2ZDKA

Exploring trypsin s3 pocket
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA02
3GY6A 2BD2A 3DHKH 4MVNA 1RIWC 1UTMA 3M5OA 4D9QA 2HNTF 4R8TB 5HGGA 4IN2A 2FM2A 5JBBS 1S83A 3SQHE 2QYIA 2G8TA 1BMAA 3LC3A 2DE9A 4X2YA 1PPHE 4MNYA 1NT1A 1T8LA 1TPOA 1TX8A 3O8BA 3LU9B 1DUEA 2AEIH 1P09A 1RS0A 2A45B 5JYIA 4KTUA 1Z6JH 1O3DA 1AVGH 3QN7A 4GCHF 3MNBA 3UNQA 1JMOH 1W10U 5TCAA 3GISB 3D23A 3TVJB 1GI8B 2HNTE 1HAYB 2BVRH 1ETTH 1XUKA 3QTVH 5EODA 1EZSC 2ZHFH 7LPRA 3RMNH 4FVDA 1TA6A 3UREA 1TOMH 1P3EA 4CRAA 2SGDE 4O3UA 2GKVE 2G5NA 1D9IA 3ESTA 3LGTA 1D3QB 3M35A 3U8OH 1QA7A 1GBIA 2VH0A 2AGEX 3SNBA 2PW8H 2V0BA 2SNVA 3TNSA 8GCHG 1ESBA 5FCKA 1DPOA 4INKA 2ZIQH 1B0FA 3E3TA 4Y8XA 3MFJA 1AE8H 1TNKA 4GVUA 1MTVA 1C1UH 5G4BA 3SJIA 3KCGH 4Y10E 3S9BA 1YC0A 1K28D 2Z3DA 3S69A 2HWLB 3AAUA 1A61H 4UFFH 2A5AA 3SGQE 1E38B 3TH4H 2M5TA 3Q77A 1YLDA 2A4RA 1BOQA 5JDUB 1DANH 2VVCA 3PO1C 3SU4A 4CH2B 1ELEE 1NRQH 2QXIA 4BTTB 4OS2A 5PTPA 2GZ8A 1GBHA 1Y3XA 1FDPA 3ZVEA 3STJA 3GCTG 2VIPA 1RJXB 1MKXK 2Y6TA 3ATLA 2CGAA 1TWXB 2WV4A 1OP2A 2BXUH 3A85A 3GCHC 1PPFE 2WPIS 3ATWA 1GBLA 2Y7ZA 4Y71A 1TLDA 1HAXB 1QRXA 3HGPA 1ELGA 1SG8B 9LPRA 2VIVA 3VB5A 2ZPQA 1O3NA 2BD3A 1TX6A 3RC4A 1IHSH 2FZZA 1QGFA 1X7AC 1PPBH 1YPHE 3QTOH 4H42U 1K1MA 1TGCA 2BX3A 3U8RH 3H7OA 1GDNA 2DUCA 1EB1H 1O2ZA 4O9VA 4K5ZA 3I78A 4WH6A 1EUFA 2GCHF 2V3HH 1VCWA 4AGKA 4Y76A 2P3TB 1P01A 3SHAH 2O8UA 1IQJA 1K2I1 4U30A 2Y82A 1LVBA 2FO9A 1W7XH 1MTNC 3W94A 1ZRBA 2Q6FA 3RM0H 1SGFG 1TNJA 1JOUB 1W2KH 3BSQA 1ZPBA 5FAHA 1IQKA 1RTFB 1D3TB 2SFAA 3RXSA 4D7GA 1K21H 5GCHF 1SFIA 2R3UA 3BTFE 2O9QA 4JK5A 5DP9A 1P11E 5DP8A 1OP0A 4ABEA 1D6WA 5EPNA 1L0ZA 5DPAA 2VGCC 1EKBB 3RXHA 2FP7B 4TWWA 1SGNE 1GBCA 2W5EA 4GLYA 4X1SU 3F6UH 5A0AE 2STBE 2ZU5A 4Y6DA 3ZZ8A 4UFDH 4FUDA 3U8TH 3RM2H 2B8OH 1K1OA 1GCDA 5CMXH 2Y81A 4UFGH 3PB1E 2ZDLA 1FY3A 1ZJDA 3A80A 3A83A 1H8IH 3NKKA 4IGDA 1P05A 5JBTA 1HIAB 2QGRA 1MQ5A 2BOKA 5E8EH 2BY6X 2Z9IA 2PLXA 3SV6A 1KIGH 1N6XA 4XDEA 3SV2H 4NIWA 4FUIA 2BDCA 4NFFA 2W26A 3F9HA 1FIZA 1P2MA 4IMQA 3MI4A 1J14A 1SGIB 3KGPA 2PTCE 3OY5U 1ZGIA 4LZ1H 4IS5A 4YOGA 3LJJA 1ZZZA 3NPSA 1OWJA 1EAUA 1WYKA 5AFYH 2QF0A 4F4OC 4B74A 2QV1A 2IPHA 3BTEE 5IDKA 1AB9C 1QRZA 2GCHG 2FDAA 3A7XA 2TRMA 2FS9A 4B2BA 1FQ3A 1TYNA 2OD3B 3ELAH 3BTHE 2AH4X 3GDUA 3OX7U 5E0HA 2R9PA 5JB9S 4K2YA 2P3FH 1O5AB 3MH4A 1HUTH 4MTBA 2J95A 3D62A 4D7FA 1ZJKA 1F2SE 3FFGA 2NWNA 1CQQA 1BHXB 4MG3A 2PKSB 3PMAB 4IN1A 1FPHH 1TBZH 1ZHPA 4UFEH 3Q3KA 4UEHH 3PMJA 1TABE 1MTSA 3T26A 1QJ1B 1XKAC 3SUFA 2A32A 1YPHC 2XC0A 1VJ9U 3AW0A 1O2XA 4MLFB 1UK2A 3V0XA 1DLEA 2GV6A 4X1PU 3UNSA 4NZQA 5GIBA 2XRCA 4ASHA 1JBUH 3TH2H 2VIWA 1GJAB 3L6PA 4FXGH 3IITA 3KQDA 2G4TA 3UOUA 2ZDNA 1AE5A 1QIXB 4U01A 4ABBA 3SGBE 1T8MA 4WMFA 4TY6A 3H7TA 4AX9H 1O3PB 3SNCA 4DVAU 4I8GA 1NZQH 5I25A 1ANDA 1BITA 1C1MA 1S6HA 1F7ZA 3P6ZB 1SL3A 4Q80A 2EA3A 2FWWA 2XBYA 1UTPA 1KXDA 2QIQA 1DWEH 1Q3XA 1HAOH 2CMYA 2ANMH 2EI7A 1C5ZB 2ZU4A 3ZYDA 3K2UA 3OSYA 1AD8H 1T4VH 4ZUHA 1V2LT 3Q00A 1O3CA 4K1SA 3SU5A 3TK6A 3M36A 3MH7A 1YPEH 2PSXA 1E37B 2WV5A 1VGCB 2ZHDA 3SV8A 4OS6A 1LCYA 3MU4A 3SORA 1GHBG 1S0RA 2XWAA 3URDA 4BANB 4IC6A 1NRSH 1QBOA 1BMMH 2PUQH 4FUCA 3ATMA 1NRNH 1QB6A 3E0PB 1O30A 2Y80A 2ZPSA 1OKXA 1MTNB 3UUZA 5FPTA 4LK4A 3UQOA 3NWUA 1VITG 3EA9A 1AU8A 3BG8A 4ZROA 2AFQB 2Z9GA 3SJ8A 1ZHRA 1TB6H 1Y5BT 5C3NA 1KYNA 1G32B 1RIWB 5ABWA 3BTTE 5EG4A 2JKHA 5EOKA 1BQYA 1CT0E 4X8TH 1YBWA 2IJOB 3A7VA 1XUGA 4JZEH 3VB3A 1CBWB 3PLBA 1GMHF 1HAPH 2R2MB 3HGNA 1VITF 2I6QA 1OOKB 2OINA 5FCRA 2BZ6H 3U9AH 3B9FH 1E36B 1O31A 5C1UA 2ZTZA 2BQWB 1TBRH 5AHGH 4BAQB 1WAYB 1DWBH 4F49A 1GI1A 1KXFA 3BN9A 3TIUA 3SU3A 5FPYA 3RXJA 5A2MH 5JB8S 1U6QA 3M37A 2BHGA 4Q7ZA 4Y8ZA 3ZZ3A 1BDAA 3Q76A 5EQRA 2AYWA 1OS8A 3GYLB 4YT6H 2FOGA 2C8XB 1B0EA 4ISHH 1F5RA 3VEQB 1O2TA 1GMDG 4HI3A 2HLCA 2ILNA 1O39A 4NA9H 1G3BA 1YP9A 3G01A 4WH8A 1CHOF 4IW4E 1Z7KA 3T5FH 1GVZA 5HM9A 1K1NA 1ZRKA 1Y8TA 4XE4A 1BMLA 1EJAA 4A1XA 1GBJA 3ZZ9A 1NESE 2EC9H 3C27B 1O3OA 1TNGA 2H9HA 3S0NA 1YF4A 1YKTA 2GT7A 1O36A 1MKXH 4LZ4B 1AFQB 3RXTA 2AMPA 4CRBA 4FU9A 1LVOA 3M7UA 4X0WU 1TGBA 2O8TA 4B2AA 1C1NA 2W7UA 1SSXA 5F8ZA 3DFJA 1RTLA 1P10A 1QTFA 1YPMH 1GHBF 1G30B 1SMFE 3GDSA 2ZEBA 3SJ9A 4DIIH 5C1YA 1GMHG 3VGCB 3ZZCA 1T31A 4GUXA 1FJSA 4FUBA 2ZCLP 1JIMA 1O33A 2FOAA 2ZFSA 1EJMA 1EP6A 2RCEA 4OS7A 2ZG0H 1V2TT 1YM0A 5J4SA 3RXDA 1KTSB 2QAAA 1KLTA 2QC2A 3SNEA 3GCOA 5C20A 1ZSJA 3SV7A 3BTKE 8LPRA 4AYYB 1BCUH 1Y59T 3M7TA 1O35A 3EGKH 2OC7A 4Z6AH 3SNDA 2FEQH 3EQ0H 1P8VC 2J38A 5C5OA 4JYTA 3TLOA 1LQDB 1PQ5A 1Z6EA 1EOJA 2BLQA 1TMBH 1B5GH 3QZRA 3Q3XA 2F91A 1HNEE 2OC1A 1XXDA 3K6ZA 5CHAC 1DT2A 3N7OA 1UTQA 1C5OH 1RTKA 1V2WT 2P94A 2Z9LA 3AASA 1YLCA 3ZYEA 1O34A 3D49H 4U32A 1A5HA 1DXPA 1ELAA 2GX4A 1GG6B 2WPKS 3M3SA 3RXEA 1LKAA 2Z6BD 1KXAA 4RN6A 5JPMH 4XBCA 1LPZB 1T4UH 3RXAA 2FIRH 2Z9JA 2WYGA 2BD8A 1UTKA 3D65E 1QQ4A 1AI8H 3EE0B 4FUFA 1HGTH 2ZFQH 3SW2B 4ZMAH 1IQHA 2BM2A 1THSH 1AZ8A 4K60A 4NIVA 1WQSA 4ESTE 4YZUA 3IG6B 2ZA5A 5DP5A 1WTGH 3JZ2B 1MD8A 1MBMA 1GMDF 4E06H 1GBBA 4INLA 2PR3A 3PTBA 3O8DA 2W7SA 1NU9A 