9AA 4R50A 1TUBA 2Z0AA 1TA8A 2X6BA 2EX3A 5CA0B 2AHZA 5EK0A 3I5DA 2R9RB 5K1PA 3AG1C 4YY3O 4LR3A 3G4SV 4N23A 1K5QA 3OTOB 3U0ZA 2Q4PA 4QE7A 4ZI7A 4NXMB 2EIJC 4B3RO 1TVKA 1VQ7V 5J9PC 2A7WA 2CDYA 3JAWA 2VWJA 1SESA 4ZBMA 3N2GB 3RN4A 4WFBV 3CXHF 1UFIA 4DV5O 1WA8B 3ZMUA 4DV0O 1P4RA 5LMUB 3ZN1A 4RQEA 2UUBB 1PL0A 4OX9B 3TJTA 4J11A 3OD4A 1L0LH 4PV1B 4DV2B 1BSMA 3NXSA 2LFRA 1XI1A 1X59A 1YJ9V 3X2QB 5A9GA 4B3MB 4DR4B 5BR8O 5CB4A 3ZMSA 2R9IA 4FLVA 2W0XA 3TK1A 4UVAA 3JASB 3JSLA 1FFTB 4H44B 1PD3A 4KXRA 5IY5B 5KHKA 3CCJV 1PNKA 5LP6A 3A0RA 3CD6V 1S5LZ 5EC1C 4UXNA 5IWAO 3ZJZA 5IYDO 1SA0A 3STLC 3IC9A 2BTQB 3ZS8C 1HNZO 3ABLC 1VQKV 2ZXWB 4IGGA 2XNDG 5IJ0B 3QF7A 2IW5A 4AQYB 4JI2O 2YXYA 2X7RB 3L73H 4FLXA 3J7AU 2F1MA 1BMFG 3LSQA 2QR4A 1SKVA 4WF9V 4X20B 1PP9H 2QM7A 2QM4A 5LHHA 5EYPA 1QU7A 3JD2A 2CTQA 2E3CA 1ZL8A 1JFFB 2WLLA 1VQ4V 2JS5A 4X1YB 2BSKB 3AG4C 1JR9A 5CA3A 4LH6A 3EVKA 3F5WC 2CAZC 4DW0A 5LA6A 4YY3B 4JI6O 1AI5A 4YJ3A 1PNMA 4FFBA 3CE2A 3R66A 3RYCB 4B3RB 1YIJV 5LGUA 4O4IB 3PN1A 2GDSA 1WPXA 4DV5B 3ML0A 2K1EA 4DV0B 5IDJA 1N36O 4K3AA 2HVKC 2NN4A 4CH4A 2UU9O 3OR6C 3DTUB 2EJRA 2YUAA 3N2GA 5B1NA 1EN6A 1EN5A 2QM8A 3TXSA 3ABMB 1S77D 4GX5A 1NBMG 1ZSPA 1ZTEA 1NVPB 2G38A 5L3DA 5BR8B 4OGQB 1NU1H 4PA3A 2LGWA 4NTWA 1O9HA 1KKCA 1IVSA 5E1AC 4PDVA 1A32A 4TV9B 3SDLA 2R72A 2OCHA 3ZHVA 1NTMH 4YJ2B 2GHYA 5BY1A 5IWAB 1QCEA 2ZDIC 3CCLV 2HP8A 3KCXA 2QDOA 4GX0A 1QR8A 1GM9A 4JAAA 4I4TB 2Q8VA 1HNZB 5KUMA 1DGSA 3HKBB 4CS3A 1M93A 3SYPA 5B3SB 4XDKA 2OYQA 1G1XB 4JI2B 1KQSU 1NQTA 4PA6A 1OCZB 4R6ZA 2DYRC 1VF6C 4RUEA 4DV1B 1MABG 4J7KA 1DK1A 2UXCO 3ASOB 2BTQA 4F4LA 1V54B 1VIBA 5IYZB 3MD0A 4MW3A 1GAXA 1DF5A 1BQ0A 2NLJC 5C8YB 4DO2A 5IJ0A 2E75B 3E8HA 1HNWO 1NH2D 3HKCB 1H38A 5J2TB 4X20A 1KP3A 1OCRC 4P9PA 4JI6B 1UJWB 2UXBO 3IJ4A 2DQ3A 3RFRA 4GX2A 1JFFA 4X1YA 3SPHA 1IXBA 1VQNV 2BCCH 2BSKA 3QNEA 1OCCB 1E1QG 4UV8A 2QA4V 4RWUA 2PI4A 4I9WA 3O65A 1H2NA 3LDEA 1N36B 4W4LA 4LF9O 2UU9B 1SQPH 3APQA 4E2LA 4O4IA 5HFMA 3EHBB 2E76B 2OIGA 4UVBA 1SZXA 2W6IG 3P32A 5CBHA 5JCOA 4XBFA 4TV8A 2OWOA 2CUGA 5JJEB 2KG7A 1PL4A 1F4MA 1BCCH 2DYSB 2OCCB 5FNVB 3L70H 1YEWA 4JASA 1Q6HA 3FFQA 5LL6Y 2YS8A 3CMAV 4F6RB 1I94O 4DR6B 1LR1A 3AEIA 2P22C 2GSMB 2ZR3A 4X88A 4GZRB 1GN6A 1SF9A 2EBOA 3W7SA 2EINC 4QPJA 3H1JH 4X64O 2GTSA 2NR5A 3ZRSA 3G6EV 2YXLA 4JTAB 5TISZ 5JCOC 1R6TA 1L8DA 1XREA 4TV9A 4BR6A 1SERA 4H0LB 3OT7A 2ODMA 2ILMA 3FD9A 4YJ2A 4X1IA 3OTFA 2Y0IA 1SQVH 1LUWA 3RW0A 3QO7A 2KSDA 1Q7YW 1RSOB 1XNQO 4I4TA 4WFGA 1WB7A 3L9DA 5ITZA 3KZIZ 3BEHA 1YF2A 3CMEV 1FAFA 5GONA 5LGTA 4X65O 3CJHB 4I0XA 3CPWU 4JGSA 5DECA 3JD1A 3CYOA 1IX9A 1BZKA 3JALB 5LXTB 4DR5O 1W2BU 4X1KB 3CRAA 3SGIA 1Z2GA 2UXBB 1FXHA 2E5LO 2EJ7A 4GYCB 5C8YA 1AJQA 3ABUA 1TUBB 2XAFA 3FAVB 1I0HA 5JWPA 5IYBO 2Y4UA 4DV3O 3D36C 4JTDB 2QWQB 4U7OA 5KUKA 5J2TA 3E2EA 3GWKC 4PA7A 2LW7A 4IIJB 2D3OW 2BE3A 4LF9B 4U3JB 5JQGA 3ZHQA 2UUAO 3JAWB 1NR1A 3C3SA 3OFNG 3SPGA 4Q6GA 2RNBA 2YIBD 4TOIA 2ARHA 1PV0A 4FM2A 1YTFD 4IYIA 2QEXV 2P90A 5AG2A 3TGUH 4JI0O 3K5MA 3RYHA 3FB6C 2ATKC 2FL4A 1K4CC 4JAUA 2VQEO 2ZIOA 1OCOC 2PZSA 5H9CA 1VQMV 2BOCC 3VQYA 4MVZA 5GW7A 4JI5O 4QGPA 4EB6A 3NR7A 3ZCCA 4LC1A 4LFAB 3ABLB 5FNVA 5CB4B 1R3LC 2IH1C 1L1FA 3H1HH 5DEDA 3SPCA 3K5LA 3CCEV 1K97A 4X64B 4F6RA 4G28B 5EC2C 3RVYA 2QJ1A 1WNSA 3N27A 1YITV 5LP6B 4IYHA 4JI7O 4K35A 4ZKIA 3K57A 2JEXA 1D5AA 2IH3C 1AI4A 2HEPA 1XNQB 4CC6A 1ZUQA 3ETDA 4OXSA 1BT8A 4X65B 2LP7A 3ZRWA 4CH5A 2IJJA 2ITCC 4JF3A 4LF6B 1YSCA 4B3TO 3BCCH 4DR5B 2EULA 2XAJA 5IE9A 1EN4A 4DUYO 3F7YC 5EYPB 1M90W 2A0LA 1ZL8B 3SJCC 1KYOF 1GM7A 2Q0AA 1Q8IA 4X89A 2E5LB 3F5TA 3CJHA 4HZ3A 1WB8A 2FTKA 2HKOA 4QE9A 5KMGB 3CXCU 4H37A 3JALA 5LXTA 2LW1A 4DV3B 5LA6B 2Q7GA 2V7QG 1GN4A 3K9SA 1GRJA 5B1AC 3ZBHA 4BW5A 3ZRXA 5KX5A 3EXAA 2UUAB 1FXKC 3FAVA 4DR7B 2VRZA 2WA4A 4H33A 4K8ZA 4JYAO 4B7EA 2W6JG 3CB2A 4YXWG 4NR1A 3H01A 4NTYA 1V9PA 4JI0B 1ZX3A 4IIJA 1UPGA 4PJ0Z 4U3JA 2VQEB 5IJ9B 5JVDA 3OEHG 1U96A 2VQFO 3W7UA 4JI5B 4UCRA 1YHQV 2PY5A 3DXRA 1Z5VA 5B66Z 1FFXB 2QWOB 3SYCA 3E22A 2P6JA 1VQ9V 3ZHRA 3B4SA 3ZMVA 1CEZA 2Q7HA 4DR1O 1OV9A 1AR1B 1JX9A 4JAVA 2DYRB 1HP8A 1K8AW 3EFFK 4B3SO 4L8JA 1NZ6A 2ZINA 2EZOA 3ZN0A 2JEUA 4JI7B 2CK3G 3P30A 1NJIW 3W7WA 4O4LB 4KFMA 4G27B 4DUZO 3ABKC 2JDIG 1OCRB 1YI2V 5B1BC 3LSUA 1QLNA 2P5OA 3SJAC 2UUCB 1MSWD 4AHCA 5LHIA 2RJZA 3CCSV 1N34O 4I5SA 4B3TB 4MVSA 2YXHA 2FMLA 4DUYB 4JI1O 1NTZH 4U3FH 2IU0A 3ABTA 3VOUA 4P2ZA 1NKDA 4J9ZB 5LMNO 2LGQA 1I7FA 3JCZA 4DV1O 4UVCA 3UKMA 1FKAO 1NT2B 3AG2B 4FLTA 1WPBA 3OEEG 5KHJA 1SQFA 1Y66A 1VP7A 2Y0PA 4KHPO 4OPHA 3ZIAG 4LWSB 3THOA 5D5QA 4RO2A 2B9ZA 4WCEV 1CP9A 4ZOLA 4JYAB 2Q7EA 3RVZA 2DWEC 5KMGA 3M7MX 4FLZA 2ZD9A 3B2EE 1GO3F 1XHXA 1KU9A 4JZ2A 1XBLA 2W0FC 4LBEC 1GN2A 2KB1A 1OJHA 4H13B 3CHXA 3BA9A 2ZT9B 1TUEB 5EBWC 1Q82W 4CZZA 2VQFB 2Y48A 2FKXA 5CBFA 1H2LA 3DSQA 4A5UB 1VQ8V 1WN7A 4TV8B 4DR2O 1HR0O 2JRIA 2KG7B 