2ZDKA

Exploring trypsin s3 pocket
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA02
2V0BA 2Y7ZA 3RXPA 2AMQA 2SGDE 2Z9GA 3E6PH 3IWMA 1TGSZ 1FIZA 4NIYA 2P3FH 4K8BA 1LKAA 1FPHH 4GHQA 5JBTA 3N7OA 2WPLS 4CRGA 3ZZ7A 3A7TA 1P57B 1NY22 1CO7E 5T6DA 4NSVA 4NA7A 3A7WA 5TCCA 3NXPA 5A8XA 1BHXB 1IQMA 1S6FA 1UTMA 4CRFA 1H1BA 5FX6A 5TJXA 1NFUA 1A3EH 3SU3A 1QNJA 4Y79A 3VB7A 2QN5T 2ANMH 1JOUB 3M7TA 1GBKA 1KXBA 3O8BA 1YP9A 3A8BA 1MQ6A 2J95A 3RM2H 1NFYA 1ZSKA 4WMDA 1GHAG 1HJAC 3BTQE 1KSNA 4K1TA 4AX9H 2VIDA 3DA9B 3BV9B 1V2UT 5ESBA 1EJAA 3T29A 2WYGA 4KGAA 3UQOA 3LU9B 2ZWLH 3BEUA 3O8CA 3U69H 1IQLA 3SV6A 3FFGA 3O8DA 4X2VA 1UMAH 1BOQA 1FIWA 1UHBB 2ZFFH 3SUDA 1O2SA 1P0SH 1UTKA 1QB6A 2A5AA 4BXSA 1FI8A 1GHAF 4ZROA 1GJDB 1QB9A 3RXTA 2VB0A 3E8LA 1KDQA 4WMFA 5BPEA 4WY3A 3MO3A 2BD9A 2PTCE 3RXOA 1CVWH 3HGPA 1SLWB 1W10U 2BDHA 1SQTA 1ZRBA 1O5AB 4ZUHA 3LPRA 4JZ1A 2I6SA 3RXBA 3KL6A 4JZIA 3SU4A 1BHXF 1O5CB 1DLKB 2A0QB 1C2GA 2XRCA 1FY5A 5J4SA 1GJ5H 1VCPA 2GD4B 4NA8A 1MD7A 1HAVB 2NWNA 1O2NA 1QFKH 5EGMA 4RKOB 2XWBI 4X2XA 1ZZZA 1OWKA 3S9BA 2BLOA 3SJIA 1BJUA 2O8WA 2C4FH 1ZHRA 4GCHG 3TJUA 3CS7A 2A7HA 1YBWA 4KP0A 1HAPH 1SB1H 1O2HA 1TPPA 5CHAC 1T31A 2A4OA 2BVSH 1C1QA 1O33A 1TRNA 1O0DH 3BSQA 1PYTC 2FOCA 2FTMA 5AF9H 1JMOH 1DSUA 4GCHF 2VIWA 1GDNA 2OC7A 3T28A 1C5NH 1XXDA 2OBOA 2ZPSA 3LC3A 2FYQA 3M35A 3VB6A 4X1PU 1CGHA 1KLJH 2XWAA 4AN7A 1YPJH 2XYAA 3TH3H 3BTTE 4UD9H 3VXFH 2VIVA 6LPRA 4JK5A 3L33A 2HALA 3RXLA 3BG8A 1Q3XA 3FZDA 2H5CA 3ELAH 2ZEBA 1T8MA 3A7XA 1MD8A 2BDGA 3A88A 3SU0A 1BA8B 1DUEA 1DX5M 2OC8A 1THSH 1GJCB 2XCNA 1BMNH 3SUGA 3A81A 3ATLA 5F03A 1L1JA 1Z1IA 4J1YA 2GGVB 1YPMH 2ZGHA 1JXPA 4O3UA 4WF8A 5SGAE 4KELA 4TPYA 1O3JA 5JYIA 1Z8GA 1NTPA 2ZPQA 3U8TH 1NPMA 5A0BA 2PWXA 3LH3A 2GVFA 1HGTH 1GG6B 1TRMA 4NSYA 1C4U2 1UTJA 1YPEH 1BITA 5GCHF 3D23A 3ZVBA 1PPHE 1SPJA 1TE0A 4WJG2 3P8NA 1O3HA 2ZG0H 2Z3CA 1LQEA 3RXFA 2XNIA 2ZKSA 3M5LA 2PHBA 3ESTA 2J4IA 3TGJE 2ZDNA 1LDTT 1WSSH 1ZJKA 2ZTYA 4CRBA 1W11U 2FX6A 3GY6A 4ISHH 3M5OA 2Z9LA 1TBZH 2ULLA 1QJ6B 2Y81A 1IQJA 2XTTB 1EB1H 1ANCA 1C1RA 1O2JA 2ZFQH 1GBMA 1QBNA 4Y7BA 5E0JA 1GBCA 3STIA 1YCPH 1V2TT 2Y5GA 1S81A 8KME2 4AYVB 1SGEE 4A1TA 1GBJA 5DP5A 5LGOA 1MMJN 3KF2A 1HPGA 1K1MA 2FLRH 1PPEE 3SBKA 3IG6B 1B7XB 3DFJA 2FPZA 1BBRH 3PV4A 3T5FH 4IBLH 1OXGA 1ZHPA 5C20A 2HNTF 5EXMA 4B76A 1EAWA 1FLEE 1GGDB 1Y5BT 3RXMA 1O3PB 2Z9KA 4B75A 4BOHA 4AG1A 1AQ7A 2BYAX 1P09A 1VGCB 1DY9A 3BIVH 1BCUH 3PWBA 1L4DA 5E2OA 3E0NB 5EXNA 1ETTH 1KIGH 4DT7B 1AVXA 1QA0A 1NU7B 1GMHG 7ESTE 4CR5A 3PYHA 1N1LA 2VIOA 5DKMA 1C2HA 2SGEE 3SU5A 3SU2A 2BDIA 1BTWA 1VJAU 1EZSC 1EKBB 1MTWA 4WWYA 