1BJVA 1O2IA 1GBEA 1ZR0A 1JRTA 2BZAA 2BVSH 4X6OA 1K1PA 1FN6A 1C5RA 1ZPCA 1UK3A 1GHXH 1HXFH 2D1JA 1FUJA 5JBAS 2A2XH 3QX5H 1HB0B 3GY5A 1C1TA 4J1YA 4ISNA 2ZHWH 2OUAA 4ABIA 3BTWE 3E1XB 4Q7YA 3GCTF 1YPLH 3GDVA 3KQEA 4CREA 5F8TA 1AO5A 2ZKSA 1GMCF 2A7JA 4CRGA 4FUGA 3A8AA 1N8OC 5E2OA 1HBTH 1SGRE 1O3KA 1M9UA 1JRSA 2ODPA 4BAOB 2Q1JA 2NU0E 2FOMB 3QO6A 1V2OT 5ETXA 3MO6A 3TGIE 4AFZA 6CHAC 1O2RA 1PFXC 2TGAA 3RXRA 1N8OB 3RMOH 1CE5A 1HLTH 2OCVB 3PLPA 4Y11E 1RFNA 1O2UA 1S5SA 2BQ7B 1ZPZA 4I8LA 4B71A 2XYAA 1O2NA 2ZQ1A 2GP9B 3F9GA 2BD4A 1DXWA 1C2HA 1C5YB 3A87A 5LPEA 2UWOA 3DFLA 1WOFA 3PM3A 5AFZH 3SZNA 1INCA 1BRCE 2FTLE 3T29A 3PTNA 1VJAU 2HRVA 1AMHA 2WPHS 1HAZB 1SQOA 4BXWA 3RXUA 1OXGA 1SGQE 8KME2 1O3EA 1PQAA 3KHVA 3CENA 1TGNA 4YLQH 1FNIA 1DFPA 2PV9B 3EYDA 1P04A 1GI3A 2BDYA 3KEEA 1K1LA 4YESB 1GDUA 1LHEH 2VH6A 2OBQA 1QFKH 3SOSA 3ODDA 1NM6A 2F3CE 3RLYH 4ZXYH 1CA0C 1ELBA 1TMTH 2BY5X 1TGSZ 2OLGA 4B2CA 3TU7H 2YNAA 2TBSA 3NK8A 1O5DH 1GG6C 1BTZA 3U1IB 2XNIA 2OC0A 2IN2A 2EEKA 2C93B 3E0NB 2J92A 2GCTC 1EASA 3LKWA 4JYUH 1C5TA 1UVPA 5GPIB 1MMJN 2BOHB 1OWHA 1LPGB 2G4UA 5GXPA 5T6GA 5ESTE 1IQEA 2QN5T 1TPPA 3E16B 5B6OA 2AMDA 4WXIA 4IC5A 2C90B 3HPTB 3SUDA 4ABJA 2FYRA 3OTJE 6ESTA 3PROA 1Z8JB 1TNLA 2H9EH 1EAXA 5L30H 4SGAE 4FUHA 4XSKU 4KGAA 4CRDA 3IWMA 1BTXA 3VB6A 1IQLA 3RU4T 3RXFA 5F6MA 1S81A 4AN7A 4YOIA 2VWMA 4JCNA 1QL7A 3FZDA 4WY3A 1GVLA 3SJOA 4NZLA 1SQTA 1N6YA 3UR9A 4QT8C 3AAVA 4K69A 4AFQA 2R0KA 2H5CA 2ODYB 1UO6A 5DKMA 1CA8B 5DP7A 1QBNA 2TGDA 3ZVDA 4AZ2B 1SLXB 2Y7XA 4HGCA 3A84A 4MQAA 4XFQA 3SO3A 2BD7A 2NU2E 4BNRA 2F9VA 1C2KA 1G2LA 1O2VA 1S84A 1ANEA 1W12U 4TPYA 1FN8A 1GJ7B 2XXLA 1CT2E 4AORA 4AGJA 1XUJA 2VJ1A 1WU1A 2F9PA 1KXCA 1C1WH 1QJ7B 2F9UA 4BTUB 3TK5A 1P57B 3TNTA 1UHBA 2Z3EA 3MU5A 1EAWA 1Z8RA 4SGBE 4GSOA 2W3KA 2WUCA 1QURH 1AGJA 4NSVA 2P8OB 1C1QA 3OYPA 2BD5A 2XCFA 1NU7B 3M5NA 3GYMA 1AFQC 2ZQ2A 3ZV9A 3UTUH 1H1BA 3F9EA 1O2KA 1ZTKA 1AFEH 5TJXA 1GCTC 1A3BH 3VXEH 5H4IB 1LHCH 4A7IB 5L2ZH 1JXPA 3A86A 4MPVA 4A6LA 1DSTA 1SGTA 1AKSA 4ZKSU 2AGGX 4B1TA 3CP7A 1V2VT 5BPEA 1C2EA 1C2DA 2D8WA 1DICA 1GGDC 4O97A 2FOCA 1MZAA 1FI8A 5T3HA 4E7RG 1SGDE 4DURA 1UVSH 2B0FA 3GICB 1TPSA 1CBWC 1G3EA 1GJ5H 2RG3A 3RUOA 3LIWA 4BXSA 2AMQA 3PO1B 4CHAB 1GHAF 3TGJE 5LPFA 1PYTD 3S9AA 2SGEE 4AOQA 1TRYA 2G00A 2YNBA 2ZGBH 1C1SA 1C4V2 1W13U 3GY2A 4Y7BA 2BLOA 1GJDB 3L33A 5GWZA 1F5KU 3PLKA 1G9IE 1OYTH 1AUTC 1AY6H 2SNWA 3ZZBA 3FP8E 1GWAA 4VGCC 2W3IA 1QNJA 4ISLA 3BEFB 2C8YB 1GBAA 5ESBA 2J94A 5C5NA 2PWXA 3MU8A 3LH3A 1KXEA 1C5VA 1A1RA 1VGCC 1TBQH 2FXRA 3FP7E 2OBOA 2ZTXA 2BX4A 1C1VH 4X1RU 4TYDA 3C1KA 4GPGA 1ELFA 1P3CA 1J16A 1Y3VA 2C3SA 4BAHB 3E91A 4MPWA 5FX6A 2ZI2H 4LOYH 1ARBA 1P2NA 4I33A 4Q2KA 2FOBA 2NU4E 2ZWLH 3NUMA 2FX4A 3MOCA 2ZGJA 2PGBB 1EOLA 1FZZA 5DP3A 3RXKA 1H9IE 2F9OA 2PTNA 1DY9A 3MU0A 1H9HE 2VIOA 1BBRE 2ZHEH 4U2WA 5EW1H 2ZDMA 1IAUA 2THFB 6CHAB 3QUMP 2ZGXH 1EPTB 2ZCKP 3FVFB 3KQCA 3RXIA 4B75A 4HZHA 4OS4A 4UDWH 1O2QA 2OQ5A 1NO9H 4ZXXH 1GHAG 3AW1A 1P2KA 1AKSB 5EGMA 4KTCA 1TA2A 2BMGB 1ZTJA 1VCQA 3ATIA 3EAJA 1A4WH 3BG4C 3UOPA 2GDDA 1XX9A 2PUXB 1LVMA 1H4WA 4DY7B 5A0CA 1SLUB 2V3OH 1O2MA 1HAHH 2AERH 2JH5D 5JBCS 1DM4B 4I7YH 1NN6A 5DP6A 1EQ9A 2ESTE 5SGAE 1NY22 1GI7B 1WV7H 5J4QA 1S6FA 2XBWA 3P8OA 2ZFPH 5T6FA 1ACBE 1SGEE 1V2NT 3KF2A 7GCHF 1UHBB 3MMGA 1AB9B 1HCGA 5GDSH 3RDZA 1VCPA 3BTGE 1XMNB 1T7CA 1HDTH 1UTLM 4BOHA 3P92A 2P16A 5C2ZA 9ESTA 1SGPE 1A2CH 2LNCA 1GI9B 4K1TA 4NFEA 3RXPA 5L2YH 1G2MA 1BZXE 4H6TA 2FLRH 1BB0B 1L4DA 1Z1IA 1LPKB 2Z9KA 1S0QA 1OYQA 4WMDA 3V12A 2G51A 4ABDA 2A4OA 1O5GH 4PROA 2KAIA 3ZVFA 1GL1A 2GGVB 3RXQA 4NG9H 3SI3H 1EZXC 1O3JA 2GMTC 1VZQH 1KDQB 1MBQA 3QDZB 2VIDA 2ZGHA 5DJ7A 2WPLS 3A88A 2OQUA 2HPQH 5A09A 2A0QB 3PMBB 1V3XA 4DIHH 2C4FH 2CHAB 1C5LH 1DDJA 2VWOA 1C2FA 1QJ6B 3HATH 3P95A 3ZVAA 1MD7A 1SLWB 1A7SA 1BTYA 2RA3A 1GVKB 2ZDVH 1DVAH 1QHRB 1UTOA 2BB4A 3BEUA 4E7NA 1SGYE 1PJPA 4X6PA 3CS7A 2V6NA 1DITH 2FLBH 3KN2A 2ZZUH 2VNTA 1F5LA 1ZSKA 1GJ9B 2H5DA 2O8MA 1QB1A 3EA8A 4X2WA 3VB7A 1UCYH 1MCVA 4KP0A 2G55A 3LC5A 1O3HA 1C4U2 1EPTA 1Y5UT 2ZECA 3MH5A 2BDHA 5HYOA 1UCYE 2OC8A 2QY0B 4BAKB 1SBWA 5FPSA 3FP6E 4MNXA 1CGHA 1GJCB 2GD4B 1H9LB 3TJOA 4IBLH 3T25A 1MUEB 2G52A 2XBXA 1QL9A 1UTJA 3NCLA 2ANKH 1TFXA 2WPJS 2QCYA 2AIPA 1CGJE 3ZZAA 3SUGA 4X8SH 3R0FA 4VGCB 3BF6H 4XOJA 1O3IA 3FANA 4H4FA 1ELVA 3BIUH 4TPIZ 1IQIA 3I77A 1D6RA 1FY5A 1O3GA 1O5FH 1SFQB 2VIQA 5IYTA 5LH8A 1LQEA 4RKJB 1SLVB 5L6NH 1MKWK 3BTQE 1NFWA 3LGVA 2F9NA 1P2JA 2FODA 2TIOA 3RXOA 2PFEA 1MU6B 1BBRH 3UWIA 2ZU1A 4MNWA 2A1DB 4KELA 3A7WA 1TALA 1TNIA 1UCYK 3DA9B 3A7YA 3SGAE 1GGDB 2BY9X 2Q6DA 1QQUA 3MNCA 5T6DA 4A5TS 2ZO3H 2UWLA 1YPKH 4A1TA 3A89A 1O3BA 2BLVA 2UUJB 3GCHB 4DOQA 4DCDA 3RXBA 5HM2A 4J2YB 3LGIA 5HMAA 2UUYA 1IQNA 1ELDE 2SGFE 1O5BB 3WY8A 1ZLRA 3QWCH 1SC8U 4WWYA 3RMLH 1O3LA 3BG4B 3STIA 1TE0A 1TONA 1UVOA 2ZTYA 3GY3A 3SUEA 1FONA 1P2IA 4ABAA 3K65B 3PWCA 2B5TB 1TIOA 2P93A 5AF9H 1OX1A 1HAVB 3FZZA 3P17H 3RXMA 1DOJA 3LDXH 1RXPA 4NIYA 3B23B 1P02A 6LPRA 2P8OC 2QXJA 1T8OA 1F0RA 2CF8H 1C5PA 4X6MA 3BTME 3EA7A 1GHZA 2B9LA 