3UM7A 4EKWA 2XAHA 3E83A 1RM1C 4LF5B 1H2SB 2UXXA 5GTIZ 4B08A 4DK0A 1AR5A 5IJ9A 4YIPA 4DR1B 2EIMB 1CXZB 2F23A 1XMQO 2ZDIA 4ABMA 2QE7G 4IL6Z 3JATB 1FFXA 3GB7C 4B3SB 5C93A 1QR9A 3KKYA 1OHHG 3ZHSA 1IURA 1R3IC 1XNRO 1S72V 1N33O 1NVPD 4DR6O 4UCUA 1KUQA 4DUZB 1Q6UA 2WWWA 1VF6A 1QLEB 3CCUV 4JYBA 1XHZA 2WLJA 4NKGB 1R3KC 1VEWA 1WJZA 4PD4F 3K59A 3BPZA 4X1IB 1N32O 2CH7A 2PYJA 3BVOA 4PA4A 1N34B 4FIPC 4CS2A 1Q6IA 4O4LA 2B1GA 2WLHA 1XEQA 3G6BA 1ZLZA 3AG3C 4I55B 1VF7A 2OTJV 2YIDA 4JI1B 5ITZB 1TAEA 2X6AA 1JJOA 3OMNB 5GONB 4I0XB 3IC7A 1N0JA 1RPOA 5LMNB 4WFFA 3OUSA 1Y6XA 1F4NA 1N8RW 4JI3O 3K3WA 2RDCA 3T2MA 1M57C 4PELA 3JCUZ 3RGBA 2RQ6A 5KAIZ 2GUZB 2Q73A 4NVPA 5CMUA 2A79B 3OMIB 1HW7A 2R9AA 3O9OA 4KHPB 3L71H 2P4KA 1QNMA 3ETQA 2PGGA 3L72H 4TSFG 1OCOB 1R3JC 1Q86W 3CRQA 4LFCO 1KMIZ 4HBNA 3X2QC 2Q0OC 4TWKA 2WPDG 3ZMZA 5D5PA 4RUFA 1NH2B 1B04A 1K7DA 2H94A 2Q67A 2ZE5A 5JQGB 4Q20A 3B40A 4LWSA 3E8BA 1GH6A 5JJNB 2BOBC 4UUJC 1H8HG 4JPRA 4WBNB 1QVFU 4BIOA 5IY5C 2YICA 2YC0A 1BL8A 4DR2B 1HR0B 1YJNV 3K58A 3WB2A 4F6EA 3RYHB 2QWPB 2QTOA 4R7CA 5EIBD 3R65A 4O2AB 3UO2A 4TQFA 5JH7B 2FB5A 1PKXA 1GMGA 1EM1A 1XMQB 4EB6B 1VQPV 2DOSA 2Y69B 4K8XA 1H2GA 1PNLA 4PI0A 2NNUA 4IT5A 3DGEA 2WLNA 1VQ6V 4DK1A 4J9YB 3BFRA 1DTOA 3B77A 4ZHQB 1SQBH 1BS3A 5DM6V 3SPJA 1XNRB 3LNMB 5J2UB 3ZHTA 1N33B 1Q81W 3RBZA 3TCUA 2QWRB 3JAMN 3JATA 5CN0A 3ZX6A 4YIOA 2F4VB 1KB9F 1EFRG 2XHBA 4LFAO 1AB3A 2YDEA 4LF7O 1G4YB 3SJBC 1I5XA 3JARA 1N32B 2AW9A 4DV7O 1S5HC 2BTOA 2CE4A 1FPOA 5LOVB 3K79A 1AR4A 3JAKB 5KA6A 2QGNA 1WP8A 3FB7C 1E79G 1VARA 1BE3H 4U7NA 1E1RG 3QTCA 4FFKA 3ZRWB 1WAZA 2Z3YA 1M4UA 1W0JG 1Y74A 2OIEA 4JI3B 3RYFA 4O2BA 1FXVA 4I55A 3LDCA 3FYIB 4J7ZA 4PI2A 3BY6A 3W7XA 3BHPA 3AG1B 3D36A 3ZHUA 2MK3A 1YJWV 1VQ5V 1D5NA 1AROP 2IU3A 2GTAA 3CRRA 2HLDG 2EIJB 1GTOA 1PPJH 4AILC 3FB5C 4LF6O 2N04A 3FX7A 4LFCB 1K73W 3ASNC 1MOFA 2GUZA 4D7SA 3M8AA 1QQCA 1S0VA 1EZJA 1COWG 4J41A 4PHZA 5KX5B 1SS3A 1W59A 4BAYA 4P30A 3B8NA 2EZPA 3CCVV 4TQDA 2CTPA 1T5EA 3CC2V 1XUQA 4RAIA 4UB8Z 4MVOA 4JI8O 2ZKOA 1HNXO 3CCQV 2DJVA 2M7WA 1GN3A 4NB5A 3M99B 3JYCA 2HR3A 4IHJB 4DR7O 5JVDB 1Y4MA 4DR3O 2UXNA 3FYEB 2AHYA 1XQ8A 4WBNA 3JD3A 1N4CA 3DXRB 2Z5UA 2RCVA 4LNUA 2EILC 1MZFA 3E22B 4MVUA 4JZGA 1RPRA 1PM9A 1YTFB 4O2AA 5JH7A 3ZMTA 1AILA 2OT5A 1P7BA 3ASOC 1Y67A 4BW9A 3QO8A 2LQTA 5H2FZ 2OTLV 4KL1A 2K9PA 4KUMA 3J81N 3WG7C 4PA9A 1XDCA 1I5YA 3D3QA 4LF7B 2VWKA 3LUTB 3OAAG 1VQOV 1S3JA 5H5NA 4CH6A 2IJHA 4DV7B 5KHHA 4ZHQA 2Q6AA 2H8PC 5J2UA 1R1BA 4QIWF 2Q69A 1JQ0A 3VBBA 3MHHC 1H2KA 1KC8W 3FB8C 4GX1A 3H9VA 1B06A 2P7TC 1DLBA 4HAMA 4EEQA 1ZWIC 4J10A 5EIBC 3AG4B 1SQQH 3S3WA 3UO3A 5LOVA 1MA1A 1FS0G 3JAKA 2D2CB 2X6CA 2GV9A 5B1OA 3ZEDA 2RMKB 3CCRV 2L35A 2YSUB 1H8EG 4FLWA 1OZ0A 2UUCO 3A0BZ 3J80N 1FXKA 2HJFC 4DXWA 3OW2U 3A2FA 4JV5O 1XMOB 3CC7V 3A0HZ 4FK5C 2OCCC 1S76D 1MZEA 1K3EA 4GT1A 4W4KA 2QKAA 4JYCA 1RM1B 4D6TH 2PTMA 5LBQA 3RT3C 2Q68A 4ZOLB 3UQ8A 1ZAUA 4JI8B 5KA5A 1YCIA 1P49A 2VS0A 1HNXB 3DC6A 3QO5A 2AZ0A 4PDMA 4JYYA 1K5SA 2A9HA 4UB6Z 4DR3B 2CTRA 4HNAA 3U11A 2ZE8A 1V55C 5EBLC 1Q90D 1IBMO 1JA8A 4MTFA 1FJGO 2HG5C 2PF4E 2WA3A 2YIAA 4IHJA 3K0GA 1EBOA 3HKEB 1SC5B 3K5NA 3CP1A 5JJJB 3DC5A 2B1IA 3AG3B 2A06H 2AXTZ 4LF5O 2YIBA 3P3NA 3WB0A 4NXNO 3FKSG 2AGAA 2DN9A 4K0KO 3C90A 1YVWA 2R70A 2DWDC 4P9OA 2C2AA 5CA1A 2QKCA 4GCZA 1M57B 1EZVH 3H1LH 3WB1A 3RYIA 4PDLA 2QKSA 2ZNIA 4ASUG 2UXDO 3T1YB 4GKJO 1Q3EA 4UV9A 2CH7B 2RN9A 2DQ0A 2YEVB 3U10A 2JS3A 1Q43A 3H1IH 3AG7A 3I56V 3OR7C 4I50A 5CBGA 3T4ZA 2HFEC 3OMAB 1K33A 1JMKC 4ZIBA 4LF4O 5E79Z 1QVGU 3OGCC 4FVMA 1THZA 5FPOA 1XOUA 4JV5B 4X8AA 3GWOA 2XUMA 2ZR2A 1F7YA 5BMVA 1NR7A 1J95A 1VQLV 2P67A 4B7KA 4J7JA 4JI4O 2F66C 4OPAA 3JD0A 5H6RA 1FD9A 4WFAV 4ICGA 1IZ3A 2N74A 3T1CA 1JPXA 4J42A 4MVRA 4RQFA 1AVMA 3ETGA 3K04A 1MNGA 2MW2B 3B09A 4LH7A 1M5IA 4DV4O 2AZ2A 5LP6C 1IBMB 1R6KA 3BRCA 4DRXB 1FJGB 4FM1A 3JSNA 3BABA 5KHGA 2ZM6O 4CBCA 5IT9N 1QHTA 2ZCEA 3KCYA 3E8FA 2EINB 2F95B 1YZBA 1BQZA 3N2KA 5L3FA 3L75H 3VQVA 1GKFA 3SYQA 3CSXA 1VMGA 4NXNB 3CX5F 4DW1A 4FLUA 4K0KB 4QPKA 1KBHA 1M56C 4X62O 3Q4HB 3HKEA 5CA0A 3CRCA 3K0DA 1JOYA 1RFYA 2EIKC 4UCTA 1P7GA 2V1DA 3SR2C 2UXDB 3JARB 1KP2A 4GKJB 2L6LA 3B8MA 4UCVA 3W7TA 1N0NA 2JJ1G 4BWAA 5FPRA 1Y76B 2XAQA 1TGOA 3HPLC 4FM0A 1WA8A 2B5UA 2F4VO 4X9QA 2QWNB 3AK3A 3ASNB 1NS1A 1YXBA 4GKKO 4Z1MG 1G8MA 3D8CA 4LF4B 4FPPA 1M9NA 3S3XA 3HKDB 5B5EZ 1Y74B 4O4HB 2YEVA 1GK9A 3OE7G 3RYFB 1RP3B 4O2BB 2QTSA 3HB3B
chains in the Genus database with same CATH topology
