2ZDJA

Crystal structure of ttma177, a hypothetical protein from thermus thermophilus phage tma
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
MKMRKLVKDFGDDYTLIQDSQEVKAILEYIGSEEEPHALFVKVGDGDYEEVWGIDSFVPYNFLEAYRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of TTMA177, a Hypothetical Protein from Thermus thermophilus phage TMA
rcsb
source organism Thermus thermophilus phage tma
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTMA177
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.450 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2zdjA00
2ZDJA
chains in the Genus database with same CATH superfamily
1O7PB 1V58A 1VQQA 1E97A 1ROAA 2W56B 4FCZA 4QWTA 3N54B 5IG3A 1O7GB 4LZIA 3CCE3 3KFQC 7RNTA 1NB5I 1BUJA 1OF5B 1KQS2 1ZS7A 3S29A 1X1WA 3BB9A 4JRFA 2CFWA 3UL6A 1C7HA 3EJVA 3F8HA 3Q90A 1MWTA 5IG5A 1Q7Y4 3D9RA 5G2GA 1T2IA 1YGEA 1BNEA 1BRGA 3OWYA 5FGOA 4BTYA 3WMDA 4STDA 1KC84 1N9EA 3OW22 4RNZA 7STDA 3DM8A 3NM7A 3G6E3 3LXUX 1CEWI 3CU3A 3GRDA 1LQGC 3HX8A 1LVNA 1R4CA 4N6OB 3ZG5A 3MSOA 2OOVA 2F99A 3SOAA 4FR9A 3IJEB 2RFRA 4XBYA 1YGWA 3KCHA 1O7WB 2RGQA 1UDII 5HOHA 3CCV3 4XDVA 2E2TA 1B20A 1BNJA 4HOHA 3MKIA 2V1LA 3BNBA 4HM1B 3FKAA 2OQEA 3CXC2 1HU9A 5M19A 3LMLA 3WDGB 4XBTA 1HKXA 1BVIA 4FCJA 4RZMA 2R41A 1VQ83 1RHLA 1OGZA 1IQXA 1JNQA 2WGOA 1GD4A 2XSOB 1S723 1M1K4 4FMDA 1OHOA 2Z76A 3G0KA 1FA3A 1FGOA 1GOVA 1GY5A 1LNHA 2F56A 2OOVC 2QGUA 1W4NA 1WNHA 1BRNL 3KZTA 3WHOA 1FGRA 1X1UA 2QEX3 5IEPA 3AHSA 3D5GA 3HK4A 1D6YA 2CFGA 3FLJA 2F98A 1JKGB 5A0OB 5AEWB 4HZ9B 3EB8A 5CLKA 1BSBA 2M7OA 2CWUA 3DXOA 4X2HA 1GSPA 2AADA 2FGTA 1IVUA 3FGYA 2GU1A 1FZUA 3PYJA 1DMQA 1M1XB 1MWSA 2L1SA 3OV4A 1JRQA 4ILFA 1JB5A 5BU4A 1UUGB 1DVCA 4N3VA 5AIGA 2Y74A 3Q2PA 4GSPA 2ZHXB 3BLZA 2PZVA 2WOHA 3DH2A 3SXXA 4FMBA 1Z1SA 5CK6A 1IVVA 1BIRA 1N8QA 2KXGA 2WOFA 3SOYA 8RNTA 1T2HA 3F8XA 4HYZA 2Q07A 4HM0B 3OWUA 4TX4A 3D5IA 1JB4A 1W6GA 1W01A 3AMOA 2RSXA 1WMPA 4CJNA 1CQSA 1RSNA 1OGXA 2CWVA 1UW1A 1CH0A 1GY7A 2XEPA 3UB1A 3CCU3 1GMQA 3FG3A 3K7CA 4OUQA 2LYXA 5STDA 3OX9A 2PNCA 1IT8A 2KAAA 1I3FA 2B24B 1DE3A 1PFPA 1QAKA 3BIRA 4HM6B 1QVF2 3LTCA 2KF6A 3LOYA 1D6UA 1LNIA 1FUTA 2UUGC 4BTWA 1I2GA 4EV5A 4HVNA 1RTUA 2P0MA 3SLUA 1BNSA 2IUKA 5IEOA 1B21A 2YFLB 1KWIA 1BRHA 3I0YA 1YJ93 2OTJ3 1QJGA 1TP6A 2O3OA 4N6TA 1TJDA 1DYUA 3CME3 9RNTA 3FF0A 3V92A 4AKYA 1K28A 1O7HB 1Q40B 3MG1A 4HBRA 2STDA 1O7NB 4K90B 3WA2X 1B2XA 3GSPA 2CK3H 2W6JH 3B7CA 5IG0A 4X2OA 1I2FA 3B4PA 1JB2A 1MOLA 4GL6A 5BIRA 3LZAA 5D81A 3S67A 3X42A 2K0MA 1RGCA 3NV0A 2HMNB 2SARA 3CCM3 1A2PA 5IG4A 4RBNA 4MJDA 3U97A 1EUIC 1JV2B 1MWRA 3WOFB 1A2VA 1S5AA 4HM4B 4WP5A 1KSIA 2P05A 1RLSA 1BAOA 3ALAA 1UCLA 5AIHA 2KRTA 3F14A 2J8XB 2HMKB 1V74A 3U1WA 1OCVA 2F5MA 3NM2A 4WHAA 1UGHI 1VQN3 3JUOA 1B2UA 1Q40A 4OK0A 1FGTA 3ROBA 3DGYA 4IT7A 3KN4A 3HI7A 5I97A 5IF6A 4O8SA 2GBXB 1IK3A 1BSDA 3H51A 1RGLA 1OHSA 3FG1A 1ZX2A 3H3HA 3NBJA 4BL3A 4CCVA 1SIIA 1MGRA 1QVG2 4HKVB 3CC43 2YX9A 3CNXA 4L7KA 4LEHA 1BSAA 1W00A 2OQEC 2XRXB 3MPHA 3PS8A 4XB5A 1GY6A 1UI7A 2CG0A 2XH9A 1DVDA 4IIAA 3CPOA 1LXEA 1RGEA 1W2B2 3EHCA 2YFIB 1TFKA 3MG2A 3NBRA 1UUVB 4N6MA 4EV2A 1TIJA 3HOHA 3DGMA 2CW9A 3E99A 1PYLA 1M904 1OUNA 3MYTA 1VQ63 3K63A 3T8NA 4O3VA 2W9PA 2H0HA 3ZFZA 1Q42A 1DETA 4LSOA 3V98A 1TRQA 1UI8A 2W03A 3KIIA 4R1KA 1FGMA 4HZBB 6RNTA 1AY7A 3J7Yd 4RNYA 3FF2A 3NXJA 3V99A 5CF2A 1JN5A 3PGBA 2B1XB 4R9LA 3X3ZA 3S27A 3OWSA 3X40A 3LTDA 3CC73 1ROVA 5JBSA 4HM7B 5HGRA 2D42A 1VZZA 1KD14 3SX1A 4HJLB 3D3LA 4GB5A 2MC8A 1MWUA 1W5ZA 2KF3A 1GOUA 3EBYA 3PXMA 3ZG0A 4BTXA 1Q7HA 2BIRA 1A2KA 2BNGA 2GBWB 2XSHB 5RNTA 1Q824 2GXFA 4XDWA 2F86B 2E2UA 1R4YA 1US1A 3BNDA 4CDLA 1ZO2A 4O2HA 