2ZDKA

Exploring trypsin s3 pocket
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA02
2A31A 2PTNA 2W7UA 3RC5A 2UUKB 1ACBE 2F3CE 1RRKA 3Q3YA 2ZDKA 3KGPA 1HPGA 2FS9A 2C93B 1OYQA 1O2YA 1LQDB 5FCRA 4FUHA 1ZRBA 1TABE 1BZXE 2WPIS 3A81A 4ABFA 2ZU1A 3SJOA 1MAXA 1SGPE 4DIHH 2XBWA 3T28A 2BZAA 4Z6AH 4BTIB 1O36A 1TMUH 1HCGA 1HAXB 1H9LB 5J4QA 2ZC9H 1FNIA 2QXJA 1O3BA 3ENSB 1N6YA 3ZZ9A 4I8JA 1C2MA 3URCA 2R3YA 2GZ8A 1DICA 3F68H 2GP9B 1Z8JB 4ISIH 2IPHA 2AMDA 1CGJE 4A1XA 2F9VA 1FY3A 1SGFG 1MTNC 4FUCA 4ZKSU 4BAOB 1EJAA 1ELTA 1UTLM 1MKWH 1BTYA 4AYYB 2ANYA 3RUOA 4UONA 4ISLA 2I6SA 3PMBB 1DLEA 4ZROA 4B71A 2FI5E 1PQ5A 2A7CA 1D4PB 1O0DH 2ZQ2A 1O5BB 1T4UH 1SFQB 4YT6H 1P06A 3K6ZA 1YCPH 2ZIQH 5EW2H 1NRSH 1CO7E 2ZDNA 1V2JT 2Z9IA 4BAMB 4NG9H 4CRDA 3SI3H 3A83A 1XX9A 3TK6A 3FANA 2R2MB 1SG8B 1ZMLA 5K0HA 5HGGA 3M3TA 2QAAA 3GDVA 5FX5A 4BNRA 1ELCA 1UK4A 1NFWA 4CRFA 2D2DA 4K1TA 3ODDA 5JBBS 5LPFA 1Z6JH 4NIYA 5C67A 2Y5HA 4JZIA 3SU5A 1TQ0B 1FAXA 1SLXB 4GHTA 1Y8TA 1J14A 5A0CA 4IMZA 3E0PB 1P2JA 4YLQH 4ABJA 5I46H 4DURA 5L2YH 1F7ZA 1K2I1 4R8TB 2OBQA 2FZZA 1GL1A 4WJG2 5C2ZA 1O3GA 1O3OA 2Y80A 3QX5H 2B0FA 3E1XB 2PLXA 1IHTH 3P6ZB 3SN8A 1VGCB 2SGPE 6CHAB 4ABDA 1TPAE 3S9CA 3GCTG 4R0IA 1MBQA 1ZPZA 5B6OA 5JB9S 3MH7A 2QF3A 4MNVA 2PKSC 3GISB 4Y8XA 4YZUA 1P01A 2ZHWH 1SLVB 5GJ4B 3B9FH 1O5FH 1WOFA 3L6PA 1MU8B 1MBMA 1QHRB 1O38A 1YP9A 2XWBI 1H9IE 2VIOA 1C1PA 2HVXA 1HYLA 3BTHE 3RLWH 2ZFPH 3AAVA 1BTHH 4IS5A 4RSPA 3ZZ5A 2A45B 1AB9B 5FCKA 5C20A 2HRVA 1GVKB 3IWMA 3SHAH 1TALA 3SU2A 3VGCC 4OS2A 4ABHA 1C1RA 2BLOA 1EP6A 3U1IB 1O2SA 4MQAA 1GGDC 4O03A 3FZZA 3ZZ7A 1BBRH 3Q3KA 3LPRA 5EG4A 4ZKRU 2BD5A 3UNQA 2UWOA 4KTUA 3BEFB 3UREA 3TH3H 1L1JA 2C8XB 4DY7B 3MWIU 1TX6A 3EDXB 3KF2A 5T6GA 1EZQA 1TE0A 1TFXA 1LPZB 2FEQH 1LHGH 2A0QB 2V0BA 1MTSA 2P3FH 2TGDA 1HAVA 3KHVA 3D49H 2J34A 1C1OA 2QXHA 4X1QU 3M5MA 4CR9A 3AW0A 1TWXB 4IGDA 2WINI 3M5NA 3NPSA 2LPRA 4XFQA 3UQOA 2ANKH 3Q76A 5ESBA 5C5OA 4WXIA 3PMHB 4JYTA 1ETRH 1BHXB 3DUXH 1ORFA 2PR3A 2FOMB 2AGIX 2ESTE 3AASA 1C5LH 4FUGA 2GCHG 1AWHB 3BEUA 1HAIH 4FXGH 1BJUA 1LVYA 2OQUA 2P16A 4I33A 4AG2A 1K28D 1PQAA 3UOPA 2QXIA 2W3IA 1ID5H 2WPMS 2WYGA 2Z3DA 3STIA 1HAVB 2Z9JA 2JKHA 3A87A 1L1GA 4KTSA 2VIPA 1NS3A 3SGBE 1GHYH 5DP8A 2HNTF 3LJOA 5K7RA 1P3EA 3LGWA 5FBIA 3K6YA 1AGJA 5GPIB 2VWMA 1FY5A 4UFDH 4IN1A 4SGAE 3RP2A 1GJ7B 5FBEA 1SLUB 5DP3A 2CHAB 5JBTA 1BRBE 2RDLA 5F8XA 4LXBH 2H9TH 4AFSA 7GCHF 1FIZA 3SUFA 1EZSC 3STJA 2ODQA 1O32A 1P2QA 3QUMP 2FTMA 4K1EA 5JPMH 4Y6DA 4YM9A 2F9UA 4U30A 2GCTC 1GWAA 2F9NA 2ZGCA 2VINA 4XBDA 1E35B 1TNHA 2TIOA 5EOKA 3RM2H 3EQ0H 3KQCA 2GZ9A 3ZZ8A 1P8VC 1O3CA 2GV7A 4X1NU 1V2OT 1O3NA 1THRH 2FOAA 1P02A 3A86A 1A2CH 2FPZA 2O8WA 1KTSB 3VB5A 2QF0A 2W5EA 3PMJA 1KXDA 4FUFA 4FUDA 4HI3A 3K2UA 1KDQA 1GBHA 3W94A 3ZVAA 1LDTT 1W0ZU 2HNTE 4NIXA 4E7RG 1L4ZA 5ESTE 1EZUC 1S83A 2WPHS 3PV4A 1EPTA 1O2OA 2C4FH 4KP0A 3CENA 1LKAA 2FS8A 1E38B 1O2JA 3BTME 1QY6A 2V6NA 3SNBA 1O5EH 2H5CA 1D6RA 1DPOA 2XRCA 3BTQE 3P8FA 1RIWB 1VCWA 1GBCA 1SHYA 2Q1JA 3AAUA 1GCTC 1TGNA 2VIWA 4IC5A 4YLUA 1BMLA 1GMHG 2GDDA 5ABWA 2GCHF 1KDQB 1TRNA 1BUIA 1LPKB 4O9VA 3SU3A 1Y5AT 4ABIA 5A0BA 1HAPH 5T3HA 4AB8A 1ETTH 1JRTA 1A5IA 1AFQB 1EPTB 1OWHA 2XBXA 1PPFE 1OWJA 1QQ4A 4WH6A 1O2UA 3ATKA 4I8LA 1BA8B 1GI8B 2H1UA 1AIXH 3E3TA 1T8NA 1NRPH 2Z9LA 1HJ9A 1RS0A 2FP7B 1F5RA 2ZWLH 2BXUH 1JRSA 4M7GA 3U8OH 3BTKE 2Q6GA 1BHXF 1RFNA 1MKXH 4Y0ZE 1TGBA 1DWCH 1GHVH 1K21H 1DITH 1O2QA 2BY8X 3H7OA 4UD9H 1GBLA 4YOJA 3PWBA 1W11U 3SNDA 1YLDA 1E37B 1S85A 3RU4E 3QGNB 4UFEH 2PV9B 4XE4A 4O97A 3EA9A 2RCEA 1IQIA 3SORA 3QWCH 3B23B 2D1JA 2VVUA 4Y8YA 1O2WA 1AY6H 3V7TA 5PTPA 4O3TA 4QT8C 3A8CA 4X6PA 1E34B 2XYAA 2FOCA 1QL7A 1LHCH 1FN8A 1ABIH 3RDZA 2EC9H 5H4IB 1GHXH 1LTOA 2ZA5A 2C8WB 5F8TA 1ANBA 2UUYA 1ZHMA 1L4DA 1MAYA 4OS6A 4CRGA 3HKIB 5JYIA 4MLFB 5FPYA 2FOHA 1K1JA 3A85A 1EAWA 2NU1E 2HLCA 3RMLH 3IG6B 4B2BA 7KMEH 1C5OH 1O2PA 2HPPH 1T8MA 1OWEA 1C5SA 1KYNA 1KLTA 4XBCA 3SZNA 3NUMA 3LC5A 1GBTA 3JZ1B 4B76A 2OQ5A 1C5QA 1WU1A 4XOJA 1IQNA 2YOLA 1ZRKA 2M5TA 1KTTB 1MD7A 1C4U2 1C5RA 1F2SE 1T8OA 1P9UA 4ZXXH 1EATA 2TGPZ 1C1SA 1S84A 1QBNA 1WBGB 3DD2H 1O2MA 2XBVA 2ZP0H 1FZZA 1YPKH 3PO1C 1FMGA 1H8DH 4ZUHA 3SU4A 2GTBA 1G3DA 4MPXA 1BTPA 3EE0B 1PFXC 4ZHAA 3RXPA 1IQLA 2AGGX 3ZYDA 4DVAU 2J38A 2ZGXH 1OS8A 2BOHB 4MG3A 1TMBH 2ZEBA 1A0JA 2OC0A 1UVTH 2ZTXA 3BG4B 5GDSH 1GMHF 2BDGA 4ISOA 5HMAA 2IN2A 3C1KA 3RU4T 2FO9A 3VXEH 1QJ6B 4NSVA 2GKVE 3LGVA 2O8MA 1OKXA 5F03A 1C1QA 1P10A 1MTNB 1P2KA 3GCHB 1UO6A 1Y3UA 4F49A 3A89A 3SQHE 2B5TB 4K3JA 4X1RU 1C4V2 2RA3A 1F5LA 2Y81A 3RM0H 1TRMA 1XM1A 2ZECA 5HYOA 1FLEE 1OXGA 1NFXA 2ULLA 1OOKB 3SGAE 1C5ZB 3WY8A 3A84A 3SV6A 1W8BH 1O3MA 1AVGH 1EQ9A 3F1SB 1UVSH 2J4IA 3RXEA 1Z1JA 1K1NA 1ABJH 1GVZA 2FYRA 4X1PU 4Y8ZA 2R0KA 4AB9A 3GY6A 4BAQB 2ZQ1A 1PPHE 1HXFH 1P11E 3GY2A 2ZGJA 1AVXA 3TJNA 3TJUA 1XVMA 2AS9A 3EYDA 3V0XA 1F0TA 1GHBG 1EZXC 1QBVH 2QY0B 1D3TB 1XUGA 1FJSA 1TGCA 3BN9A 5GIBA 3A88A 3M5OA 4ZH8A 2FX4A 4Y79A 1Y3VA 1SGFA 2TRMA 2VJ1A 4H42U 4Q2KA 1NROH 1GL0E 1QR3E 1ZJKA 3PTNA 5FXLA 1UVPA 1DUEA 2HPQH 