4I8JA 1TNKA 2SGAA 1CA0C 1MKXK 3LGVA 1FQ3A 3MNXA 3TITA 1GMHF 3M3VA 1AIXH 2ZHWH 1V2ST 3HKJB 1K2I1 1QY6A 1IQKA 2FS8A 4U01A 2LNCA 1XUHA 1OWEA 1TNJA 4Q2KA 3RM0H 1PPCE 4I31A 3ZZAA 5CMXH 4BTTB 2YOLA 1GWAA 2RCEA 1ANEA 1RRKA 4ISOA 1AFQB 3K6YA 4YOJA 4YT7H 3FP6E 1MTUA 1AVGH 5E8EH 3V0XA 1TX7A 2H9TH 4NIXA 1HCGA 2FM2A 1ZPZA 3TGIE 1BQYA 1TALA 5JDUB 2ZFPH 1INCA 1GBLA 5TCAA 5DPAA 1PPBH 2UWPA 4E7RG 3NCLA 3TH2H 3TPIZ 2B9LA 1C1SA 2WUBA 1WTHD 3TK5A 4GLYA 3GCHB 4BAKB 1O2YA 1NO9H 3TU7H 1V2VT 1DSTA 2ASUB 1GI3A 1V2LT 3RC6A 1SFQB 2QXJA 2BD4A 3LONA 5ABWA 2BB4A 1AFEH 1J15A 2BY8X 3GDSA 3HGNA 3VB5A 2QIQA 2ANYA 4VGCB 1P9UA 3IITA 4UEHH 1GJ6A 1UVSH 4Q7XA 2ZU1A 4KTUA 1GDQA 5F8ZA 1SOTA 2GT7A 2ZPRA 1GBDA 4X8VH 3U1IB 1HAOH 1OKXA 3RXJA 4K1SA 1SHYA 1ARCA 1IOEA 1Z8IB 1FAXA 1TNLA 3GY8A 3PO1B 4AGJA 2CF8H 3T25A 1EZUC 1BMMH 1GHWH 2QGRA 4IC5A 1V2PT 3ITIA 1MH0A 2JH6D 3VFEA 2XBYA 3QX5H 4XDEA 3MU8A 1AUJA 5C67A 1T4VH 2FS9A 3RXDA 1MKWK 1UVTH 4NIVA 4B1TA 3SV8A 1A5HA 3U9AH 1IAUA 3RXAA 1G36A 1JIMA 4OS4A 5DG6A 2ZP0H 1S0QA 1GHBG 1HAGE 5L2ZH 2GDEH 1XXFA 3ATIA 1TGBA 5EU8A 2CF9H 3TJNA 4X1QU 1O2TA 3JZ2B 5I46H 3ZVAA 2BZAA 1K1PA 2ZHDA 3PMJA 1JIRA 4MTBA 3V13A 3VXEH 1OWHA 2ZGBH 4ABIA 1SG8B 3M5MA 1EAUA 1O3LA 3ODDA 4AFUA 1GHBF 2PR3A 3SUFA 5A09A 4ISLA 1P8VC 1UTPA 2CXVA 3M5NA 4FU7A 3HPTB 1TOMH 3MFJA 1HJ8A 1SLXB 3SHCH 4GSOA 3MH7A 1A0LA 2ZGJA 3W95A 3QZRA 1IQIA 5E0GA 3UREA 2ZNKH 3TH4H 3SW2B 3JZ1B 1SGDE 5T6FA 1KXAA 3BEFB 1GJ9B 1HIAA 1TGNA 1CT0E 3K65B 1TWXB 3RXVA 4DOQA 1O34A 3LOXA 1GMDG 2TGDA 4JYVH 3ZVEA 1YPHC 4BXWA 1QURH 1AVWA 3MMGA 3ZVDA 4NWLA 1BTHH 3FAOA 3HATH 2DUCA 4SGAE 1CHGA 1BT7A 4TPIZ 4ISIH 5EW1H 8GCHG 4OGXA 1L2EA 2Y80A 1YM0A 1K1OA 4X6PA 2STBE 2HLCA 9LPRA 4HGCA 1ZPCA 3AVZA 4IMZA 1GMDF 1BB0B 1S0RA 2D26C 2GTBA 3MO9A 1YPGH 2WPKS 3SNBA 1N8OB 3RMLH 1GDUA 4E7NA 4J2YB 3UPEA 3TK9A 8GCHF 1Z7KA 1EB2A 1ZMNA 3GY3A 3KEEA 5GXPA 1WOFA 2FOFA 1SHHB 3SU6A 5C5NA 1GMCG 3PLKA 2Q6FA 1MTSA 2H1UA 4WH8A 1THRH 1C1UH 1GBIA 2BLQA 2B5TB 4YZUA 1ZTJA 1FAKH 1NRRH 3HK3B 1L4ZA 1XVOA 1AE8H 4ASHA 1O5EH 2BOHB 1C5PA 1QGFA 2FYRA 1TPSA 4Z6AH 4JYUH 1GJ8B 1GMCF 2A32A 2AS9A 2IPHA 1J14A 2UWOA 3A83A 1LCYA 5AHGH 1ABJH 4RKJB 3F68H 2VNTA 3S69A 1AGJA 2HWLB 2OP9A 1YPKH 4X6NA 2TIOA 4K2YA 4DJZB 1HAHH 4AGKA 1LHGH 3RLYH 1SMFE 6GCHG 1C4Y2 1Z71A 1C2DA 4B2CA 1FONA 1EPTB 3SI3H 1G9IE 4NWKA 4Y6DA 3KQBA 4UDWH 5A2MH 1LPGB 5GWZA 1EAIA 4RN6A 1C5QA 4E06H 3SI4H 3U98H 3AAVA 2VGCC 2OUAA 3PTNA 3LT3A 1ELFA 2F9BH 1FPCH 1SSXA 2SNVA 4MQAA 1MZAA 1GJ7B 4E05H 3LH1A 1W3CA 1O36A 1UCYE 6GCHF 5FPYA 2PV9B 3VPKA 1LKBA 2QY0B 2A2XH 2PW8H 1FNIA 2KAIB 4MPUA 4CH2B 3KQEA 1SGQE 1D6RA 2QAAA 