2IH3C 1AI4A 3ZRWB 2Z3YA 3E86A 1PD3A 1W0JG 5IY5B 4MS2A 3CCJV 1PNKA 3A0RA 3ETDA 3CD6V 4R8CA 1FXVA 4OXSA 3LDCA 5EC1C 3FYIB 1IXMA 4UXNA 3BY6A 3W7XA 3AG1B 3D36A 3ZJZA 5IYDO 2LP7A 2MK3A 1YJWV 3STLC 3ZRWA 1AROP 2IU3A 1VQ5V 2IJJA 2ITCC 4JF3A 3ETEA 1CPYA 1YSCA 4MTGA 2HLDG 1K92A 2EILB 2EIJB 1GTOA 5L3BA 3ABLC 3FB5C 1VQKV 2XAJA 2ZXWB 3F7YC 3SPIA 1K73W 2XNDG 1M90W 2A0LA 3ASNC 2IW5A 1GM7A 1MOFA 2X7RB 4X89A 4XDLA 2LFSA 3K08A 1S0VA 1EZJA 4HZ3A 1BMFG 2FTKA 3LSQA 1COWG 1KD1W 4WF9V 2HKOA 4QE9A 1JVMA 4MTOA 4BAYA 2QM7A 4P30A 3CXCU 3WG7B 4H37A 5LHHA 3B8NA 2DW4A 2EZPA 3JD2A 3CCVV 5L3EA 1WLEA 2V7QG 3CC2V 2WLLA 1VQ4V 4RAIA 5B1AC 4MVOA 3AG4C 4FJCC 4BW5A 3ZRXA 5CA3A 2WLMA 3CCQV 2M7WA 1FXKC 3F5WC 3M99B 1BHBA 3JYCA 2HR3A 4H33A 2W6JG 1AI5A 4YXWG 1PNMA 1Y4MA 3H01A 2UXNA 3FYEB 4MT8A 1K4DC 2AHYA 2IJKA 3E89A 2WAMA 3JD3A 5H6QA 2Z5UA 1YIJV 5LGUA 2EILC 1AI7A 4MVUA 2WLIB 1WPXA 3T4DA 5LGNA 1RPRA 3ML0A 2ZXWC 3OEHG 1QBZA 1YTFB 2K1EA 2JJ2G 3W7UA 5HFLA 5IDJA 1YHQV 2HVKC 3OUFA 3ZMTA 2OT5A 2X0LA 1P7BA 3ASOC 3SYCA 3QO8A 3OR6C 1K9MW 2P6JA 2EJRA 3DTUB 2OTLV 1VQ9V 3OM3B 4MW8A 4KUMA 3ZMVA 3WG7C 4G2KA 4LCUC 5B1NA 1CEZA 2QM8A 3AG2C 4PA9A 1I5YA 3ABMB 3LUTB 3OAAG 1VQOV 3PJSK 1KKDA 5L3CA 1S3JA 1S77D 5DN6G 2IJHA 4GX5A 1NBMG 1AR1B 2Q6AA 1JX9A 2H8PC 2DYRB 4JAVA 4QIWF 1NVPB 1K8AW 5L3DA 3EFFK 2Q69A 1SRYA 4PA3A 1JQ0A 2EZOA 3ZN0A 3VBBA 2JEUA 5IYCO 2CK3G 3MHHC 1AI6A 3P30A 1KC8W 3FB8C 4GX1A 1NJIW 5E1AC 4PDVA 2P7TC 1DLBA 4HAMA 3W7WA 5B1AB 2F43G 4KFMA 1ZWIC 4G27B 4WFEA 3AG4B 1DF4A 4TT3G 3ABKC 2JK5C 2JDIG 1OCRB 2GHYA 1FXKB 1YI2V 1M1KW 1FS0G 5B1BC 2X6CA 1QCEA 2ZDIC 3CCLV 1QLNA 3JD4A 4GX0A 5B1OA 1MSWD 4HYOA 1V55B 3LSSA 5LHIA 3CCRV 3CCSV 4JTCB 1QR8A 1GM9A 2YSUB 1H8EG 4LP8A 1OZ0A 4I5SA 4L87A 4MVSA 5KUMA 1R6NA 1FXKA 2EIMC 2HJFC 4DXWA 3SYPA 3OW2U 4PDRA 4XDKA 5B3SB 3ABMC 3CC7V 5LHGA 1XL6A 1KQSU 4FK5C 1NQTA 2OCCC 4PA6A 2IU0A 1S76D 3ABTA 3SYOA 1OCZB 1K3EA 4GT1A 4R6ZA 3VOUA 2DYRC 3I55V 1GM8A 1ROPA 4P2ZA 4RUEA 5FL7G 1NKDA 1MABG 4J9ZB 4JYCA 3ASOB 3TETA 1RM1B 4F4LA 1V54B 5LBQA 3JCZA 2Q68A 4UVCA 3UKMA 3MD0A 4MW3A 1DF5A 3AG2B 2NLJC 1R73A 4DO2A 3OEEG 3E8HA 1QLEC 1Y66A 3SYAA 5KA5A 1JCHA 3ZIAG 1NH2D 5L3GA 3QO5A 1H38A 4RO2A 4WCEV 4PDMA 1CP9A 1KP3A 1OCRC 4P9PA 1ENVA 1K5SA 3RVZA 2DWEC 1W0KG 1AJNA 2A9HA 1UJWB 2DQ3A 1MG1A 2ZD9A 4GX2A 1GO3F 1SZTA 1V55C 3SPHA 5EBLC 1VQNV 2W0FC 3QNEA 4LBEC 1OCCB 4XDJA 5BZBA 2KB1A 1E1QG 4MTFA 4QJFB 4UV8A 2QA4V 1TUEB 2HG5C 2PI4A 3ABKB 4I9WA 5EBWC 1Q82W 4CZZA 3LDEA 5B3SC 1LNQA 2Y48A 3E8GA 3K0GA 5B1BB 1EBOA 4MTXA 2HVJC 5CBFA 3K03A 3CC4V 4QNHB 1VQ8V 2JIZG 1OCZC 3CP1A 3UM7A 4EKWA 2XAHA 3E83A 4E2LA 1RM1C 2B1IA 3AG3B 2UXXA 1V54C 5HFMA 3EHBB 2WLIA 2EIMB 4UVBA 3FKSG 1ORQC 1BHAA 2ZDIA 2W6IG 3P32A 2ITDC 5CBHA 2QE7G 4XBFA 3CCMV 1JJ2U 1F4MA 2DWDC 2DYSB 2OCCB 4P9OA 2C2AA 3K06A 3E35A 3GB7C 5C93A 1QR9A 4JASA 4BIZA 4GCZA 1M57B 1OHHG 3LDDA 3CMAV 4PDLA 2QKSA 4ASUG 4MVQA 1R3IC 2ZQMA 3AEIA 1S72V 4UV9A 3ZRVA 3F7VC 1F23A 1NVPD 2GSMB 2ZR3A 1OCCC 2DQ0A 2WWWA 2YEVB 1QLEB 4KP4A 4X88A 3CCUV 1B6QA 4JYBA 3I56V 3OR7C 2WLJA 1R3KC 5CBGA 2EBOA 2IJIA 3T4ZA 2HFEC 4MSWC 3KG2A 3W7SA 3OMAB 1KECA 1K33A 2EINC 4QPJA 3STZC 4PA4A 3ZRSA 3G6EV 2XOKG 4JTAB 1QVGU 3OGCC 4FIPC 2B1GA 2WLHA 1THZA 1SERA 3AG3C 3WFVA 4N21A 2OTJV 1XL4A 4X8AA 3GWOA 4WFHA 2X6AA 2Y69C 3G71V 2WSSG 3OMNB 3RW0A 1SETA 3QO7A 2ZR2A 3IC7A 1Q7YW 1RPOA 2DYSC 5EBMC 4WFFA 3OUSA 4WFGA 1NR7A 1F4NA 1N8RW 1J95A 2XAGA 3K3WA 1VQLV 1K34A 3T2MA 1AJPA 1M57C 2P67A 4PELA 3BEHA 3CMEV 3JD0A 5CMUA 3D3IA 5LGTA 2A79B 3OMIB 1M56B 5H6RA 3CPWU 4JGSA 4WFAV 3MHSC 3JD1A 3T1CA 3CYOA 1JPXA 4MVMA 1F51A 1OCOB 4TSFG 1W2BU 4MVRA 4RQFA 2EIKB 3IGAC 1R3JC 2WLLB 1Q86W 3ETGA 3K04A 3X2QC 3SJQC 1FXHA 4TWKA 2WPDG 3ZMZA 3IFXA 4RUFA 2XASA 1NH2B 1AJQA 2WLKA 3ABUA 2XAFA 1K7DA 4BIUA 2PI5A 2H94A 1R6KA 2Q67A 1HWYA 4Q20A 5IYBO 3E8BA 4JTDB 4U7OA 5KUKA 2BOBC 4CBCA 4UUJC 1H8HG 4JPRA 4FMTA 4PA7A 1QVFU 3E2EA 3K9AA 4R50A 5IY5C 3E8FA 2D3OW 1BL8A 2EINB 1YJNV 2X6BA 2AHZA 5EK0A 2QTOA 1NR1A 5L3FA 4R7CA 2R9RB 3R65A 3OFNG 3AG1C 3SPGA 1GKFA 3SYQA 3G4SV 4N23A 1PKXA 1GMGA 1K5QA 1YTFD 2QEXV 2P90A 4QE7A 4QPKA 1VQPV 1M56C 2EIJC 1VQ7V 2Y69B 5J9PC 1H2GA 1PNLA 3FB6C 2ATKC 3K0DA 1SESA 1K4CC 4ZBMA 2NNUA 4JAUA 4WFBV 3DGEA 1OCOC 2WLNA 1JOYA 2EIKC 5H9CA 1VQ6V 1VQMV 2BOCC 4J9YB 3ZMUA 4MVZA 2V1DA 1DTOA 5GW7A 3B77A 1P4RA 3ZCCA 3ZN1A 5DM6V 3SPJA 1KP2A 3LNMB 4RQEA 3B8MA 3W7TA 2JJ1G 1Q81W 3RBZA 3TCUA 4LC1A 1PL0A 5CN0A 2XAQA 1EFRG 3ABLB 3HPLC 1R3LC 2B5UA 2IH1C 3NXSA 1L1FA 2LFRA 1G4YB 3ASNB 3SPCA 1I5XA 3CCEV 1K97A 4G28B 4Z1MG 1YJ9V 1G8MA 5EC2C 1S5HC 3X2QB 4FPPA 3RVYA 1M9NA 3K79A 1YITV 3ZMSA 2R9IA 5KA6A 2YEVA 1GK9A 3OE7G 3TK1A 3FB7C 1E79G 3HB3B 4UVAA 4ZKIA 4U7NA 2JEXA 1E1RG 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK C;  2ZDI C;  1FXK A;  2ZQM A;  2ZDI A;  3AEI A;  1FXK B; 
#chains in the Genus database with same CATH topology