5TGNA 4I4KA 2BMOB 3Q1CA 5G1LA 3EF8A 4BU4A 5ELJA 2XGLA 1FUSA 1UUWB 1MNLA 2CFKA 5AYSC 1V57A 4N6UA 4AKZA 2UX0A 3A5EA 1AVLA 2IY2A 3AHWA 3JUMA 2KF4A 1VQK3 2CFDA 1B3SA 1BSEA 3NBBA 3D79A 1SPUA 1YNVX 3MWZA 1NJI4 5KP4A 3DGOA 3DY5A 3NQZA 4MMYB 1GOYA 2O9UX 4HM2B 1FYSA 1LOWA 1WTHA 2BMQB 3QK9A 4LMIA 4R9KA 1B2MA 3UNLA 1EQKA 4GHOA 4ZM8A 2CFLA 1U8CB 3F7XA 1AVKA 1LOVA 4U13A 3I553 3EQQB 2F4YA 3GZBA 3GZYB 3CPW2 1YHQ3 3N9HA 1Q864 5AYRB 3CMA3 2QA43 2RBIA 1X1XA 2JQ5A 4G1MB 3X3XA 3NUVA 2C4BA 1FW7A 4PEJA 1EKMA 1BOXA 2F5WA 1RJOA 1T5YA 3EC9A 1YVSA 1WMOA 1IQ8A 2CKFB 2GSPA 1O7MB 3F9SA 4CPKA 4KT3B 3JUNA 2CX0A 2IYJA 3IMAB 3EX9A 3JUPA 2ZL8A 3A76A 1OPYA 3AMOB 3IPTA 4HM8B 5AI1A 1NDOB 3GZRA 2QIYA 3DGNA 1PU4A 2C11A 5ELUA 1J2BA 2R4IA 4BIRA 3EN8A 1BANA 3HZPA 3RGAA 3M8CA 3K0ZA 3QRDA 4EBGA 1G02A 1I0XA 3HIGA 1BRKA 3PCRA 5EQLA 3NHXA 1NU3A 1EEJA 3EBTA 2P38A 3URPA 5CXOA 1NNVA 4MEIA 2E2VA 4NHFA 3VSYA 4KFEA 4L8PA 1LOXA 2IMJA 7GSPA 1K8A4 3X3YA 4WYKB 3CCL3 1Q814 3FG4A 3MG3A 3RDEA 1F8NA 1RN1A 3BU4A 3O8YA 3DUKA 3LTBA 1CYVA 4J5KA 1OACA 2XGNA 1ULJB 3K9MC 2JDIH 4AEQA 2OCTA 1QALA 5JPUA 1B27A 3Q3FA 2BHMA 3I563 4DKIA 5KP3A 1T3BA 2P0XA 2ML5A 3CCR3 4K1UA 1YIT3 5EVHA 3L0RA 1K9M4 1TU5A 1W2ZA 3DGLA 2HMMB 1RGAA 3CCJ3 1GMPA 5AEUB 1N9JA 1TUHA 1U5OA 4MMZB 5EEOA 1GYBA 4IPBA 1TTOA 4MMXB 3F7SA 1RGHA 4KVHA 4FCMA 1IQYA 1E3VA 2HOHA 1VQO3 1MGWA 6GSPA 3LT8A 2P09A 2ZA4A 1IDPA 1YVBI 3DMCA 3T8UA 1BSCA 2YFJB 4J9AA 4N6NB 4EC6A 1VQ53 3S28A 1G96A 3B8LA 5IW9A 5GSPA 3VGNA 2C10A 4L8OA 1NB3I 3G8ZA 3S5CA 4FMAA 1ASKA 3PCSA 1YI23 1ULIB 1SJWA 2IUJA 3LTAA 1JBRA 3GZXB 1EG9B 4EW5A 2BO9B 3LH4A 1YIJ3 1IVXA 2CC3A 1ISKA 4HM5B 1OHPA 1I3IA 1W6CA 5LC7A 2KF5A 1BNIA 1I0VA 1IYYA 4HAAA 2XFSA 1YJW3 1VQ93 3CD63 3NQYA 1E3RA 1BGSA 1GS3A 1UCIA 4LYLB 3AGOA 1GD3A 2XR8B 4N6LA 2CIUA 3HIIA 3WODG 1IU7A 1RGKA 2CX1A 2SBLA 2RNTA 1K734 1Y4KA 2K54A 5BVBA 1RGGA 1CYUA 1AR0A 5IENA 1QMAA 1EA2A 2ML6A 2H0GA 3BNCA 5D82A 2HMJB 2Z6BA 3FH1A 1IT7A 2GEXA 3G16A 3LYGA 3TDGA 1VQL3 1A90A 4OVMA 3RGRA 3ER7A 3UJMA 3FCSB 5JPPA 1DMNA 1B2ZA 1FUWA 1G0TA 1BNFA 2W9QA 3K5TA 2L4VA 1RCLA 2Z77A 2WO0A 1VQM3 5KP1A 2IA7A 4FMCA 5FW5A 1SQWA 2WGQA 5DREA 3WOEB 2MF7A 1FGQA 1GMRA 2Z7AA 1OF5A 3GWRA 1RN7A 1BRIA 4N6V0 4WFOA 5LC6A 1W02A 2HMLB 1WMNA 2BT3A 2KCDA 4KFDA 5G1KA 2CWTA 3UL5A 3BNEA 2W04A 4JF8A 1LOYA 2HMOB 4LGQA 2H0IA 4XBXA 1HZ1A 3EN1B 4K61A 1IV7A 1UGIA 2BMRB 3KSPA 4O02B 1SIHA 3N8BA 4I5QA 4J5GA 3JVCA 3NX0A 1LRAA 1RCKA 1UCKA 8CHOA 1RNBA 4NPBA 4R4KA 4NREA 1ZGXA 3G4S3 3STDA 3CCQ3 2GU3A 1A67A 3DZLA 2D1WA 3SYUA 3OXAA 1W6YA 1I70A 1NO3A 2K3DA 1X1YA 1B2SA 1WQLB 3G713 1N5HA 1IVWA 2OTL3 3FSDA 4WYKA 4WWUC 4HM3B 3WR2A 3JUQA 1HYFA 2INXA 1JKGA 2A15A 4K1VA 1N5PA 1W7CA 4RNTA 1RKYA 1YJN3 3B4OA 1BUQA 1L5GB 1STFI 2GEYA 3ECFA 1K41A 2XF3A 2UGIA 3SEDA 3X41A 2FXTA 4EXRA 1RDSA 4H3UA 2I9WA 5IERA 2OWPA 2CH9A 1STDA 4H61A 2BU4A 4KZ1A 1SARA 3D4AA 1BRSA 1JN5B 1DMMA 5M18A 1OH0A 1NWWA 3WA3A 1UCJA 1IV9A 2Y73A 3T0UA 6STDA 2LQVA 3CCS3 1RMSA 1I8VA 1RRHA 5D83A 3PZWA 1JBSA 2AAEA 1VQ73 1TFOA 2W2CA 4Q53A 1Q9EA 5AIIA 3CC23 1BU4A 2XFTA 3NV0B 4R80A 1RN4A 1PY3A 2RCDA 1AQZA 2W56A 4J8TA 5BXQA 1N8R4 1TRPA 1BRJA 2CHCA 2CG1A 4BL2A 5AIFA 1JJ22 1VQ43 4ORLA 3GAXA 1LQMB 3EE1A 1I2EA 1BNRA 1BNGA 3RNTA 3VF1A 1VQP3 3AGNA 3MHEA 1JZOA 1M9GA 3SVAA 3KSED 4KFFA 1RGFA 5DRVA 3F40A 1JZDA 1C54A 3LT9A 4EYCA 1RRLA 5M1AA 5CF1A 2ZDJA 3KKGA 1QAFA 2W0QA 1RNTA 1D6ZA 3CNMA 3FZWA 3KE7A 1AV4A 1JBTA 4XM4A 2FNQA
chains in the Genus database with same CATH topology