4R0IA 1TX6A 2O8TA 2G81E 3GYLB 3FZZA 1AKSA 1A5IA 3TJOA 2F9NA 2SNWA 3P8OA 1DT2A 3LGYA 1HJAB 4RSPA 5PTPA 4FUGA 1MU8B 1ZOMA 3RXKA 1TGCA 3TLOA 4MNWA 2FOMB 4DIHH 2GCTB 1CU1A 1O2XA 3ZV8A 4AFQA 3EAJA 4WMEA 2JKHA 1BJVA 3S9AA 2FDAA 2ZCLP 3MNCA 1TNIA 1BMLA 2XXLA 1F5RA 2AIPA 2H9HA 3QGNB 4Q7YA 5DP7A 1HBTH 1O3IA 2C3SA 5C2ZA 1O2ZA 2FI4E 2FWWA 3K9XB 1DXWA 3RP2A 2EI8A 2XC5A 2W3KA 4IMQA 2FOGA 2ZTXA 5ESTE 4THNH 1SGFA 3SV2H 2PKAA 1TABE 3W94A 1OYTH 2Z3EA 1NESE 1Y3YA 4JCNA 5EOKA 1P01A 2BY7X 3SU1A 1UK2A 2BMGB 1EX3A 1O5GH 2J38A 1XUFA 3ZZ6A 4ABFA 2A2QH 1PQ8A 2BD3A 4NCYA 1LVBA 1QR3E 7KMEH 1SC8U 1G3CA 2FX4A 2ZA5A 3QO6A 1AZ8A 4GHTA 1ZRKA 4A5TS 2D2DA 5JBAS 2K1QA 3BTEE 1FJSA 4X1RU 1ZPBA 4I8KA 3S9CA 5A8ZA 1O30A 2DE8A 2ZCHP 2PLXA 1O31A 5EQQA 4HTCH 3RC4A 1D3DB 3SJOA 3UR6A 2Y82A 3KIDU 1QHRB 4LOYH 5EQSA 3KN2A 3SNEA 1F5LA 4D8NA 1GL1A 4X2YA 3GY5A 1UO6A 5CHAB 1YGCH 1A4WH 2OD3B 1YKTA 1F0UA 3U8RH 4CHAB 1AHTH 4ZXXH 1P2IA 5DGJA 5F8XA 2SGFE 2IN2A 2G51A 1ZGVA 3GY7A 3LKWA 2AMPA 3EGKH 1OOKB 2IOTA 1P2NA 3T27A 4FUEA 2ESTE 1SLUB 1CBWC 1TMUH 3DUXH 1C9PA 3MH6A 2XBWA 1AO5A 3BTKE 5FXLA 2ZHEH 9ESTA 3VEQB 1O3BA 1O32A 2ZZUH 3P6ZB 5F6MA 4FUFA 3F9HA 6CHAB 1RXPA 2B7DH 1K1NA 2VWOA 2Z9JA 5L2YH 2RG3A 3CENA 4BTUB 1NC6A 4U2WA 2THFB 2BDCA 1YPHE 2VWNA 4K5ZA 3QUMP 4CRDA 2GV7A 1TONA 1DS2E 1ARBA 1O3OA 1V2QT 1O3EA 1GVZA 1NT1A 3P95A 4XE4A 3RUOA 1NU9A 5C3NA 2WV5A 1BRAA 1BZXE 4O3TA 1O5BB 1VITG 1RFNA 1IQNA 2CJIA 2F9OA 1UVOA 1ANDA 2J2UA 3UFAA 4CRCA 1S82A 2ZDLA 2HVXA 1ELCA 3AW1A 1XKBC 3VGCB 3P8GA 4NG9H 3RXIA 1DWEH 4ZKOU 2BZ6H 5E0HA 1V2WT 1TB6H 3ZVCA 2Z3DA 4WH6A 5DJ7A 1EJNA 2B8OH 5J4QA 3RU4E 1VITF 1QA7A 4BNRA 1F92A 2ZHFH 5JB8S 1A3BH 4XOJA 3UR9A 4CR9A 1ZSJA 2BDYA 3PB1E 3O8RA 3Q77A 4ZMAH 2ZC9H 1T32A 2JETC 4ZHLU 4X8SH 3NK8A 1P10A 3NUMA 1Y3XA 3D62A 2R9PA 4I32A 1D4PB 3TIUA 4H6SB 3A84A 2A7JA 1TA2A 2OCVB 2BQ6B 1PPFE 3SQEE 4AB9A 1SGTA 2BVRH 1LHDH 1HDTH 4YTAA 3UUZA 1C5LH 1AUTC 2D8WA 5AFZH 3KQCA 2VVUA 1RIWC 1MCTA 2G55A 4JMYA 4Z0KA 1P04A 1Y8TA 2NU0E 1CT4E 3Q00A 3URCA 3RXEA 1Y3VA 1HFDA 2BD8A 2BXUH 2GP9B 4OS7A 2F91A 4I8HA 1B0FA 1V2KT 2FODA 5EODA 1C5RA 1YLCA 3QZQA 2ZU5A 2ZGXH 1CA0B 2BX3A 4X6MA 1WBGB 3A87A 1UTLM 4I33A 1ETRH 3ENSB 1GI0A 3UTUH 2FIRH 3NPSA 1BRBE 4YT6H 1J8AA 2YNAA 1C5OH 4BTIB 2PUQH 4MNYA 1P2KA 3ZZ4A 1W2KH 3Q3XA 1QRXA 2G5NA 1GHXH 3G01A 2WYJA 1BRUP 2EI6A 3E91A 2OC0A 4FXGH 5EXLA 2QF3A 2VVVA 1TBQH 2R3YA 3M7UA 1GBEA 4MLFB 1Z8JB 1FY3A 2ZU2A 3LC5A 2C8ZB 1CE5A 4GAWA 3SNCA 2WINI 4MNVA 4CBNA 1QRWA 2WPMS 2OLGA 4HZHA 3UNSA 1KDQB 4B73A 1SBWA 1CT2E 1F5KU 4LZ1H 3QLPH 4KTCA 1FXYA 1IQEA 2HOBA 2R2WU 1RTLA 2Q1JA 3NKKA 2NU2E 1BTZA 