1W2KH 4WF8A 1Z8RA 1SGYE 5C1UA 2PKSB 3MU4A 1PPCE 1UTJA 2JH0D 3RXJA 5A09A 1QA7A 3AVZA 3SJ8A 4INHA 4LK4A 1CA8B 1ELDE 3F9GA 4X0WU 1Z1IA 3S7KB 1B0FA 3ZVCA 1XMNB 2Q6FA 2SGEE 3MO6A 5LPRA 1BDAA 1WUNH 2GDEH 4JZ1A 1GBDA 2FESH 5EPYA 1J17T 1YPGH 6GCHG 4A1VA 2HWLB 3V12A 4NA8A 2BX3A 1DDJA 3GCNA 1KXCA 1BB0B 3MU5A 5A8ZA 3M7UA 3VGCB 3VB3A 2EA3A 2R9PA 3ZZ3A 1C5UA 4FUIA 2FDAA 2ZZUH 3EA7A 1XUIA 4NFFA 4OS7A 2BQ7B 1KXEA 4I8HA 1DWEH 5E2PA 2GX4A 4TWWA 1AKSA 1T4VH 4H4FA 1EUFA 2BLQA 3LU9B 4ISNA 4JMYA 1VJAU 3E91A 3NKKA 1C2KA 1JMOH 2BQWB 4K8BA 4OS5A 2BTCE 1EASA 3D65E 2PHBA 3U1JB 1OPHB 4KGAA 1NESE 4B74A 5DJ7A 1SQAA 1OP8A 3RXSA 1O3JA 1S82A 1PYTC 1TOMH 2AIPA 3MFJA 1NRNH 3SUGA 4D7GA 1XVOA 1XKAC 2J95A 1ZJDA 4MPWA 4JCNA 2BMGB 2B9LA 2G81E 1GI7B 1ZSKA 3MI4A 1Q31A 2G5NA 1C2DA 1CU1A 4X2YA 1YCPK 4WVPE 1P12E 5EQQA 2GMTC 1A0HB 1CHOG 2ZCHP 5A2MH 1A0LA 1TNJA 4JZDH 2Z9KA 1TGTA 2BY5X 3P95A 5DG6A 1CA0C 4Q7XA 3OSYA 1F92A 1AUTC 1TONA 4NSYA 3RU4D 1IQHA 4CBOA 1P2OA 1QIXB 2BLVA 3E16B 1NU9A 2VVVA 4TY6A 1ARBA 1TRYA 1CVWH 1GMCF 1SGTA 1BMAA 1BRAA 1XKBC 1BTXA 2ZFSA 2ZPSA 1CSOE 1W12U 3A7XA 1OP2A 2H5DA 3VFEA 1CBWC 3NCLA 3UWIA 3TU7H 3L3TA 2BVXH 1GMDG 4CRBA 1O3EA 2A4RA 3MNCA 2O8UA 3MYWA 1LPGB 1O30A 1HJAC 1J16A 1ETSH 4CH2B 2GCTB 4WMFA 1K1IA 2H9EH 4RKOB 2CN0H 2VH0A 4OGYA 1C2GA 1TPPA 3VXFH 1TAWA 5GWZA 1JWTA 1E0FD 3M61U 2WPKS 2CV3A 4AFUA 5EXLA 2OBOA 4RKJB 1O2RA 2FI4E 2P8OB 8GCHG 1TNIA 1GBMA 4MPVA 1YPHC 5EXNA 1GI2A 2BX4A 4DW2U 1MUEB 2NU2E 1HV7A 4TPIZ 4AG1A 3D62A 2K1QA 3OY5U 4ZMAH 2W3KA 1GI6A 1BIOA 1C2FA 2VGCB 1W7XH 1DOJA 1AFEH 1BRUP 1MZDA 1HJ8A 4E7NA 2AGEX 1TNGA 1GI9B 3BG8A 4BXWA 2VU8E 1O3KA 1B0EA 3RXAA 3ZVBA 2GT8A 1QURH 3T5FH 4I31A 3ELAH 1EOLA 1O3FA 6ESTA 1GI5A 1J9CH 4KELA 1WQSA 1C5YB 4FU7A 3U8TH 5EGMA 1FY8E 5CHAC 3LGTA 1EB1H 3UOUA 1WQVH 1G36A 5LH8A 1G2MA 1GCTB 1GJ8B 3P8GA 5DP6A 3KEEA 3D23A 1UTPA 1O37A 1K1PA 1W13U 1AO5A 2NWNA 4AORA 1D3DB 1RTKA 3H5CB 3ZZDA 4ZAEA 1MCTA 1MU6B 1N8OB 4YO9A 2BDBA 4I8GA 1V2KT 1BRCE 1GJ6A 2ASUB 4ABGA 2ZDAH 3A7VA 3DT0H 3M5LA 3LGIA 3DHKH 2ZFTA 1DSUA 2TPIZ 2OCVB 3GOVB 4XDEA 4Y71A 2H6MA 1YPEH 1QFKH 2F9BH 1ELEE 1A4WH 3FVFB 1A3BH 2Q6DA 3SV9A 1CGIE 3SV8A 1AD8H 1C5TA 4ZHMU 4ZXYH 1EX3A 1S0QA 1KLJH 4B73A 2A2QH 3LGYA 3HATH 1N1LA 3M7TA 1FPCH 1RXPA 3SU0A 2JH6D 1SPJA 4D9QA 4AX9H 1VITH 1TPSA 9ESTA 1P2MA 4IW4E 2ZFRH 2HGTH 4FVDA 4UFGH 3RXVA 4UFFH 3S9AA 2XBYA 2FOEA 4U2WA 1GMDF 1P0SH 3GCTF 1GVLA 1NT1A 2ZHDA 4HFPB 1YPMH 2R0LA 2P3UB 3LKWA 4FUEA 2J9NA 2PKAA 1NM6A 4JYVH 3I77A 1K1MA 1MQ5A 4NZLA 1PPEE 1GDNA 1BITA 3V13A 2QYIA 3M35A 5I25A 2ZKSA 3F9EA 3SJKA 1VCPA 3PLKA 5FPTA 3BTFE 2NU3E 2BY9X 1AMHA 5EQSA 2BD2A 3GY4A 2F9OA 6CHAC 1TMTH 1XUHA 1VR1H 3Q77A 1CT2E 1P3CA 1C1MA 3NXPA 3RXCA 3TNTA 4I7YH 1OSSA 4X6NA 2BD4A 2Y7XA 4MDSA 2UUFB 2VIDA 3GICB 4D76A 1IQJA 1PPBH 1IAUA 2PKAB 3RLYH 2EI7A 3LIWA 2XTTB 1FAKH 3SNEA 1GJDB 1UHBA 1ZMJA 4NZQA 4JZEH 2THFB 3KNXA 3PO1B 4O3UA 1DFPA 1C5XB 4B1TA 4FU8A 1JBUH 1CT4E 1XUJA 2ZTZA 4D9RA 5DP5A 5A0AE 1TBQH 3M3VA 2FLBH 7ESTE 4X8TH 4UE7H 3UR6A 2HALA 5E0GA 3P92A 5JBCS 1A5HA 1DXWA 1HNEE 2ODYB 3PB1E 1A3EH 1ZZZA 1C5VA 1UHBB 4DOQA 4HZHA 3UUZA 2A4GA 1WTHD 2C3SA 2SFAA 3ATLA 1NY22 1ANDA 3RXIA 4IMQA 5E8EH 2BVSH 3FP6E 4RN6A 3G01A 4Q80A 3H7TA 3RC4A 2ANMH 1GJ5H 2C8YB 1SI5H 1H9HE 3HK3B 2O8TA 3P70B 1ZMNA 2AIQA 1UK3A 4CR5A 3N7OA 1G37A 1SQTA 4DT7B 1K1LA 4ZHLU 5AFZH 3SGQE 1G3BA 3U9AH 4YOGA 3GDUA 1V2QT 3NZIA 1PQ7A 2OUAA 3UQVA 3ATWA 1G3EA 2W26A 1FV9A 2EI8A 4GAWA 2QIQA 3B8JA 3KQEA 2UWPA 2G4TA 3M36A 1D9IA 4TWYA 3MTYA 3S9BA 3LC3A 2VIQA 1MKXK 1GI3A 1GI0A 1UCYH 2NU0E 2B7DH 1DX5M 1V2LT 2STBE 3MNSA 3UIRA 2CF8H 2BOKA 3P8OA 4CHAC 1E36B 2PSXA 2I6QA 2G52A 1GDQA 3C27B 4VGCC 4I32A 1P2NA 1KXBA 2D8WA 3HGNA 1GBIA 1O5CB 1KSNA 3A8DA 1NN6A 2XXLA 4FUJA 5EPNA 4XSKU 1DS2E 2CHAC 1Z7KA 2VVCA 3F9FA 1GBKA 5TCAA 2AMPA 1ZTLA 4NIWA 1Z8GA 3U98H 3VEQB 1UTNA 5SGAE 2WV5A 3RXFA 2CJIA 2HOBA 4LOYH 2CF9H 3BTDE 2FX6A 1YBWA 3TJVA 1DY9A 5AFYH 4K60A 2NU4E 2XC5A 4E05H 2A1DB 3T29A 3CP7A 5DO4H 1ZTJA 2BZ6H 1BMMH 1IQKA 2G51A 1UTOA 4LZ1H 3VB7A 2ZO3H 1NU7B 5F8ZA 1SLWB 1ZGVA 2GD4B 2ZCLP 1T7CA 2KAIA 1XUKA 1ZTKA 3ATIA 3KCGH 1UJ1A 3QDZB 2OP9A 4INLA 5C1YA 4A5TS 1QGFA 4BTUB 1ESAA 5C3NA 1QBOA 3HK6B 3RXBA 1DXPA 2DE9A 1CGHA 3HKJB 1SC8U 2GVFA 1AWFH 2Y5FA 1YCPM 1HGTH 2LNCA 1TA6A 1V2ST 2A5KA 3GCOA 1O3LA 2A2XH 1ESTA 2BDCA 3MHWU 4K8YA 1O31A 2BY7X 3S69A 1T32A 1O5DH 1O2NA 1DUAA 3PMAB 5J4SA 1H1BA 1TLDA 1TOCB 2XW9A 4INKA 1PQ8A 1V2PT 3IITA 3O8DA 3T25A 2UWLA 3QN7A 2RG3A 2FYQA 4K1SA 1NO9H 5LPEA 1TBZH 3U69H 1RIWC 3U8RH 5EXMA 1IQFA 1H4WA 2A7HA 1NFUA 4AGJA 4BAHB 1EOJA 1AVWA 1ZPBA 5BPEA 4TYDA 3TPIZ 1N6XA 3MU8A 3KN2A 3RMMH 1TA2A 4NGAH 1WCZA 4AZ2B 1HLTH 1RGQA 2CXVA 5C1XA 1L0ZA 2AMQA 2G00A 4D8NA 5AF9H 8KME2 3PROA 3CS7A 1S5SA 1SL3A 2GMTB 2BYAX 3ZVDA 1RTLA 3SNAA 1LHFH 1ZSJA 1YYY1 1OP0A 2ZPQA 2G4UA 4JZFH 5AHGH 4KTCA 4X6OA 3RXLA 1TQ7B 1LVBA 1GBBA 4Y76A 1CA0B 2PUXB 3TH4H 5FPSA 1ELGA 1O5GH 5HM2A 1YPLH 3SBKA 1C1VH 1FONA 1UK2A 2ZGBH 4IBLH 1P05A 3TK5A 1BOQA 2GT7A 1DWBH 2A7JA 5FHTA 1AN1E 3SJIA 1NRRH 1QRZA 2PSYA 1LHDH 1HXEH 2ZF0H 