1O7PB 4FCZA 4QWTA 1E97A 1ROAA 2W56B 3N54B 5IG3A 1O7GB 4LZIA 3CCE3 3KFQC 1NB5I 1OF5B 1KQS2 3S29A 3BB9A 4JRFA 2CFWA 3UL6A 1C7HA 3EJVA 3F8HA 3Q90A 5IG5A 1Q7Y4 3D9RA 5G2GA 1YGEA 3OWYA 5FGOA 4BTYA 3WMDA 4STDA 1KC84 1N9EA 3OW22 4RNZA 7STDA 3DM8A 3NM7A 3G6E3 3LXUX 1CEWI 3CU3A 3GRDA 3HX8A 1LVNA 1R4CA 4N6OB 3MSOA 2OOVA 2F99A 3SOAA 4FR9A 3IJEB 2RFRA 4XBYA 3CCV3 1O7WB 2RGQA 4XDVA 2E2TA 3MKIA 2V1LA 3BNBA 4HM1B 3FKAA 2OQEA 3CXC2 1HU9A 3LMLA 3WDGB 4XBTA 1HKXA 4FCJA 4RZMA 1VQ83 1OGZA 1IQXA 1JNQA 2WGOA 1GD4A 2XSOB 1S723 1M1K4 4FMDA 1OHOA 2Z76A 3G0KA 1FA3A 1FGOA 1GY5A 1LNHA 2QGUA 2OOVC 1W4NA 1WNHA 3KZTA 2QEX3 1FGRA 5IEPA 3HK4A 1D6YA 2CFGA 3FLJA 2F98A 1JKGB 5A0OB 5AEWB 4HZ9B 3EB8A 5CLKA 2M7OA 2CWUA 3DXOA 4X2HA 2FGTA 1IVUA 3FGYA 2GU1A 3PYJA 1DMQA 1M1XB 3OV4A 1JRQA 1JB5A 1DVCA 4N3VA 5AIGA 2Y74A 3Q2PA 3BLZA 2PZVA 2WOHA 3SXXA 4FMBA 1Z1SA 5CK6A 1IVVA 1N8QA 2KXGA 2WOFA 3SOYA 3F8XA 4HYZA 2Q07A 4HM0B 3OWUA 4TX4A 1JB4A 1W6GA 1W01A 3AMOA 2RSXA 1WMPA 1CQSA 1OGXA 2CWVA 1UW1A 2XEPA 1GY7A 3UB1A 3CCU3 3FG3A 3K7CA 4OUQA 2LYXA 5STDA 3OX9A 2PNCA 1IT8A 2B24B 1PFPA 1QAKA 4HM6B 1QVF2 3LTCA 3LOYA 1D6UA 4BTWA 4EV5A 4HVNA 2P0MA 3SLUA 2IUKA 5IEOA 2YFLB 1KWIA 1YJ93 3I0YA 2OTJ3 1QJGA 1TP6A 2O3OA 4N6TA 3CME3 1DYUA 3FF0A 3V92A 4AKYA 1K28A 1O7HB 1Q40B 3MG1A 4HBRA 2STDA 1O7NB 4K90B 3WA2X 2CK3H 2W6JH 3B7CA 5IG0A 4X2OA 3B4PA 1JB2A 1MOLA 4GL6A 3LZAA 5D81A 3S67A 3X42A 2K0MA 3NV0A 2HMNB 3CCM3 5IG4A 4RBNA 4MJDA 3U97A 1JV2B 3WOFB 1A2VA 1S5AA 4HM4B 4WP5A 1KSIA 2P05A 3ALAA 5AIHA 2KRTA 3F14A 2HMKB 1V74A 3U1WA 1OCVA 3NM2A 4WHAA 1VQN3 3JUOA 1Q40A 4OK0A 1FGTA 3ROBA 4IT7A 3KN4A 3HI7A 5I97A 5IF6A 4O8SA 2GBXB 1IK3A 3H51A 1OHSA 3FG1A 1ZX2A 3H3HA 3NBJA 4CCVA 1SIIA 1QVG2 3CC43 4HKVB 2YX9A 3CNXA 4L7KA 4LEHA 1W00A 2OQEC 2XRXB 3MPHA 3PS8A 4XB5A 1GY6A 1UI7A 2CG0A 2XH9A 1DVDA 4IIAA 3CPOA 1LXEA 1W2B2 3EHCA 2YFIB 1TFKA 3MG2A 3NBRA 1UUVB 4N6MA 4EV2A 1TIJA 3DGMA 2CW9A 3E99A 1M904 1OUNA 3MYTA 1VQ63 3K63A 3T8NA 4O3VA 2W9PA 1Q42A 4LSOA 3V98A 1UI8A 2W03A 3KIIA 4R1KA 1FGMA 4HZBB 3J7Yd 4RNYA 3FF2A 3NXJA 3V99A 5CF2A 1JN5A 3PGBA 2B1XB 4R9LA 3X3ZA 3S27A 3OWSA 3X40A 3LTDA 3CC73 1ROVA 5JBSA 4HM7B 5HGRA 2D42A 1VZZA 1KD14 3SX1A 4HJLB 3D3LA 4GB5A 2MC8A 1W5ZA 3PXMA 3EBYA 4BTXA 2GBWB 2XSHB 1A2KA 2BNGA 1Q824 2GXFA 4XDWA 2F86B 2E2UA 1US1A 3BNDA 4CDLA 1ZO2A 4O2HA 5TGNA 4I4KA 2BMOB 3Q1CA 3EF8A 5ELJA 2XGLA 1UUWB 1MNLA 2CFKA 5AYSC 4AKZA 4N6UA 2UX0A 1AVLA 3JUMA 1VQK3 2CFDA 3NBBA 1SPUA 3MWZA 1NJI4 5KP4A 3DGOA 3DY5A 3NQZA 4MMYB 2O9UX 4HM2B 1WTHA 2BMQB 4R9KA 3QK9A 4LMIA 3UNLA 1EQKA 4ZM8A 2CFLA 1U8CB 3F7XA 1AVKA 4U13A 3I553 3EQQB 3GZBA 3GZYB 3CPW2 1YHQ3 3N9HA 1Q864 5AYRB 3CMA3 2QA43 2JQ5A 4G1MB 3X3XA 3NUVA 4PEJA 1EKMA 1RJOA 1T5YA 3EC9A 1WMOA 1IQ8A 2CKFB 1O7MB 3F9SA 3JUNA 3IMAB 3EX9A 3JUPA 2ZL8A 3A76A 1OPYA 3AMOB 3IPTA 4HM8B 5AI1A 1NDOB 3GZRA 2QIYA 3DGNA 1PU4A 2C11A 5ELUA 1J2BA 2R4IA 3EN8A 3HZPA 3RGAA 3M8CA 3K0ZA 3QRDA 4EBGA 3HIGA 3PCRA 5EQLA 3NHXA 1NU3A 3EBTA 2P38A 5CXOA 4MEIA 2E2VA 4NHFA 3VSYA 4KFEA 4L8PA 1LOXA 2IMJA 1K8A4 3X3YA 4WYKB 3CCL3 1Q814 3FG4A 3MG3A 3RDEA 1F8NA 3O8YA 3DUKA 3LTBA 1CYVA 2XGNA 1OACA 1ULJB 3K9MC 2JDIH 4AEQA 2OCTA 1QALA 5JPUA 2BHMA 3I563 5KP3A 3CCR3 2P0XA 2ML5A 4K1UA 1YIT3 5EVHA 3L0RA 1K9M4 1TU5A 1W2ZA 3DGLA 2HMMB 3CCJ3 5AEUB 1N9JA 1TUHA 1U5OA 4MMZB 5EEOA 1GYBA 4IPBA 4MMXB 3F7SA 4KVHA 4FCMA 1IQYA 1E3VA 1VQO3 3LT8A 2P09A 3T8UA 1IDPA 1YVBI 3DMCA 4N6NB 2YFJB 4J9AA 4EC6A 1VQ53 3S28A 1G96A 3B8LA 5IW9A 3VGNA 2C10A 4L8OA 1NB3I 3G8ZA 3S5CA 4FMAA 1ASKA 3PCSA 1YI23 1ULIB 1SJWA 2IUJA 3LTAA 3GZXB 1EG9B 2BO9B 3LH4A 1YIJ3 1IVXA 2CC3A 1ISKA 4HM5B 1OHPA 1W6CA 5LC7A 2XFSA 1YJW3 1VQ93 3CD63 3NQYA 1E3RA 1GS3A 1GD3A 2XR8B 4N6LA 2CIUA 3HIIA 3WODG 1IU7A 2SBLA 1K734 1Y4KA 2K54A 5BVBA 1CYUA 1AR0A 5IENA 1QMAA 1EA2A 2ML6A 3BNCA 5D82A 2HMJB 2Z6BA 3FH1A 1IT7A 2GEXA 3G16A 