3A7ZA 4AB8A 4HI3A 1ID5H 2STAE 4U30A 3GCNA 1UVPA 1MAXA 4H4FA 1ACBE 1DM4B 1GI6A 3PTBA 3TNTA 2A4QA 3F1SB 4INKA 1DY8A 4X8TH 1AMHA 5FCRA 1NZQH 1DVAH 2ALVA 1DFPA 1RTFB 1TFXA 3DT0H 1Q31A 2SGPE 4WVPE 3ATKA 5GJ4B 3UY9A 1WCZA 3E0PB 3NWUA 3RMMH 2R0LA 3FANA 1AFQC 3V7TA 1ELDE 4JZFH 4FU9A 2EC9H 2BOKA 3FP7E 4MPVA 1H9LB 2P8OC 1TMBH 3F9GA 1ZLRA 3B23B 5HM2A 4TY7A 1KXEA 1GJ4H 4FU8A 3Q3KA 3EE0B 1O2OA 1XUJA 1C5VA 1O3CA 5DP6A 1EUFA 1C1VH 5GDSH 3AW0A 2PKSC 1C1NA 2ZDAH 1MTNC 1GCTC 1AD8H 4MPWA 1VJ9U 1BBRE 1NRNH 1N6XA 1F7ZA 4K8YA 1ELVA 3RXCA 5EPYA 1WQSA 1O3AA 2RA0A 4BAQB 1XMNB 1Y3WA 5FHTA 4VGCC 2BQWB 4MDSA 3PLPA 4B2AA 3MNBA 1ELAA 1Z6EA 2BD5A 3UQVA 1O5FH 1SVPA 2ZDMA 1LO6A 3LDXH 2TGTA 4OS2A 4H6TA 4Y0YE 3ATWA 1C5TA 1O3FA 1S5SA 4FUJA 4PROA 2GMTC 1KTTB 4XBDA 3T2NA 3MOCA 1KTSB 2J92A 4Y71A 5FBIA 2CN0H 3SJKA 1GBBA 1PYTD 1AE5A 1DXPA 1MBQA 1P2OA 2GZ7A 4X2WA 1MUEB 1QIXB 1F0TA 4ABBA 3SGQE 1AB9C 1UHBA 4Y0ZE 3BG4C 1KXDA 1DE7H 5GPIB 3QK1A 2O8MA 1EASA 1PQ7A 5G4BA 2I6QA 1TOCB 4O9VA 4OS6A 2ZDKA 1D6WA 1JRTA 2TPIZ 1HV7A 2FOEA 1M9UA 3GCTG 4ABHA 1FY8E 1GPZA 1WQVH 4IN2A 1GI4A 3A7VA 3ZYEA 1O2PA 4YOIA 1KLIH 1TA6A 3MH5A 2XBXA 4MG3A 1S85A 1VZQH 3UNQA 2GV6A 2H9EH 3EQ0H 4K69A 2G00A 1G3DA 4TWYA 4D9QA 3SGBE 1P2JA 2O8UA 1HAVA 1KYNA 3GCTF 3P70B 4QT8C 2AGEX 1O38A 4YM9A 1HYLA 1FUJA 1QL7A 1O2LA 3GY4A 7GCHG 2FZZA 4NGAH 1Z8RA 1HAZB 1YLDA 2G5VA 4ZKRU 4ZAEA 2G52A 1D3PB 4X0WU 1UK3A 3QN7A 3RMOH 2BD2A 3M37A 1XUIA 4ZHAA 1W0ZU 4BANB 2A7CA 1O39A 1ZMLA 1ESAA 2O9QA 3RLWH 1P06A 1TGTA 1GI2A 1W7XH 4OS5A 1Y3UA 7GCHF 1J9CH 3A80A 2W5EA 1AY6H 1SGYE 3A8CA 1EZQA 1PQ5A 1Z1JA 2JH5D 2FO9A 3ZV9A 1U6QA 1ZGIA 2YNBA 1E34B 1E38B 4WXVA 2VINA 3OYPA 3UIRA 3MO6A 1A2CH 3E1XB 4NA9H 1GHVH 3ZZ9A 2C8XB 1A46H 4Y8ZA 1IQHA 2A5IA 1O3GA 2DE9A 1HAIH 3PMHB 1LHEH 4I8LA 3URDA 1BTXA 1ABIH 1C5WB 4TY6A 5FPTA 3P92A 1E36B 1K22H 4OS1A 1K21H 1C4V2 3SJ9A 2FMJA 1GI9B 2ODPA 2Z6BD 3KNXA 2QXHA 1UCYK 1O5DH 1W8BH 3VB4A 1VR1H 1DPOA 1NRQH 1SFIA 3A8DA 3SV7A 2TRMA 3SNDA 3VB3A 2P95A 3PROA 2V3OH 3DD2H 1LMWB 3V3MA 1D3TB 2D1JA 1UJ1A 2H2ZA 1E35B 1C2MA 1QTFA 2AH4X 1T4UH 2CHAB 1CGJE 1QRZA 5C1UA 1ZMJA 3BTHE 1XM1A 1BTUA 3OTJE 2UUFB 5JPMH 1L0ZA 2VIPA 1NM6A 4M7GA 1J17T 3TJVA 4TWWA 1H8IH 1C2KA 5T3HA 1ZSLA 4SGBE 1CGIE 1P12E 2C90B 2AEIH 1HNEE 1SGPE 2OTVA 8LPRA 2A5KA 3H5CB 1ANBA 3FP8E 1H9IE 1LHFH 2QF0A 4OGYA 1Y5UT 1G3EA 1RTKA 3UWIA 4INHA 2M5TA 3BN9A 4D76A 1D9IA 1O2RA 3SORA 1EP6A 1EPTC 2P3UB 2VJ1A 1LQDB 2ANWA 3ZZ8A 2W3IA 2PGBB 1CHOG 1G37A 2UUKB 1A1RA 1TQ0B 1JWTA 4Y76A 1TX8A 5LPEA 4MNXA 4YLQH 1QCPA 2Y5FA 4X8UH 4LZ4B 3M3SA 4DIIH 1YYY1 1AN1E 2G8TA 1SGRE 5L30H 4AFSA 3OSYA 4ISNA 2P16A 