1C2IA 3MNXA 4CH8B 1BHXF 1HJ8A 4KKDA 1NRPH 1C9PA 3LT3A 3RC6A 3LGWA 1BRAA 4AB9A 4Q7XA 2UWPA 1HJAB 4NA8A 3LJOA 1E34B 1D3DB 1RGQA 3VXFH 2WYJA 1W0YH 1TOCB 1F0UA 2BYAX 3HKJB 2D2DA 1HJAC 4ABGA 5E0GA 1AN1E 2J9NA 5DO4H 1HFDA 3MU1A 1SPJA 3ZZ7A 1YPJH 2TGPZ 3Q3YA 6GCHF 1WSSH 2D26C 2PKAB 2AIQA 1EZQA 3UIRA 2ZU3A 4ZHMU 1QBVH 4ZHLU 1QCPA 1FAXA 4RSPA 1N1LA 2BLWA 2A4GA 1CGIE 3M7QA 3MO9A 1SQAA 1O2GH 5EW2H 1O0DH 2H6MA 3P8FA 1C5WB 4CBNA 2ZP0H 1GJ6A 2Y5FA 1XUIA 1GJ4H 1O32A 1SHHB 2ZHQH 2FOHA 3MNSA 4WXVA 1BTHH 5A8YA 2GTBA 1DY8A 6GCHG 7KMEH 1DWCH 1QR3E 4FU8A 2R3YA 1KY9A 4OGXA 1BTWA 4A92A 1K1JA 1K9OE 2WPMS 4WVPE 1PQ7A 1WUNH 1UVUH 1SOTA 1SI5H 5DK1A 1HJ9A 1RD3B 2A7HA 2GCTB 2I6SA 4CHAC 1O37A 2WINI 2PSYA 3RC5A 1S82A 1OWEA 3GCNA 1MU8B 1ANCA 3V13A 4MPUA 2O8WA 1EP5A 4O3TA 2Y5HA 4OGYA 3VB4A 1FAKH 4YOJA 3W95A 3O8RA 2P59A 3RXCA 4FUEA 1A0HB 4MPXA 3ZV8A 2PKSC 4JZFH 3M5MA 3UNRA 2EI6A 1EAIA 2FYQA 4TY7A 3MWIU 3QGJA 3QZQA 3URCA 1FPCH 3A8BA 3GOVB 1FY1A 3LONA 1V2ST 3M5LA 1IHTH 1JWTA 2VWNA 3T62A 5EQSA 1GHVH 4GHQA 1DLKB 3KNXA 2KAIB 1L2EA 3KL6A 2BY8X 1C5MD 1UMAH 1GHYH 2Z7FE 1GBTA 1O2PA 3BV9B 2ZDKA 3MHWU 4BAMB 4NIXA 1CT4E 1EPTC 1FY8E 4MNVA 1K22H 2A5KA 1A0JA 3VPKA 1WCZA 2FTMA 1C2JA 2QXGA 1QA0A 4IMZA 2CF9H 1Y3WA 1OWIA 3TH3H 4B73A 1AWHB 3RU4D 4GAWA 1YCPM 3SJKA 1IQGA 2HVXA 2ZFRH 1C5NH 2FS8A 2Z3CA 3BTDE 3M61U 3A81A 4NGAH 2OTVA 4ABHA 1DWDH 4NCYA 4I8JA 1YCPH 1P2QA 2CV3A 2FOFA 3ZZ5A 3HKIB 4X2VA 1FY4A 1O2SA 2BVXH 1XM1A 1TGTA 5I46H 1AQ7A 3AVZA 3DD2H 3T27A 1UTNA 2FI4E 5E2PA 1TRMA 2ODQA 3B8JA 4E05H 3TJUA 4OS1A 4WJG2 3LGYA 1CVWH 1Z71A 1YGCH 4ZKNU 1A46H 1OPHB 1ZYOA 2HALA 1UK4A 2CHAC 3TITA 3PYHA 1TQ7B 2TGTA 4M7GA 1CSOE 3SHCH 3A8CA 3SU0A 2GMTB 2RDLA 3SV9A 3GY4A 1W8BH 1LO6A 1BT7A 1HXEH 4ZAEA 3S7HB 3P8NA 3H5CB 4GHTA 1KLJH 1NTPA 1V6DA 2BDAA 2QXHA 1XVMA 1YPGH 1OWKA 2ZF0H 1IQFA 1NRRH 2P95A 1V2RT 1KDQA 3NXPA 1BIOA 4DW2U 4ISIH 1ZGVA 1Y3UA 3LGUA 1MCTA 2IOTA 1F0SA 4JZ1A 3SN8A 5BRRE 1XUFA 2P3UB 2O8LA 1C4Y2 1YYY1 1IOEA 1TQ0B 4CR5A 5A8XA 4B76A 2VB0A 4YO9A 2A4QA 2XW9A 3RXGA 2FESH 1WQVH 1Q31A 4H6SB 2H1UA 1F0TA 1HAVA 2SGPE 1GMCG 5HXFA 3ENSB 1EATA 1F92A 1O3MA 3SI4H 2BDGA 1Y5AT 4KTSA 4D76A 1GI6A 4RKOB 1GCTB 1O2OA 1WBGB 1ANBA 3TK9A 3F1SB 4Y79A 1UVTH 1GJBB 3ODFA 1O38A 3K6YA 1C5UA 4I8KA 3UWJH 1QRWA 1ZSLA 1HV7A 3SBKA 3T2NA 1OP8A 4ISOA 5A0BA 1V2MT 2XTTB 1DS2E 2ULLA 1V2QT 2R0LA 1E0FD 1EB2A 1FXYA 1V2JT 2BQ6B 1HPGA 3QK1A 1PPGE 1KSNA 1O5EH 1MH0A 1L1JA 1MTWA 1NFXA 1GDQA 1P03A 3FAOA 2GDEH 2VVUA 1CHOG 1A5IA 4NWLA 5FX5A 2HGTH 4NA7A 3A7ZA 3MTYA 1P9UA 4AG2A 5LPRA 2STAE 5DGJA 4R0IA 4FVBA 2F83A 1P12E 4UE7H 1TAWA 3I29A 1TX7A 1MTUA 4YT7H 1AWFH 2BTCE 3MH6A 1WTHD 4X1NU 3DUXH 1W7GH 1D3PB 1MKWH 2BXTH 1A5GH 2FPZA 4XBDA 1EZUC 3UFAA 1ELCA 1PYTC 3VFEA 1T32A 1LHFH 1O2LA 1S85A 4X8UH 3A82A 4K3JA 1G37A 1AHTH 3UQVA 2DE8A 1LVYA 2NU1E 1Y3YA 4HFPB 1RRKA 2LPRA 1GBMA 1O3FA 1ZHMA 3ZVBA 4ZH8A 2PGQB 1SR5C 2UUKB 3GY8A 4CRCA 3TJNA 1AVXA 4INHA 1NPMA 2NU3E 2ZDAH 1NROH 1BTPA 8GCHF 1EX3A 5FHTA 2A2QH 4DG4A 4OS5A 2BDIA 5C67A 2XCNA 4ZHAA 1P06A 1P0SH 3KQBA 1MAXA 3PMHB 1QL8A 3SNAA 2XWBI 2UUFB 1W11U 5AVDA 1QY6A 4AG1A 2F9BH 1BMNH 3ZZ4A 4UD9H 1LHGH 1OWDA 1W3CA 5DG6A 3TJVA 3A7TA 5A8ZA 1VR1H 1BRBE 5DP4A 2ZCHP 2SGAA 3ZVCA 1O2JA 5EXLA 1O2HA 1G36A 1SB1H 1TRNA 1G3CA 1THRH 3E6PH 1XUHA 1MZDA 1LMWB 2V35A 2A5IA 1Z8IB 2FOEA 2Y5GA 1THPB 3GY7A 1ARCA 3E90B 5CHAB 1SGFA 1DX5M 1BBRK 1P9SA 1JIRA 1HYLA 4ABFA 4X6NA 3P8GA 1W14U 1LTOA 4I31A 1Z8GA 3RU4E 4X1QU 5EPYA 4CBOA 1ZMNA 3SU2A 1W0ZU 3LPRA 2B7DH 2VINA 2GZ7A 2ALVA 1E35B 3SU1A 5GCHG 1L1GA 4X2XA 1ESAA 1V2PT 1CU1A 3OY6U 4D9RA 1BTUA 2FMJA 3RXVA 2YOLA 4Z0KA 5EXNA 1ZTLA 3CS0A 4THNH 3VGCC 1NS3A 4NWKA 3OU0A 3UR6A 1EXFA 1DE7H 1GBFA 2A31A 3T28A 3MYWA 1A3EH 5EQQA 1C2GA 1C1RA 1C5XB 1T8NA 2ZU2A 1C5SA 3NZIA 4JMYA 1AVWA 1LDTT 1C9TA 4GCHG 5TCCA 2FI5E 1G3DA 2JETB 3E8LA 3EDXB 1C5QA 3QGNB 3PV4A 3UPEA 2Q6GA 1FV9A 1GL0E 3BIVH 1HRTH 2CN0H 5EU8A 2ANYA 2GT8A 2GVFA 2J4IA 2ANWA 2BD9A 1XVOA 1D4PB 1LHDH 2XBVA 5K7RA 1ABIH 5F8XA 4Y7AA 1B7XB 3TPIZ 2K1QA 2OXSA 1DUAA 1PPEE 2H2ZA 3P70B 2BDBA 2PHBA 1HAIH 3MO3A 5FBEA 2OP9A 4CRFA 2JH0D 1NC6A 1Z1JA 2ZFFH 3QLPH 2TPIZ 1SOZA 2HNTC 4DGJA 1C1PA 1ABJH 4AFUA 4YLUA 1L1NA 4O03A 3U98H 3U69H 2A7CA 3PWBA 5CE1A 1NFYA 2HOBA 1PPZA 2CJIA 3RXLA 3RP2A 5F03A 1BA8B 1J8AA 4K1EA 2ZGCA 3V7TA 2ZNKH 4YTAA 1Q2WA 5K0HA 1J17T 4DJZB 2SGQE 1CA0B 1SGCA 4X8VH 4AYVB 1BJUA 4JZIA 1XXFA 2J34A 1BRUP 1J15A 3LOXA 3ZZDA 1O5CB 4WMEA 2AS9A 4YM9A 1FIWA 2QA9E 2XC5A 1ETSH 1C2MA 2ZPRA 3KIDU 3M3TA 1V2UT 3ITIA 1V2KT 3O8CA 4HTCH 3S7KB 4D8NA 1SVPA 4AB8A 1HAGE 4NSYA 1OSSA 1QB9A 3RLWH 2JH6D 1GBDA 3V3MA 3ZZ6A 3U1JB 1AZZA 4I32A 1J9CH 1FMGA 1ORFA 4JYVH 2RA0A 3ZVGA 3F9FA 1LKBA 1KLIH 1O3AA 2HPPH 3HK6B 5FBIA 2VWLA 1GI4A 7GCHG 1ESTA 1PPCE 2VVVA 4WF8A 1GPZA 2AGIX 1MAYA 2JETC 3A8DA 2ALPA 2VGCB 2EI8A 4I8HA 1PQ8A 1K1IA 1A0LA 8ESTE 1HIAA 1GJ8B 3HK3B 1FLEE 3RMMH 2ASUB 1NFUA 2G81E 4AFSA 1ZOMA 2Z94A 4JZDH 1GHWH 1BUIA 4UONA 1VITH 1GBKA 4Y0ZE 2WUBA 4K8YA 4Y0YE 1UJ1A 1DSUA 2VU8E 3M3VA 3UY9A 2C8ZB 4ZKRU 2ZC9H 4ZKOU 1GI2A 4XBBA 1O2YA 4K8BA 1MQ6A 1XKBC 3K9XB 1TMUH 2GV7A 4MDSA 1GI5A 1ZMLA 3DT0H 3L3TA 5LGOA 2XC4A 2CXVA 4TWYA 1KTTB 2FX6A 4FUJA 4BTIB 5EXMA 1C2LA 5GJ4B 3ATKA 2QF3A 1TPAE 5FXLA 1ZMJA 1CO7E 4A1VA 2FI3E 2BY7X 1AUJA 4Y8YA 3LH1A 1CHGA 4JK6A 3BEIB 1TNHA 1C1OA 1H8DH 4LXBH 1EJNA 1IQMA 1L4ZA 2PKAA 3R3GB 5C1XA 1YCPK 7ESTE 4DT7B 1SHYA 1KXBA 1ELTA 2H9TH 1P2OA 3TGKE 3JZ1B 3SQEE 3F68H 1ID5H 1ETRH 2ZFTA 2G5VA 2C8WB 1AIXH 1GI0A 2J2UA 3SU6A 2GZ9A 2R2WU 3S9CA 1O2WA 5E0JA 4CR9A 4FU7A