 1SQG A;  1VF5 B;  3E86 A;  3TXQ A;  4MS2 A;  4R8C A;  4JI4 B;  1IXM A;  3JAS A;  3WU2 Z;  1IBK O;  4I9Q A;  4I7Z B;  3ETE A;  1CPY A;  4MTG A;  1K92 A;  2EIL B;  2Q9L A;  5L3B A;  3A8T A;  3ICX A;  3SPI A;  2ZE6 A;  4GLX A;  4XDL A;  2LFS A;  4DV4 B;  2ADQ B;  3K08 A;  4X66 O;  1NTK H;  1KD1 W;  1JVM A;  4MTO A;  3WG7 B;  2HHH O;  2DW4 A;  4DYL A;  2ZIM A;  5L3E A;  2ZM6 B;  1WLE A;  3CWB H;  2P4V A;  5FLX N;  4FJC C;  2WLM A;  1BHB A;  4LNU B;  4J80 A;  3UT5 B;  5GTH Z;  4DRX A;  3L74 H;  4TUY B;  4E4E A;  4MT8 A;  1K4D C;  2IJK A;  3E89 A;  2WAM A;  5H6Q A;  4X62 B;  5KHI A;  1AI7 A;  2WLI B;  3T4D A;  3AK1 A;  5LGN A;  2ZXW C;  1QBZ A;  5K1X A;  2JJ2 G;  5HFL A;  3RYC A;  4DV6 O;  5EZY B;  4CS4 A;  3OUF A;  2X0L A;  1H2M A;  1K9M W;  3Q4H A;  5LYJ B;  3OM3 B;  4NTX A;  4MW8 A;  4G2K A;  4LCU C;  1Z5W A;  3AG2 C;  2IM9 A;  3LNN A;  2YI9 A;  1IBL O;  3PJS K;  1KKD A;  5L3C A;  5DN6 G;  4GKK B;  3T1H O;  2CGN A;  5KAF Z;  1Y76 A;  1SRY A;  4UCO A;  3VQX A;  5IYC O;  1AI6 A;  2JGD B;  2F93 B;  3CRM A;  2IBZ H;  3K5O A;  5B1A B;  2F43 G;  1P84 F;  1G6U A;  4WFE A;  3H1K H;  4YHH O;  1XIL A;  1DF4 A;  4TT3 G;  2JK5 C;  2ZE7 A;  1FXK B;  3HKD A;  1M1K W;  4O4J B;  4O4H A;  4CC5 A;  4LF8 O;  4LFB O;  3JD4 A;  5BXZ A;  4Z1V A;  1IBK B;  3IAY A;  4HYO A;  1V55 B;  3LSS A;  4JTC B;  4AI8 A;  2HJD A;  4L87 A;  4LP8 A;  3BAA A;  1R6N A;  3AK2 A;  2EIM C;  4UFZ A;  2LJ2 A;  4PDR A;  3ABM C;  5LHG A;  1XL6 A;  1IDS A;  2FYU H;  2GBO A;  1XMO O;  2YI8 A;  4FZ0 A;  3SYO A;  2UXC B;  3I55 V;  1GM8 A;  4X66 B;  1ROP A;  5FL7 G;  3C3T A;  1J5E O;  3QG5 A;  3TET A;  2ADP A;  3HKB A;  1I08 A;  4EFE A;  1S5J A;  2HHH B;  1HNW B;  1O9G A;  1R73 A;  2Q5Z A;  4HNA B;  2LO1 A;  1QLE C;  3SYA A;  3CEI A;  1JCH A;  4EFB A;  2PUS A;  2P06 A;  5L3G A;  4GUN A;  5IYZ A;  1ENV A;  1W0K G;  1LUV A;  1AJN A;  3G80 A;  1MG1 A;  2M6Y A;  1SZT A;  3HKC A;  2XTA A;  4XDJ A;  5BZB A;  2H3O A;  4QJF B;  3P3P A;  1AP6 A;  3UT5 A;  3ABK B;  5B3S C;  1URF A;  1LNQ A;  4ZI7 B;  3E8G A;  4TUY A;  1NI8 A;  4MTX A;  5B1B B;  1TVK B;  2HVJ C;  4DV6 B;  3K03 A;  3CC4 V;  4QNH B;  2JIZ G;  1OCZ C;  3MAQ A;  3QVN A;  1AP5 A;  4Z2W A;  1SQX H;  1V54 C;  5CA1 B;  2ETN A;  2A3Q A;  2WLI A;  3OGI B;  2ZNJ A;  3OTO O;  1IBL B;  1ORQ C;  1BHA A;  3RYI B;  2XT9 A;  4NXM O;  2ITD C;  3CCM V;  1JJ2 U;  5EZY A;  3T1H B;  1US6 A;  4CH3 A;  3K06 A;  3GVM A;  3E35 A;  4BIZ A;  5LYJ A;  3HR0 A;  1I94 B;  3LDD A;  1L0N H;  1HDJ A;  4I50 B;  2KQX A;  1D2D A;  5LMU O;  4MVQ A;  2ZQM A;  3ZRV A;  3F7V C;  2DMX A;  2UUB O;  1F23 A;  3G67 A;  3T1Y O;  4NYK A;  4OX9 O;  1OCC C;  2CGO A;  4YHH B;  4KP4 A;  1B6Q A;  4DV2 O;  4C7U A;  1X4T A;  4LF8 B;  4LFB B;  2IJI A;  4FZ1 A;  4MSW C;  3KG2 A;  1KEC A;  4D7T A;  5KLV H;  3STZ C;  2JGD A;  2XOK G;  2JVD A;  2O57 A;  4B3M O;  1BGY H;  4DR4 O;  2E74 B;  3MDS A;  2PYL A;  5BMV B;  3WFV A;  4N21 A;  2N05 A;  1XL4 A;  1B3Q A;  1SA0 B;  4O4J A;  4WFH A;  1MMM A;  2Y69 C;  2WSS G;  3G71 V;  3VQW A;  1SET A;  2Y4T A;  5F2V O;  2DYS C;  5EBM C;  1J5E B;  2XAG A;  1K34 A;  1AJP A;  1YDX A;  5A2Q N;  3D3I A;  1FYJ A;  1M56 B;  1U97 A;  1RSO A;  3MHS C;  3CS5 A;  1WP7 A;  3RWR D;  4MVM A;  1F51 A;  1Q5O A;  2KKW A;  2EIK B;  3IGA C;  4FLY A;  2WLL B;  4AQY O;  3SJQ C;  3IFX A;  2XAS A;  2JGU A;  2DE0 X;  2WLK A;  2PI5 A;  4BIU A;  3BA8 A;  1HWY A;  2CTW A;  3N2K B;  3APO A;  4X1K A;  4UCS A;  4YJ3 B;  4FFB B;  2V4D A;  3UCS C;  1MSD A;  2QSA A;  4FMT A;  3K9A A;  4R50 A;  1TUB A;  2Z0A A;  1TA8 A;  2X6B A;  2EX3 A;  5CA0 B;  2AHZ A;  5EK0 A;  3I5D A;  2R9R B;  5K1P A;  3AG1 C;  4YY3 O;  4LR3 A;  3G4S V;  4N23 A;  1K5Q A;  3OTO B;  3U0Z A;  2Q4P A;  4QE7 A;  4ZI7 A;  4NXM B;  2EIJ C;  4B3R O;  1TVK A;  1VQ7 V;  5J9P C;  2A7W A;  2CDY A;  3JAW A;  2VWJ A;  1SES A;  4ZBM A;  3N2G B;  3RN4 A;  4WFB V;  3CXH F;  1UFI A;  4DV5 O;  1WA8 B;  3ZMU A;  4DV0 O;  1P4R A;  5LMU B;  3ZN1 A;  4RQE A;  2UUB B;  1PL0 A;  4OX9 B;  3TJT A;  4J11 A;  3OD4 A;  1L0L H;  4PV1 B;  4DV2 B;  1BSM A;  3NXS A;  2LFR A;  1XI1 A;  1X59 A;  1YJ9 V;  3X2Q B;  5A9G A;  4B3M B;  4DR4 B;  5BR8 O;  5CB4 A;  3ZMS A;  2R9I A;  4FLV A;  2W0X A;  3TK1 A;  4UVA A;  3JAS B;  3JSL A;  1FFT B;  4H44 B;  1PD3 A;  4KXR A;  5IY5 B;  5KHK A;  3CCJ V;  1PNK A;  5LP6 A;  3A0R A;  3CD6 V;  1S5L Z;  5EC1 C;  4UXN A;  5IWA O;  3ZJZ A;  5IYD O;  1SA0 A;  3STL C;  3IC9 A;  2BTQ B;  3ZS8 C;  1HNZ O;  3ABL C;  1VQK V;  2ZXW B;  4IGG A;  2XND G;  5IJ0 B;  3QF7 A;  2IW5 A;  4AQY B;  4JI2 O;  2YXY A;  2X7R B;  3L73 H;  4FLX A;  3J7A U;  2F1M A;  1BMF G;  3LSQ A;  2QR4 A;  1SKV A;  4WF9 V;  4X20 B;  1PP9 H;  2QM7 A;  2QM4 A;  5LHH A;  5EYP A;  1QU7 A;  3JD2 A;  2CTQ A;  2E3C A;  1ZL8 A;  1JFF B;  2WLL A;  1VQ4 V;  2JS5 A;  4X1Y B;  2BSK B;  3AG4 C;  1JR9 A;  5CA3 A;  4LH6 A;  3EVK A;  3F5W C;  2CAZ C;  4DW0 A;  5LA6 A;  4YY3 B;  4JI6 O;  1AI5 A;  4YJ3 A;  1PNM A;  4FFB A;  3CE2 A;  3R66 A;  3RYC B;  4B3R B;  1YIJ V;  5LGU A;  4O4I B;  3PN1 A;  2GDS A;  1WPX A;  4DV5 B;  3ML0 A;  2K1E A;  4DV0 B;  5IDJ A;  1N36 O;  4K3A A;  2HVK C;  2NN4 