3LYGA 3TDGA 1VQL3 1A90A 4OVMA 3RGRA 3ER7A 3UJMA 3FCSB 5JPPA 1DMNA 1FUWA 3K5TA 2W9QA 2L4VA 2Z77A 2WO0A 1VQM3 5KP1A 2IA7A 4FMCA 5FW5A 1SQWA 2WGQA 5DREA 3WOEB 2MF7A 1FGQA 2Z7AA 3GWRA 1OF5A 1RN7A 4N6V0 4WFOA 5LC6A 1W02A 2HMLB 1WMNA 2BT3A 2KCDA 4KFDA 2CWTA 3UL5A 3BNEA 2W04A 4JF8A 2HMOB 4LGQA 4XBXA 3EN1B 4K61A 1IV7A 2BMRB 3KSPA 4O02B 1SIHA 3N8BA 3JVCA 3NX0A 8CHOA 4R4KA 4NREA 3G4S3 3STDA 3CCQ3 2GU3A 1A67A 3DZLA 2D1WA 3OXAA 1W6YA 1NO3A 1WQLB 3G713 1N5HA 1IVWA 2OTL3 3FSDA 4WYKA 4WWUC 4HM3B 3JUQA 2INXA 1JKGA 2A15A 4K1VA 1N5PA 1W7CA 1RKYA 1YJN3 3B4OA 1BUQA 1L5GB 1STFI 3ECFA 2GEYA 1K41A 2XF3A 3SEDA 3X41A 4EXRA 2FXTA 4H3UA 2I9WA 5IERA 2OWPA 2CH9A 1STDA 4H61A 4KZ1A 1JN5B 1DMMA 1OH0A 1NWWA 3WA3A 1IV9A 2Y73A 3T0UA 6STDA 2LQVA 3CCS3 5D83A 1RRHA 3PZWA 1VQ73 1TFOA 2W2CA 4Q53A 5AIIA 3CC23 2XFTA 3NV0B 4R80A 2W56A 2RCDA 4J8TA 5BXQA 1N8R4 2CHCA 2CG1A 5AIFA 1JJ22 1VQ43 4ORLA 3GAXA 3EE1A 3VF1A 1VQP3 3MHEA 1M9GA 3SVAA 3KSED 4KFFA 5DRVA 3F40A 3LT9A 4EYCA 1RRLA 5CF1A 2ZDJA 3KKGA 1QAFA 2W0QA 3CNMA 1D6ZA 3FZWA 3KE7A 1AV4A 4XM4A 2FNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDJ A; 
#chains in the Genus database with same CATH topology
 1O7P B;  1V58 A;  1VQQ A;  1E97 A;  1ROA A;  2W56 B;  4FCZ A;  4QWT A;  3N54 B;  5IG3 A;  1O7G B;  4LZI A;  3CCE 3;  3KFQ C;  7RNT A;  1NB5 I;  1BUJ A;  1OF5 B;  1KQS 2;  1ZS7 A;  3S29 A;  1X1W A;  3BB9 A;  4JRF A;  2CFW A;  3UL6 A;  1C7H A;  3EJV A;  3F8H A;  3Q90 A;  1MWT A;  5IG5 A;  1Q7Y 4;  3D9R A;  5G2G A;  1T2I A;  1YGE A;  1BNE A;  1BRG A;  3OWY A;  5FGO A;  4BTY A;  3WMD A;  4STD A;  1KC8 4;  1N9E A;  3OW2 2;  4RNZ A;  7STD A;  3DM8 A;  3NM7 A;  3G6E 3;  3LXU X;  1CEW I;  3CU3 A;  3GRD A;  1LQG C;  3HX8 A;  1LVN A;  1R4C A;  4N6O B;  3ZG5 A;  3MSO A;  2OOV A;  2F99 A;  3SOA A;  4FR9 A;  3IJE B;  2RFR A;  4XBY A;  1YGW A;  3KCH A;  1O7W B;  2RGQ A;  1UDI I;  5HOH A;  3CCV 3;  4XDV A;  2E2T A;  1B20 A;  1BNJ A;  4HOH A;  3MKI A;  2V1L A;  3BNB A;  4HM1 B;  3FKA A;  2OQE A;  3CXC 2;  1HU9 A;  5M19 A;  3LML A;  3WDG B;  4XBT A;  1HKX A;  1BVI A;  4FCJ A;  4RZM A;  2R41 A;  1VQ8 3;  1RHL A;  1OGZ A;  1IQX A;  1JNQ A;  2WGO A;  1GD4 A;  2XSO B;  1S72 3;  1M1K 4;  4FMD A;  1OHO A;  2Z76 A;  3G0K A;  1FA3 A;  1FGO A;  1GOV A;  1GY5 A;  1LNH A;  2F56 A;  2OOV C;  2QGU A;  1W4N A;  1WNH A;  1BRN L;  3KZT A;  3WHO A;  1FGR A;  1X1U A;  2QEX 3;  5IEP A;  3AHS A;  3D5G A;  3HK4 A;  1D6Y A;  2CFG A;  3FLJ A;  2F98 A;  1JKG B;  5A0O B;  5AEW B;  4HZ9 B;  3EB8 A;  5CLK A;  1BSB A;  2M7O A;  2CWU A;  3DXO A;  4X2H A;  1GSP A;  2AAD A;  2FGT A;  1IVU A;  3FGY A;  2GU1 A;  1FZU A;  3PYJ A;  1DMQ A;  1M1X B;  1MWS A;  2L1S A;  3OV4 A;  1JRQ A;  4ILF A;  1JB5 A;  5BU4 A;  1UUG B;  1DVC A;  4N3V A;  5AIG A;  2Y74 A;  3Q2P A;  4GSP A;  2ZHX B;  3BLZ A;  2PZV A;  2WOH A;  3DH2 A;  3SXX A;  4FMB A;  1Z1S A;  5CK6 A;  1IVV A;  1BIR A;  1N8Q A;  2KXG A;  2WOF A;  3SOY A;  8RNT A;  1T2H A;  3F8X A;  4HYZ A;  2Q07 A;  4HM0 B;  3OWU A;  4TX4 A;  3D5I A;  1JB4 A;  1W6G A;  1W01 A;  3AMO A;  2RSX A;  1WMP A;  4CJN A;  1CQS A;  1RSN A;  1OGX A;  2CWV A;  1UW1 A;  1CH0 A;  1GY7 A;  2XEP A;  3UB1 A;  3CCU 3;  1GMQ A;  3FG3 A;  3K7C A;  4OUQ A;  2LYX A;  5STD A;  3OX9 A;  2PNC A;  1IT8 A;  2KAA A;  1I3F A;  2B24 B;  1DE3 A;  1PFP A;  1QAK A;  3BIR A;  4HM6 B;  1QVF 2;  3LTC A;  2KF6 A;  3LOY A;  1D6U A;  1LNI A;  1FUT A;  2UUG C;  4BTW A;  1I2G A;  4EV5 A;  4HVN A;  1RTU A;  2P0M A;  3SLU A;  1BNS A;  2IUK A;  5IEO A;  1B21 A;  2YFL B;  1KWI A;  1BRH A;  3I0Y A;  1YJ9 3;  2OTJ 3;  1QJG A;  1TP6 A;  2O3O A;  4N6T A;  1TJD