chains in the Genus database with same CATH superfamily
3GY6A 2BD2A 3DHKH 4MVNA 1RIWC 1UTMA 3M5OA 4D9QA 2HNTF 4R8TB 5HGGA 4IN2A 2FM2A 2F43B 5JBBS 1S83A 3SQHE 2QYIA 2G8TA 1BMAA 3LC3A 2DE9A 4X2YA 1PPHE 4MNYA 1NT1A 1T8LA 1TPOA 1TX8A 3O8BA 3LU9B 1DUEA 2AEIH 1P09A 1RS0A 2A45B 5JYIA 4KTUA 1Z6JH 1O3DA 3OFND 1AVGH 3QN7A 4GCHF 3MNBA 3UNQA 1JMOH 1W10U 5TCAA 3GISB 3D23A 3TVJB 1GI8B 2HNTE 1HAYB 2BVRH 1ETTH 1XUKA 3QTVH 5EODA 1EZSC 2ZHFH 7LPRA 3RMNH 4FVDA 3KYGA 1TA6A 3UREA 1TOMH 1P3EA 4CRAA 2SGDE 4O3UA 2GKVE 2G5NA 1D9IA 3ESTA 3LGTA 1D3QB 3M35A 3U8OH 1W0KD 1QA7A 1GBIA 2VH0A 2AGEX 3SNBA 2PW8H 2V0BA 2SNVA 3TNSA 8GCHG 1ESBA 5FCKA 1DPOA 4INKA 2ZIQH 1B0FA 3E3TA 4Y8XA 3MFJA 1AE8H 1TNKA 4GVUA 1MTVA 1C1UH 5G4BA 3SJIA 3KCGH 4Y10E 3S9BA 1YC0A 1K28D 2Z3DA 3S69A 2HWLB 3AAUA 1A61H 4UFFH 2A5AA 3SGQE 1E38B 3TH4H 2M5TA 3Q77A 1YLDA 2A4RA 1BOQA 5JDUB 1DANH 2VVCA 5C17A 3PO1C 3SU4A 4CH2B 1ELEE 1NRQH 2QXIA 3ZIAD 4BTTB 4OS2A 5PTPA 2GZ8A 1GBHA 1Y3XA 1FDPA 3ZVEA 3STJA 3GCTG 2VIPA 1RJXB 1MKXK 3DSPA 2Y6TA 3ATLA 2CGAA 1TWXB 2WV4A 1OP2A 2BXUH 3A85A 3GCHC 1PPFE 2WPIS 3ATWA 1GBLA 2Y7ZA 4Y71A 1TLDA 1HAXB 1QRXA 3HGPA 1ELGA 1SG8B 2KCOA 9LPRA 2VIVA 3VB5A 2ZPQA 1O3NA 2BD3A 1TX6A 3F2GA 3RC4A 1IHSH 2FZZA 1QGFA 1X7AC 2XNDD 1PPBH 1YPHE 3QTOH 4H42U 1K1MA 1TGCA 2BX3A 3U8RH 3H7OA 1GDNA 2DUCA 1EB1H 1O2ZA 4O9VA 4K5ZA 4M9FA 3I78A 4WH6A 1EUFA 2GCHF 2V3HH 1VCWA 4YXWD 4AGKA 4Y76A 5EJ1A 2P3TB 1P01A 3SHAH 2O8UA 1IQJA 1K2I1 4U30A 2Y82A 1LVBA 2FO9A 1W7XH 1MTNC 3W94A 1ZRBA 2Q6FA 3RM0H 1SGFG 1TNJA 1JOUB 1W2KH 3BSQA 1ZPBA 5FAHA 1IQKA 1RTFB 1D3TB 2SFAA 3RXSA 4D7GA 1K21H 5GCHF 1SFIA 2R3UA 3BTFE 2YMSD 2O9QA 4JK5A 5DP9A 1P11E 5DP8A 1OP0A 4ABEA 1D6WA 5EPNA 1L0ZA 5DPAA 1E1QD 2VGCC 1EKBB 3RXHA 2FP7B 4TWWA 1SGNE 1GBCA 2W5EA 4GLYA 4X1SU 3F6UH 5A0AE 2STBE 1YLNA 2ZU5A 4Y6DA 3ZZ8A 4UFDH 4FUDA 3U8TH 3RM2H 2B8OH 5B6LA 1K1OA 1GCDA 5CMXH 2Y81A 4UFGH 3PB1E 2ZDLA 1FY3A 1ZJDA 3A80A 3A83A 1H8IH 3NKKA 4IGDA 1P05A 5JBTA 1HIAB 2QGRA 1MQ5A 2J98A 2BOKA 5E8EH 2BY6X 2Z9IA 2PLXA 3SV6A 1KIGH 1N6XA 4XDEA 3SV2H 4NIWA 2KR7A 4FUIA 2BDCA 4NFFA 2W26A 3F9HA 1FIZA 1P2MA 4IMQA 3MI4A 1J14A 1SGIB 3KGPA 2PTCE 3OY5U 1ZGIA 4LZ1H 4IS5A 4YOGA 2WZQA 3LJJA 1ZZZA 3NPSA 1OWJA 1EAUA 1WYKA 5AFYH 2QF0A 4F4OC 4B74A 2QV1A 2IPHA 3BTEE 5IDKA 1AB9C 1QRZA 2GCHG 2FDAA 3A7XA 2TRMA 2FS9A 4B2BA 1FQ3A 1TYNA 2OD3B 3ELAH 3BTHE 2AH4X 3GDUA 3OX7U 5E0HA 2R9PA 5JB9S 4K2YA 2P3FH 1O5AB 3MH4A 1HUTH 4MTBA 2J95A 3D62A 4D7FA 1ZJKA 1F2SE 3FFGA 2NWNA 1CQQA 1BHXB 4MG3A 2PKSB 3PMAB 4IN1A 1FPHH 1TBZH 1ZHPA 4UFEH 3Q3KA 4UEHH 3PMJA 1TABE 1MTSA 3T26A 1QJ1B 1XKAC 3SUFA 2A32A 1YPHC 2XC0A 1VJ9U 2XOKD 3AW0A 1O2XA 4MLFB 1UK2A 3V0XA 1DLEA 2GV6A 4X1PU 3UNSA 1YWUA 4NZQA 2XRCA 5GIBA 4ASHA 1JBUH 3TH2H 2VIWA 1GJAB 3L6PA 4FXGH 3IITA 3KQDA 2G4TA 3UOUA 2ZDNA 1AE5A 1QIXB 4U01A 4ABBA 3SGBE 1T8MA 4WMFA 4TY6A 3H7TA 4AX9H 1O3PB 3SNCA 4DVAU 4I8GA 1NZQH 5I25A 1ANDA 1BITA 1C1MA 1S6HA 2HLDD 5CHBA 1F7ZA 3P6ZB 1SL3A 4Q80A 2EA3A 2FWWA 2XBYA 1UTPA 1KXDA 2QIQA 1DWEH 1Q3XA 1HAOH 2CMYA 2ANMH 2EI7A 1C5ZB 2ZU4A 3ZYDA 3K2UA 3OSYA 1AD8H 1T4VH 4ZUHA 1V2LT 3Q00A 1O3CA 4K1SA 3FN8A 3SU5A 3TK6A 3M36A 3MH7A 1YPEH 2PSXA 1E37B 2WV5A 1VGCB 2ZHDA 3SV8A 4OS6A 1LCYA 3MU4A 3SORA 1GHBG 3PV5A 1S0RA 2XWAA 3URDA 4BANB 4IC6A 1NRSH 1QBOA 1BMMH 2PUQH 4FUCA 1EFRD 3ATMA 1NRNH 1QB6A 3E0PB 1O30A 2Y80A 2ZPSA 1OKXA 1MTNB 3UUZA 5FPTA 4LK4A 3UQOA 3NWUA 1VITG 3EA9A 1AU8A 3BG8A 4ZROA 2AFQB 2Z9GA 3SJ8A 1ZHRA 1TB6H 2CK3D 1Y5BT 1QZ8A 1BMFD 5C3NA 1KYNA 1G32B 1RIWB 5ABWA 3BTTE 5EG4A 2JKHA 5EOKA 1BQYA 1CT0E 4X8TH 1YBWA 2IJOB 3A7VA 1XUGA 4JZEH 3VB3A 1CBWB 3PLBA 1GMHF 1HAPH 2R2MB 3HGNA 1VITF 2I6QA 1OOKB 2OINA 5FCRA 2BZ6H 3U9AH 3B9FH 1E36B 1O31A 5C1UA 2ZTZA 2BQWB 1TBRH 5AHGH 4BAQB 1WAYB 1E1RD 5C0TA 1DWBH 2LELA 1GI1A 1KXFA 3BN9A 4F49A 3TIUA 3SU3A 5FPYA 3RXJA 5A2MH 5JB8S 4AC9A 1U6QA 3M37A 2BHGA 4Q7ZA 4Y8ZA 3ZZ3A 1BDAA 3Q76A 5EQRA 2AYWA 1OS8A 3GYLB 4YT6H 2FOGA 2C8XB 1B0EA 4ISHH 1F5RA 3VEQB 1O2TA 1GMDG 4HI3A 2HLCA 2ILNA 1O39A 4NA9H 1G3BA 1YP9A 3G01A 4WH8A 1CHOF 4IW4E 1Z7KA 3T5FH 1GVZA 5HM9A 1K1NA 1ZRKA 1Y8TA 4XE4A 1BMLA 1EJAA 4A1XA 1GBJA 3ZZ9A 1NESE 2EC9H 3C27B 1O3OA 1TNGA 2H9HA 3S0NA 1YF4A 1YKTA 2GT7A 1O36A 1MKXH 4LZ4B 1AFQB 3RXTA 2AMPA 4CRBA 4FU9A 1LVOA 3M7UA 4X0WU 4TT3D 1TGBA 2O8TA 4B2AA 1C1NA 2W7UA 1SSXA 5F8ZA 3DFJA 1RTLA 1P10A 1QTFA 1YPMH 1GHBF 1G30B 1SMFE 3GDSA 2ZEBA 3SJ9A 4DIIH 5C1YA 1GMHG 3VGCB 3ZZCA 1T31A 4GUXA 1FJSA 4FUBA 2ZCLP 1JIMA 1O33A 2FOAA 2ZFSA 1EJMA 1EP6A 2RCEA 4OS7A 2ZG0H 1V2TT 1YM0A 5J4SA 3RXDA 1KTSB 2QAAA 1H8HD 1KLTA 2QC2A 3SNEA 3GCOA 5C20A 