A;  4CH4 A;  2UU9 O;  3OR6 C;  3DTU B;  2EJR A;  2YUA A;  3N2G A;  5B1N A;  1EN6 A;  1EN5 A;  2QM8 A;  3TXS A;  3ABM B;  1S77 D;  4GX5 A;  1NBM G;  1ZSP A;  1ZTE A;  1NVP B;  2G38 A;  5L3D A;  5BR8 B;  4OGQ B;  1NU1 H;  4PA3 A;  2LGW A;  4NTW A;  1O9H A;  1KKC A;  1IVS A;  5E1A C;  4PDV A;  1A32 A;  4TV9 B;  3SDL A;  2R72 A;  2OCH A;  3ZHV A;  1NTM H;  4YJ2 B;  2GHY A;  5BY1 A;  5IWA B;  1QCE A;  2ZDI C;  3CCL V;  2HP8 A;  3KCX A;  2QDO A;  4GX0 A;  1QR8 A;  1GM9 A;  4JAA A;  4I4T B;  2Q8V A;  1HNZ B;  5KUM A;  1DGS A;  3HKB B;  4CS3 A;  1M93 A;  3SYP A;  5B3S B;  4XDK A;  2OYQ A;  1G1X B;  4JI2 B;  1KQS U;  1NQT A;  4PA6 A;  1OCZ B;  4R6Z A;  2DYR C;  1VF6 C;  4RUE A;  4DV1 B;  1MAB G;  4J7K A;  1DK1 A;  2UXC O;  3ASO B;  2BTQ A;  4F4L A;  1V54 B;  1VIB A;  5IYZ B;  3MD0 A;  4MW3 A;  1GAX A;  1DF5 A;  1BQ0 A;  2NLJ C;  5C8Y B;  4DO2 A;  5IJ0 A;  2E75 B;  3E8H A;  1HNW O;  1NH2 D;  3HKC B;  1H38 A;  5J2T B;  4X20 A;  1KP3 A;  1OCR C;  4P9P A;  4JI6 B;  1UJW B;  2UXB O;  3IJ4 A;  2DQ3 A;  3RFR A;  4GX2 A;  1JFF A;  4X1Y A;  3SPH A;  1IXB A;  1VQN V;  2BCC H;  2BSK A;  3QNE A;  1OCC B;  1E1Q G;  4UV8 A;  2QA4 V;  4RWU A;  2PI4 A;  4I9W A;  3O65 A;  1H2N A;  3LDE A;  1N36 B;  4W4L A;  4LF9 O;  2UU9 B;  1SQP H;  3APQ A;  4E2L A;  4O4I A;  5HFM A;  3EHB B;  2E76 B;  2OIG A;  4UVB A;  1SZX A;  2W6I G;  3P32 A;  5CBH A;  5JCO A;  4XBF A;  4TV8 A;  2OWO A;  2CUG A;  5JJE B;  2KG7 A;  1PL4 A;  1F4M A;  1BCC H;  2DYS B;  2OCC B;  5FNV B;  3L70 H;  1YEW A;  4JAS A;  1Q6H A;  3FFQ A;  5LL6 Y;  2YS8 A;  3CMA V;  4F6R B;  1I94 O;  4DR6 B;  1LR1 A;  3AEI A;  2P22 C;  2GSM B;  2ZR3 A;  4X88 A;  4GZR B;  1GN6 A;  1SF9 A;  2EBO A;  3W7S A;  2EIN C;  4QPJ A;  3H1J H;  4X64 O;  2GTS A;  2NR5 A;  3ZRS A;  3G6E V;  2YXL A;  4JTA B;  5TIS Z;  5JCO C;  1R6T A;  1L8D A;  1XRE A;  4TV9 A;  4BR6 A;  1SER A;  4H0L B;  3OT7 A;  2ODM A;  2ILM A;  3FD9 A;  4YJ2 A;  4X1I A;  3OTF A;  2Y0I A;  1SQV H;  1LUW A;  3RW0 A;  3QO7 A;  2KSD A;  1Q7Y W;  1RSO B;  1XNQ O;  4I4T A;  4WFG A;  1WB7 A;  3L9D A;  5ITZ A;  3KZI Z;  3BEH A;  1YF2 A;  3CME V;  1FAF A;  5GON A;  5LGT A;  4X65 O;  3CJH B;  4I0X A;  3CPW U;  4JGS A;  5DEC A;  3JD1 A;  3CYO A;  1IX9 A;  1BZK A;  3JAL B;  5LXT B;  4DR5 O;  1W2B U;  4X1K B;  3CRA A;  3SGI A;  1Z2G A;  2UXB B;  1FXH A;  2E5L O;  2EJ7 A;  4GYC B;  5C8Y A;  1AJQ A;  3ABU A;  1TUB B;  2XAF A;  3FAV B;  1I0H A;  5JWP A;  5IYB O;  2Y4U A;  4DV3 O;  3D36 C;  4JTD B;  2QWQ B;  4U7O A;  5KUK A;  5J2T A;  3E2E A;  3GWK C;  4PA7 A;  2LW7 A;  4IIJ B;  2D3O W;  2BE3 A;  4LF9 B;  4U3J B;  5JQG A;  3ZHQ A;  2UUA O;  3JAW B;  1NR1 A;  3C3S A;  3OFN G;  3SPG A;  4Q6G A;  2RNB A;  2YIB D;  4TOI A;  2ARH A;  1PV0 A;  4FM2 A;  1YTF D;  4IYI A;  2QEX V;  2P90 A;  5AG2 A;  3TGU H;  4JI0 O;  3K5M A;  3RYH A;  3FB6 C;  2ATK C;  2FL4 A;  1K4C C;  4JAU A;  2VQE O;  2ZIO A;  1OCO C;  2PZS A;  5H9C A;  1VQM V;  2BOC C;  3VQY A;  4MVZ A;  5GW7 A;  4JI5 O;  4QGP A;  4EB6 A;  3NR7 A;  3ZCC A;  4LC1 A;  4LFA B;  3ABL B;  5FNV A;  5CB4 B;  1R3L C;  2IH1 C;  1L1F A;  3H1H H;  5DED A;  3SPC A;  3K5L A;  3CCE V;  1K97 A;  4X64 B;  4F6R A;  4G28 B;  5EC2 C;  3RVY A;  2QJ1 A;  1WNS A;  3N27 A;  1YIT V;  5LP6 B;  4IYH A;  4JI7 O;  4K35 A;  4ZKI A;  3K57 A;  2JEX A;  1D5A A;  2IH3 C;  1AI4 A;  2HEP A;  1XNQ B;  4CC6 A;  1ZUQ A;  3ETD A;  4OXS A;  1BT8 A;  4X65 B;  2LP7 A;  3ZRW A;  4CH5 A;  2IJJ A;  2ITC C;  4JF3 A;  4LF6 B;  1YSC A;  4B3T O;  3BCC H;  4DR5 B;  2EUL A;  2XAJ A;  5IE9 A;  1EN4 A;  4DUY O;  3F7Y C;  5EYP B;  1M90 W;  2A0L A;  1ZL8 B;  3SJC C;  1KYO F;  1GM7 A;  2Q0A A;  1Q8I A;  4X89 A;  2E5L B;  3F5T A;  3CJH A;  4HZ3 A;  1WB8 A;  2FTK A;  2HKO A;  4QE9 A;  5KMG B;  3CXC U;  4H37 A;  3JAL A;  5LXT A;  2LW1 A;  4DV3 B;  5LA6 B;  2Q7G A;  2V7Q G;  1GN4 A;  3K9S A;  1GRJ A;  5B1A C;  3ZBH A;  4BW5 A;  3ZRX A;  5KX5 A;  3EXA A;  2UUA B;  1FXK C;  3FAV A;  4DR7 B;  2VRZ A;  2WA4 A;  4H33 A;  4K8Z A;  4JYA O;  4B7E A;  2W6J G;  3CB2 A;  4YXW G;  4NR1 A;  3H01 A;  4NTY A;  1V9P A;  4JI0 B;  1ZX3 A;  4IIJ A;  1UPG A;  4PJ0 Z;  4U3J A;  2VQE B;  5IJ9 B;  5JVD A;  3OEH G;  1U96 A;  2VQF O;  3W7U A;  4JI5 B;  4UCR A;  1YHQ V;  2PY5 A;  3DXR A;  1Z5V A;  5B66 Z;  1FFX B;  2QWO B;  3SYC A;  3E22 A;  2P6J A;  1VQ9 V;  3ZHR A;  3B4S A;  3ZMV A;  1CEZ A;  2Q7H A;  4DR1 O;  1OV9 A;  1AR1 B;  1JX9 A;  4JAV A;  2DYR B;  1HP8 A;  1K8A W;  3EFF K;  4B3S O;  4L8J A;  1NZ6 A;  2ZIN A;  2EZO A;  3ZN0 A;  2JEU A;  4JI7 B;  2CK3 G;  3P30 A;  1NJI W;  3W7W A;  4O4L B;  4KFM A;  4G27 B;  4DUZ O;  3ABK C;  2JDI G;  1OCR B;  1YI2 V;  5B1B C;  3LSU A;  1QLN A;  2P5O A;  3SJA C;  2UUC B;  1MSW D;  4AHC A;  5LHI A;  2RJZ A;  3CCS V;  1N34 O;  4I5S A;  4B3T B;  4MVS A;  