A;  1DYU A;  3CME 3;  9RNT A;  3FF0 A;  3V92 A;  4AKY A;  1K28 A;  1O7H B;  1Q40 B;  3MG1 A;  4HBR A;  2STD A;  1O7N B;  4K90 B;  3WA2 X;  1B2X A;  3GSP A;  2CK3 H;  2W6J H;  3B7C A;  5IG0 A;  4X2O A;  1I2F A;  3B4P A;  1JB2 A;  1MOL A;  4GL6 A;  5BIR A;  3LZA A;  5D81 A;  3S67 A;  3X42 A;  2K0M A;  1RGC A;  3NV0 A;  2HMN B;  2SAR A;  3CCM 3;  1A2P A;  5IG4 A;  4RBN A;  4MJD A;  3U97 A;  1EUI C;  1JV2 B;  1MWR A;  3WOF B;  1A2V A;  1S5A A;  4HM4 B;  4WP5 A;  1KSI A;  2P05 A;  1RLS A;  1BAO A;  3ALA A;  1UCL A;  5AIH A;  2KRT A;  3F14 A;  2J8X B;  2HMK B;  1V74 A;  3U1W A;  1OCV A;  2F5M A;  3NM2 A;  4WHA A;  1UGH I;  1VQN 3;  3JUO A;  1B2U A;  1Q40 A;  4OK0 A;  1FGT A;  3ROB A;  3DGY A;  4IT7 A;  3KN4 A;  3HI7 A;  5I97 A;  5IF6 A;  4O8S A;  2GBX B;  1IK3 A;  1BSD A;  3H51 A;  1RGL A;  1OHS A;  3FG1 A;  1ZX2 A;  3H3H A;  3NBJ A;  4BL3 A;  4CCV A;  1SII A;  1MGR A;  1QVG 2;  4HKV B;  3CC4 3;  2YX9 A;  3CNX A;  4L7K A;  4LEH A;  1BSA A;  1W00 A;  2OQE C;  2XRX B;  3MPH A;  3PS8 A;  4XB5 A;  1GY6 A;  1UI7 A;  2CG0 A;  2XH9 A;  1DVD A;  4IIA A;  3CPO A;  1LXE A;  1RGE A;  1W2B 2;  3EHC A;  2YFI B;  1TFK A;  3MG2 A;  3NBR A;  1UUV B;  4N6M A;  4EV2 A;  1TIJ A;  3HOH A;  3DGM A;  2CW9 A;  3E99 A;  1PYL A;  1M90 4;  1OUN A;  3MYT A;  1VQ6 3;  3K63 A;  3T8N A;  4O3V A;  2W9P A;  2H0H A;  3ZFZ A;  1Q42 A;  1DET A;  4LSO A;  3V98 A;  1TRQ A;  1UI8 A;  2W03 A;  3KII A;  4R1K A;  1FGM A;  4HZB B;  6RNT A;  1AY7 A;  3J7Y d;  4RNY A;  3FF2 A;  3NXJ A;  3V99 A;  5CF2 A;  1JN5 A;  3PGB A;  2B1X B;  4R9L A;  3X3Z A;  3S27 A;  3OWS A;  3X40 A;  3LTD A;  3CC7 3;  1ROV A;  5JBS A;  4HM7 B;  5HGR A;  2D42 A;  1VZZ A;  1KD1 4;  3SX1 A;  4HJL B;  3D3L A;  4GB5 A;  2MC8 A;  1MWU A;  1W5Z A;  2KF3 A;  1GOU A;  3EBY A;  3PXM A;  3ZG0 A;  4BTX A;  1Q7H A;  2BIR A;  1A2K A;  2BNG A;  2GBW B;  2XSH B;  5RNT A;  1Q82 4;  2GXF A;  4XDW A;  2F86 B;  2E2U A;  1R4Y A;  1US1 A;  3BND A;  4CDL A;  1ZO2 A;  4O2H A;  5TGN A;  4I4K A;  2BMO B;  3Q1C A;  5G1L A;  3EF8 A;  4BU4 A;  5ELJ A;  2XGL A;  1FUS A;  1UUW B;  1MNL A;  2CFK A;  5AYS C;  1V57 A;  4N6U A;  4AKZ A;  2UX0 A;  3A5E A;  1AVL A;  2IY2 A;  3AHW A;  3JUM A;  2KF4 A;  1VQK 3;  2CFD A;  1B3S A;  1BSE A;  3NBB A;  3D79 A;  1SPU A;  1YNV X;  3MWZ A;  1NJI 4;  5KP4 A;  3DGO A;  3DY5 A;  3NQZ A;  4MMY B;  1GOY A;  2O9U X;  4HM2 B;  1FYS A;  1LOW A;  1WTH A;  2BMQ B;  3QK9 A;  4LMI A;  4R9K A;  1B2M A;  3UNL A;  1EQK A;  4GHO A;  4ZM8 A;  2CFL A;  1U8C B;  3F7X A;  1AVK A;  1LOV A;  4U13 A;  3I55 3;  3EQQ B;  2F4Y A;  3GZB A;  3GZY B;  3CPW 2;  1YHQ 3;  3N9H A;  1Q86 4;  5AYR B;  3CMA 3;  2QA4 3;  2RBI A;  1X1X A;  2JQ5 A;  4G1M B;  3X3X A;  3NUV A;  2C4B A;  1FW7 A;  4PEJ A;  1EKM A;  1BOX A;  2F5W A;  1RJO A;  1T5Y A;  3EC9 A;  1YVS A;  1WMO A;  1IQ8 A;  2CKF B;  2GSP A;  1O7M B;  3F9S A;  4CPK A;  4KT3 B;  3JUN A;  2CX0 A;  2IYJ A;  3IMA B;  3EX9 A;  3JUP A;  2ZL8 A;  3A76 A;  1OPY A;  3AMO B;  3IPT A;  4HM8 B;  5AI1 A;  1NDO B;  3GZR A;  2QIY A;  3DGN A;  1PU4 A;  2C11 A;  5ELU A;  1J2B A;  2R4I A;  4BIR A;  3EN8 A;  1BAN A;  3HZP A;  3RGA A;  3M8C A;  3K0Z A;  3QRD A;  4EBG A;  1G02 A;  1I0X A;  3HIG A;  1BRK A;  3PCR A;  5EQL A;  3NHX A;  1NU3 A;  1EEJ A;  3EBT A;  2P38 A;  3URP A;  5CXO A;  1NNV A;  4MEI A;  2E2V A;  4NHF A;  3VSY A;  4KFE A;  4L8P A;  1LOX A;  2IMJ A;  7GSP A;  1K8A 4;  3X3Y A;  4WYK B;  3CCL 3;  1Q81 4;  3FG4 A;  3MG3 A;  3RDE A;  1F8N A;  1RN1 A;  3BU4 A;  3O8Y A;  3DUK A;  3LTB A;  1CYV A;  4J5K A;  1OAC A;  2XGN A;  1ULJ B;  3K9M C;  2JDI H;  4AEQ A;  2OCT