1ZSJA 3SV7A 3BTKE 8LPRA 4AYYB 1BCUH 1Y59T 3M7TA 1O35A 3EGKH 2OC7A 4Z6AH 3SNDA 4DT4A 2FEQH 3EQ0H 1P8VC 2J38A 5C5OA 4JYTA 3TLOA 2KCPA 1LQDB 1PQ5A 1Z6EA 1EOJA 2BLQA 1TMBH 1B5GH 3QZRA 3Q3XA 2F91A 1HNEE 2OC1A 1XXDA 3K6ZA 5CHAC 1DT2A 3N7OA 2K0QA 1UTQA 1C5OH 1RTKA 1V2WT 2P94A 2Z9LA 3AASA 1YLCA 3ZYEA 1O34A 3D49H 1WXRA 2OK5A 4U32A 1A5HA 1DXPA 1ELAA 2GX4A 1GG6B 2WPKS 3M3SA 3RXEA 1LKAA 2Z6BD 1KXAA 4RN6A 3U28C 5JPMH 4XBCA 5T1VA 1LPZB 1T4UH 3RXAA 4XD7D 2FIRH 1OHHD 2Z9JA 2WYGA 2BD8A 1UTKA 3D65E 1QQ4A 1AI8H 3EE0B 4FUFA 3N7DA 1HGTH 2ZFQH 3SW2B 4ZMAH 1IQHA 2BM2A 1THSH 1AZ8A 1WDIA 4K60A 1WQSA 4NIVA 4YZUA 4ESTE 3IG6B 2ZA5A 3F0OA 5DP5A 1WTGH 3JZ2B 1MD8A 1MBMA 1GMDF 4E06H 1GBBA 4INLA 2PR3A 3PTBA 3O8DA 2W7SA 1NU9A 1BJVA 1O2IA 1GBEA 1ZR0A 1JRTA 2BZAA 2BVSH 4X6OA 1K1PA 1FN6A 1C5RA 1ZPCA 1UK3A 1GHXH 1HXFH 2D1JA 1FUJA 5JBAS 2A2XH 3QX5H 1HB0B 3GY5A 1C1TA 4J1YA 4ISNA 2ZHWH 2OUAA 4ABIA 3BTWE 3E1XB 2WSSD 4Q7YA 3GCTF 1YPLH 3GDVA 3KQEA 4CREA 5F8TA 1AO5A 2ZKSA 1GMCF 2WHXA 2A7JA 4CRGA 4FUGA 3DSOA 2QF5A 1N8OC 3A8AA 1HBTH 1SGRE 5E2OA 3NRLA 1O3KA 1M9UA 1JRSA 2ODPA 4BAOB 2Q1JA 1K0HA 2NU0E 2FOMB 2JIZD 3QO6A 1V2OT 5ETXA 3MO6A 3TGIE 2W6JD 4AFZA 6CHAC 1O2RA 1PFXC 3FO8D 2TGAA 3RXRA 2KFWA 1N8OB 3RMOH 1CE5A 1HLTH 2OCVB 3PLPA 4Y11E 1RFNA 1O2UA 1S5SA 2BQ7B 3AK5A 1ZPZA 4I8LA 4B71A 2XYAA 1O2NA 2ZQ1A 2GP9B 3F9GA 2BD4A 1DXWA 1C2HA 1C5YB 3A87A 4ASUD 5LPEA 5EJZA 2UWOA 3DFLA 1WOFA 3PM3A 5AFZH 3SZNA 1INCA 1BRCE 2FTLE 3T29A 3PTNA 1VJAU 2HRVA 1AMHA 2WPHS 1HAZB 1SQOA 4BXWA 3RXUA 1OXGA 1SGQE 8KME2 1O3EA 1PQAA 3KHVA 3CENA 1TGNA 4YLQH 5HIYA 1FNIA 1DFPA 2PV9B 3EYDA 1P04A 1GI3A 2BDYA 3KEEA 1K1LA 1S6LA 1GDUA 4YESB 1LHEH 2VH6A 2OBQA 1QFKH 3SOSA 3ODDA 1NM6A 2F3CE 3RLYH 4ZXYH 1CA0C 1ELBA 1TMTH 2BY5X 1TGSZ 2OLGA 3OEHD 4B2CA 3TU7H 2YNAA 2TBSA 3NK8A 1O5DH 1GG6C 1BTZA 3U1IB 2XNIA 2OC0A 2IN2A 2EEKA 2C93B 3E0NB 2J92A 2GCTC 2JJ2D 1EASA 3LKWA 4JYUH 3KQ5A 1C5TA 1UVPA 5GPIB 1MMJN 2BOHB 1OWHA 1LPGB 2G4UA 5GXPA 5T6GA 2GJGA 5ESTE 1IQEA 2QN5T 1TPPA 3E16B 5B6OA 2AMDA 4WXIA 4IC5A 2C90B 3HPTB 1UW7A 3SUDA 4ABJA 2FYRA 3OTJE 2WV9A 6ESTA 3PROA 4RI0A 2WPDD 1Z8JB 1TNLA 2H9EH 1EAXA 5L30H 4SGAE 4ACBA 4FUHA 2RFKC 4XSKU 4KGAA 4CRDA 3IWMA 1KMHB 1BTXA 3VB6A 1IQLA 3RU4T 3RXFA 5F6MA 1S81A 4AN7A 4YOIA 2VWMA 4RT0A 4JCNA 1QL7A 3FZDA 4WY3A 1GVLA 3SJOA 4NZLA 1SQTA 1N6YA 3UR9A 4QT8C 3AAVA 4K69A 4AFQA 2R0KA 2H5CA 2ODYB 1UO6A 5DKMA 1CA8B 1NBME 2V3MA 5DP7A 1QBNA 2TGDA 3ZVDA 4AZ2B 1SLXB 2Y7XA 4HGCA 3A84A 4MQAA 4XFQA 3SO3A 2BD7A 2NU2E 4BNRA 2F9VA 1C2KA 1G2LA 3WWBA 1O2VA 1S84A 1ANEA 1W12U 4TPYA 1FN8A 1GJ7B 2XXLA 1CT2E 4AORA 2JJ1D 4AGJA 1XUJA 2VJ1A 1WU1A 5C94A 2F9PA 1KXCA 1C1WH 1QJ7B 2F9UA 4BTUB 3TK5A 1P57B 3TNTA 1UHBA 2Z3EA 3MU5A 1EAWA 1Z8RA 4SGBE 4GSOA 2W3KA 3UAIC 2WUCA 1QURH 1AGJA 4NSVA 2QF4A 2P8OB 1C1QA 3OYPA 2BD5A 2XCFA 1NU7B 2PP6A 3M5NA 3GYMA 1AFQC 2ZQ2A 2J97A 3ZV9A 3UTUH 1H1BA 3F9EA 1O2KA 2J98B 1ZTKA 1AFEH 5TJXA 1GCTC 1A3BH 3VXEH 5EIYA 5H4IB 3MQKC 1LHCH 4A7IB 5L2ZH 1JXPA 3A86A 4MPVA 2VBCA 4A6LA 1DSTA 1SGTA 1W0JD 1AKSA 4ZKSU 2AGGX 4B1TA 3CP7A 1SQRA 1V2VT 5BPEA 1C2EA 1C2DA 2D8WA 3DSGA 1DICA 1GGDC 4O97A 2FOCA 1MZAA 1FI8A 5T3HA 4E7RG 1SGDE 4DURA 1UVSH 2B0FA 3GICB 1TPSA 1CBWC 1G3EA 1GJ5H 2RG3A 3RUOA 3LIWA 4BXSA 2AMQA 3PO1B 4P00A 4CHAB 1GHAF 3TGJE 5LPFA 1PYTD 3S9AA 2SGEE 4AOQA 1TRYA 2G00A 2YNBA 2ZGBH 1C1SA 1C4V2 1W13U 3GY2A 4Y7BA 2BLOA 1GJDB 3L33A 5GWZA 1F5KU 3PLKA 1G9IE 1OYTH 1AUTC 1AY6H 2SNWA 3ZZBA 3FP8E 1GWAA 4VGCC 2W3IA 1QNJA 4ISLA 3BEFB 2C8YB 1GBAA 5ESBA 2J94A 5F53A 5C5NA 2PWXA 3MU8A 3LH3A 1KXEA 1C5VA 1A1RA 1VGCC 1TBQH 2FXRA 3FP7E 2OBOA 2ZTXA 4B6EA 2BX4A 3GS9A 1C1VH 4X1RU 4TYDA 3C1KA 4GPGA 1ELFA 1P3CA 1J16A 1Y3VA 2C3SA 4BAHB 3E91A 4MPWA 5FX6A 2ZI2H 3F3BA 4LOYH 1ARBA 1P2NA 4I33A 4Q2KA 2FOBA 2NU4E 2ZWLH 3NUMA 2FX4A 3MOCA 2ZGJA 2PGBB 1EOLA 1FZZA 5DP3A 3RXKA 2RDEA 3SYJA 1H9IE 2F9OA 2PTNA 1DY9A 3MU0A 1H9HE 2VIOA 1BBRE 2ZHEH 4U2WA 5EW1H 2ZDMA 1IAUA 2THFB 6CHAB 3QUMP 2ZGXH 1EPTB 2ZCKP 1E79D 3FVFB 3KQCA 3OAAD 4HZHA 3RXIA 4B75A 4OS4A 4UDWH 1O2QA 2OQ5A 1NO9H 4ZXXH 1GHAG 3AW1A 1P2KA 1AKSB 5EGMA 4KTCA 1TA2A 2BMGB 1ZTJA 1VCQA 3ATIA 3EAJA 1A4WH 3BG4C 3UOPA 2GDDA 1XX9A 2PUXB 1LVMA 1H4WA 4DY7B 5A0CA 1SLUB 2V3OH 1O2MA 1HAHH 2AERH 2JH5D 5JBCS 1DM4B 2K8IA 4I7YH 1NN6A 5DP6A 1EQ9A 2ESTE 5SGAE 1NY22 1GI7B 1WV7H 5J4QA 1S6FA 2XBWA 3P8OA 2ZFPH 5T6FA 1ACBE 1SGEE 1V2NT 3KF2A 7GCHF 1UHBB 3MMGA 1AB9B 1HCGA 5GDSH 3RDZA 1VCPA 3BTGE 1XMNB 1T7CA 1HDTH 1UTLM 4BOHA 3P92A 2P16A 5C2ZA 9ESTA 3FKSD 1SGPE 1A2CH 2LNCA 1GI9B 4K1TA 3EE7A 4NFEA 3RXPA 5L2YH 4FETA 1G2MA 1BZXE 4H6TA 2FLRH 3FOAA 1BB0B 1L4DA 1Z1IA 1LPKB 2Z9KA 1S0QA 4Z1MD 1OYQA 4WMDA 3V12A 2G51A 4ABDA 2A4OA 1O5GH 4PROA 2M2AA 2KAIA 3ZVFA 1GL1A 2GGVB 3RXQA 4NG9H 3SI3H 1EZXC 1O3JA 2GMTC 1VZQH 1KDQB 1MBQA 3QDZB 2VIDA 2ZGHA 5DJ7A 2WPLS 3A88A 2OQUA 2HPQH 5A09A 2A0QB 3PMBB 1V3XA 4DIHH 2C4FH 2CHAB 1C5LH 1DDJA 2VWOA 1C2FA 1QJ6B 3HATH 3P95A 2JDID 1MD7A 3ZVAA 1SLWB 1A7SA 1BTYA 2RA3A 1GVKB 2ZDVH 1DVAH 1QHRB 1UTOA 2BB4A 3BEUA 4E7NA 1SGYE 1PJPA 4X6PA 3CS7A 2V6NA 1DITH 2FLBH 3CNRA 