1AWHB 4K1EA 2AYWA 1P2QA 3ATMA 3RXGA 2ZFRH 3QDZB 1CHOF 4DURA 1NN6A 2F9VA 4NZQA 3R3GB 1OP8A 1C5MD 1C5ZB 5DP8A 1CA8B 1GBHA 3ODFA 2PFEA 4B71A 5F8TA 5C5OA 4GVUA 3S0NA 1P11E 2BX4A 2FTLE 1OP2A 1P2MA 1LHCH 2P93A 1GBTA 4YESB 1O2WA 4JZDH 5FPSA 1OS8A 5CE1A 1T8LA 4NIWA 2AGIX 2GCTC 2R2MB 3RXHA 2P59A 1O3KA 4ABDA 1AZZA 1GI7B 3A89A 1EOJA 2QXGA 1RJXB 4ZKSU 1ESTA 3OY5U 4UFEH 2ZF0H 2QCYA 4JK6A 2AMDA 3UOUA 2EA3A 2UUJB 4IC6A 1V2RT 1SGIB 1TIOA 5EPNA 1MZDA 1GBFA 2PSXA 2O8LA 1W12U 1LVYA 3I77A 3E16B 1UK4A 1QQUA 2FLBH 4FVBA 1CBWB 1BMAA 1TNGA 1TMTH 3DFLA 3BEIB 3GDVA 4IW4E 2IJOB 2W26A 4AOQA 1SL3A 3PMBB 1ESBA 3QGJA 1FZZA 2P94A 5K0HA 1SGNE 1A5GH 1XVMA 4XFQA 1O2QA 4FUDA 3H7TA 3LJJA 1GL0E 4AYYB 2EEKA 3F9FA 2FI5E 3EA9A 1HIAB 3KCGH 3AAUA 1LPKB 1HLTH 3LGTA 4XBBA 1K28D 2CMYA 1RGQA 1B5GH 1ELEE 1L1GA 3HKIB 4CREA 2C8YB 4MVNA 1MQ5A 3Q3YA 3STJA 4MPXA 1QJ1B 1DWDH 2ZTZA 1WUNH 2FESH 1Z6JH 4K3JA 2AFQB 1H8DH 5C1YA 2JH0D 4B2BA 1EATA 2FOBA 1TNHA 3MU5A 2R0KA 1NFXA 2GDDA 2GKVE 1UTOA 4O97A 1BTYA 1GI5A 1C2EA 3CP7A 3GICB 1IQFA 2HPPH 4X1SU 2PUXB 1GJAB 1WU1A 4NZLA 3ZZ5A 3B8JA 1PQAA 5DK1A 2ZFSA 2Y5HA 4CHAC 1ZTKA 5T6GA 1G3BA 5K7RA 7LPRA 4Y7AA 1K1LA 1O2IA 1QBOA 2VIQA 2W7UA 2OBQA 2QC2A 1C5SA 3GCOA 1N6YA 3GISB 4BAOB 5ETXA 3T26A 3GY2A 3RU4T 2WPHS 1TPOA 3AASA 2UUYA 1XUGA 2ZI2H 4Y10E 2OQ5A 1NFWA 1MAYA 3WY8A 2V6NA 2VH0A 5FX5A 1P03A 3MI4A 4UFDH 6CHAC 5IDKA 5JB9S 5EQRA 1SGCA 4CH8B 1O2UA 4FUCA 1C5UA 3CS0A 5LPFA 1UVUH 2ZGCA 1HB0B 6ESTA 3E3TA 5GCHG 2FOAA 3ZVFA 2G4UA 1K9OE 2JETB 1JBUH 2SFAA 4ABAA 2VWMA 1O3DA 1OX1A 1TQ7B 2RA3A 3EYDA 2BDBA 1MKXH 1WAYB 3SGAE 2ZHQH 4UE7H 1DOJA 1C1WH 1KY9A 2CGAA 1HXEH 2FI3E 3RU4D 3TGKE 2BY6X 2HNTC 3TK6A 1RIWB 3BF6H 1TPAE 3NZIA 2FOHA 4ZH8A 3VGCC 2QV1A 3KQDA 1DLEA 1S6HA 2OQUA 3BTDE 2ZCKP 3D49H 1GG6C 3EDXB 3OU0A 2GZ9A 1Q2WA 3Q76A 5FCKA 1XKAC 1AU8A 3MYWA 1EP5A 2BM2A 2BHGA 3M36A 5HXFA 1PPZA 3LGWA 2TGPZ 1EJMA 1ELBA 5HMAA 1AWFH 1DITH 1ETSH 5HGGA 1GHYH 1SR5C 1E0FD 1EXFA 2BY9X 3K6ZA 1BDAA 3KGPA 2ANKH 1G30B 3H7OA 1ZHMA 3SV9A 1C2IA 1PFXC 1AKSB 3RXUA 1DWCH 3BTFE 1MTVA 3A85A 1HAYB 3ZVGA 3ZYDA 4DW2U 2QYIA 2ZDVH 2A4RA 3OY6U 2ZQ1A 1YCPM 1ZJDA 2J34A 2PTNA 1FN8A 3R0FA 3TNSA 3LGUA 1H4WA 5FAHA 1KXCA 1V6DA 2F9UA 1TAWA 3ZZ3A 2C93B 5A0AE 2WPIS 3L6PA 4R8TB 1P3EA 2FEQH 4KKDA 1ZR0A 3M7QA 1FMGA 1RD3B 3A7YA 1QL8A 1FV9A 1VITH 4DVAU 1GGDC 3P8FA 3C27B 4WXIA 4AFZA 2P3TB 1O3MA 2AERH 1VGCC 2PKAB 1C1MA 1F0RA 4TYDA 1G32B 2FP7B 1TBRH 3M61U 4ABEA 3LIWA 4BAHB 1EZXC 1OPHB 2RDLA 4IS5A 5GIBA 1XX9A 4CRAA 1GHZA 1SLVB 1WV7H 4Y11E 1O2KA 1YPLH 2GT8A 1C9TA 1XUKA 1HRTH 2NU3E 1W14U 4DGJA 4A7IB 1MKWH 2Z94A 1J16A 2Y7XA 1F0SA 