A;  1QAL A;  5JPU A;  1B27 A;  3Q3F A;  2BHM A;  3I56 3;  4DKI A;  5KP3 A;  1T3B A;  2P0X A;  2ML5 A;  3CCR 3;  4K1U A;  1YIT 3;  5EVH A;  3L0R A;  1K9M 4;  1TU5 A;  1W2Z A;  3DGL A;  2HMM B;  1RGA A;  3CCJ 3;  1GMP A;  5AEU B;  1N9J A;  1TUH A;  1U5O A;  4MMZ B;  5EEO A;  1GYB A;  4IPB A;  1TTO A;  4MMX B;  3F7S A;  1RGH A;  4KVH A;  4FCM A;  1IQY A;  1E3V A;  2HOH A;  1VQO 3;  1MGW A;  6GSP A;  3LT8 A;  2P09 A;  2ZA4 A;  1IDP A;  1YVB I;  3DMC A;  3T8U A;  1BSC A;  2YFJ B;  4J9A A;  4N6N B;  4EC6 A;  1VQ5 3;  3S28 A;  1G96 A;  3B8L A;  5IW9 A;  5GSP A;  3VGN A;  2C10 A;  4L8O A;  1NB3 I;  3G8Z A;  3S5C A;  4FMA A;  1ASK A;  3PCS A;  1YI2 3;  1ULI B;  1SJW A;  2IUJ A;  3LTA A;  1JBR A;  3GZX B;  1EG9 B;  4EW5 A;  2BO9 B;  3LH4 A;  1YIJ 3;  1IVX A;  2CC3 A;  1ISK A;  4HM5 B;  1OHP A;  1I3I A;  1W6C A;  5LC7 A;  2KF5 A;  1BNI A;  1I0V A;  1IYY A;  4HAA A;  2XFS A;  1YJW 3;  1VQ9 3;  3CD6 3;  3NQY A;  1E3R A;  1BGS A;  1GS3 A;  1UCI A;  4LYL B;  3AGO A;  1GD3 A;  2XR8 B;  4N6L A;  2CIU A;  3HII A;  3WOD G;  1IU7 A;  1RGK A;  2CX1 A;  2SBL A;  2RNT A;  1K73 4;  1Y4K A;  2K54 A;  5BVB A;  1RGG A;  1CYU A;  1AR0 A;  5IEN A;  1QMA A;  1EA2 A;  2ML6 A;  2H0G A;  3BNC A;  5D82 A;  2HMJ B;  2Z6B A;  3FH1 A;  1IT7 A;  2GEX A;  3G16 A;  3LYG A;  3TDG A;  1VQL 3;  1A90 A;  4OVM A;  3RGR A;  3ER7 A;  3UJM A;  3FCS B;  5JPP A;  1DMN A;  1B2Z A;  1FUW A;  1G0T A;  1BNF A;  2W9Q A;  3K5T A;  2L4V A;  1RCL A;  2Z77 A;  2WO0 A;  1VQM 3;  5KP1 A;  2IA7 A;  4FMC A;  5FW5 A;  1SQW A;  2WGQ A;  5DRE A;  3WOE B;  2MF7 A;  1FGQ A;  1GMR A;  2Z7A A;  1OF5 A;  3GWR A;  1RN7 A;  1BRI A;  4N6V 0;  4WFO A;  5LC6 A;  1W02 A;  2HML B;  1WMN A;  2BT3 A;  2KCD A;  4KFD A;  5G1K A;  2CWT A;  3UL5 A;  3BNE A;  2W04 A;  4JF8 A;  1LOY A;  2HMO B;  4LGQ A;  2H0I A;  4XBX A;  1HZ1 A;  3EN1 B;  4K61 A;  1IV7 A;  1UGI A;  2BMR B;  3KSP A;  4O02 B;  1SIH A;  3N8B A;  4I5Q A;  4J5G A;  3JVC A;  3NX0 A;  1LRA A;  1RCK A;  1UCK A;  8CHO A;  1RNB A;  4NPB A;  4R4K A;  4NRE A;  1ZGX A;  3G4S 3;  3STD A;  3CCQ 3;  2GU3 A;  1A67 A;  3DZL A;  2D1W A;  3SYU A;  3OXA A;  1W6Y A;  1I70 A;  1NO3 A;  2K3D A;  1X1Y A;  1B2S A;  1WQL B;  3G71 3;  1N5H A;  1IVW A;  2OTL 3;  3FSD A;  4WYK A;  4WWU C;  4HM3 B;  3WR2 A;  3JUQ A;  1HYF A;  2INX A;  1JKG A;  2A15 A;  4K1V A;  1N5P A;  1W7C A;  4RNT A;  1RKY A;  1YJN 3;  3B4O A;  1BUQ A;  1L5G B;  1STF I;  2GEY A;  3ECF A;  1K41 A;  2XF3 A;  2UGI A;  3SED A;  3X41 A;  2FXT A;  4EXR A;  1RDS A;  4H3U A;  2I9W A;  5IER A;  2OWP A;  2CH9 A;  1STD A;  4H61 A;  2BU4 A;  4KZ1 A;  1SAR A;  3D4A A;  1BRS A;  1JN5 B;  1DMM A;  5M18 A;  1OH0 A;  1NWW A;  3WA3 A;  1UCJ A;  1IV9 A;  2Y73 A;  3T0U A;  6STD A;  2LQV A;  3CCS 3;  1RMS A;  1I8V A;  1RRH A;  5D83 A;  3PZW A;  1JBS A;  2AAE A;  1VQ7 3;  1TFO A;  2W2C A;  4Q53 A;  1Q9E A;  5AII A;  3CC2 3;  1BU4 A;  2XFT A;  3NV0 B;  4R80 A;  1RN4 A;  1PY3 A;  2RCD A;  1AQZ A;  2W56 A;  4J8T A;  5BXQ A;  1N8R 4;  1TRP A;  1BRJ A;  2CHC A;  2CG1 A;  4BL2 A;  5AIF A;  1JJ2 2;  1VQ4 3;  4ORL A;  3GAX A;  1LQM B;  3EE1 A;  1I2E A;  1BNR A;  1BNG A;  3RNT A;  3VF1 A;  1VQP 3;  3AGN A;  3MHE A;  1JZO A;  1M9G A;  3SVA A;  3KSE D;  4KFF A;  1RGF A;  5DRV A;  3F40 A;  1JZD A;  1C54 A;  3LT9 A;  4EYC A;  1RRL A;  5M1A A;  5CF1 A;  2ZDJ A;  3KKG A;  1QAF A;  2W0Q A;  1RNT A;  1D6Z A;  3CNM A;  3FZW A;  3KE7 A;  1AV4 A;  1JBT A;  4XM4 A;  2FNQ A; 
#chains in the Genus database with same CATH homology