4WXVA 2WUCA 3SV2H 3R3GB 2QXGA 5EQRA 1MQ6A 3DA9B 4BXSA 1O2TA 2ZHEH 4YT7H 1CBWB 1C2EA 4OS1A 1IHSH 1V2VT 2BD3A 4YTAA 3RXMA 1P9SA 3RC6A 2ILNA 4H6SB 2XWAA 4X2XA 5IYTA 1EB2A 1PJPA 2BQ6B 2Y6TA 1Z6EA 1HJAB 2ODPA 4JK6A 2ZCKP 2ZDVH 1AUJA 1W10U 1RD3B 2Y5GA 1QJ7B 1RJXB 3ZZ4A 2OC8A 1HAYB 1JXPA 2A5IA 2WV4A 1V2UT 1YF4A 2OLGA 4HTCH 1SGQE 3R0FA 4GUXA 3RMNH 1UTMA 1AZ8A 2PFEA 1O3PB 2XNIA 2A5AA 2STAE 1B7XB 1P57B 5EU8A 2P93A 1MH0A 1ZPCA 1CQQA 1BT7A 1TGSZ 1THPB 2TBSA 1IQGA 2FTLE 3VB6A 1UTKA 5GXPA 3SNCA 2F83A 1T31A 4WY3A 1GGDB 2Z3CA 4CH8B 1GJBB 3GYLB 1ANCA 3SI4H 1GCDA 3UTUH 3SQEE 4Q7ZA 3ZV9A 4Q7YA 2SGAA 4WH8A 3SV7A 1Q2WA 2YNBA 5C5NA 4BTTB 1TB6H 1GG6C 2P94A 5IDKA 5JBAS 1Y5UT 1ELAA 2IOTA 1LMWB 2AFQB 3OX7U 1TPOA 2ALVA 1W14U 1XXFA 1F0SA 3ZZ6A 2ZHFH 1CE5A 1QRXA 2XC0A 3MMGA 4BOHA 3BG4C 5CHAB 1TBRH 3ZZCA 3RXKA 1DANH 1KIGH 1HB0B 1ZOMA 3O8CA 4ISHH 2WUBA 2PUQH 1MKWK 1V2RT 2QGRA 3M7QA 4LZ4B 1O3IA 1BCUH 4B2CA 4TPYA 3URDA 1AKSB 3TJOA 2FODA 1ZR0A 3GCHC 1HFDA 2CMYA 3E90B 1QB1A 3S7HB 1DE7H 4GCHG 4B2AA 1FUJA 2P95A 4ZKOU 3GDSA 1C1UH 1W3CA 5FAHA 1LHEH 1LKBA 1NFYA 4AN7A 4DGJA 1C2IA 4K69A 3E6PH 2QN5T 1THSH 3ZYEA 1SGRE 1Y5BT 3LH3A 4NA9H 2AERH 1C4Y2 4X8SH 2VH6A 4MNWA 1EJMA 2J2UA 1NRQH 5HM9A 2QC2A 1GHBF 4Y11E 3BTTE 1FPHH 4JYUH 2ZFFH 1YC0A 2FOBA 1SGDE 1VITG 2EI6A 1GJ9B 1H8IH 2IJOB 1VJ9U 3A80A 3MNXA 3M3SA 5JB8S 3RXDA 1KXFA 2SNWA 5E0HA 2FXRA 1C9TA 1V2WT 2JETC 1QB9A 2QCYA 4GHQA 2ZGHA 2TGAA 1HBTH 1W7GH 4GVUA 1QQUA 1BMNH 4NWKA 2VNTA 1ZGIA 1WYKA 2BDIA 1EAUA 2Z7FE 1OWIA 4I8KA 3RXTA 1A46H 1MTVA 1GPZA 5GCHG 4AOQA 1DSTA 2FMJA 1MD8A 2H2ZA 2WPJS 1C1TA 2BD9A 3I78A 3RXOA 3TK9A 1ZSLA 7GCHG 6GCHF 1SGCA 1DWDH 4MPUA 2ZDLA 1GBFA 1AI8H 2BDYA 3PLPA 4E06H 3DFLA 3PWCA 3LT3A 1FY4A 1O33A 2A32A 1SB1H 1FN6A 2Z94A 1GHZA 1QJ1B 4THNH 1QTFA 4GSOA 5TCCA 2XCNA 2Z9GA 3LJJA 1SBWA 2OINA 1D3QB 2VWNA 2B8OH 1C5MD 1ANEA 3P17H 1GHWH 2PW8H 3SUEA 2O8LA 3T26A 4B75A 1CHGA 3ZZBA 1MZAA 1BBRK 1QA0A 1TNLA 1F5KU 4D7FA 1DY8A 1LO6A 4OS4A 4TY7A 1ZYOA 3A8AA 3GY5A 4K2YA 3ZZAA 1DM4B 2DUCA 1JIRA 4AGKA 3EGKH 5E0JA 4CREA 4NFEA 1X7AC 1FQ3A 2F9PA 3RXQA 2W7SA 4CRAA 1HAHH 4XBBA 2J94A 1SHHB 1AE8H 1A1RA 1AE5A 3E8LA 1G3CA 3PTBA 4GCHF 2GGVB 3KIDU 1QL8A 1TIOA 5LGOA 1VCQA 1TYNA 4Y10E 1CHOF 1J8AA 5AVDA 5DK1A 1EAXA 2GV6A 5EW1H 2BM2A 4IC6A 3QZQA 1YGCH 2ZU4A 2JH5D 4MNYA 4DIIH 4AYVB 3MU0A 2HNTC 3BV9B 2WYJA 1D3PB 1LCYA 1SFIA 1FIWA 2O9QA 1V2NT 1VITF 2PTCE 4X2WA 2J92A 2R3UA 2ZHQH 2A4QA 3MNBA 3MO3A 1ZHRA 3QTVH 1EAIA 1BBRE 3T2NA 1JOUB 5DP9A 4CBNA 5DKMA 1C5PA 3FFGA 1G30B 1YPJH 2ZFQH 1KLIH 2VB0A 3TGKE 3SJ9A 3O8RA 4CHAB 1EKBB 2VIVA 1QRWA 2BVRH 1O2KA 1O2ZA 4X8UH 4VGCB 2ZPRA 4ABEA 4FVBA 5GCHF 3Q3XA 1C5NH 1GJ4H 4X6MA 1YPHE 4Y7BA 4A6LA 3P8NA 2A4OA 1BJVA 3TITA 3ODFA 3BF6H 4BANB 1P09A 2BB4A 1BTUA 1ELBA 1EJNA 2ZDMA 1SGNE 4PROA 1VGCC 3BEIB 2ZG0H 2ZU2A 3UFAA 4A7IB 8GCHF 2C90B 2VWOA 1L2EA 2OC1A 3UNSA 3ATMA 3ITIA 1LVMA 4MTBA 4Z0KA 1NZQH 1DLKB 1IQMA 1Z8IB 2Z3EA 2FOFA 1HDTH 1GI4A 4U32A 1MTUA 1O2LA 1Y59T 1HAOH 1O5AB 2P8OC 1FY1A 4NCYA 4J1YA 1O2IA 1LQEA 3LGUA 3JZ2B 3LDXH 3RXRA 3PM3A 3BTWE 1EXFA 3KQBA 3LONA 1AB9C 1K1OA 2Z6BD 5TJXA 3SU1A 4CRCA 3W95A 3TH2H 1INCA 1ZHPA 2BLWA 2G8TA 2V3HH 4FU9A 1V3XA 1Y3YA 1DT2A 2VGCC 3A7TA 3QGJA 3PLBA 3TNSA 4A92A 4NWLA 4YOIA 3SOSA 5T6FA 1WTGH 1GI1A 3V3MA 3LOXA 1ZLRA 4X1SU 4MNXA 1P04A 1GJAB 3DFJA 1TX8A 1VZQH 2F91A 5A8XA 1GHAG 1QNJA 3ZVFA 4U01A 1OWKA 4DJZB 1G32B 1DVAH 3UNRA 1C2LA 1EP5A 5FX6A 4WMDA 5DPAA 1S6HA 3TGIE 4IN2A 3A7ZA 1HIAA 1LVOA 3FZDA 3ZVGA 4WMEA 1Y3WA 4SGBE 3UR9A 3A8BA 3ZV8A 1CT0E 2BXTH 4UDWH 1ELFA 2AEIH 3SU6A 2ZU5A 1BTZA 3SO3A 1OX1A 1N8OC 1QL9A 1KY9A 3TLOA 3BIVH 3UY9A 1P2IA 1L1NA 1UMAH 1GBAA 5L30H 2CGAA 1O2GH 2SNVA 4JK5A 3TIUA 1UTQA 4BAKB 1SMFE 1F0UA 1WV7H 2PGQB 3E0NB 4NIVA 3UPEA 1C9PA 4UEHH 2RA0A 4H6TA 3SUDA 1UCYK 1HIAB 3FAOA 1GDUA 1C1NA 3OTJE 1SGEE 3FP7E 5CMXH 3CS0A 5EODA 2WPLS 1ESBA 1AHTH 1PPGE 2FIRH 1TX7A 4Y7AA 2QV1A 5DGJA 1IQEA 4ZKNU 1SQOA 2R2WU 1YLCA 1QCPA 1K9OE 1SOZA 1F0RA 1T8LA 1PPZA 1C2JA 1C2HA 3T62A 1SGIB 3BIUH 1O3DA 3QK1A 2FOGA 3QO6A 2BD8A 2AYWA 1U6QA 1Q3XA 2XC4A 1Z71A 5CE1A 3OY6U 1GBJA 2Y7ZA 3L33A 3MOCA 2ZU3A 1WAYB 1AZZA 3MH5A 1AQ7A 3SW2B 5G4BA 4J2YB 2G5VA 3A82A 4A1TA 1HAZB 2V35A 2UUJB 3AW1A 1O2VA 2BY6X 1C1WH 1YM0A 1WSSH 3A7WA 3S0NA 4GLYA 3UWJH 1KXAA 1V2TT 1UCYE 2SGQE 2TGTA 4WWYA 3QLPH 1QB6A 1O39A 1PYTD 3GY8A 3BSQA 4ASHA 3RMOH 1YKTA 8LPRA 1BTWA 1C5WB 2OD3B 2FWWA 3QZRA 3Q00A 2P3TB 3NWUA 3F6UH 1OWDA 3RXUA 2ZNKH 3BTGE 1NPMA 4Y0YE 3MU1A 4DG4A 3KL6A 3VPKA 1GG6B 9LPRA 1GHAF 1MTWA 1A61H 4KKDA 3EAJA 2FLRH 2BD7A 3I29A 2KAIB 2C8ZB 3VB4A 1W0YH 4DCDA 4HGCA 3ZVEA 3M37A 1O3HA 5HXFA 3T27A 1A5GH 2AH4X 1S0RA 1G2LA 1HAGE 2FI3E 4YESB 1XUFA 2P59A 2PWXA 2FM2A 1FXYA 3LH1A 1SOTA 3KQDA 1M9UA 1G9IE 1HUTH 1SR5C 2EEKA 4NA7A 3OU0A 1V6DA 3A7YA 2BDHA 5BRRE 1AFQC 1EPTC 2OC7A 5JDUB 4X2VA 3GYMA 2GZ7A 8ESTE 5L6NH 2ZI2H 1O35A 2BHGA 2SGDE 1GJCB 4AFZA 1ARCA 3FP8E 4K5ZA 3RXHA 3MO9A 2OXSA 2DE8A 1NTPA 4ESTE 3NK8A 3MH6A 1JIMA 1OYTH 1XXDA 5DP7A 3PYHA 1P03A 2BDAA 3SHCH 2OTVA 3K9XB 3BTEE 1BQYA 1GBEA 5T6DA 4ABBA 2JETB 3K65B 1V2MT 1O2XA 2SGFE 3HGPA 3HPTB 5A8YA 1AU8A 1ELVA 2XCFA 1FI8A 3ESTA 1MMJN 1D6WA 2ALPA 1S81A 1MCVA 3F9HA 3TVJB 1NC6A 2YNAA 2V3OH 1J15A 6LPRA 3GY7A 3OYPA 2ANWA 4AFQA 1RTFB 1S6FA 1Y3XA 1GMCG 2D26C 5L2ZH 2PGBB 2QA9E 3EA8A 1O2HA 1HRTH 3TGJE 5E2OA 1SVPA 5DP4A 1O34A 4F4OC 2ZTYA 4MVNA 4ABAA 3GY3A 4FUBA 4X8VH 5F6MA 4OGXA 3O8BA 5ETXA 3RXGA 2G55A 1A7SA 1UVOA 1B5GH 3MH4A 1IOEA 1UVUH 2Y82A 4GPGA 1K22H 1SSXA 2VWLA 1FDPA 7LPRA 1TNKA 2H9HA 3QTOH 1O3AA