4DCDA 1O3NA 4JYTA 2Q6GA 1CQQA 3U8OH 2ODQA 3MWIU 5I25A 4XBCA 1FY4A 4I7YH 1YCPK 3BTWE 3RC5A 1O2GH 2F3CE 1SOZA 1YC0A 2F9PA 1EOLA 3PMAB 4ZKNU 1C1OA 1THPB 1GVLA 1ZYOA 2P8OB 1IHTH 1SGFG 1GJBB 2BQ7B 1EPTA 1ZTLA 2J9NA 3TVJB 1BBRK 1W13U 1EAXA 1ELTA 4X6OA 1K1IA 2AIQA 3A82A 1TRYA 2HGTH 5E2PA 1P3CA 2ZIQH 2VWLA 4ABJA 4Q80A 3SOSA 2PKSB 1GBAA 2PGQB 1CSOE 4UONA 3B9FH 1MTNB 1SI5H 1GCTB 5DP9A 2XW9A 3BTGE 1K1JA 5EG4A 2HRVA 4UFFH 1VCWA 2LPRA 4YO9A 2A31A 1X7AC 3K2UA 4LXBH 1TLDA 2KAIA 4AORA 3I78A 1V3XA 1EQ9A 4A1XA 3C1KA 3L3TA 2XC0A 3SHAH 3QWCH 3GCHC 1FN6A 5LPRA 1UTNA 4B74A 1LPZB 2NU4E 3P17H 3MNSA 1O35A 2GMTB 2GX4A 4D9RA 4INLA 3UWJH 1HUTH 3ZZBA 5DO4H 3PLBA 2ZECA 2BXTH 4IN1A 1Y5AT 3OX7U 2QA9E 1AB9B 2WPJS 3SO3A 3BG4B 1HAXB 3PO1C 2XCFA 1RS0A 1GCDA 1C5YB 3EA7A 3SUEA 5AFYH 3MU1A 2A1DB 1GI8B 1HXFH 4AG2A 4YLUA 1P02A 1DICA 1FDPA 3GOVB 1MCVA 5L6NH 4I8GA 1G2LA 3QTOH 5DP3A 3RMNH 2ODYB 2H6MA 1V2MT 1SQAA 2WV4A 4F49A 1A0HB 4GUXA 1C2FA 1PJPA 3SQHE 1BTPA 3MU0A 3PM3A 2G4TA 2Z7FE 2W7SA 1QB1A 3UNRA 2GZ8A 2F83A 3F9EA 5BRRE 2ZFTA 1C2JA 2TGAA 4A6LA 1C5XB 1OP0A 3PWCA 2A45B 4D7FA 4XSKU 2CV3A 2QXIA 1KLTA 2C8WB 1V2OT 4A1VA 1C2LA 2SGQE 4FUHA 2ILNA 2ZU4A 5HM9A 2BD7A 2PSYA 1NROH 1AI8H 1UCYH 4FUIA 4CBOA 1DUAA 1A7SA 2J94A 1T8NA 1ELGA 1TYNA 2TBSA 2Y6TA 4X1NU 5JBCS 2BLWA 1DANH 2UWLA 1KXFA 3GDUA 3U1JB 1A0JA 4O03A 3LGIA 1OYQA 3QTVH 3RXRA 3ZZDA 2HNTE 5A8YA 1O37A 1V2JT 1MU6B 1ORFA 3MH4A 2ALPA 2WUCA 1BRCE 1H9HE 5H4IB 2R3UA 1QBVH 2ZO3H 2GCHG 3E90B 4ABGA 3MU4A 3ZZCA 1WYKA 5IYTA 2HPQH 1LVMA 2FXRA 1W7GH 5B6OA 4HFPB 3S7HB 3F6UH 1S83A 3MHWU 4NFEA 1OWJA 1DWBH 3BIUH 1S84A 1UTQA 1VCQA 5EW2H 3RXSA 4BAMB 1W0YH 1NRSH 3EA8A 4H42U 3I29A 1IQGA 2ZQ2A 2BDAA 2Q6DA 1B0EA 1L1NA 1NS3A 1QJ7B 4DY7B 1P9SA 2GCHF 2H5DA 1O2MA 3M3TA 1LVOA 1DDJA 2OXSA 4ZXYH 1OWDA 1G2MA 1P05A 5DP4A 5A0CA 4KTSA 1OWIA 2XC4A 5C1XA 4Q7ZA 4AZ2B 1NRPH 3SJ8A 3HK6B 4IGDA 5JBBS 3T62A 1GI1A 2AGGX 3UOPA 1PPGE 4ESTE 2EI7A 2XBVA 3SZNA 3LJOA 1QQ4A 2Z9IA 1OSSA 3GYMA 1N8OC 4YOGA 2A4GA 1C1PA 1BUIA 3D65E 1GVKB 3SN8A 2VGCB 1HJ9A 3V12A 2BY5X 1IHSH 1SQOA 2BTCE 2V3HH 3FVFB 2VH6A 3RDZA 4K60A 1A61H 1LTOA 4U32A 2OC1A 3SNAA 5LH8A 4FUBA 1D3QB 3BTME 2VVCA 8ESTE 1T7CA 3MTYA 5FBEA 2NU1E 4DG4A 5AVDA 1BIOA 4UFGH 4LK4A 1Y59T 1E37B 2ZU3A 3S7KB 4A92A 1C1TA 3A86A 4Y8XA 3A8AA 1JRSA 1F2SE 2BLVA 1FY1A 1WTGH 3RXQA 2OINA 5HYOA 1QL9A 1O2VA 4NFFA 2V35A 4F4OC 4FVDA 4ZHMU 2BVXH 4D7GA 2VU8E 2B0FA 4Y8YA 1V2NT 1T8OA 4GPGA 2CHAC 3DHKH 1YF4A 4JZEH 1MBMA 3KHVA
chains in the Genus database with same CATH superfamily