 1O7P B;  4FCZ A;  4QWT A;  1E97 A;  1ROA A;  2W56 B;  3N54 B;  5IG3 A;  1O7G B;  4LZI A;  3CCE 3;  3KFQ C;  1NB5 I;  1OF5 B;  1KQS 2;  3S29 A;  3BB9 A;  4JRF A;  2CFW A;  3UL6 A;  1C7H A;  3EJV A;  3F8H A;  3Q90 A;  5IG5 A;  1Q7Y 4;  3D9R A;  5G2G A;  1YGE A;  3OWY A;  5FGO A;  4BTY A;  3WMD A;  4STD A;  1KC8 4;  1N9E A;  3OW2 2;  4RNZ A;  7STD A;  3DM8 A;  3NM7 A;  3G6E 3;  3LXU X;  1CEW I;  3CU3 A;  3GRD A;  3HX8 A;  1LVN A;  1R4C A;  4N6O B;  3MSO A;  2OOV A;  2F99 A;  3SOA A;  4FR9 A;  3IJE B;  2RFR A;  4XBY A;  3CCV 3;  1O7W B;  2RGQ A;  4XDV A;  2E2T A;  3MKI A;  2V1L A;  3BNB A;  4HM1 B;  3FKA A;  2OQE A;  3CXC 2;  1HU9 A;  3LML A;  3WDG B;  4XBT A;  1HKX A;  4FCJ A;  4RZM A;  1VQ8 3;  1OGZ A;  1IQX A;  1JNQ A;  2WGO A;  1GD4 A;  2XSO B;  1S72 3;  1M1K 4;  4FMD A;  1OHO A;  2Z76 A;  3G0K A;  1FA3 A;  1FGO A;  1GY5 A;  1LNH A;  2QGU A;  2OOV C;  1W4N A;  1WNH A;  3KZT A;  2QEX 3;  1FGR A;  5IEP A;  3HK4 A;  1D6Y A;  2CFG A;  3FLJ A;  2F98 A;  1JKG B;  5A0O B;  5AEW B;  4HZ9 B;  3EB8 A;  5CLK A;  2M7O A;  2CWU A;  3DXO A;  4X2H A;  2FGT A;  1IVU A;  3FGY A;  2GU1 A;  3PYJ A;  1DMQ A;  1M1X B;  3OV4 A;  1JRQ A;  1JB5 A;  1DVC A;  4N3V A;  5AIG A;  2Y74 A;  3Q2P A;  3BLZ A;  2PZV A;  2WOH A;  3SXX A;  4FMB A;  1Z1S A;  5CK6 A;  1IVV A;  1N8Q A;  2KXG A;  2WOF A;  3SOY A;  3F8X A;  4HYZ A;  2Q07 A;  4HM0 B;  3OWU A;  4TX4 A;  1JB4 A;  1W6G A;  1W01 A;  3AMO A;  2RSX A;  1WMP A;  1CQS A;  1OGX A;  2CWV A;  1UW1 A;  2XEP A;  1GY7 A;  3UB1 A;  3CCU 3;  3FG3 A;  3K7C A;  4OUQ A;  2LYX A;  5STD A;  3OX9 A;  2PNC A;  1IT8 A;  2B24 B;  1PFP A;  1QAK A;  4HM6 B;  1QVF 2;  3LTC A;  3LOY A;  1D6U A;  4BTW A;  4EV5 A;  4HVN A;  2P0M A;  3SLU A;  2IUK A;  5IEO A;  2YFL B;  1KWI A;  1YJ9 3;  3I0Y A;  2OTJ 3;  1QJG A;  1TP6 A;  2O3O A;  4N6T A;  3CME 3;  1DYU A;  3FF0 A;  3V92 A;  4AKY A;  1K28 A;  1O7H B;  1Q40 B;  3MG1 A;  4HBR A;  2STD A;  1O7N B;  4K90 B;  3WA2 X;  2CK3 H;  2W6J H;  3B7C A;  5IG0 A;  4X2O A;  3B4P A;  1JB2 A;  1MOL A;  4GL6 A;  3LZA A;  5D81 A;  3S67 A;  3X42 A;  2K0M A;  3NV0 A;  2HMN B;  3CCM 3;  5IG4 A;  4RBN A;  4MJD A;  3U97 A;  1JV2 B;  3WOF B;  1A2V A;  1S5A A;  4HM4 B;  4WP5 A;  1KSI A;  2P05 A;  3ALA A;  5AIH A;  2KRT A;  3F14 A;  2HMK B;  1V74 A;  3U1W A;  1OCV A;  3NM2 A;  4WHA A;  1VQN 3;  3JUO A;  1Q40 A;  4OK0 A;  1FGT A;  3ROB A;  4IT7 A;  3KN4 A;  3HI7 A;  5I97 A;  5IF6 A;  4O8S A;  2GBX B;  1IK3 A;  3H51 A;  1OHS A;  3FG1 A;  1ZX2 A;  3H3H A;  3NBJ A;  4CCV A;  1SII A;  1QVG 2;  3CC4 3;  4HKV B;  2YX9 A;  3CNX A;  4L7K A;  4LEH A;  1W00 A;  2OQE C;  2XRX B;  3MPH A;  3PS8 A;  4XB5 A;  1GY6 A;  1UI7 A;  2CG0 A;  2XH9 A;  1DVD A;  4IIA A;  3CPO A;  1LXE A;  1W2B 2;  3EHC A;  2YFI B;  1TFK A;  3MG2 A;  3NBR A;  1UUV B;  4N6M A;  4EV2 A;  1TIJ A;  3DGM A;  2CW9 A;  3E99 A;  1M90 4;  1OUN A;  3MYT A;  1VQ6 3;  3K63 A;  3T8N A;  4O3V A;  2W9P A;  1Q42 A;  4LSO A;  3V98 A;  1UI8 A;  2W03 A;  3KII A;  4R1K A;  1FGM A;  4HZB B;  3J7Y d;  4RNY A;  3FF2 A;  3NXJ A;  3V99 A;  5CF2 A;  1JN5 A;  3PGB A;  2B1X B;  4R9L A;  3X3Z A;  3S27 A;  3OWS A;  3X40 A;  3LTD A;  3CC7 3;  1ROV A;  5JBS A;  4HM7 B;  5HGR A;  2D42 A;  1VZZ A;  1KD1 4;  3SX1 A;  4HJL B;  3D3L A;  4GB5 A;  2MC8 A;  1W5Z A;  3PXM A;  3EBY A;  4BTX A;  2GBW B;  2XSH B;  1A2K A;  2BNG A;  1Q82 4;  2GXF A;  4XDW A;  2F86 B;  2E2U A;  1US1 A;  3BND A;  4CDL A;  1ZO2 A;  4O2H A;  5TGN A;  4I4K A;  2BMO B;  3Q1C A;  3EF8 A;  5ELJ A;  2XGL A;  1UUW B;  1MNL A;  2CFK A;  5AYS C;  4AKZ A;  4N6U A;  2UX0 A;  1AVL A;  3JUM A;  1VQK 3;  2CFD A;  3NBB A;  1SPU A;  3MWZ A;  1NJI 4;  5KP4 A;  3DGO A;  3DY5 A;  3NQZ A;  4MMY B;  2O9U