3KN2A 2ZZUH 2VNTA 1F5LA 1ZSKA 1GJ9B 2H5DA 2O8MA 1QB1A 3EA8A 4X2WA 3VB7A 1UCYH 1MCVA 4KP0A 2G55A 3LC5A 1O3HA 1C4U2 1EPTA 1Y5UT 2ZECA 3MH5A 2BDHA 2L6OA 5HYOA 1UCYE 2OC8A 2QY0B 4BAKB 1SBWA 5FPSA 3FP6E 4MNXA 1CGHA 1GJCB 2GD4B 1H9LB 3TJOA 4IBLH 3T25A 1MUEB 2G52A 2XBXA 1QL9A 1UTJA 3NCLA 2ANKH 1TFXA 2WPJS 2QCYA 2AIPA 1CGJE 3OEED 3ZZAA 3SUGA 4X8SH 3R0FA 4VGCB 3BF6H 4XOJA 5KGOA 1O3IA 3FANA 4H4FA 1ELVA 3BIUH 4TPIZ 2HVYB 1IQIA 3I77A 3PRDA 1D6RA 1FY5A 1O3GA 1O5FH 1SFQB 2VIQA 5IYTA 5LH8A 1LQEA 4RKJB 1SLVB 5KECA 5L6NH 1MKWK 3BTQE 1NFWA 3LGVA 2F9NA 1P2JA 2FODA 2TIOA 3RXOA 2PFEA 5HKKD 1MU6B 1BBRH 3UWIA 2ZU1A 4MNWA 2A1DB 4KELA 3A7WA 1TALA 1TNIA 1UCYK 3DA9B 3A7YA 3SGAE 1GGDB 2BY9X 5DN6D 4HG6A 2Q6DA 1QQUA 3MNCA 5T6DA 4A5TS 2ZO3H 2UWLA 1YPKH 4A1TA 3A89A 4B6FA 1O3BA 2BLVA 2UUJB 2AHME 3GCHB 4DOQA 4DCDA 3F0PA 3RXBA 5HM2A 4J2YB 3LGIA 5HMAA 2UUYA 1IQNA 1ELDE 2SGFE 1O5BB 3WY8A 1ZLRA 3QWCH 1SC8U 4WWYA 3RMLH 1O3LA 3BG4B 3STIA 1TE0A 1TONA 1UVOA 2ZTYA 3GY3A 3SUEA 1FONA 1P2IA 4ABAA 3K65B 3PWCA 2B5TB 1TIOA 2P93A 5AF9H 1OX1A 1HAVB 3FZZA 3P17H 3RXMA 1DOJA 3LDXH 1RXPA 4NIYA 3B23B 1P02A 6LPRA 2P8OC 2QXJA 1T8OA 1F0RA 2CF8H 1C5PA 4X6MA 3BTME 3EA7A 1GHZA 2B9LA 1C2IA 3MNXA 3WWFA 4CH8B 1BHXF 1HJ8A 4KKDA 1NRPH 1C9PA 3LT3A 3RC6A 3LGWA 1BRAA 4AB9A 4Q7XA 2UWPA 1HJAB 4NA8A 3LJOA 1E34B 1D3DB 1RGQA 3VXFH 2WYJA 1W0YH 1TOCB 1F0UA 2BYAX 3HKJB 2D2DA 1HJAC 4ABGA 5E0GA 1AN1E 2J9NA 5DO4H 1HFDA 3MU1A 1SPJA 3ZZ7A 1YPJH 2TGPZ 3Q3YA 6GCHF 1SKYE 1WSSH 2D26C 2PKAB 2AIQA 1EZQA 3UIRA 2ZU3A 4ZHMU 1QBVH 4ZHLU 1QCPA 1VKYA 5FL7D 1FAXA 4RSPA 1N1LA 2BLWA 2A4GA 1CGIE 3M7QA 3MO9A 1SQAA 1O2GH 3PV2A 5EW2H 1O0DH 2H6MA 3P8FA 1C5WB 4CBNA 2ZP0H 1GJ6A 2Y5FA 1XUIA 3F2FA 1GJ4H 1O32A 1SHHB 2ZHQH 2FOHA 3MNSA 4WXVA 1BTHH 5A8YA 2GTBA 1DY8A 6GCHG 7KMEH 3OTPA 1DWCH 1QR3E 2YMSB 4FU8A 2R3YA 1KY9A 4OGXA 1BTWA 5CDFE 4A92A 1K1JA 1K9OE 2WPMS 4WVPE 1PQ7A 1WUNH 1UVUH 1SOTA 1SI5H 5DK1A 1HJ9A 1RD3B 2A7HA 2GCTB 2I6SA 4CHAC 1O37A 2WINI 2PSYA 3RC5A 1S82A 1OWEA 3GCNA 1MU8B 1ANCA 3V13A 4MPUA 2O8WA 1EP5A 4O3TA 2Y5HA 4OGYA 3VB4A 1FAKH 4YOJA 3W95A 3O8RA 2P59A 3RXCA 4FUEA 1A0HB 4MPXA 3ZV8A 2PKSC 4JZFH 3M5MA 3UNRA 2EI6A 1EAIA 2FYQA 4TY7A 4XRNA 3MWIU 3OE7D 3QGJA 3QZQA 3URCA 1FPCH 3A8BA 3GOVB 1FY1A 3LONA 1V2ST 3M5LA 1IHTH 1JWTA 2VWNA 3T62A 5EQSA 1GHVH 4GHQA 1DLKB 3KNXA 2KAIB 1L2EA 3KL6A 2BY8X 1C5MD 1UMAH 1GHYH 2Z7FE 1GBTA 1O2PA 3BV9B 2ZDKA 3MHWU 4BAMB 4NIXA 1CT4E 1EPTC 1FY8E 4MNVA 1K22H 2A5KA 1A0JA 3VPKA 1WCZA 2FTMA 1C2JA 2QXGA 1QA0A 4IMZA 2CF9H 1Y3WA 1OWIA 3TH3H 4B73A 1AWHB 4ZCNA 3RU4D 4GAWA 1YCPM 3SJKA 1IQGA 2F4LA 2HVXA 2ZFRH 1C5NH 2FS8A 2Z3CA 3BTDE 3M61U 3A81A 4NGAH 2OTVA 4ABHA 1DWDH 4NCYA 4I8JA 1YCPH 1P2QA 2CV3A 2FOFA 3ZZ5A 3HKIB 4X2VA 1FY4A 1O2SA 2BVXH 1XM1A 1TGTA 5I46H 1AQ7A 3AVZA 3DD2H 5EJLA 3T27A 1UTNA 2FI4E 5E2PA 1TRMA 2ODQA 3B8JA 4E05H 3TJUA 4OS1A 4WJG2 3LGYA 1CVWH 1Z71A 1YGCH 4ZKNU 1A46H 1OPHB 1ZYOA 2HALA 1UK4A 2CHAC 3TITA 3PYHA 1TQ7B 2TGTA 4M7GA 2IPQX 1CSOE 3SHCH 3A8CA 3SU0A 2GMTB 2RDLA 1NBMD 3SV9A 3GY4A 1W8BH 1LO6A 1COWD 1BT7A 1HXEH 4ZAEA 3S7HB 3P8NA 3H5CB 4GHTA 1KLJH 1NTPA 1V6DA 2BDAA 2QXHA 1XVMA 1YPGH 1OWKA 2ZF0H 1IQFA 1NRRH 2P95A 1V2RT 1KDQA 3NXPA 1BIOA 4DW2U 4ISIH 3VG8A 1ZGVA 1Y3UA 3LGUA 1MCTA 2IOTA 1F0SA 4JZ1A 3SN8A 5BRRE 1XUFA 2P3UB 2O8LA 1C4Y2 1YYY1 1IOEA 1TQ0B 4CR5A 5A8XA 4B76A 4Q4LA 2VB0A 4YO9A 2A4QA 2XW9A 3RXGA 2FESH 1WQVH 1Q31A 4H6SB 2H1UA 1F0TA 1HAVA 2SGPE 1GMCG 5HXFA 3ENSB 1EATA 1F92A 1O3MA 3SI4H 2BDGA 1Y5AT 4KTSA 4D76A 1GI6A 4RKOB 1GCTB 1O2OA 1WBGB 1ANBA 3TK9A 3F1SB 4Y79A 1UVTH 1GJBB 3ODFA 1O38A 3K6YA 1C5UA 4I8KA 3UWJH 1QRWA 1ZSLA 1HV7A 3SBKA 3T2NA 1OP8A 4ISOA 5A0BA 1V2MT 2XTTB 1DS2E 4TSFD 2ULLA 2LP6A 1V2QT 2R0LA 1E0FD 1EB2A 1FXYA 1V2JT 2BQ6B 4I86A 1HPGA 3QK1A 1PPGE 1KSNA 1O5EH 1MH0A 1L1JA 1MTWA 1NFXA 1GDQA 1P03A 3FAOA 2GDEH 2VVUA 1CHOG 1A5IA 4NWLA 5FX5A 2HGTH 4NA7A 3A7ZA 3MTYA 1P9UA 4AG2A 5LPRA 2EQNA 2STAE 5DGJA 4R0IA 4FVBA 2F83A 1P12E 4UE7H 1TAWA 3I29A 1TX7A 1MTUA 4YT7H 1AWFH 2BTCE 3MH6A 5DSFA 1WTHD 4X1NU 3DUXH 2KM0A 1W7GH 1D3PB 1MKWH 2BXTH 1A5GH 2FPZA 4XBDA 1EZUC 3UFAA 1ELCA 1PYTC 3VFEA 1T32A 1LHFH 1O2LA 1S85A 4X8UH 3A82A 3WW7A 3F2HA 4K3JA 1G37A 1AHTH 3UQVA 2DE8A 1LVYA 2NU1E 1Y3YA 4HFPB 3DCLA 1RRKA 2LPRA 1GBMA 1O3FA 1ZHMA 3ZVBA 4ZH8A 2PGQB 1SR5C 2UUKB 3GY8A 4CRCA 3TJNA 1AVXA 4INHA 1NPMA 2NU3E 2ZDAH 1NROH 1BTPA 2V7QD 8GCHF 1EX3A 5FHTA 2A2QH 4DG4A 4OS5A 2BDIA 5C67A 2XCNA 4ZHAA 1P06A 1P0SH 3KQBA 1MAXA 3PMHB 1QL8A 3SNAA 2XWBI 2UUFB 1W11U 5AVDA 1QY6A 4AG1A 2F9BH 2YMSC 1BMNH 3ZZ4A 2QE7D 4UD9H 1LHGH 1OWDA 1W3CA 5DG6A 3TJVA 3A7TA 5A8ZA 1VR1H 1BRBE 5DP4A 2ZCHP 2SGAA 3ZVCA 1O2JA 5EXLA 1O2HA 1G36A 1SB1H 1TRNA 1G3CA 1THRH 3E6PH 1XUHA 1MZDA 1LMWB 2V35A 3N99A 2A5IA 1Z8IB 2FOEA 2Y5GA 1THPB 3GY7A 1ARCA 3E90B 5CHAB 1SGFA 1DX5M 1BBRK 1P9SA 1JIRA 1HYLA 4ABFA 4X6NA 3P8GA 1W14U 1LTOA 4I31A 4F55A 2IJD1 1Z8GA 3RU4E 4Q63A 4X1QU 5EPYA 4CBOA 1ZMNA 3SU2A 1W0ZU 3LPRA 2B7DH 2VINA 2GZ7A 2ALVA 1YY3A 1E35B 3SU1A 5GCHG 1L1GA 4X2XA 1ESAA 1V2PT 1CU1A 3OY6U 4D9RA 1BTUA 2FMJA 3RXVA 2YOLA 4Z0KA 