chains in the Genus database with same CATH superfamily
2A31A 2PTNA 2W7UA 3RC5A 2UUKB 1ACBE 2F3CE 1RRKA 3Q3YA 2ZDKA 3KGPA 1HPGA 2FS9A 2C93B 1OYQA 1O2YA 1LQDB 5FCRA 4FUHA 1ZRBA 2GJGA 1TABE 3FO8D 1BZXE 4P00A 2WPIS 3A81A 4ABFA 2ZU1A 3SJOA 1MAXA 1SGPE 4DIHH 2XBWA 3KYFA 3T28A 2BZAA 4Z6AH 4BTIB 1O36A 1TMUH 1HCGA 5EJ1A 1HAXB 1H9LB 3F2GA 5J4QA 2ZC9H 1FNIA 2QXJA 1O3BA 3ENSB 2JIZD 1N6YA 3ZZ9A 4I8JA 1C2MA 3URCA 2R3YA 2GZ8A 1DICA 3F68H 2GP9B 1Z8JB 4ISIH 2IPHA 2AMDA 1CGJE 4A1XA 2F9VA 1FY3A 1SGFG 1MTNC 4FUCA 4ZKSU 2HVYB 4BAOB 1EJAA 1ELTA 1UTLM 1MKWH 1BTYA 4AYYB 2ANYA 3RUOA 2HLDD 4UONA 4ISLA 2I6SA 5IK2D 3PMBB 1DLEA 4ZROA 4B71A 2FI5E 1PQ5A 2A7CA 1D4PB 1O0DH 2ZQ2A 1O5BB 1T4UH 1SFQB 2KCYA 1P06A 4YT6H 3K6ZA 1YCPH 2ZIQH 5EW2H 1NRSH 1CO7E 2ZDNA 1V2JT 2Z9IA 4BAMB 2KM0A 4NG9H 4CRDA 3SI3H 3A83A 1XX9A 3TK6A 3FANA 2R2MB 1SG8B 1ZMLA 5K0HA 5HGGA 2JJ2D 3M3TA 2QAAA 3GDVA 2YMSB 4B6EA 2W6ID 5FX5A 4BNRA 1ELCA 1UK4A 1NFWA 4CRFA 2D2DA 4K1TA 3ODDA 5JBBS 5LPFA 1Z6JH 4NIYA 1S6LA 5C67A 2Y5HA 4JZIA 3SU5A 1TQ0B 1FAXA 1SLXB 4GHTA 1Y8TA 4HG6A 1J14A 5A0CA 4IMZA 3E0PB 1P2JA 4YLQH 4ABJA 5I46H 4DURA 5L2YH 1F7ZA 1K2I1 4R8TB 2OBQA 2FZZA 1GL1A 4WJG2 5C2ZA 1O3GA 1O3OA 2Y80A 3QX5H 2B0FA 3E1XB 2PLXA 1IHTH 3P6ZB 3SN8A 1VGCB 2SGPE 6CHAB 4ABDA 1TPAE 3S9CA 4AC9A 3GCTG 4R0IA 1MBQA 1ZPZA 5B6OA 5JB9S 3MH7A 2QF3A 4MNVA 2PKSC 3GISB 4Y8XA 4YZUA 1P01A 2ZHWH 1SLVB 5GJ4B 3B9FH 1O5FH 1WOFA 3L6PA 1MU8B 1MBMA 1QHRB 1O38A 1YP9A 2XWBI 1H9IE 2VIOA 1C1PA 2HVXA 1HYLA 4RT1A 3BTHE 3RLWH 2ZFPH 3AAVA 1BTHH 4IS5A 4RSPA 3ZZ5A 2A45B 1AB9B 5FCKA 5C20A 2HRVA 1GVKB 3IWMA 3SHAH 1TALA 3SU2A 3VGCC 4OS2A 4ABHA 1C1RA 2BLOA 1EP6A 3U1IB 1O2SA 4MQAA 1GGDC 4O03A 3FZZA 3ZZ7A 1BBRH 3Q3KA 3LPRA 5EG4A 4ZKRU 2BD5A 3N99A 4M9FA 3UNQA 2UWOA 4KTUA 3BEFB 3UREA 3F2FA 3TH3H 1L1JA 2C8XB 4DY7B 1YY3A 1TX6A 3EDXB 3MWIU 3KF2A 5T6GA 1EZQA 1TE0A 1TFXA 1LPZB 2FEQH 1LHGH 2A0QB 2V0BA 1MTSA 2P3FH 2TGDA 1HAVA 3KHVA 3WWBA 3D49H 2J34A 1C1OA 2QXHA 4X1QU 3M5MA 4CR9A 3AW0A 1WDIA 1TWXB 4IGDA 2WINI 3M5NA 3NPSA 2LPRA 4XFQA 3UQOA 2ANKH 3Q76A 5ESBA 5C5OA 4WXIA 2JDID 3PMHB 5CHBA 4JYTA 1ETRH 1BHXB 1YLNA 1ORFA 2PR3A 3DUXH 2FOMB 2AGIX 2ESTE 2L74A 3AASA 1C5LH 4FUGA 2GCHG 1AWHB 3BEUA 1HAIH 4FXGH 1BJUA 1LVYA 2OQUA 2P16A 4I33A 4AG2A 1K28D 1PQAA 3F0OA 3UOPA 2QXIA 2W3IA 1ID5H 2WPMS 2WYGA 2Z3DA 3STIA 1HAVB 2Z9JA 2JKHA 3A87A 1L1GA 4KTSA 2VIPA 4Z1MD 1NS3A 3SGBE 5GNDA 1GHYH 5DP8A 1H8HD 2HNTF 3LJOA 5K7RA 1P3EA 3LGWA 5FBIA 3K6YA 1AGJA 5GPIB 2VWMA 1FY5A 4UFDH 4IN1A 4SGAE 3RP2A 1GJ7B 5FBEA 1SLUB 5DP3A 2CHAB 5JBTA 1BRBE 2RDLA 5F8XA 4LXBH 2H9TH 4AFSA 7GCHF 1FIZA 3SUFA 1EZSC 3DSOA 3STJA 2ODQA 1O32A 1P2QA 3QUMP 1SKYE 2FTMA 4K1EA 5JPMH 3N7DA 4Y6DA 4YM9A 1VKYA 2F9UA 4U30A 2GCTC 1GWAA 1YWUA 2F9NA 2ZGCA 2VINA 4XBDA 4FETA 3UB0A 1E35B 1TNHA 2TIOA 5EOKA 3RM2H 3EQ0H 3KQCA 2GZ9A 3ZZ8A 1P8VC 1O3CA 2GV7A 4X1NU 1V2OT 1O3NA 1THRH 2FOAA 1P02A 3A86A 1A2CH 3NRLA 2FPZA 2O8WA 1KTSB 3VB5A 2QF0A 2W5EA 3PMJA 1KXDA 4FUFA 4FUDA 4HI3A 3K2UA 1KDQA 1GBHA 3W94A 3ZVAA 1LDTT 1W0ZU 2HNTE 4NIXA 4E7RG 4F48B 1L4ZA 5ESTE 1EZUC 1S83A 2WPHS 3PV4A 1EPTA 1O2OA 2C4FH 4KP0A 3CENA 1LKAA 2FS8A 1E38B 1O2JA 3BTME 1QY6A 2V6NA 3SNBA 1O5EH 2H5CA 1D6RA 1DPOA 2XRCA 3BTQE 3P8FA 1RIWB 1VCWA 1GBCA 1SHYA 2Q1JA 3AAUA 1GCTC 1TGNA 2VIWA 4IC5A 4YLUA 1BMLA 1GMHG 2GDDA 5ABWA 2GCHF 1KDQB 1TRNA 1BUIA 1LPKB 4O9VA 2RFKC 3SU3A 1Y5AT 4ABIA 5A0BA 1HAPH 5T3HA 4AB8A 1ETTH 1JRTA 1A5IA 1AFQB 1EPTB 1OWHA 2XBXA 1PPFE 1OWJA 1QQ4A 3FKSD 4WH6A 1O2UA 3ATKA 4I8LA 1BA8B 1GI8B 2H1UA 1AIXH 3E3TA 1T8NA 1NRPH 2Z9LA 4ACAA 1HJ9A 1RS0A 2FP7B 1F5RA 2ZWLH 2BXUH 1JRSA 4M7GA 3U8OH 3BTKE 2Q6GA 1BHXF 1RFNA 1MKXH 4Y0ZE 1TGBA 1DWCH 1GHVH 1K21H 1DITH 1O2QA 2BY8X 4FOUC 3H7OA 4UD9H 1GBLA 4YOJA 3PWBA 1W11U 3SNDA 1YLDA 1E37B 1S85A 3RU4E 3QGNB 4UFEH 2PV9B 4XE4A 4O97A 3EA9A 2RCEA 1IQIA 3SORA 3QWCH 3B23B 2D1JA 2VVUA 4Y8YA 1O2WA 1AY6H 3V7TA 5PTPA 4O3TA 4QT8C 3A8CA 4X6PA 1E34B 2XYAA 2FOCA 1QL7A 1LHCH 1FN8A 2KCAA 1ABIH 3RDZA 2EC9H 5H4IB 1GHXH 1LTOA 2ZA5A 2C8WB 5F8TA 1ANBA 2UUYA 1ZHMA 1L4DA 1MAYA 4OS6A 4CRGA 3HKIB 5JYIA 4MLFB 5FPYA 2FOHA 1K1JA 3A85A 1EAWA 2NU1E 2HLCA 3RMLH 3IG6B 4B2BA 7KMEH 1C5OH 4ASUD 1O2PA 2HPPH 1T8MA 1OWEA 1C5SA 1KYNA 1KLTA 4XBCA 3SZNA 3NUMA 3LC5A 1GBTA 3JZ1B 4B76A 2OQ5A 1C5QA 1WU1A 4XOJA 1IQNA 2M2AA 2YOLA 1ZRKA 1KTTB 2M5TA 1MD7A 1C4U2 1C5RA 1F2SE 1T8OA 1P9UA 4ZXXH 1EATA 2TGPZ 1C1SA 1S84A 1QBNA 1WBGB 3OEED 3N7EA 3DD2H 1O2MA 2XBVA 2ZP0H 1FZZA 1YPKH 3PO1C 1FMGA 1H8DH 4ZUHA 3SU4A 2GTBA 1G3DA 4MPXA 1BTPA 3EE0B 1PFXC 4ZHAA 3RXPA 1IQLA 2AGGX 3ZYDA 4DVAU 2J38A 2ZGXH 5DSFA 