X;  4HM2 B;  1WTH A;  2BMQ B;  4R9K A;  3QK9 A;  4LMI A;  3UNL A;  1EQK A;  4ZM8 A;  2CFL A;  1U8C B;  3F7X A;  1AVK A;  4U13 A;  3I55 3;  3EQQ B;  3GZB A;  3GZY B;  3CPW 2;  1YHQ 3;  3N9H A;  1Q86 4;  5AYR B;  3CMA 3;  2QA4 3;  2JQ5 A;  4G1M B;  3X3X A;  3NUV A;  4PEJ A;  1EKM A;  1RJO A;  1T5Y A;  3EC9 A;  1WMO A;  1IQ8 A;  2CKF B;  1O7M B;  3F9S A;  3JUN A;  3IMA B;  3EX9 A;  3JUP A;  2ZL8 A;  3A76 A;  1OPY A;  3AMO B;  3IPT A;  4HM8 B;  5AI1 A;  1NDO B;  3GZR A;  2QIY A;  3DGN A;  1PU4 A;  2C11 A;  5ELU A;  1J2B A;  2R4I A;  3EN8 A;  3HZP A;  3RGA A;  3M8C A;  3K0Z A;  3QRD A;  4EBG A;  3HIG A;  3PCR A;  5EQL A;  3NHX A;  1NU3 A;  3EBT A;  2P38 A;  5CXO A;  4MEI A;  2E2V A;  4NHF A;  3VSY A;  4KFE A;  4L8P A;  1LOX A;  2IMJ A;  1K8A 4;  3X3Y A;  4WYK B;  3CCL 3;  1Q81 4;  3FG4 A;  3MG3 A;  3RDE A;  1F8N A;  3O8Y A;  3DUK A;  3LTB A;  1CYV A;  2XGN A;  1OAC A;  1ULJ B;  3K9M C;  2JDI H;  4AEQ A;  2OCT A;  1QAL A;  5JPU A;  2BHM A;  3I56 3;  5KP3 A;  3CCR 3;  2P0X A;  2ML5 A;  4K1U A;  1YIT 3;  5EVH A;  3L0R A;  1K9M 4;  1TU5 A;  1W2Z A;  3DGL A;  2HMM B;  3CCJ 3;  5AEU B;  1N9J A;  1TUH A;  1U5O A;  4MMZ B;  5EEO A;  1GYB A;  4IPB A;  4MMX B;  3F7S A;  4KVH A;  4FCM A;  1IQY A;  1E3V A;  1VQO 3;  3LT8 A;  2P09 A;  3T8U A;  1IDP A;  1YVB I;  3DMC A;  4N6N B;  2YFJ B;  4J9A A;  4EC6 A;  1VQ5 3;  3S28 A;  1G96 A;  3B8L A;  5IW9 A;  3VGN A;  2C10 A;  4L8O A;  1NB3 I;  3G8Z A;  3S5C A;  4FMA A;  1ASK A;  3PCS A;  1YI2 3;  1ULI B;  1SJW A;  2IUJ A;  3LTA A;  3GZX B;  1EG9 B;  2BO9 B;  3LH4 A;  1YIJ 3;  1IVX A;  2CC3 A;  1ISK A;  4HM5 B;  1OHP A;  1W6C A;  5LC7 A;  2XFS A;  1YJW 3;  1VQ9 3;  3CD6 3;  3NQY A;  1E3R A;  1GS3 A;  1GD3 A;  2XR8 B;  4N6L A;  2CIU A;  3HII A;  3WOD G;  1IU7 A;  2SBL A;  1K73 4;  1Y4K A;  2K54 A;  5BVB A;  1CYU A;  1AR0 A;  5IEN A;  1QMA A;  1EA2 A;  2ML6 A;  3BNC A;  5D82 A;  2HMJ B;  2Z6B A;  3FH1 A;  1IT7 A;  2GEX A;  3G16 A;  3LYG A;  3TDG A;  1VQL 3;  1A90 A;  4OVM A;  3RGR A;  3ER7 A;  3UJM A;  3FCS B;  5JPP A;  1DMN A;  1FUW A;  3K5T A;  2W9Q A;  2L4V A;  2Z77 A;  2WO0 A;  1VQM 3;  5KP1 A;  2IA7 A;  4FMC A;  5FW5 A;  1SQW A;  2WGQ A;  5DRE A;  3WOE B;  2MF7 A;  1FGQ A;  2Z7A A;  3GWR A;  1OF5 A;  1RN7 A;  4N6V 0;  4WFO A;  5LC6 A;  1W02 A;  2HML B;  1WMN A;  2BT3 A;  2KCD A;  4KFD A;  2CWT A;  3UL5 A;  3BNE A;  2W04 A;  4JF8 A;  2HMO B;  4LGQ A;  4XBX A;  3EN1 B;  4K61 A;  1IV7 A;  2BMR B;  3KSP A;  4O02 B;  1SIH A;  3N8B A;  3JVC A;  3NX0 A;  8CHO A;  4R4K A;  4NRE A;  3G4S 3;  3STD A;  3CCQ 3;  2GU3 A;  1A67 A;  3DZL A;  2D1W A;  3OXA A;  1W6Y A;  1NO3 A;  1WQL B;  3G71 3;  1N5H A;  1IVW A;  2OTL 3;  3FSD A;  4WYK A;  4WWU C;  4HM3 B;  3JUQ A;  2INX A;  1JKG A;  2A15 A;  4K1V A;  1N5P A;  1W7C A;  1RKY A;  1YJN 3;  3B4O A;  1BUQ A;  1L5G B;  1STF I;  3ECF A;  2GEY A;  1K41 A;  2XF3 A;  3SED A;  3X41 A;  4EXR A;  2FXT A;  4H3U A;  2I9W A;  5IER A;  2OWP A;  2CH9 A;  1STD A;  4H61 A;  4KZ1 A;  1JN5 B;  1DMM A;  1OH0 A;  1NWW A;  3WA3 A;  1IV9 A;  2Y73 A;  3T0U A;  6STD A;  2LQV A;  3CCS 3;  5D83 A;  1RRH A;  3PZW A;  1VQ7 3;  1TFO A;  2W2C A;  4Q53 A;  5AII A;  3CC2 3;  2XFT A;  3NV0 B;  4R80 A;  2W56 A;  2RCD A;  4J8T A;  5BXQ A;  1N8R 4;  2CHC A;  2CG1 A;  5AIF A;  1JJ2 2;  1VQ4 3;  4ORL A;  3GAX A;  3EE1 A;  3VF1 A;  1VQP 3;  3MHE A;  1M9G A;  3SVA A;  3KSE D;  4KFF A;  5DRV A;  3F40 A;  3LT9 A;  4EYC A;  1RRL A;  5CF1 A;  2ZDJ A;  3KKG A;  1QAF A;  2W0Q A;  3CNM A;  1D6Z A;  3FZW A;  3KE7 A;  1AV4 A;  4XM4 A;  2FNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...