2YXH A;  2FML A;  4DUY B;  4JI1 O;  1NTZ H;  4U3F H;  2IU0 A;  3ABT A;  3VOU A;  4P2Z A;  1NKD A;  4J9Z B;  5LMN O;  2LGQ A;  1I7F A;  3JCZ A;  4DV1 O;  4UVC A;  3UKM A;  1FKA O;  1NT2 B;  3AG2 B;  4FLT A;  1WPB A;  3OEE G;  5KHJ A;  1SQF A;  1Y66 A;  1VP7 A;  2Y0P A;  4KHP O;  4OPH A;  3ZIA G;  4LWS B;  3THO A;  5D5Q A;  4RO2 A;  2B9Z A;  4WCE V;  1CP9 A;  4ZOL A;  4JYA B;  2Q7E A;  3RVZ A;  2DWE C;  5KMG A;  3M7M X;  4FLZ A;  2ZD9 A;  3B2E E;  1GO3 F;  1XHX A;  1KU9 A;  4JZ2 A;  1XBL A;  2W0F C;  4LBE C;  1GN2 A;  2KB1 A;  1OJH A;  4H13 B;  3CHX A;  3BA9 A;  2ZT9 B;  1TUE B;  5EBW C;  1Q82 W;  4CZZ A;  2VQF B;  2Y48 A;  2FKX A;  5CBF A;  1H2L A;  3DSQ A;  4A5U B;  1VQ8 V;  1WN7 A;  4TV8 B;  4DR2 O;  1HR0 O;  2JRI A;  2KG7 B;  3UM7 A;  4EKW A;  2XAH A;  3E83 A;  1RM1 C;  4LF5 B;  1H2S B;  2UXX A;  5GTI Z;  4B08 A;  4DK0 A;  1AR5 A;  5IJ9 A;  4YIP A;  4DR1 B;  2EIM B;  1CXZ B;  2F23 A;  1XMQ O;  2ZDI A;  4ABM A;  2QE7 G;  4IL6 Z;  3JAT B;  1FFX A;  3GB7 C;  4B3S B;  5C93 A;  1QR9 A;  3KKY A;  1OHH G;  3ZHS A;  1IUR A;  1R3I C;  1XNR O;  1S72 V;  1N33 O;  1NVP D;  4DR6 O;  4UCU A;  1KUQ A;  4DUZ B;  1Q6U A;  2WWW A;  1VF6 A;  1QLE B;  3CCU V;  4JYB A;  1XHZ A;  2WLJ A;  4NKG B;  1R3K C;  1VEW A;  1WJZ A;  4PD4 F;  3K59 A;  3BPZ A;  4X1I B;  1N32 O;  2CH7 A;  2PYJ A;  3BVO A;  4PA4 A;  1N34 B;  4FIP C;  4CS2 A;  1Q6I A;  4O4L A;  2B1G A;  2WLH A;  1XEQ A;  3G6B A;  1ZLZ A;  3AG3 C;  4I55 B;  1VF7 A;  2OTJ V;  2YID A;  4JI1 B;  5ITZ B;  1TAE A;  2X6A A;  1JJO A;  3OMN B;  5GON B;  4I0X B;  3IC7 A;  1N0J A;  1RPO A;  5LMN B;  4WFF A;  3OUS A;  1Y6X A;  1F4N A;  1N8R W;  4JI3 O;  3K3W A;  2RDC A;  3T2M A;  1M57 C;  4PEL A;  3JCU Z;  3RGB A;  2RQ6 A;  5KAI Z;  2GUZ B;  2Q73 A;  4NVP A;  5CMU A;  2A79 B;  3OMI B;  1HW7 A;  2R9A A;  3O9O A;  4KHP B;  3L71 H;  2P4K A;  1QNM A;  3ETQ A;  2PGG A;  3L72 H;  4TSF G;  1OCO B;  1R3J C;  1Q86 W;  3CRQ A;  4LFC O;  1KMI Z;  4HBN A;  3X2Q C;  2Q0O C;  4TWK A;  2WPD G;  3ZMZ A;  5D5P A;  4RUF A;  1NH2 B;  1B04 A;  1K7D A;  2H94 A;  2Q67 A;  2ZE5 A;  5JQG B;  4Q20 A;  3B40 A;  4LWS A;  3E8B A;  1GH6 A;  5JJN B;  2BOB C;  4UUJ C;  1H8H G;  4JPR A;  4WBN B;  1QVF U;  4BIO A;  5IY5 C;  2YIC A;  2YC0 A;  1BL8 A;  4DR2 B;  1HR0 B;  1YJN V;  3K58 A;  3WB2 A;  4F6E A;  3RYH B;  2QWP B;  2QTO A;  4R7C A;  5EIB D;  3R65 A;  4O2A B;  3UO2 A;  4TQF A;  5JH7 B;  2FB5 A;  1PKX A;  1GMG A;  1EM1 A;  1XMQ B;  4EB6 B;  1VQP V;  2DOS A;  2Y69 B;  4K8X A;  1H2G A;  1PNL A;  4PI0 A;  2NNU A;  4IT5 A;  3DGE A;  2WLN A;  1VQ6 V;  4DK1 A;  4J9Y B;  3BFR A;  1DTO A;  3B77 A;  4ZHQ B;  1SQB H;  1BS3 A;  5DM6 V;  3SPJ A;  1XNR B;  3LNM B;  5J2U B;  3ZHT A;  1N33 B;  1Q81 W;  3RBZ A;  3TCU A;  2QWR B;  3JAM N;  3JAT A;  5CN0 A;  3ZX6 A;  4YIO A;  2F4V B;  1KB9 F;  1EFR G;  2XHB A;  4LFA O;  1AB3 A;  2YDE A;  4LF7 O;  1G4Y B;  3SJB C;  1I5X A;  3JAR A;  1N32 B;  2AW9 A;  4DV7 O;  1S5H C;  2BTO A;  2CE4 A;  1FPO A;  5LOV B;  3K79 A;  1AR4 A;  3JAK B;  5KA6 A;  2QGN A;  1WP8 A;  3FB7 C;  1E79 G;  1VAR A;  1BE3 H;  4U7N A;  1E1R G;  3QTC A;  4FFK A;  3ZRW B;  1WAZ A;  2Z3Y A;  1M4U A;  1W0J G;  1Y74 A;  2OIE A;  4JI3 B;  3RYF A;  4O2B A;  1FXV A;  4I55 A;  3LDC A;  3FYI B;  4J7Z A;  4PI2 A;  3BY6 A;  3W7X A;  3BHP A;  3AG1 B;  3D36 A;  3ZHU A;  2MK3 A;  1YJW V;  1VQ5 V;  1D5N A;  1ARO P;  2IU3 A;  2GTA A;  3CRR A;  2HLD G;  2EIJ B;  1GTO A;  1PPJ H;  4AIL C;  3FB5 C;  4LF6 O;  2N04 A;  3FX7 A;  4LFC B;  1K73 W;  3ASN C;  1MOF A;  2GUZ A;  4D7S A;  3M8A A;  1QQC A;  1S0V A;  1EZJ A;  1COW G;  4J41 A;  4PHZ A;  5KX5 B;  1SS3 A;  1W59 A;  4BAY A;  4P30 A;  3B8N A;  2EZP A;  3CCV V;  4TQD A;  2CTP A;  1T5E A;  3CC2 V;  1XUQ A;  4RAI A;  4UB8 Z;  4MVO A;  4JI8 O;  2ZKO A;  1HNX O;  3CCQ V;  2DJV A;  2M7W A;  1GN3 A;  4NB5 A;  3M99 B;  3JYC A;  2HR3 A;  4IHJ B;  4DR7 O;  5JVD B;  1Y4M A;  4DR3 O;  2UXN A;  3FYE B;  2AHY A;  1XQ8 A;  4WBN A;  3JD3 A;  1N4C A;  3DXR B;  2Z5U A;  2RCV A;  4LNU A;  2EIL C;  1MZF A;  3E22 B;  4MVU A;  4JZG A;  1RPR A;  1PM9 A;  1YTF B;  4O2A A;  5JH7 A;  3ZMT A;  1AIL A;  2OT5 A;  1P7B A;  3ASO C;  1Y67 A;  4BW9 A;  3QO8 A;  2LQT A;  5H2F Z;  2OTL V;  4KL1 A;  2K9P A;  4KUM A;  3J81 N;  3WG7 C;  4PA9 A;  1XDC A;  1I5Y A;  3D3Q A;  4LF7 B;  2VWK A;  3LUT B;  3OAA G;  1VQO V;  1S3J A;  5H5N A;  4CH6 A;  2IJH A;  4DV7 B;  5KHH A;  4ZHQ A;  2Q6A A;  2H8P C;  5J2U A;  1R1B A;  4QIW F;  2Q69 A;  1JQ0 A;  3VBB A;  3MHH C;  1H2K A;  1KC8 W;  3FB8 C;  4GX1 A;  3H9V A;  1B06 A;  2P7T C;  1DLB A;  4HAM A;  4EEQ A;  1ZWI C;  4J10 A;  5EIB C;  3AG4 B;  1SQQ H;  3S3W A;  3UO3 A;  5LOV A;  1MA1 A;  1FS0 G;  3JAK A;  2D2C B;  2X6C A;  2GV9 A;  5B1O A;  3ZED A;  2RMK B;  3CCR V;  2L35 A;  2YSU B;  