1OS8A 2BOHB 3OTPA 4MG3A 1TMBH 2ZEBA 1A0JA 2OC0A 1UVTH 2ZTXA 3BG4B 5GDSH 1GMHF 2BDGA 2EY4C 4ISOA 5HMAA 2IN2A 3C1KA 3RU4T 2FO9A 3VXEH 1QJ6B 4NSVA 2GKVE 3LGVA 2O8MA 1OKXA 5F03A 1C1QA 1P10A 1MTNB 1P2KA 2JJ1D 3GCHB 1UO6A 2XOKD 1Y3UA 4F49A 3A89A 3SQHE 2B5TB 4K3JA 3PV5A 4X1RU 1C4V2 2RA3A 1F5LA 2Y81A 3RM0H 1TRMA 1QZ8A 1XM1A 2ZECA 5HYOA 1FLEE 1OXGA 1NFXA 2ULLA 1OOKB 3SGAE 1C5ZB 3WY8A 1OHHD 3A84A 3SV6A 1W8BH 1O3MA 1AVGH 1EQ9A 2W6JD 3F1SB 1UVSH 2J4IA 3RXEA 1Z1JA 1K1NA 1ABJH 1GVZA 2FYRA 4X1PU 4Y8ZA 2R0KA 4AB9A 3GY6A 4BAQB 2ZQ1A 1PPHE 1HXFH 1P11E 3GY2A 2ZGJA 1AVXA 3TJNA 3TJUA 1XVMA 2AS9A 3EYDA 3U28C 3V0XA 1F0TA 1GHBG 1EZXC 1QBVH 2QY0B 1D3TB 1XUGA 1FJSA 1TGCA 3BN9A 5GIBA 3A88A 3M5OA 4ZH8A 2FX4A 4Y79A 1Y3VA 1SGFA 2TRMA 2VJ1A 4H42U 4Q2KA 1NROH 1GL0E 1QR3E 1ZJKA 3PTNA 5FXLA 1UVPA 1DUEA 2HPQH 1W2KH 4WF8A 1Z8RA 1SGYE 5C1UA 4TT3D 2PKSB 3MU4A 1PPCE 1UTJA 2JH0D 2IPQX 3RXJA 5A09A 1QA7A 3AVZA 3SJ8A 4INHA 4LK4A 1CA8B 1ELDE 3F9GA 3FN8A 4X0WU 1Z1IA 3S7KB 1B0FA 3ZVCA 1XMNB 2Q6FA 2SGEE 3MO6A 5LPRA 1BDAA 1WUNH 5B6LA 2QF5A 2GDEH 4JZ1A 1GBDA 2FESH 5EPYA 1J17T 1YPGH 6GCHG 4A1VA 2HWLB 3V12A 3DCLA 4NA8A 2BX3A 1DDJA 3GCNA 1KXCA 1BB0B 3MU5A 5A8ZA 3M7UA 3VGCB 3VB3A 2EA3A 2R9PA 3ZZ3A 1C5UA 4FUIA 2FDAA 2ZZUH 3EA7A 1XUIA 4NFFA 4OS7A 2BQ7B 2LP6A 1KXEA 4I8HA 1DWEH 5E2PA 3F0PA 2GX4A 4TWWA 1AKSA 1T4VH 4H4FA 1EUFA 2BLQA 3LU9B 4ISNA 4JMYA 1VJAU 2YMSD 3E91A 3NKKA 1C2KA 1JMOH 2BQWB 4K8BA 4OS5A 2BTCE 1EASA 2F43B 3D65E 2PHBA 3U1JB 1OPHB 4KGAA 1NESE 4B74A 5DJ7A 1SQAA 1OP8A 3RXSA 1O3JA 1S82A 1PYTC 1TOMH 2AIPA 3MFJA 1NRNH 3SUGA 4D7GA 1XVOA 1XKAC 2J95A 1ZJDA 4MPWA 4JCNA 2BMGB 2B9LA 2G81E 1GI7B 4YXWD 1ZSKA 3MI4A 1Q31A 2G5NA 3CNRA 1C2DA 1CU1A 4X2YA 1YCPK 4WVPE 1P12E 5EQQA 2GMTC 1A0HB 2KX4A 1CHOG 2ZCHP 5A2MH 1A0LA 1TNJA 4JZDH 2Z9KA 1TGTA 2BY5X 3P95A 5DG6A 1CA0C 4Q7XA 3OSYA 1F92A 1AUTC 1TONA 4NSYA 3RU4D 1IQHA 4CBOA 1P2OA 5KECA 1QIXB 3DSGA 2CK3D 2BLVA 3E16B 1NU9A 1W0JD 2VVVA 4TY6A 1ARBA 1TRYA 1CVWH 1GMCF 1SGTA 1BMAA 1BRAA 1XKBC 1BTXA 2ZFSA 5C94A 2ZPSA 1CSOE 1W12U 3A7XA 1OP2A 2H5DA 3VFEA 1CBWC 3NCLA 3UWIA 3TU7H 3L3TA 2BVXH 1GMDG 4CRBA 1O3EA 2A4RA 3MNCA 2O8UA 3MYWA 2LELA 1LPGB 1O30A 1HJAC 1J16A 1ETSH 2V3MA 2GCTB 4CH2B 4WMFA 1K1IA 2H9EH 4RKOB 2CN0H 2VH0A 4OGYA 2RDEA 1C2GA 1TPPA 3VXFH 1TAWA 5GWZA 1JWTA 1E0FD 3M61U 2WPKS 2CV3A 4AFUA 5EXLA 2OBOA 4RKJB 1O2RA 2FI4E 2P8OB 3SZEA 8GCHG 1TNIA 1GBMA 4MPVA 3KQ5A 1YPHC 1COWD 5EXNA 1GI2A 2BX4A 4DW2U 1MUEB 2NU2E 1HV7A 4TPIZ 4AG1A 3D62A 2K1QA 3OY5U 4ZMAH 2W3KA 1GI6A 1BIOA 1C2FA 2VGCB 1W7XH 1DOJA 1AFEH 1BRUP 1MZDA 1HJ8A 4E7NA 2AGEX 1TNGA 1GI9B 3BG8A 5C0TA 4BXWA 2VU8E 1O3KA 1B0EA 3RXAA 3ZVBA 2GT8A 1QURH 3T5FH 4I31A 3ELAH 1EOLA 1O3FA 6ESTA 1GI5A 1J9CH 4KELA 1WQSA 1C5YB 4FU7A 3U8TH 5EGMA 1FY8E 5CHAC 3LGTA 1EB1H 3UOUA 1WQVH 1G36A 5LH8A 1G2MA 1GCTB 1GJ8B 3P8GA 5DP6A 3KEEA 3D23A 1UTPA 1O37A 1K1PA 1W13U 1AO5A 2NWNA 4AORA 1D3DB 1RTKA 3H5CB 3ZZDA 4ZAEA 1MCTA 1MU6B 1N8OB 4YO9A 2BDBA 4I8GA 1V2KT 1BRCE 1GJ6A 2ASUB 4ABGA 2ZDAH 3A7VA 3DT0H 3M5LA 3LGIA 3DHKH 2ZFTA 1DSUA 2TPIZ 2OCVB 3GOVB 4XDEA 4Y71A 2H6MA 1YPEH 1QFKH 2F9BH 1ELEE 1A4WH 3FVFB 1A3BH 2Q6DA 3SV9A 1CGIE 3SV8A 1AD8H 1C5TA 4ZHMU 4ZXYH 5HKKD 1EX3A 1S0QA 1KLJH 4B73A 2A2QH 3LGYA 3HATH 1N1LA 3M7TA 1FPCH 1RXPA 4RT0A 3SU0A 2JH6D 1SPJA 4D9QA 4AX9H 1VITH 1TPSA 9ESTA 1P2MA 4IW4E 2ZFRH 1K0HA 2HGTH 4FVDA 4UFGH 3RXVA 4UFFH 3S9AA 2XBYA 2FOEA 3UAIC 4U2WA 1GMDF 1P0SH 3GCTF 1GVLA 1NT1A 2ZHDA 3PRBA 1YPMH 4HFPB 2R0LA 2P3UB 3LKWA 4FUEA 2J9NA 2PKAA 5HIZA 1NM6A 4JYVH 3I77A 1K1MA 1MQ5A 5EIYA 4NZLA 1PPEE 1GDNA 1BITA 3V13A 2K0QA 2QYIA 3M35A 5I25A 2ZKSA 3F9EA 3SJKA 1VCPA 3PLKA 5FPTA 3BTFE 2NU3E 2KCOA 2BY9X 1AMHA 5EQSA 2BD2A 3GY4A 2F9OA 6CHAC 1TMTH 1XUHA 1VR1H 3Q77A 1CT2E 1P3CA 1C1MA 3NXPA 3RXCA 3TNTA 4I7YH 1OSSA 4X6NA 2BD4A 2Y7XA 4MDSA 2UUFB 2VIDA 3GICB 4D76A 1IQJA 1PPBH 1IAUA 2PKAB 3RLYH 2EI7A 3LIWA 2XTTB 1FAKH 3SNEA 1GJDB 1UHBA 1ZMJA 4NZQA 4JZEH 2THFB 3KNXA 3FOAA 3PO1B 4O3UA 1DFPA 1C5XB 4B1TA 4FU8A 1JBUH 1CT4E 1XUJA 2ZTZA 4D9RA 1EFRD 5DP5A 5A0AE 1TBQH 3M3VA 2FLBH 7ESTE 4X8TH 4UE7H 3UR6A 4OM9A 2HALA 5E0GA 3P92A 5JBCS 1A5HA 1DXWA 1HNEE 2ODYB 3PB1E 1A3EH 1ZZZA 1C5VA 1UHBB 4DOQA 4HZHA 3UUZA 2A4GA 1WTHD 2C3SA 2SFAA 3ATLA 1NY22 1ANDA 3RXIA 4IMQA 5E8EH 2BVSH 3FP6E 4RN6A 3G01A 4Q80A 3H7TA 3RC4A 2ANMH 1GJ5H 2C8YB 1SI5H 1H9HE 3HK3B 2O8TA 3P70B 1ZMNA 2AIQA 1UK3A 4CR5A 4XD7D 3N7OA 1G37A 1SQTA 4DT7B 1K1LA 4ZHLU 5AFZH 3SGQE 1G3BA 3U9AH 4YOGA 3GDUA 1V2QT 3NZIA 1PQ7A 2OUAA 3UQVA 3ATWA 1G3EA 2W26A 1FV9A 2EI8A 4GAWA 2QIQA 3B8JA 3KQEA 2UWPA 2G4TA 3M36A 1D9IA 4TWYA 2KR7A 3MTYA 3S9BA 3LC3A 2VIQA 1MKXK 1GI3A 1GI0A 1UCYH 2NU0E 2B7DH 1DX5M 1V2LT 4Q63A 2STBE 3MNSA 3UIRA 2CF8H 2BOKA 3P8OA 4CHAC 1E36B 2PSXA 2I6QA 2G52A 1GDQA 3PRDA 3C27B 4VGCC 4I32A 1P2NA 1KXBA 2D8WA 3HGNA 1GBIA 1O5CB 1KSNA 3A8DA 1NN6A 2XXLA 4FUJA 3DSPA 5EPNA 4XSKU 1DS2E 2CHAC 1Z7KA 2VVCA 3F9FA 1GBKA 5TCAA 2AMPA 1FX0B 1ZTLA 4NIWA 1Z8GA 3U98H 3VEQB 1UTNA 3GS9A 5SGAE 2WV5A 3RXFA 2CJIA 2HOBA 4LOYH 2CF9H 3BTDE 2FX6A 1YBWA 3TJVA 1DY9A 5C0UA 5AFYH 4K60A 