2V0BA 2Y7ZA 5F53A 3RXPA 3OFND 2AMQA 2SGDE 2Z9GA 3E6PH 3IWMA 1TGSZ 1FIZA 4NIYA 2P3FH 4K8BA 1LKAA 1FPHH 4GHQA 5JBTA 3N7OA 2WPLS 4CRGA 3ZZ7A 3A7TA 1P57B 1NY22 1CO7E 5T6DA 4NSVA 4NA7A 3A7WA 5TCCA 3NXPA 5A8XA 1BHXB 1IQMA 1S6FA 1UTMA 4CRFA 1H1BA 5FX6A 5TJXA 1NFUA 1A3EH 3SU3A 1QNJA 4Y79A 3VB7A 2QN5T 2ANMH 1JOUB 3M7TA 1GBKA 1KXBA 3O8BA 1YP9A 3A8BA 1MQ6A 2J95A 3RM2H 1NFYA 2WV9A 1ZSKA 4WMDA 1GHAG 1HJAC 3BTQE 1KSNA 4K1TA 4AX9H 2VIDA 3DA9B 3BV9B 1V2UT 5ESBA 1EJAA 3F2GA 2WYGA 3T29A 4KGAA 3UQOA 3MQKC 3LU9B 2ZWLH 3BEUA 3O8CA 3U69H 1IQLA 3SV6A 3FFGA 3O8DA 4X2VA 1UMAH 1BOQA 1FIWA 1UHBB 2ZFFH 3WWFA 3SUDA 1O2SA 1P0SH 1UTKA 1QB6A 2A5AA 4BXSA 1FI8A 1GHAF 4ZROA 1GJDB 1QB9A 3RXTA 2VB0A 3E8LA 1KDQA 4WMFA 5BPEA 2RDEA 4WY3A 3MO3A 2BD9A 2PTCE 3RXOA 1CVWH 3HGPA 1SLWB 1W10U 2BDHA 1SQTA 2WHXA 2W6ID 1ZRBA 1O5AB 1OHHD 4ZUHA 3LPRA 4JZ1A 2I6SA 3RXBA 3KL6A 5EIYA 4JZIA 3SU4A 1BHXF 1O5CB 1DLKB 2A0QB 1C2GA 2XRCA 1FY5A 5J4SA 1GJ5H 1VCPA 2GD4B 4NA8A 1MD7A 1HAVB 2NWNA 1O2NA 1QFKH 5EGMA 4RKOB 3U28C 2XWBI 4X2XA 1ZZZA 1OWKA 3S9BA 3KQ5A 2BLOA 3SJIA 1BJUA 2O8WA 2C4FH 1ZHRA 4GCHG 3TJUA 2KZ4A 3CS7A 2A7HA 1YBWA 4KP0A 1HAPH 1SB1H 1O2HA 1TPPA 5CHAC 1T31A 2A4OA 2BVSH 1C1QA 4P02A 1O33A 1TRNA 1O0DH 5GNDA 3BSQA 1PYTC 2FOCA 2FTMA 5AF9H 1JMOH 2OK5A 1DSUA 4GCHF 2VIWA 1GDNA 2OC7A 3T28A 1C5NH 1XXDA 2OBOA 2ZPSA 3LC3A 3WW7A 2FYQA 3M35A 3VB6A 4X1PU 1CGHA 1KLJH 2XWAA 4AN7A 1YPJH 2XYAA 3TH3H 3BTTE 4UD9H 3VXFH 2VIVA 6LPRA 4JK5A 3L33A 2HALA 3RXLA 2RFKC 3BG8A 1Q3XA 3FZDA 2H5CA 3ELAH 3CNRA 2ZEBA 1T8MA 3A7XA 1MD8A 2BDGA 3A88A 3SU0A 1BA8B 1DUEA 1DX5M 2OC8A 1THSH 1GJCB 2XCNA 1BMNH 3SUGA 3A81A 3DCLA 3ATLA 5F03A 4B6EA 1L1JA 1Z1IA 4J1YA 2GGVB 1YPMH 2ZGHA 1JXPA 4O3UA 4WF8A 5SGAE 4KELA 4TPYA 1O3JA 5JYIA 1Z8GA 1NTPA 2ZPQA 3U8TH 1E79D 1NPMA 5A0BA 2PWXA 3LH3A 2GVFA 1HGTH 1GG6B 1TRMA 4NSYA 1C4U2 2K0QA 1UTJA 1YPEH 1BITA 5GCHF 3D23A 3ZVBA 2YMSB 3UB0A 1PPHE 1SPJA 1TE0A 4WJG2 3P8NA 1O3HA 2ZG0H 2Z3CA 1LQEA 4XD7D 3RXFA 2XNIA 2ZKSA 3M5LA 2PHBA 3ESTA 2J4IA 3TGJE 2ZDNA 1LDTT 1WSSH 1ZJKA 2ZTYA 4CRBA 1W11U 2FX6A 5CDFE 3GY6A 4ISHH 3M5OA 2Z9LA 1TBZH 2ULLA 1QJ6B 2Y81A 1IQJA 2XTTB 1EB1H 1ANCA 1C1RA 1O2JA 2ZFQH 1GBMA 1QBNA 4Y7BA 5E0JA 1GBCA 3STIA 1YCPH 1V2TT 2Y5GA 1S81A 8KME2 4AYVB 1SGEE 4A1TA 1GBJA 1EFRD 5DP5A 1MMJN 5LGOA 3KF2A 1HPGA 1K1MA 2FLRH 1PPEE 3SBKA 3IG6B 1B7XB 3DFJA 2FPZA 1BBRH 3PV4A 3T5FH 4IBLH 3OTPA 1OXGA 1ZHPA 5C20A 2HNTF 5EXMA 4B76A 1EAWA 1FLEE 1GGDB 1Y5BT 3RXMA 1O3PB 2Z9KA 3NRLA 4B75A 4BOHA 4AG1A 1AQ7A 2BYAX 4ZCNA 1P09A 1VGCB 1DY9A 3BIVH 1W0KD 1BCUH 3PWBA 1L4DA 5E2OA 3E0NB 5EXNA 1ETTH 1KIGH 4DT7B 1AVXA 1QA0A 1NU7B 1GMHG 7ESTE 4CR5A 3PYHA 1N1LA 2VIOA 5DKMA 1C2HA 4P00A 2SGEE 3SU5A 3SU2A 2BDIA 1BTWA 