1H8E G;  4FLW A;  1OZ0 A;  2UUC O;  3A0B Z;  3J80 N;  1FXK A;  2HJF C;  4DXW A;  3OW2 U;  3A2F A;  4JV5 O;  1XMO B;  3CC7 V;  3A0H Z;  4FK5 C;  2OCC C;  1S76 D;  1MZE A;  1K3E A;  4GT1 A;  4W4K A;  2QKA A;  4JYC A;  1RM1 B;  4D6T H;  2PTM A;  5LBQ A;  3RT3 C;  2Q68 A;  4ZOL B;  3UQ8 A;  1ZAU A;  4JI8 B;  5KA5 A;  1YCI A;  1P49 A;  2VS0 A;  1HNX B;  3DC6 A;  3QO5 A;  2AZ0 A;  4PDM A;  4JYY A;  1K5S A;  2A9H A;  4UB6 Z;  4DR3 B;  2CTR A;  4HNA A;  3U11 A;  2ZE8 A;  1V55 C;  5EBL C;  1Q90 D;  1IBM O;  1JA8 A;  4MTF A;  1FJG O;  2HG5 C;  2PF4 E;  2WA3 A;  2YIA A;  4IHJ A;  3K0G A;  1EBO A;  3HKE B;  1SC5 B;  3K5N A;  3CP1 A;  5JJJ B;  3DC5 A;  2B1I A;  3AG3 B;  2A06 H;  2AXT Z;  4LF5 O;  2YIB A;  3P3N A;  3WB0 A;  4NXN O;  3FKS G;  2AGA A;  2DN9 A;  4K0K O;  3C90 A;  1YVW A;  2R70 A;  2DWD C;  4P9O A;  2C2A A;  5CA1 A;  2QKC A;  4GCZ A;  1M57 B;  1EZV H;  3H1L H;  3WB1 A;  3RYI A;  4PDL A;  2QKS A;  2ZNI A;  4ASU G;  2UXD O;  3T1Y B;  4GKJ O;  1Q3E A;  4UV9 A;  2CH7 B;  2RN9 A;  2DQ0 A;  2YEV B;  3U10 A;  2JS3 A;  1Q43 A;  3H1I H;  3AG7 A;  3I56 V;  3OR7 C;  4I50 A;  5CBG A;  3T4Z A;  2HFE C;  3OMA B;  1K33 A;  1JMK C;  4ZIB A;  4LF4 O;  5E79 Z;  1QVG U;  3OGC C;  4FVM A;  1THZ A;  5FPO A;  1XOU A;  4JV5 B;  4X8A A;  3GWO A;  2XUM A;  2ZR2 A;  1F7Y A;  5BMV A;  1NR7 A;  1J95 A;  1VQL V;  2P67 A;  4B7K A;  4J7J A;  4JI4 O;  2F66 C;  4OPA A;  3JD0 A;  5H6R A;  1FD9 A;  4WFA V;  4ICG A;  1IZ3 A;  2N74 A;  3T1C A;  1JPX A;  4J42 A;  4MVR A;  4RQF A;  1AVM A;  3ETG A;  3K04 A;  1MNG A;  2MW2 B;  3B09 A;  4LH7 A;  1M5I A;  4DV4 O;  2AZ2 A;  5LP6 C;  1IBM B;  1R6K A;  3BRC A;  4DRX B;  1FJG B;  4FM1 A;  3JSN A;  3BAB A;  5KHG A;  2ZM6 O;  4CBC A;  5IT9 N;  1QHT A;  2ZCE A;  3KCY A;  3E8F A;  2EIN B;  2F95 B;  1YZB A;  1BQZ A;  3N2K A;  5L3F A;  3L75 H;  3VQV A;  1GKF A;  3SYQ A;  3CSX A;  1VMG A;  4NXN B;  3CX5 F;  4DW1 A;  4FLU A;  4K0K B;  4QPK A;  1KBH A;  1M56 C;  4X62 O;  3Q4H B;  3HKE A;  5CA0 A;  3CRC A;  3K0D A;  1JOY A;  1RFY A;  2EIK C;  4UCT A;  1P7G A;  2V1D A;  3SR2 C;  2UXD B;  3JAR B;  1KP2 A;  4GKJ B;  2L6L A;  3B8M A;  4UCV A;  3W7T A;  1N0N A;  2JJ1 G;  4BWA A;  5FPR A;  1Y76 B;  2XAQ A;  1TGO A;  3HPL C;  4FM0 A;  1WA8 A;  2B5U A;  2F4V O;  4X9Q A;  2QWN B;  3AK3 A;  3ASN B;  1NS1 A;  1YXB A;  4GKK O;  4Z1M G;  1G8M A;  3D8C A;  4LF4 B;  4FPP A;  1M9N A;  3S3X A;  3HKD B;  5B5E Z;  1Y74 B;  4O4H B;  2YEV A;  1GK9 A;  3OE7 G;  3RYF B;  1RP3 B;  4O2B B;  2QTS A;  3HB3 B; 
#chains in the Genus database with same CATH homology
 2IH3 C;  1AI4 A;  3ZRW B;  2Z3Y A;  3E86 A;  1PD3 A;  1W0J G;  5IY5 B;  4MS2 A;  3CCJ V;  1PNK A;  3A0R A;  3ETD A;  3CD6 V;  4R8C A;  1FXV A;  4OXS A;  3LDC A;  5EC1 C;  3FYI B;  1IXM A;  4UXN A;  3BY6 A;  3W7X A;  3AG1 B;  3D36 A;  3ZJZ A;  5IYD O;  2LP7 A;  2MK3 A;  1YJW V;  3STL C;  3ZRW A;  1ARO P;  2IU3 A;  1VQ5 V;  2IJJ A;  2ITC C;  4JF3 A;  3ETE A;  1CPY A;  1YSC A;  4MTG A;  2HLD G;  1K92 A;  2EIL B;  2EIJ B;  1GTO A;  5L3B A;  3ABL C;  3FB5 C;  1VQK V;  2XAJ A;  2ZXW B;  3F7Y C;  3SPI A;  1K73 W;  2XND G;  1M90 W;  2A0L A;  3ASN C;  2IW5 A;  1GM7 A;  1MOF A;  2X7R B;  4X89 A;  4XDL A;  2LFS A;  3K08 A;  1S0V A;  1EZJ A;  4HZ3 A;  1BMF G;  2FTK A;  3LSQ A;  1COW G;  1KD1 W;  4WF9 V;  2HKO A;  4QE9 A;  1JVM A;  4MTO A;  4BAY A;  2QM7 A;  4P30 A;  3CXC U;  3WG7 B;  4H37 A;  5LHH A;  3B8N A;  2DW4 A;  2EZP A;  3JD2 A;  3CCV V;  5L3E A;  1WLE A;  2V7Q G;  3CC2 V;  2WLL A;  1VQ4 V;  4RAI A;  5B1A C;  4MVO A;  3AG4 C;  4FJC C;  4BW5 A;  3ZRX A;  5CA3 A;  2WLM A;  3CCQ V;  2M7W A;  1FXK C;  3F5W C;  3M99 B;  1BHB A;  3JYC A;  2HR3 A;  4H33 A;  2W6J G;  1AI5 A;  4YXW G;  1PNM A;  1Y4M A;  3H01 A;  2UXN A;  3FYE B;  4MT8 A;  1K4D C;  2AHY A;  2IJK A;  3E89 A;  2WAM A;  3JD3 A;  5H6Q A;  2Z5U A;  1YIJ V;  5LGU A;  2EIL C;  1AI7 A;  4MVU A;  2WLI B;  1WPX A;  3T4D A;  5LGN A;  1RPR A;  3ML0 A;  2ZXW C;  3OEH G;  1QBZ A;  1YTF B;  2K1E A;  2JJ2 G;  3W7U A;  5HFL A;  5IDJ A;  1YHQ V;  2HVK C;  3OUF A;  3ZMT A;  2OT5 A;  2X0L A;  1P7B A;  3ASO C;  3SYC A;  3QO8 A;  3OR6 C;  1K9M W;  2P6J A;  2EJR A;  3DTU B;  2OTL V;  1VQ9 V;  3OM3 B;  4MW8 A;  4KUM A;  3ZMV A;  3WG7 C;  4G2K A;  4LCU C;  5B1N A;  1CEZ A;  2QM8 A;  3AG2 C;  4PA9 A;  1I5Y A;  3ABM B;  3LUT B;  3OAA G;  1VQO V;  3PJS K;  1KKD A;  5L3C A;  1S3J A;  1S77 D;  5DN6 G;  2IJH A;  4GX5 A;  1NBM G;  1AR1 B;  2Q6A A;  1JX9 A;  2H8P C;  2DYR B;  4JAV A;  4QIW F;  1NVP B;  1K8A W;  5L3D A;  3EFF K;  2Q69 A;  1SRY A;  4PA3 A;  1JQ0 A;  2EZO A;  3ZN0 A;  3VBB A;  2JEU A;  5IYC O;  2CK3 G;  3MHH C;  1AI6 A;  3P30 A;  1KC8 W;  3FB8 C;  4GX1 A;  1NJI W;  5E1A C;  4PDV A;  2P7T C;  1DLB A;  4HAM A;  3W7W A;  5B1A B;  2F43 G;  4KFM A;  