2NU4E 2XC5A 4E05H 2A1DB 3T29A 3CP7A 5KGOA 5DO4H 1ZTJA 2BZ6H 1BMMH 1IQKA 4Q4LA 2G51A 1UTOA 4LZ1H 3VB7A 2ZO3H 1NU7B 5F8ZA 1SLWB 1ZGVA 2GD4B 2ZCLP 1T7CA 2KAIA 1XUKA 1ZTKA 3ATIA 3KCGH 1UJ1A 3QDZB 2OP9A 4INLA 5C1YA 3SYJA 1QGFA 4A5TS 4BTUB 1ESAA 5C3NA 1QBOA 3HK6B 3RXBA 1DXPA 2DE9A 1CGHA 3HKJB 1SC8U 2QE7D 2GVFA 1AWFH 2Y5FA 1YCPM 1HGTH 2LNCA 1TA6A 1V2ST 2A5KA 3GCOA 1O3LA 2A2XH 1ESTA 2BDCA 3MHWU 4K8YA 1O31A 2BY7X 3S69A 1T32A 1O5DH 1O2NA 1DUAA 3PMAB 5J4SA 1H1BA 1TLDA 1TOCB 2XW9A 4INKA 1PQ8A 1V2PT 3IITA 3O8DA 3T25A 2UWLA 3QN7A 2RG3A 2FYQA 4K1SA 1NO9H 5LPEA 1TBZH 3U69H 1RIWC 3U8RH 5EXMA 1IQFA 1H4WA 2A7HA 1H8ED 1NFUA 4AGJA 4BAHB 1EOJA 1AVWA 1ZPBA 5BPEA 4TYDA 3TPIZ 1N6XA 3MU8A 3KN2A 3RMMH 1TA2A 4NGAH 1WCZA 4AZ2B 1HLTH 1RGQA 2CXVA 5C1XA 1L0ZA 2AMQA 2G00A 4D8NA 1KMHB 5AF9H 8KME2 3PROA 3CS7A 1S5SA 1SL3A 2GMTB 2BYAX 3ZVDA 1RTLA 3SNAA 1LHFH 1ZSJA 1YYY1 1OP0A 2ZPQA 2G4UA 4JZFH 5AHGH 4KTCA 4X6OA 3RXLA 1TQ7B 1LVBA 1GBBA 4Y76A 1CA0B 2PUXB 3TH4H 5FPSA 1ELGA 1O5GH 5HM2A 5KEDA 1YPLH 3SBKA 1C1VH 1FONA 1UK2A 2ZGBH 4IBLH 4ACBA 2V7QD 1P05A 3TK5A 1BOQA 2GT7A 1DWBH 2A7JA 5FHTA 1AN1E 3SJIA 1NRRH 1QRZA 2PSYA 1LHDH 1HXEH 2ZF0H 4WXVA 2WUCA 3SV2H 3R3GB 2QXGA 5EQRA 3MQKC 1MQ6A 3DA9B 4BXSA 1O2TA 2ZHEH 4YT7H 1CBWB 3AK5A 1C2EA 4OS1A 1IHSH 1V2VT 2BD3A 4YTAA 3RXMA 1P9SA 3RC6A 2ILNA 4H6SB 2WHXA 4ZCNA 2XWAA 4X2XA 5IYTA 1EB2A 1PJPA 2BQ6B 2Y6TA 1Z6EA 3WWFA 1HJAB 2ODPA 4JK6A 2ZCKP 2ZDVH 1AUJA 1W10U 1RD3B 2Y5GA 1QJ7B 1RJXB 3ZZ4A 2OC8A 1HAYB 1JXPA 5FL7D 2A5IA 2WV4A 1V2UT 1YF4A 2OLGA 3PV2A 4HTCH 1SGQE 3R0FA 4GUXA 3RMNH 1UTMA 1AZ8A 2PFEA 1O3PB 2XNIA 2A5AA 2STAE 1B7XB 1P57B 5EU8A 2P93A 1MH0A 1ZPCA 1CQQA 1BT7A 1TGSZ 1THPB 2TBSA 1IQGA 2FTLE 3VB6A 1UTKA 5GXPA 3SNCA 2F83A 1T31A 4WY3A 5CDFE 1GGDB 2Z3CA 4CH8B 1GJBB 3GYLB 1ANCA 3SI4H 1GCDA 3UTUH 3SQEE 4Q7ZA 3ZV9A 4Q7YA 2SGAA 4WH8A 3SV7A 1Q2WA 2YNBA 5C5NA 4BTTB 1TB6H 1GG6C 2P94A 5IDKA 5JBAS 1Y5UT 1ELAA 2IOTA 1LMWB 2AFQB 3OX7U 1TPOA 2ALVA 1W14U 1XXFA 1F0SA 3ZZ6A 2ZHFH 1CE5A 1QRXA 3F2HA 2XC0A 3MMGA 4BOHA 3BG4C 5CHAB 1TBRH 3ZZCA 3RXKA 1DANH 3OFND 1KIGH 1HB0B 1ZOMA 3O8CA 2WV9A 2WUBA 4ISHH 2PUQH 1MKWK 1V2RT 5EJZA 2QGRA 3M7QA 4LZ4B 1O3IA 1BCUH 4B2CA 4TPYA 3URDA 1AKSB 3TJOA 2FODA 1ZR0A 3GCHC 1HFDA 2CMYA 3E90B 1QB1A 3S7HB 1DE7H 4GCHG 4B2AA 1FUJA 2P95A 4ZKOU 3GDSA 1C1UH 1W3CA 5FAHA 1LHEH 2WPDD 1LKBA 1NFYA 4AN7A 4DGJA 1C2IA 4K69A 3E6PH 2QN5T 2WSSD 1THSH 2KZ4A 3ZYEA 1SGRE 1Y5BT 3LH3A 4NA9H 1E1RD 2AERH 1C4Y2 4X8SH 2VH6A 4MNWA 1EJMA 2J2UA 1NRQH 5HM9A 2QC2A 1GHBF 4Y11E 3BTTE 1FPHH 4JYUH 2ZFFH 2OK5A 1YC0A 2FOBA 1SGDE 1VITG 2EI6A 1GJ9B 1H8IH 2IJOB 1VJ9U 3A80A 3MNXA 3M3SA 5JB8S 3RXDA 1KXFA 2SNWA 5E0HA 2FXRA 1C9TA 1V2WT 2JETC 1QB9A 2QCYA 4GHQA 2ZGHA 2TGAA 1HBTH 1W7GH 4GVUA 1QQUA 1BMNH 4NWKA 2VNTA 1ZGIA 1WYKA 2BDIA 1EAUA 2Z7FE 1OWIA 4I8KA 4P02A 1A46H 1MTVA 3RXTA 1GPZA 5GCHG 4AOQA 1DSTA 2FMJA 1MD8A 2H2ZA 2WPJS 1C1TA 2BD9A 3I78A 3RXOA 3TK9A 1ZSLA 7GCHG 6GCHF 1SGCA 1DWDH 4MPUA 2ZDLA 1GBFA 1AI8H 2BDYA 2KFWA 3PLPA 4E06H 1NBME 3DFLA 3PWCA 3LT3A 1FY4A 1O33A 2A32A 1SB1H 1FN6A 2Z94A 1GHZA 1QJ1B 4THNH 1QTFA 4GSOA 1UW7A 5TCCA 2XCNA 2Z9GA 3LJJA 1SBWA 2OINA 1D3QB 2VWNA 3H09A 2B8OH 1C5MD 2VBCA 1ANEA 3P17H 1GHWH 2PW8H 3SUEA 2O8LA 3T26A 4B75A 1CHGA 3ZZBA 1MZAA 1BBRK 1QA0A 1TNLA 1F5KU 4D7FA 1DY8A 1LO6A 2WZQA 4OS4A 4TY7A 1ZYOA 3A8AA 3GY5A 4K2YA 3ZZAA 1W0KD 2AHME 1DM4B 2DUCA 1JIRA 4AGKA 3EGKH 5E0JA 4CREA 4NFEA 1X7AC 1FQ3A 2F9PA 3RXQA 1MABB 2W7SA 4CRAA 1HAHH 4XBBA 2J94A 1SHHB 1AE8H 1A1RA 1AE5A 3E8LA 1G3CA 3PTBA 4GCHF 2GGVB 3KIDU 1QL8A 1TIOA 5LGOA 1VCQA 1TYNA 4Y10E 1CHOF 1J8AA 3W1EA 5AVDA 5DK1A 1EAXA 1WXRA 2GV6A 5EW1H 2BM2A 4IC6A 3QZQA 1YGCH 2ZU4A 2JH5D 4MNYA 4DIIH 4AYVB 3MU0A 2HNTC 3BV9B 2WYJA 2QF4A 1D3PB 1LCYA 1SFIA 1FIWA 2O9QA 1V2NT 1VITF 2PTCE 4X2WA 2J92A 2R3UA 2ZHQH 2A4QA 3MNBA 3MO3A 1ZHRA 3QTVH 1EAIA 1BBRE 3T2NA 1JOUB 2F4LA 2YMSC 5DP9A 4CBNA 5DKMA 1C5PA 3FFGA 1G30B 1YPJH 2ZFQH 1KLIH 2VB0A 3TGKE 3SJ9A 3O8RA 4CHAB 1EKBB 2VIVA 1QRWA 2BVRH 1O2KA 1O2ZA 4X8UH 4VGCB 2ZPRA 4ABEA 4FVBA 5GCHF 3Q3XA 1C5NH 1GJ4H 4X6MA 1YPHE 2KCPA 4TSFD 4Y7BA 3P8NA 2A4OA 2PP6A 3OE7D 4A6LA 1BJVA 3TITA 3ODFA 3BF6H 4BANB 1P09A 2BB4A 1BTUA 1ELBA 5EJLA 5HIYA 1EJNA 2ZDMA 3EE7A 1SGNE 4PROA 1VGCC 3BEIB 2ZG0H 2ZU2A 3UFAA 4A7IB 8GCHF 2L6OA 2C90B 2VWOA 1L2EA 2OC1A 3UNSA 3ATMA 3ITIA 1LVMA 4MTBA 4Z0KA 1NZQH 1DLKB 3ZIAD 1IQMA 3OEHD 1Z8IB 2Z3EA 2FOFA 1HDTH 1GI4A 4U32A 4B6FA 1MTUA 1O2LA 1Y59T 1HAOH 1O5AB 2P8OC 1FY1A 4NCYA 4J1YA 1O2IA 1LQEA 3LGUA 3JZ2B 2IJD1 3LDXH 3PM3A 3RXRA 3BTWE 1EXFA 3KQBA 3LONA 1AB9C 1K1OA 2Z6BD 5TJXA 3SU1A 4CRCA 1E79D 3W95A 3TH2H 1INCA 1ZHPA 2BLWA 2G8TA 2V3HH 4FU9A 1V3XA 1Y3YA 1DT2A 2VGCC 3A7TA 3QGJA 3PLBA 3TNSA 4A92A 4NWLA 4YOIA 3SOSA 5T6FA 1WTGH 1GI1A 3V3MA 3LOXA 1ZLRA 4X1SU 4MNXA 1P04A 1GJAB 4XRNA 3DFJA 1TX8A 1BMFD 1VZQH 2F91A 5A8XA 1GHAG 1QNJA 3ZVFA 4U01A 1OWKA 4DJZB 1G32B 1DVAH 3UNRA 1C2LA 1EP5A 5FX6A 4WMDA 5DN6D 5DPAA 1S6HA 3TGIE 4IN2A 3A7ZA 1HIAA 1LVOA 3FZDA 3ZVGA 4WMEA 1Y3WA 4SGBE 3UR9A 3A8BA 3ZV8A 1CT0E 2BXTH 4UDWH 1ELFA 2AEIH 3SU6A 2ZU5A 