5EXNA 1ZTLA 3CS0A 4THNH 3VGCC 1NS3A 4NWKA 3OU0A 3UR6A 1EXFA 1DE7H 1GBFA 2A31A 3T28A 3MYWA 1A3EH 5EQQA 1C2GA 1C1RA 1C5XB 1T8NA 2ZU2A 1C5SA 3NZIA 4JMYA 1AVWA 1LDTT 1C9TA 4GCHG 5TCCA 2FI5E 1G3DA 2JETB 3E8LA 3EDXB 1C5QA 3QGNB 3PV4A 3UPEA 2Q6GA 1FV9A 5GNDA 1GL0E 3UB0A 3BIVH 1HRTH 2CN0H 5EU8A 2ANYA 2GT8A 2GVFA 2J4IA 2ANWA 2BD9A 5C0UA 1XVOA 1D4PB 1LHDH 2XBVA 5K7RA 3N7EA 1ABIH 5F8XA 4Y7AA 1B7XB 3TPIZ 2K1QA 2OXSA 1DUAA 1PPEE 2H2ZA 3P70B 2BDBA 2PHBA 1HAIH 3MO3A 5FBEA 2OP9A 4CRFA 2JH0D 1NC6A 1Z1JA 2ZFFH 3QLPH 2TPIZ 1SOZA 2HNTC 4DGJA 1C1PA 1ABJH 4AFUA 4YLUA 1L1NA 4O03A 3U98H 3U69H 2KZ4A 2A7CA 3PWBA 3PRBA 5CE1A 1NFYA 2HOBA 1PPZA 2CJIA 3RXLA 3RP2A 3SZEA 5F03A 1H8ED 4RT1A 5IK2D 1BA8B 1J8AA 4K1EA 2ZGCA 3V7TA 2ZNKH 4YTAA 1Q2WA 5K0HA 1J17T 4DJZB 2SGQE 3W1EA 1CA0B 1SGCA 4X8VH 2L74A 4AYVB 1BJUA 4JZIA 1XXFA 2J34A 1BRUP 1J15A 3LOXA 3ZZDA 1O5CB 4WMEA 2AS9A 4YM9A 1FIWA 1FX0B 2QA9E 2XC5A 1ETSH 1C2MA 2ZPRA 3KIDU 3M3TA 5HIZA 1V2UT 3ITIA 1V2KT 3H09A 3O8CA 4HTCH 3KYFA 3S7KB 4D8NA 1SVPA 4AB8A 1HAGE 4NSYA 1OSSA 1QB9A 3RLWH 2JH6D 1GBDA 3V3MA 3ZZ6A 3U1JB 1AZZA 4I32A 1J9CH 1FMGA 1ORFA 4JYVH 2RA0A 3ZVGA 4P02A 4F48B 3F9FA 1LKBA 1KLIH 1O3AA 2HPPH 3HK6B 5FBIA 2VWLA 1GI4A 7GCHG 1ESTA 1PPCE 2VVVA 4WF8A 1GPZA 2AGIX 1MAYA 2KCAA 2JETC 3A8DA 2ALPA 2VGCB 2EI8A 4I8HA 1PQ8A 1K1IA 1A0LA 8ESTE 1HIAA 1GJ8B 3HK3B 1FLEE 2W6ID 3RMMH 2ASUB 1NFUA 2G81E 4AFSA 1ZOMA 2Z94A 4JZDH 1GHWH 2KCYA 1BUIA 4UONA 1VITH 1GBKA 4Y0ZE 2WUBA 4K8YA 4Y0YE 1UJ1A 1DSUA 2VU8E 3M3VA 3UY9A 2C8ZB 4ZKRU 2ZC9H 4ZKOU 1GI2A 4XBBA 1O2YA 4K8BA 5KEDA 1MQ6A 1XKBC 3K9XB 1TMUH 2GV7A 4MDSA 1GI5A 1ZMLA 3DT0H 3L3TA 4OM9A 5LGOA 2XC4A 1MABB 2CXVA 4TWYA 1KTTB 2FX6A 4FUJA 4BTIB 5EXMA 1C2LA 5GJ4B 3ATKA 2QF3A 1TPAE 5FXLA 1ZMJA 1CO7E 4A1VA 2FI3E 2BY7X 1AUJA 4Y8YA 3LH1A 2KX4A 1CHGA 4JK6A 3BEIB 1TNHA 1C1OA 1H8DH 4LXBH 1EJNA 1IQMA 1L4ZA 2PKAA 3R3GB 5C1XA 1YCPK 7ESTE 4DT7B 1SHYA 1KXBA 2EY4C 1ELTA 2J5UA 2H9TH 1P2OA 3TGKE 3JZ1B 3SQEE 3F68H 1ID5H 1ETRH 2ZFTA 2G5VA 2C8WB 4ACAA 1AIXH 1GI0A 2J2UA 3SU6A 2GZ9A 2R2WU 3S9CA 1O2WA 5E0JA 4FOUC 4CR9A 4FU7A
chains in the Genus database with same CATH topology
3GY6A 2BD2A 3DHKH 4MVNA 1RIWC 1UTMA 3M5OA 4D9QA 2HNTF 4R8TB 5HGGA 4IN2A 2FM2A 5JBBS 1S83A 3SQHE 2QYIA 2G8TA 1BMAA 3LC3A 2DE9A 4X2YA 1PPHE 4MNYA 1NT1A 1T8LA 1TPOA 1TX8A 3O8BA 3LU9B 1DUEA 2AEIH 1P09A 1RS0A 2A45B 5JYIA 4KTUA 1Z6JH 1O3DA 1AVGH 3QN7A 4GCHF 3MNBA 3UNQA 1JMOH 1W10U 5TCAA 3GISB 3D23A 3TVJB 1GI8B 2HNTE 1HAYB 2BVRH 1ETTH 1XUKA 3QTVH 5EODA 1EZSC 2ZHFH 7LPRA 3RMNH 4FVDA 1TA6A 3UREA 1TOMH 1P3EA 4CRAA 2SGDE 4O3UA 2GKVE 2G5NA 1D9IA 3ESTA 3LGTA 1D3QB 3M35A 3U8OH 1QA7A 1GBIA 2VH0A 2AGEX 3SNBA 2PW8H 2V0BA 2SNVA 3TNSA 8GCHG 1ESBA 5FCKA 1DPOA 4INKA 2ZIQH 1B0FA 3E3TA 4Y8XA 3MFJA 1AE8H 1TNKA 4GVUA 1MTVA 1C1UH 5G4BA 3SJIA 3KCGH 4Y10E 3S9BA 1YC0A 1K28D 2Z3DA 3S69A 2HWLB 3AAUA 1A61H 4UFFH 2A5AA 3SGQE 1E38B 3TH4H 2M5TA 3Q77A 1YLDA 2A4RA 1BOQA 5JDUB 1DANH 2VVCA 3PO1C 3SU4A 4CH2B 1ELEE 1NRQH 2QXIA 4BTTB 4OS2A 5PTPA 2GZ8A 1GBHA 1Y3XA 1FDPA 3ZVEA 3STJA 3GCTG 2VIPA 1RJXB 1MKXK 2Y6TA 3ATLA 2CGAA 1TWXB 2WV4A 1OP2A 2BXUH 3A85A 3GCHC 1PPFE 2WPIS 3ATWA 1GBLA 2Y7ZA 4Y71A 1TLDA 1HAXB 1QRXA 3HGPA 1ELGA 1SG8B 9LPRA 2VIVA 3VB5A 2ZPQA 1O3NA 2BD3A 1TX6A 3RC4A 1IHSH 2FZZA 1QGFA 1X7AC 1PPBH 1YPHE 3QTOH 4H42U 1K1MA 1TGCA 2BX3A 3U8RH 3H7OA 1GDNA 2DUCA 1EB1H 1O2ZA 4O9VA 4K5ZA 3I78A 4WH6A 1EUFA 2GCHF 2V3HH 1VCWA 4AGKA 4Y76A 2P3TB 1P01A 3SHAH 2O8UA 1IQJA 1K2I1 4U30A 2Y82A 1LVBA 2FO9A 1W7XH 1MTNC 3W94A 1ZRBA 2Q6FA 3RM0H 1SGFG 1TNJA 1JOUB 1W2KH 3BSQA 1ZPBA 5FAHA 1IQKA 1RTFB 1D3TB 2SFAA 3RXSA 4D7GA 1K21H 5GCHF 1SFIA 2R3UA 3BTFE 2O9QA 4JK5A 5DP9A 1P11E 5DP8A 1OP0A 4ABEA 1D6WA 5EPNA 1L0ZA 5DPAA 2VGCC 1EKBB 3RXHA 2FP7B 4TWWA 1SGNE 1GBCA 2W5EA 4GLYA 4X1SU 3F6UH 5A0AE 2STBE 2ZU5A 4Y6DA 3ZZ8A 4UFDH 4FUDA 3U8TH 3RM2H 2B8OH 1K1OA 1GCDA 5CMXH 2Y81A 4UFGH 3PB1E 2ZDLA 1FY3A 1ZJDA 3A80A 3A83A 1H8IH 3NKKA 4IGDA 1P05A 5JBTA 1HIAB 2QGRA 1MQ5A 2BOKA 5E8EH 2BY6X 2Z9IA 2PLXA 3SV6A 1KIGH 1N6XA 4XDEA 3SV2H 4NIWA 4FUIA 2BDCA 4NFFA 2W26A 3F9HA 1FIZA 1P2MA 4IMQA 3MI4A 1J14A 1SGIB 3KGPA 2PTCE 3OY5U 1ZGIA 4LZ1H 4IS5A 4YOGA 3LJJA 1ZZZA 3NPSA 1OWJA 1EAUA 1WYKA 5AFYH 2QF0A 4F4OC 4B74A 2QV1A 2IPHA 3BTEE 5IDKA 1AB9C 1QRZA 2GCHG 2FDAA 3A7XA 2TRMA 2FS9A 4B2BA 1FQ3A 1TYNA 2OD3B 3ELAH 3BTHE 2AH4X 3GDUA 3OX7U 5E0HA 2R9PA 5JB9S 4K2YA 2P3FH 1O5AB 3MH4A 1HUTH 4MTBA 2J95A 3D62A 4D7FA 1ZJKA 1F2SE 3FFGA 2NWNA 1CQQA 1BHXB 4MG3A 2PKSB 3PMAB 4IN1A 1FPHH 1TBZH 1ZHPA 4UFEH 3Q3KA 4UEHH 3PMJA 1TABE 1MTSA 3T26A 1QJ1B 1XKAC 3SUFA 2A32A 1YPHC 2XC0A 1VJ9U 3AW0A 1O2XA 4MLFB 1UK2A 3V0XA 1DLEA 2GV6A 4X1PU 3UNSA 4NZQA 5GIBA 2XRCA 4ASHA 1JBUH 3TH2H 2VIWA 1GJAB 3L6PA 4FXGH 3IITA 3KQDA 2G4TA 3UOUA 2ZDNA 1AE5A 1QIXB 4U01A 4ABBA 3SGBE 1T8MA 4WMFA 4TY6A 3H7TA 4AX9H 1O3PB 3SNCA 4DVAU 4I8GA 1NZQH 5I25A 1ANDA 1BITA 1C1MA 1S6HA 1F7ZA 3P6ZB 1SL3A 4Q80A 2EA3A 2FWWA 2XBYA 1UTPA 1KXDA 2QIQA 1DWEH 1Q3XA 1HAOH 2CMYA 2ANMH 2EI7A 1C5ZB 2ZU4A 3ZYDA 3K2UA 3OSYA 1AD8H 1T4VH 4ZUHA 1V2LT 3Q00A 1O3CA 