1ZWI C;  4G27 B;  4WFE A;  3AG4 B;  1DF4 A;  4TT3 G;  3ABK C;  2JK5 C;  2JDI G;  1OCR B;  2GHY A;  1FXK B;  1YI2 V;  1M1K W;  1FS0 G;  5B1B C;  2X6C A;  1QCE A;  2ZDI C;  3CCL V;  1QLN A;  3JD4 A;  4GX0 A;  5B1O A;  1MSW D;  4HYO A;  1V55 B;  3LSS A;  5LHI A;  3CCR V;  3CCS V;  4JTC B;  1QR8 A;  1GM9 A;  2YSU B;  1H8E G;  4LP8 A;  1OZ0 A;  4I5S A;  4L87 A;  4MVS A;  5KUM A;  1R6N A;  1FXK A;  2EIM C;  2HJF C;  4DXW A;  3SYP A;  3OW2 U;  4PDR A;  4XDK A;  5B3S B;  3ABM C;  3CC7 V;  5LHG A;  1XL6 A;  1KQS U;  4FK5 C;  1NQT A;  2OCC C;  4PA6 A;  2IU0 A;  1S76 D;  3ABT A;  3SYO A;  1OCZ B;  1K3E A;  4GT1 A;  4R6Z A;  3VOU A;  2DYR C;  3I55 V;  1GM8 A;  1ROP A;  4P2Z A;  4RUE A;  5FL7 G;  1NKD A;  1MAB G;  4J9Z B;  4JYC A;  3ASO B;  3TET A;  1RM1 B;  4F4L A;  1V54 B;  5LBQ A;  3JCZ A;  2Q68 A;  4UVC A;  3UKM A;  3MD0 A;  4MW3 A;  1DF5 A;  3AG2 B;  2NLJ C;  1R73 A;  4DO2 A;  3OEE G;  3E8H A;  1QLE C;  1Y66 A;  3SYA A;  5KA5 A;  1JCH A;  3ZIA G;  1NH2 D;  5L3G A;  3QO5 A;  1H38 A;  4RO2 A;  4WCE V;  4PDM A;  1CP9 A;  1KP3 A;  1OCR C;  4P9P A;  1ENV A;  1K5S A;  3RVZ A;  2DWE C;  1W0K G;  1AJN A;  2A9H A;  1UJW B;  2DQ3 A;  1MG1 A;  2ZD9 A;  4GX2 A;  1GO3 F;  1SZT A;  1V55 C;  3SPH A;  5EBL C;  1VQN V;  2W0F C;  3QNE A;  4LBE C;  1OCC B;  4XDJ A;  5BZB A;  2KB1 A;  1E1Q G;  4MTF A;  4QJF B;  4UV8 A;  2QA4 V;  1TUE B;  2HG5 C;  2PI4 A;  3ABK B;  4I9W A;  5EBW C;  1Q82 W;  4CZZ A;  3LDE A;  5B3S C;  1LNQ A;  2Y48 A;  3E8G A;  3K0G A;  5B1B B;  1EBO A;  4MTX A;  2HVJ C;  5CBF A;  3K03 A;  3CC4 V;  4QNH B;  1VQ8 V;  2JIZ G;  1OCZ C;  3CP1 A;  3UM7 A;  4EKW A;  2XAH A;  3E83 A;  4E2L A;  1RM1 C;  2B1I A;  3AG3 B;  2UXX A;  1V54 C;  5HFM A;  3EHB B;  2WLI A;  2EIM B;  4UVB A;  3FKS G;  1ORQ C;  1BHA A;  2ZDI A;  2W6I G;  3P32 A;  2ITD C;  5CBH A;  2QE7 G;  4XBF A;  3CCM V;  1JJ2 U;  1F4M A;  2DWD C;  2DYS B;  2OCC B;  4P9O A;  2C2A A;  3K06 A;  3E35 A;  3GB7 C;  5C93 A;  1QR9 A;  4JAS A;  4BIZ A;  4GCZ A;  1M57 B;  1OHH G;  3LDD A;  3CMA V;  4PDL A;  2QKS A;  4ASU G;  4MVQ A;  1R3I C;  2ZQM A;  3AEI A;  1S72 V;  4UV9 A;  3ZRV A;  3F7V C;  1F23 A;  1NVP D;  2GSM B;  2ZR3 A;  1OCC C;  2DQ0 A;  2WWW A;  2YEV B;  1QLE B;  4KP4 A;  4X88 A;  3CCU V;  1B6Q A;  4JYB A;  3I56 V;  3OR7 C;  2WLJ A;  1R3K C;  5CBG A;  2EBO A;  2IJI A;  3T4Z A;  2HFE C;  4MSW C;  3KG2 A;  3W7S A;  3OMA B;  1KEC A;  1K33 A;  2EIN C;  4QPJ A;  3STZ C;  4PA4 A;  3ZRS A;  3G6E V;  2XOK G;  4JTA B;  1QVG U;  3OGC C;  4FIP C;  2B1G A;  2WLH A;  1THZ A;  1SER A;  3AG3 C;  3WFV A;  4N21 A;  2OTJ V;  1XL4 A;  4X8A A;  3GWO A;  4WFH A;  2X6A A;  2Y69 C;  3G71 V;  2WSS G;  3OMN B;  3RW0 A;  1SET A;  3QO7 A;  2ZR2 A;  3IC7 A;  1Q7Y W;  1RPO A;  2DYS C;  5EBM C;  4WFF A;  3OUS A;  4WFG A;  1NR7 A;  1F4N A;  1N8R W;  1J95 A;  2XAG A;  3K3W A;  1VQL V;  1K34 A;  3T2M A;  1AJP A;  1M57 C;  2P67 A;  4PEL A;  3BEH A;  3CME V;  3JD0 A;  5CMU A;  3D3I A;  5LGT A;  2A79 B;  3OMI B;  1M56 B;  5H6R A;  3CPW U;  4JGS A;  4WFA V;  3MHS C;  3JD1 A;  3T1C A;  3CYO A;  1JPX A;  4MVM A;  1F51 A;  1OCO B;  4TSF G;  1W2B U;  4MVR A;  4RQF A;  2EIK B;  3IGA C;  1R3J C;  2WLL B;  1Q86 W;  3ETG A;  3K04 A;  3X2Q C;  3SJQ C;  1FXH A;  4TWK A;  2WPD G;  3ZMZ A;  3IFX A;  4RUF A;  2XAS A;  1NH2 B;  1AJQ A;  2WLK A;  3ABU A;  2XAF A;  1K7D A;  4BIU A;  2PI5 A;  2H94 A;  1R6K A;  2Q67 A;  1HWY A;  4Q20 A;  5IYB O;  3E8B A;  4JTD B;  4U7O A;  5KUK A;  2BOB C;  4CBC A;  4UUJ C;  1H8H G;  4JPR A;  4FMT A;  4PA7 A;  1QVF U;  3E2E A;  3K9A A;  4R50 A;  5IY5 C;  3E8F A;  2D3O W;  1BL8 A;  2EIN B;  1YJN V;  2X6B A;  2AHZ A;  5EK0 A;  2QTO A;  1NR1 A;  5L3F A;  4R7C A;  2R9R B;  3R65 A;  3OFN G;  3AG1 C;  3SPG A;  1GKF A;  3SYQ A;  3G4S V;  4N23 A;  1PKX A;  1GMG A;  1K5Q A;  1YTF D;  2QEX V;  2P90 A;  4QE7 A;  4QPK A;  1VQP V;  1M56 C;  2EIJ C;  1VQ7 V;  2Y69 B;  5J9P C;  1H2G A;  1PNL A;  3FB6 C;  2ATK C;  3K0D A;  1SES A;  1K4C C;  4ZBM A;  2NNU A;  4JAU A;  4WFB V;  3DGE A;  1OCO C;  2WLN A;  1JOY A;  2EIK C;  5H9C A;  1VQ6 V;  1VQM V;  2BOC C;  4J9Y B;  3ZMU A;  4MVZ A;  2V1D A;  1DTO A;  5GW7 A;  3B77 A;  1P4R A;  3ZCC A;  3ZN1 A;  5DM6 V;  3SPJ A;  1KP2 A;  3LNM B;  4RQE A;  3B8M A;  3W7T A;  2JJ1 G;  1Q81 W;  3RBZ A;  3TCU A;  4LC1 A;  1PL0 A;  5CN0 A;  2XAQ A;  1EFR G;  3ABL B;  3HPL C;  1R3L C;  2B5U A;  2IH1 C;  3NXS A;  1L1F A;  2LFR A;  1G4Y B;  3ASN B;  3SPC A;  1I5X A;  3CCE V;  1K97 A;  4G28 B;  4Z1M G;  1YJ9 V;  1G8M A;  5EC2 C;  1S5H C;  3X2Q B;  4FPP A;  3RVY A;  1M9N A;  3K79 A;  1YIT V;  3ZMS A;  2R9I A;  5KA6 A;  2YEV A;  1GK9 A;  3OE7 G;  3TK1 A;  3FB7 C;  1E79 G;  3HB3 B;  4UVA A;  4ZKI A;  4U7N A;  2JEX A;  1E1R G;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...