1BTZA 3SO3A 1OX1A 1N8OC 1E1QD 1QL9A 1KY9A 3TLOA 3BIVH 3UY9A 1P2IA 1L1NA 1UMAH 1GBAA 5L30H 2CGAA 1O2GH 2SNVA 4JK5A 3TIUA 1UTQA 4BAKB 1SMFE 1F0UA 1WV7H 2PGQB 3E0NB 4NIVA 3UPEA 1C9PA 3OAAD 2RA0A 4H6TA 4UEHH 3SUDA 1UCYK 1HIAB 3FAOA 1GDUA 1C1NA 2J98A 3OTJE 1SGEE 3FP7E 5CMXH 3CS0A 5EODA 2WPLS 1ESBA 1AHTH 1PPGE 2FIRH 1TX7A 4Y7AA 2QV1A 5DGJA 1IQEA 4ZKNU 1SQOA 2R2WU 1YLCA 1QCPA 1K9OE 1SOZA 1F0RA 1T8LA 1PPZA 1C2JA 1C2HA 3T62A 1SGIB 3BIUH 2J98B 1O3DA 3QK1A 2FOGA 3QO6A 2BD8A 2AYWA 1U6QA 1Q3XA 2XC4A 1Z71A 5CE1A 3OY6U 1GBJA 2XNDD 2Y7ZA 3L33A 3MOCA 4RI0A 2ZU3A 1WAYB 1AZZA 3MH5A 4DT4A 1AQ7A 3SW2B 5G4BA 4J2YB 2G5VA 3A82A 1NBMD 2EQNA 4A1TA 1HAZB 2V35A 2UUJB 3AW1A 1O2VA 2BY6X 1C1WH 1YM0A 4I86A 1WSSH 3A7WA 3S0NA 4GLYA 3UWJH 1KXAA 1V2TT 1UCYE 2SGQE 2TGTA 4WWYA 3QLPH 1QB6A 1O39A 1PYTD 3GY8A 3BSQA 4ASHA 3RMOH 1YKTA 8LPRA 1BTWA 1C5WB 2OD3B 2FWWA 3QZRA 3Q00A 2P3TB 3NWUA 3F6UH 1OWDA 3RXUA 2ZNKH 3BTGE 1NPMA 4Y0YE 3MU1A 4DG4A 3KL6A 3VPKA 2J5UA 1GG6B 9LPRA 1GHAF 1MTWA 1A61H 4KKDA 3EAJA 2FLRH 2BD7A 3I29A 2KAIB 2C8ZB 3VB4A 1W0YH 4DCDA 4HGCA 3ZVEA 3M37A 1O3HA 5HXFA 3T27A 2J97A 1A5GH 2AH4X 1S0RA 1G2LA 1HAGE 2FI3E 4YESB 4F55A 1XUFA 2P59A 2PWXA 2FM2A 1FXYA 3LH1A 1SOTA 3KQDA 1M9UA 1G9IE 1HUTH 1SR5C 2EEKA 4NA7A 3OU0A 1V6DA 3A7YA 2BDHA 5BRRE 1AFQC 1EPTC 2OC7A 5JDUB 4X2VA 3GYMA 2GZ7A 5F53A 8ESTE 5L6NH 2ZI2H 1O35A 2BHGA 2SGDE 1GJCB 4AFZA 1ARCA 3FP8E 4K5ZA 3RXHA 3KYGA 3MO9A 2OXSA 2DE8A 1NTPA 4ESTE 3NK8A 3MH6A 1JIMA 1OYTH 1XXDA 5DP7A 3PYHA 1SQRA 1P03A 2BDAA 3SHCH 2OTVA 3WW7A 3K9XB 3BTEE 1BQYA 1GBEA 5T6DA 4ABBA 2JETB 3K65B 1V2MT 1O2XA 2SGFE 3VG8A 3HGPA 3HPTB 5A8YA 1AU8A 3F3BA 1ELVA 2XCFA 1FI8A 3ESTA 1MMJN 1D6WA 2ALPA 1S81A 1MCVA 2K8IA 3F9HA 3TVJB 1NC6A 2YNAA 2V3OH 1J15A 6LPRA 3GY7A 3OYPA 2ANWA 4AFQA 1RTFB 1S6FA 1Y3XA 1GMCG 2D26C 5L2ZH 2PGBB 2QA9E 3EA8A 1O2HA 1HRTH 3TGJE 5E2OA 1SVPA 5C17A 5DP4A 1O34A 4F4OC 2ZTYA 4MVNA 4ABAA 3GY3A 4FUBA 4X8VH 5T1VA 5F6MA 4OGXA 3O8BA 5ETXA 3RXGA 2G55A 1A7SA 1UVOA 1B5GH 3MH4A 1IOEA 1UVUH 2Y82A 4GPGA 1K22H 1SSXA 2VWLA 1FDPA 7LPRA 1TNKA 2H9HA 3QTOH 1O3AA
chains in the Genus database with same CATH topology
2A31A 2PTNA 2W7UA 3RC5A 2UUKB 1ACBE 2F3CE 1RRKA 3Q3YA 2ZDKA 3KGPA 1HPGA 2FS9A 2C93B 1OYQA 1O2YA 1LQDB 5FCRA 4FUHA 1ZRBA 1TABE 1BZXE 2WPIS 3A81A 4ABFA 2ZU1A 3SJOA 1MAXA 1SGPE 4DIHH 2XBWA 3T28A 2BZAA 4Z6AH 4BTIB 1O36A 1TMUH 1HCGA 1HAXB 1H9LB 5J4QA 2ZC9H 1FNIA 2QXJA 1O3BA 3ENSB 1N6YA 3ZZ9A 4I8JA 1C2MA 3URCA 2R3YA 2GZ8A 1DICA 3F68H 2GP9B 1Z8JB 4ISIH 2IPHA 2AMDA 1CGJE 4A1XA 2F9VA 1FY3A 1SGFG 1MTNC 4FUCA 4ZKSU 4BAOB 1EJAA 1ELTA 1UTLM 1MKWH 1BTYA 4AYYB 2ANYA 3RUOA 4UONA 4ISLA 2I6SA 3PMBB 1DLEA 4ZROA 4B71A 2FI5E 1PQ5A 2A7CA 1D4PB 1O0DH 2ZQ2A 1O5BB 1T4UH 1SFQB 4YT6H 1P06A 3K6ZA 1YCPH 2ZIQH 5EW2H 1NRSH 1CO7E 2ZDNA 1V2JT 2Z9IA 4BAMB 4NG9H 4CRDA 3SI3H 3A83A 1XX9A 3TK6A 3FANA 2R2MB 1SG8B 1ZMLA 5K0HA 5HGGA 3M3TA 2QAAA 3GDVA 5FX5A 4BNRA 1ELCA 1UK4A 1NFWA 4CRFA 2D2DA 4K1TA 3ODDA 5JBBS 5LPFA 1Z6JH 4NIYA 5C67A 2Y5HA 4JZIA 3SU5A 1TQ0B 1FAXA 1SLXB 4GHTA 1Y8TA 1J14A 5A0CA 4IMZA 3E0PB 1P2JA 4YLQH 4ABJA 5I46H 4DURA 5L2YH 1F7ZA 1K2I1 4R8TB 2OBQA 2FZZA 1GL1A 4WJG2 5C2ZA 1O3GA 1O3OA 2Y80A 3QX5H 2B0FA 3E1XB 2PLXA 1IHTH 3P6ZB 3SN8A 1VGCB 2SGPE 6CHAB 4ABDA 1TPAE 3S9CA 3GCTG 4R0IA 1MBQA 1ZPZA 5B6OA 5JB9S 3MH7A 2QF3A 4MNVA 2PKSC 3GISB 4Y8XA 4YZUA 1P01A 2ZHWH 1SLVB 5GJ4B 3B9FH 1O5FH 1WOFA 3L6PA 1MU8B 1MBMA 1QHRB 1O38A 1YP9A 2XWBI 1H9IE 2VIOA 1C1PA 2HVXA 1HYLA 3BTHE 3RLWH 2ZFPH 3AAVA 1BTHH 4IS5A 4RSPA 3ZZ5A 2A45B 1AB9B 5FCKA 5C20A 2HRVA 1GVKB 3IWMA 3SHAH 1TALA 3SU2A 3VGCC 4OS2A 4ABHA 1C1RA 2BLOA 1EP6A 3U1IB 1O2SA 4MQAA 1GGDC 4O03A 3FZZA 3ZZ7A 1BBRH 3Q3KA 3LPRA 5EG4A 4ZKRU 2BD5A 3UNQA 2UWOA 4KTUA 3BEFB 3UREA 3TH3H 1L1JA 2C8XB 4DY7B 3MWIU 1TX6A 3EDXB 3KF2A 5T6GA 1EZQA 1TE0A 1TFXA 1LPZB 2FEQH 1LHGH 2A0QB 2V0BA 1MTSA 2P3FH 2TGDA 1HAVA 3KHVA 3D49H 2J34A 1C1OA 2QXHA 4X1QU 3M5MA 4CR9A 3AW0A 1TWXB 4IGDA 2WINI 3M5NA 3NPSA 2LPRA 4XFQA 3UQOA 2ANKH 3Q76A 5ESBA 5C5OA 4WXIA 3PMHB 4JYTA 1ETRH 1BHXB 3DUXH 1ORFA 2PR3A 2FOMB 2AGIX 2ESTE 3AASA 1C5LH 4FUGA 2GCHG 1AWHB 3BEUA 1HAIH 4FXGH 1BJUA 1LVYA 2OQUA 2P16A 4I33A 4AG2A 1K28D 1PQAA 3UOPA 2QXIA 2W3IA 1ID5H 2WPMS 2WYGA 2Z3DA 3STIA 1HAVB 2Z9JA 2JKHA 3A87A 1L1GA 4KTSA 2VIPA 1NS3A 3SGBE 1GHYH 5DP8A 2HNTF 3LJOA 5K7RA 1P3EA 3LGWA 5FBIA 3K6YA 1AGJA 5GPIB 2VWMA 1FY5A 4UFDH 4IN1A 4SGAE 3RP2A 1GJ7B 5FBEA 1SLUB 5DP3A 2CHAB 5JBTA 1BRBE 2RDLA 5F8XA 4LXBH 2H9TH 4AFSA 7GCHF 1FIZA 3SUFA 1EZSC 3STJA 2ODQA 1O32A 1P2QA 3QUMP 2FTMA 4K1EA 5JPMH 4Y6DA 4YM9A 2F9UA 4U30A 2GCTC 1GWAA 2F9NA 2ZGCA 2VINA 4XBDA 1E35B 1TNHA 2TIOA 5EOKA 3RM2H 3EQ0H 3KQCA 2GZ9A 3ZZ8A 1P8VC 1O3CA 2GV7A 4X1NU 1V2OT 1O3NA 1THRH 2FOAA 1P02A 3A86A 1A2CH 2FPZA 2O8WA 1KTSB 3VB5A 2QF0A 2W5EA 3PMJA 1KXDA 4FUFA 4FUDA 4HI3A 3K2UA 1KDQA 1GBHA 3W94A 3ZVAA 1LDTT 1W0ZU 2HNTE 4NIXA 4E7RG 1L4ZA 5ESTE 1EZUC 1S83A 2WPHS 3PV4A 1EPTA 1O2OA 2C4FH 4KP0A 3CENA 1LKAA 2FS8A 1E38B 1O2JA 3BTME 1QY6A 2V6NA 3SNBA 1O5EH 2H5CA 1D6RA 1DPOA 2XRCA 3BTQE 3P8FA 1RIWB 1VCWA 