4K1SA 3SU5A 3TK6A 3M36A 3MH7A 1YPEH 2PSXA 1E37B 2WV5A 1VGCB 2ZHDA 3SV8A 4OS6A 1LCYA 3MU4A 3SORA 1GHBG 1S0RA 2XWAA 3URDA 4BANB 4IC6A 1NRSH 1QBOA 1BMMH 2PUQH 4FUCA 3ATMA 1NRNH 1QB6A 3E0PB 1O30A 2Y80A 2ZPSA 1OKXA 1MTNB 3UUZA 5FPTA 4LK4A 3UQOA 3NWUA 1VITG 3EA9A 1AU8A 3BG8A 4ZROA 2AFQB 2Z9GA 3SJ8A 1ZHRA 1TB6H 1Y5BT 5C3NA 1KYNA 1G32B 1RIWB 5ABWA 3BTTE 5EG4A 2JKHA 5EOKA 1BQYA 1CT0E 4X8TH 1YBWA 2IJOB 3A7VA 1XUGA 4JZEH 3VB3A 1CBWB 3PLBA 1GMHF 1HAPH 2R2MB 3HGNA 1VITF 2I6QA 1OOKB 2OINA 5FCRA 2BZ6H 3U9AH 3B9FH 1E36B 1O31A 5C1UA 2ZTZA 2BQWB 1TBRH 5AHGH 4BAQB 1WAYB 1DWBH 4F49A 1GI1A 1KXFA 3BN9A 3TIUA 3SU3A 5FPYA 3RXJA 5A2MH 5JB8S 1U6QA 3M37A 2BHGA 4Q7ZA 4Y8ZA 3ZZ3A 1BDAA 3Q76A 5EQRA 2AYWA 1OS8A 3GYLB 4YT6H 2FOGA 2C8XB 1B0EA 4ISHH 1F5RA 3VEQB 1O2TA 1GMDG 4HI3A 2HLCA 2ILNA 1O39A 4NA9H 1G3BA 1YP9A 3G01A 4WH8A 1CHOF 4IW4E 1Z7KA 3T5FH 1GVZA 5HM9A 1K1NA 1ZRKA 1Y8TA 4XE4A 1BMLA 1EJAA 4A1XA 1GBJA 3ZZ9A 1NESE 2EC9H 3C27B 1O3OA 1TNGA 2H9HA 3S0NA 1YF4A 1YKTA 2GT7A 1O36A 1MKXH 4LZ4B 1AFQB 3RXTA 2AMPA 4CRBA 4FU9A 1LVOA 3M7UA 4X0WU 1TGBA 2O8TA 4B2AA 1C1NA 2W7UA 1SSXA 5F8ZA 3DFJA 1RTLA 1P10A 1QTFA 1YPMH 1GHBF 1G30B 1SMFE 3GDSA 2ZEBA 3SJ9A 4DIIH 5C1YA 1GMHG 3VGCB 3ZZCA 1T31A 4GUXA 1FJSA 4FUBA 2ZCLP 1JIMA 1O33A 2FOAA 2ZFSA 1EJMA 1EP6A 2RCEA 4OS7A 2ZG0H 1V2TT 1YM0A 5J4SA 3RXDA 1KTSB 2QAAA 1KLTA 2QC2A 3SNEA 3GCOA 5C20A 1ZSJA 3SV7A 3BTKE 8LPRA 4AYYB 1BCUH 1Y59T 3M7TA 1O35A 3EGKH 2OC7A 4Z6AH 3SNDA 2FEQH 3EQ0H 1P8VC 2J38A 5C5OA 4JYTA 3TLOA 1LQDB 1PQ5A 1Z6EA 1EOJA 2BLQA 1TMBH 1B5GH 3QZRA 3Q3XA 2F91A 1HNEE 2OC1A 1XXDA 3K6ZA 5CHAC 1DT2A 3N7OA 1UTQA 1C5OH 1RTKA 1V2WT 2P94A 2Z9LA 3AASA 1YLCA 3ZYEA 1O34A 3D49H 4U32A 1A5HA 1DXPA 1ELAA 2GX4A 1GG6B 2WPKS 3M3SA 3RXEA 1LKAA 2Z6BD 1KXAA 4RN6A 5JPMH 4XBCA 1LPZB 1T4UH 3RXAA 2FIRH 2Z9JA 2WYGA 2BD8A 1UTKA 3D65E 1QQ4A 1AI8H 3EE0B 4FUFA 1HGTH 2ZFQH 3SW2B 4ZMAH 1IQHA 2BM2A 1THSH 1AZ8A 4K60A 4NIVA 1WQSA 4ESTE 4YZUA 3IG6B 2ZA5A 5DP5A 1WTGH 3JZ2B 1MD8A 1MBMA 1GMDF 4E06H 1GBBA 4INLA 2PR3A 3PTBA 3O8DA 2W7SA 1NU9A 1BJVA 1O2IA 1GBEA 1ZR0A 1JRTA 2BZAA 2BVSH 4X6OA 1K1PA 1FN6A 1C5RA 1ZPCA 1UK3A 1GHXH 1HXFH 2D1JA 1FUJA 5JBAS 2A2XH 3QX5H 1HB0B 3GY5A 1C1TA 4J1YA 4ISNA 2ZHWH 2OUAA 4ABIA 3BTWE 3E1XB 4Q7YA 3GCTF 1YPLH 3GDVA 3KQEA 4CREA 5F8TA 1AO5A 2ZKSA 1GMCF 2A7JA 4CRGA 4FUGA 3A8AA 1N8OC 5E2OA 1HBTH 1SGRE 1O3KA 1M9UA 1JRSA 2ODPA 4BAOB 2Q1JA 2NU0E 2FOMB 3QO6A 1V2OT 5ETXA 3MO6A 3TGIE 4AFZA 6CHAC 1O2RA 1PFXC 2TGAA 3RXRA 1N8OB 3RMOH 1CE5A 1HLTH 2OCVB 3PLPA 4Y11E 1RFNA 1O2UA 1S5SA 2BQ7B 1ZPZA 4I8LA 4B71A 2XYAA 1O2NA 2ZQ1A 2GP9B 3F9GA 2BD4A 1DXWA 1C2HA 1C5YB 3A87A 5LPEA 2UWOA 3DFLA 1WOFA 3PM3A 5AFZH 3SZNA 1INCA 1BRCE 2FTLE 3T29A 3PTNA 1VJAU 2HRVA 1AMHA 2WPHS 1HAZB 1SQOA 4BXWA 3RXUA 1OXGA 1SGQE 8KME2 1O3EA 1PQAA 3KHVA 3CENA 1TGNA 4YLQH 1FNIA 1DFPA 2PV9B 3EYDA 1P04A 1GI3A 2BDYA 3KEEA 1K1LA 4YESB 1GDUA 1LHEH 2VH6A 2OBQA 1QFKH 3SOSA 3ODDA 1NM6A 2F3CE 3RLYH 4ZXYH 1CA0C 1ELBA 1TMTH 2BY5X 1TGSZ 2OLGA 4B2CA 3TU7H 2YNAA 2TBSA 3NK8A 1O5DH 1GG6C 1BTZA 3U1IB 2XNIA 2OC0A 2IN2A 2EEKA 2C93B 3E0NB 2J92A 2GCTC 1EASA 3LKWA 4JYUH 1C5TA 1UVPA 5GPIB 1MMJN 2BOHB 1OWHA 1LPGB 2G4UA 5GXPA 5T6GA 5ESTE 1IQEA 2QN5T 1TPPA 3E16B 5B6OA 2AMDA 4WXIA 4IC5A 2C90B 3HPTB 3SUDA 4ABJA 2FYRA 3OTJE 6ESTA 3PROA 1Z8JB 1TNLA 2H9EH 1EAXA 5L30H 4SGAE 4FUHA 4XSKU 4KGAA 4CRDA 3IWMA 1BTXA 3VB6A 1IQLA 3RU4T 3RXFA 5F6MA 1S81A 4AN7A 4YOIA 2VWMA 4JCNA 1QL7A 3FZDA 4WY3A 1GVLA 3SJOA 4NZLA 1SQTA 1N6YA 3UR9A 4QT8C 3AAVA 4K69A 4AFQA 2R0KA 2H5CA 2ODYB 1UO6A 5DKMA 1CA8B 5DP7A 1QBNA 2TGDA 3ZVDA 4AZ2B 1SLXB 2Y7XA 4HGCA 3A84A 4MQAA 4XFQA 3SO3A 2BD7A 2NU2E 4BNRA 2F9VA 1C2KA 1G2LA 1O2VA 1S84A 1ANEA 1W12U 4TPYA 1FN8A 1GJ7B 2XXLA 1CT2E 4AORA 4AGJA 1XUJA 2VJ1A 1WU1A 2F9PA 1KXCA 1C1WH 1QJ7B 2F9UA 4BTUB 3TK5A 1P57B 3TNTA 1UHBA 2Z3EA 3MU5A 1EAWA 1Z8RA 4SGBE 4GSOA 2W3KA 2WUCA 1QURH 1AGJA 4NSVA 2P8OB 1C1QA 3OYPA 2BD5A 2XCFA 1NU7B 3M5NA 3GYMA 1AFQC 2ZQ2A 3ZV9A 3UTUH 1H1BA 3F9EA 1O2KA 1ZTKA 1AFEH 5TJXA 1GCTC 1A3BH 3VXEH 5H4IB 1LHCH 4A7IB 5L2ZH 1JXPA 3A86A 4MPVA 4A6LA 1DSTA 1SGTA 1AKSA 4ZKSU 2AGGX 4B1TA 3CP7A 1V2VT 5BPEA 1C2EA 1C2DA 2D8WA 1DICA 1GGDC 4O97A 2FOCA 1MZAA 1FI8A 5T3HA 4E7RG 1SGDE 4DURA 1UVSH 2B0FA 3GICB 1TPSA 1CBWC 1G3EA 1GJ5H 2RG3A 3RUOA 3LIWA 4BXSA 2AMQA 3PO1B 4CHAB 1GHAF 3TGJE 5LPFA 1PYTD 3S9AA 2SGEE 4AOQA 1TRYA 2G00A 2YNBA 2ZGBH 1C1SA 1C4V2 1W13U 3GY2A 4Y7BA 2BLOA 1GJDB 3L33A 5GWZA 1F5KU 3PLKA 1G9IE 1OYTH 1AUTC 1AY6H 2SNWA 3ZZBA 3FP8E 1GWAA 4VGCC 2W3IA 1QNJA 4ISLA 3BEFB 2C8YB 1GBAA 5ESBA 2J94A 5C5NA 2PWXA 3MU8A 3LH3A 1KXEA 1C5VA 1A1RA 1VGCC 1TBQH 2FXRA 3FP7E 2OBOA 2ZTXA 2BX4A 1C1VH 4X1RU 4TYDA 3C1KA 4GPGA 1ELFA 1P3CA 1J16A 1Y3VA 2C3SA 4BAHB 3E91A 4MPWA 5FX6A 2ZI2H 4LOYH 1ARBA 1P2NA 4I33A 4Q2KA 2FOBA 2NU4E 2ZWLH 3NUMA 2FX4A 3MOCA 2ZGJA 2PGBB 1EOLA 1FZZA 5DP3A 3RXKA 1H9IE 2F9OA 2PTNA 1DY9A 3MU0A 1H9HE 2VIOA 1BBRE 2ZHEH 4U2WA 5EW1H 2ZDMA 1IAUA 2THFB 6CHAB 3QUMP 2ZGXH 1EPTB 2ZCKP 3FVFB 3KQCA 3RXIA 4B75A 4HZHA 4OS4A 4UDWH 1O2QA 2OQ5A 1NO9H 4ZXXH 1GHAG 3AW1A 1P2KA 1AKSB