1GBCA 1SHYA 2Q1JA 3AAUA 1GCTC 1TGNA 2VIWA 4IC5A 4YLUA 1BMLA 1GMHG 2GDDA 5ABWA 2GCHF 1KDQB 1TRNA 1BUIA 1LPKB 4O9VA 3SU3A 1Y5AT 4ABIA 5A0BA 1HAPH 5T3HA 4AB8A 1ETTH 1JRTA 1A5IA 1AFQB 1EPTB 1OWHA 2XBXA 1PPFE 1OWJA 1QQ4A 4WH6A 1O2UA 3ATKA 4I8LA 1BA8B 1GI8B 2H1UA 1AIXH 3E3TA 1T8NA 1NRPH 2Z9LA 1HJ9A 1RS0A 2FP7B 1F5RA 2ZWLH 2BXUH 1JRSA 4M7GA 3U8OH 3BTKE 2Q6GA 1BHXF 1RFNA 1MKXH 4Y0ZE 1TGBA 1DWCH 1GHVH 1K21H 1DITH 1O2QA 2BY8X 3H7OA 4UD9H 1GBLA 4YOJA 3PWBA 1W11U 3SNDA 1YLDA 1E37B 1S85A 3RU4E 3QGNB 4UFEH 2PV9B 4XE4A 4O97A 3EA9A 2RCEA 1IQIA 3SORA 3QWCH 3B23B 2D1JA 2VVUA 4Y8YA 1O2WA 1AY6H 3V7TA 5PTPA 4O3TA 4QT8C 3A8CA 4X6PA 1E34B 2XYAA 2FOCA 1QL7A 1LHCH 1FN8A 1ABIH 3RDZA 2EC9H 5H4IB 1GHXH 1LTOA 2ZA5A 2C8WB 5F8TA 1ANBA 2UUYA 1ZHMA 1L4DA 1MAYA 4OS6A 4CRGA 3HKIB 5JYIA 4MLFB 5FPYA 2FOHA 1K1JA 3A85A 1EAWA 2NU1E 2HLCA 3RMLH 3IG6B 4B2BA 7KMEH 1C5OH 1O2PA 2HPPH 1T8MA 1OWEA 1C5SA 1KYNA 1KLTA 4XBCA 3SZNA 3NUMA 3LC5A 1GBTA 3JZ1B 4B76A 2OQ5A 1C5QA 1WU1A 4XOJA 1IQNA 2YOLA 1ZRKA 2M5TA 1KTTB 1MD7A 1C4U2 1C5RA 1F2SE 1T8OA 1P9UA 4ZXXH 1EATA 2TGPZ 1C1SA 1S84A 1QBNA 1WBGB 3DD2H 1O2MA 2XBVA 2ZP0H 1FZZA 1YPKH 3PO1C 1FMGA 1H8DH 4ZUHA 3SU4A 2GTBA 1G3DA 4MPXA 1BTPA 3EE0B 1PFXC 4ZHAA 3RXPA 1IQLA 2AGGX 3ZYDA 4DVAU 2J38A 2ZGXH 1OS8A 2BOHB 4MG3A 1TMBH 2ZEBA 1A0JA 2OC0A 1UVTH 2ZTXA 3BG4B 5GDSH 1GMHF 2BDGA 4ISOA 5HMAA 2IN2A 3C1KA 3RU4T 2FO9A 3VXEH 1QJ6B 4NSVA 2GKVE 3LGVA 2O8MA 1OKXA 5F03A 1C1QA 1P10A 1MTNB 1P2KA 3GCHB 1UO6A 1Y3UA 4F49A 3A89A 3SQHE 2B5TB 4K3JA 4X1RU 1C4V2 2RA3A 1F5LA 2Y81A 3RM0H 1TRMA 1XM1A 2ZECA 5HYOA 1FLEE 1OXGA 1NFXA 2ULLA 1OOKB 3SGAE 1C5ZB 3WY8A 3A84A 3SV6A 1W8BH 1O3MA 1AVGH 1EQ9A 3F1SB 1UVSH 2J4IA 3RXEA 1Z1JA 1K1NA 1ABJH 1GVZA 2FYRA 4X1PU 4Y8ZA 2R0KA 4AB9A 3GY6A 4BAQB 2ZQ1A 1PPHE 1HXFH 1P11E 3GY2A 2ZGJA 1AVXA 3TJNA 3TJUA 1XVMA 2AS9A 3EYDA 3V0XA 1F0TA 1GHBG 1EZXC 1QBVH 2QY0B 1D3TB 1XUGA 1FJSA 1TGCA 3BN9A 5GIBA 3A88A 3M5OA 4ZH8A 2FX4A 4Y79A 1Y3VA 1SGFA 2TRMA 2VJ1A 4H42U 4Q2KA 1NROH 1GL0E 1QR3E 1ZJKA 3PTNA 5FXLA 1UVPA 1DUEA 2HPQH 1W2KH 4WF8A 1Z8RA 1SGYE 5C1UA 2PKSB 3MU4A 1PPCE 1UTJA 2JH0D 3RXJA 5A09A 1QA7A 3AVZA 3SJ8A 4INHA 4LK4A 1CA8B 1ELDE 3F9GA 4X0WU 1Z1IA 3S7KB 1B0FA 3ZVCA 1XMNB 2Q6FA 2SGEE 3MO6A 5LPRA 1BDAA 1WUNH 2GDEH 4JZ1A 1GBDA 2FESH 5EPYA 1J17T 1YPGH 6GCHG 4A1VA 2HWLB 3V12A 4NA8A 2BX3A 1DDJA 3GCNA 1KXCA 1BB0B 3MU5A 5A8ZA 3M7UA 3VGCB 3VB3A 2EA3A 2R9PA 3ZZ3A 1C5UA 4FUIA 2FDAA 2ZZUH 3EA7A 1XUIA 4NFFA 4OS7A 2BQ7B 1KXEA 4I8HA 1DWEH 5E2PA 2GX4A 4TWWA 1AKSA 1T4VH 4H4FA 1EUFA 2BLQA 3LU9B 4ISNA 4JMYA 1VJAU 3E91A 3NKKA 1C2KA 1JMOH 2BQWB 4K8BA 4OS5A 2BTCE 1EASA 3D65E 2PHBA 3U1JB 1OPHB 4KGAA 1NESE 4B74A 5DJ7A 1SQAA 1OP8A 3RXSA 1O3JA 1S82A 1PYTC 1TOMH 2AIPA 3MFJA 1NRNH 3SUGA 4D7GA 1XVOA 1XKAC 2J95A 1ZJDA 4MPWA 4JCNA 2BMGB 2B9LA 2G81E 1GI7B 1ZSKA 3MI4A 1Q31A 2G5NA 1C2DA 1CU1A 4X2YA 1YCPK 4WVPE 1P12E 5EQQA 2GMTC 1A0HB 1CHOG 2ZCHP 5A2MH 1A0LA 1TNJA 4JZDH 2Z9KA 1TGTA 2BY5X 3P95A 5DG6A 1CA0C 4Q7XA 3OSYA 1F92A 1AUTC 1TONA 4NSYA 3RU4D 1IQHA 4CBOA 1P2OA 1QIXB 2BLVA 3E16B 1NU9A 2VVVA 4TY6A 1ARBA 1TRYA 1CVWH 1GMCF 1SGTA 1BMAA 1BRAA 1XKBC 1BTXA 2ZFSA 2ZPSA 1CSOE 1W12U 3A7XA 1OP2A 2H5DA 3VFEA 1CBWC 3NCLA 3UWIA 3TU7H 3L3TA 2BVXH 1GMDG 4CRBA 1O3EA 2A4RA 3MNCA 2O8UA 3MYWA 1LPGB 1O30A 1HJAC 1J16A 1ETSH 4CH2B 2GCTB 4WMFA 1K1IA 2H9EH 4RKOB 2CN0H 2VH0A 4OGYA 1C2GA 1TPPA 3VXFH 1TAWA 5GWZA 1JWTA 1E0FD 3M61U 2WPKS 2CV3A 4AFUA 5EXLA 2OBOA 4RKJB 1O2RA 2FI4E 2P8OB 8GCHG 1TNIA 1GBMA 4MPVA 1YPHC 5EXNA 1GI2A 2BX4A 4DW2U 1MUEB 2NU2E 1HV7A 4TPIZ 4AG1A 3D62A 2K1QA 3OY5U 4ZMAH 2W3KA 1GI6A 1BIOA 1C2FA 2VGCB 1W7XH 1DOJA 1AFEH 1BRUP 1MZDA 1HJ8A 4E7NA 2AGEX 1TNGA 1GI9B 3BG8A 4BXWA 2VU8E 1O3KA 1B0EA 3RXAA 3ZVBA 2GT8A 1QURH 3T5FH 4I31A 3ELAH 1EOLA 1O3FA 6ESTA 1GI5A 1J9CH 4KELA 1WQSA 1C5YB 4FU7A 3U8TH 5EGMA 1FY8E 5CHAC 3LGTA 1EB1H 3UOUA 1WQVH 1G36A 5LH8A 1G2MA 1GCTB 1GJ8B 3P8GA 5DP6A 3KEEA 3D23A 1UTPA 1O37A 1K1PA 1W13U 1AO5A 2NWNA 4AORA 1D3DB 1RTKA 3H5CB 3ZZDA 4ZAEA 1MCTA 1MU6B 1N8OB 4YO9A 2BDBA 4I8GA 1V2KT 1BRCE 1GJ6A 2ASUB 4ABGA 2ZDAH 3A7VA 3DT0H 3M5LA 3LGIA 3DHKH 2ZFTA 1DSUA 2TPIZ 2OCVB 3GOVB 4XDEA 4Y71A 2H6MA 1YPEH 1QFKH 2F9BH 1ELEE 1A4WH 3FVFB 1A3BH 2Q6DA 3SV9A 1CGIE 3SV8A 1AD8H 1C5TA 4ZHMU 4ZXYH 1EX3A 1S0QA 1KLJH 4B73A 2A2QH 3LGYA 3HATH 1N1LA 3M7TA 1FPCH 1RXPA 3SU0A 2JH6D 1SPJA 4D9QA 4AX9H 1VITH 1TPSA 9ESTA 1P2MA 4IW4E 2ZFRH 2HGTH 4FVDA 4UFGH 3RXVA 4UFFH 3S9AA 2XBYA 2FOEA 4U2WA 1GMDF 1P0SH 3GCTF 1GVLA 1NT1A 2ZHDA 4HFPB 1YPMH 2R0LA 2P3UB 3LKWA 4FUEA 2J9NA 2PKAA 1NM6A 4JYVH 3I77A 1K1MA 1MQ5A 4NZLA 1PPEE 1GDNA 1BITA 3V13A 2QYIA 3M35A 5I25A 2ZKSA 3F9EA 3SJKA 1VCPA 3PLKA 5FPTA 3BTFE 2NU3E 2BY9X 1AMHA 5EQSA 2BD2A 3GY4A 2F9OA 6CHAC 1TMTH 1XUHA 1VR1H 3Q77A 1CT2E 1P3CA 1C1MA 3NXPA 3RXCA 3TNTA 4I7YH 1OSSA 4X6NA 2BD4A 2Y7XA 4MDSA 2UUFB 2VIDA 3GICB 4D76A 1IQJA 1PPBH 1IAUA 2PKAB 3RLYH 2EI7A 3LIWA 2XTTB 1FAKH 3SNEA 1GJDB 1UHBA 1ZMJA 4NZQA 4JZEH 2THFB 3KNXA 3PO1B 4O3UA 1DFPA 1C5XB 4B1TA 4FU8A 1JBUH 1CT4E 1XUJA 2ZTZA 4D9RA 5DP5A 5A0AE 1TBQH 3M3VA 2FLBH 7ESTE