1VJAU 1EZSC 1EKBB 1MTWA 4WWYA 4I8JA 4OM9A 1TNKA 2SGAA 1CA0C 1MKXK 3LGVA 1FQ3A 2KCAA 3MNXA 5HIYA 3TITA 3F0OA 1GMHF 3M3VA 1AIXH 2ZHWH 1V2ST 3HKJB 1K2I1 1QY6A 1IQKA 2FS8A 4U01A 2LNCA 1XUHA 1OWEA 1TNJA 4Q2KA 5HKKD 3RM0H 1PPCE 4I31A 3ZZAA 3EE7A 5CMXH 4BTTB 2YOLA 1GWAA 2RCEA 1ANEA 1RRKA 4ISOA 1AFQB 1MABB 3K6YA 4YOJA 4YT7H 3FP6E 1MTUA 1AVGH 5E8EH 3V0XA 1TX7A 2H9TH 4NIXA 1HCGA 2FM2A 1ZPZA 3TGIE 1BQYA 1TALA 5JDUB 2ZFPH 1INCA 1GBLA 4Q63A 5TCAA 2LELA 5DPAA 1PPBH 2EQNA 2UWPA 4E7RG 3NCLA 3TH2H 3TPIZ 2B9LA 1C1SA 2WUBA 1WTHD 3TK5A 4GLYA 3GCHB 4BAKB 1O2YA 1NO9H 3TU7H 1V2VT 1DSTA 2ASUB 1GI3A 1V2LT 3RC6A 1SFQB 2QXJA 2BD4A 3LONA 5ABWA 2BB4A 1AFEH 2W6JD 1NBME 1J15A 2BY8X 3GDSA 3HGNA 2XOKD 2QIQA 3VB5A 2ANYA 4VGCB 1P9UA 3IITA 4UEHH 1GJ6A 5EJ1A 1UVSH 4Q7XA 2ZU1A 4KTUA 1GDQA 5F8ZA 1SOTA 2GT7A 2ZPRA 1GBDA 4X8VH 5HIZA 3U1IB 1HAOH 1OKXA 3RXJA 4K1SA 1SHYA 1ARCA 1IOEA 1Z8IB 1FAXA 1TNLA 3GY8A 1NBMD 3PO1B 4AGJA 2CF8H 5EJZA 3T25A 1EZUC 2JJ1D 1BMMH 1GHWH 2QGRA 4IC5A 1V2PT 3ITIA 1MH0A 4ASUD 2JH6D 3VFEA 2XBYA 3QX5H 4XDEA 3MU8A 1AUJA 5C67A 1T4VH 2FS9A 3DSOA 3RXDA 1MKWK 1UVTH 4NIVA 4B1TA 1H8HD 3SV8A 5CHBA 1A5HA 3U9AH 4Q4LA 2V7QD 1IAUA 3RXAA 1G36A 1JIMA 4OS4A 5DG6A 5EJLA 2ZP0H 1S0QA 2KFWA 1GHBG 1HAGE 5L2ZH 2GDEH 1XXFA 3ATIA 1TGBA 5EU8A 2CF9H 3TJNA 4X1QU 1O2TA 3JZ2B 5I46H 3ZVAA 2BZAA 1K1PA 2ZHDA 3PMJA 1JIRA 4MTBA 3V13A 5C0TA 3VXEH 1OWHA 2ZGBH 4ABIA 1SG8B 3M5MA 1EAUA 1O3LA 3ODDA 4AFUA 1GHBF 2PR3A 3SUFA 5A09A 4ISLA 1P8VC 1UTPA 2CXVA 3M5NA 4FU7A 3HPTB 1YY3A 1TOMH 3MFJA 2QF4A 1HJ8A 1SLXB 3SHCH 4GSOA 3MH7A 1A0LA 2ZGJA 3W95A 3QZRA 1IQIA 5E0GA 3UREA 2ZNKH 3TH4H 3SW2B 3JZ1B 1SGDE 5T6FA 1KXAA 3BEFB 1GJ9B 1HIAA 1TGNA 1CT0E 3K65B 1TWXB 3RXVA 4DOQA 1O34A 3LOXA 1GMDG 2TGDA 4JYVH 3ZVEA 1YPHC 4BXWA 1QURH 1AVWA 3MMGA 3FKSD 3ZVDA 4NWLA 1BTHH 3FAOA 3HATH 2DUCA 4SGAE 1CHGA 1BT7A 4TPIZ 4ISIH 5EW1H 8GCHG 4OGXA 1L2EA 2Y80A 1YM0A 1K1OA 4X6PA 2STBE 2HLCA 9LPRA 4HGCA 1ZPCA 3AVZA 4IMZA 1GMDF 1BB0B 1S0RA 2D26C 2GTBA 3MO9A 1YPGH 2WPKS 3SNBA 1N8OB 3RMLH 1GDUA 4E7NA 4J2YB 3UPEA 3TK9A 8GCHF 1Z7KA 1EB2A 1ZMNA 4ACBA 3GY3A 3KEEA 5GXPA 1WOFA 2FOFA 1SHHB 4XRNA 3SU6A 5C5NA 1GMCG 3PLKA 2Q6FA 1MTSA 2H1UA 4WH8A 1THRH 1C1UH 1GBIA 2J98A 2BLQA 2B5TB 4YZUA 1ZTJA 1FAKH 1NRRH 3HK3B 1L4ZA 1XVOA 1AE8H 4ASHA 1O5EH 2BOHB 1C5PA 1QGFA 2FYRA 1TPSA 4Z6AH 4JYUH 1GJ8B 1GMCF 2A32A 2AS9A 2IPHA 1J14A 2UWOA 3A83A 1LCYA 5AHGH 1ABJH 4RKJB 3F68H 2VNTA 3S69A 1AGJA 2HWLB 2OP9A 1YPKH 4X6NA 2TIOA 4K2YA 4DJZB 1HAHH 4AGKA 1LHGH 3RLYH 1SMFE 6GCHG 1C4Y2 1Z71A 1C2DA 4B2CA 1FONA 1EPTB 3SI3H 1G9IE 4NWKA 4Y6DA 3KQBA 4UDWH 5A2MH 1LPGB 5GWZA 3FOAA 3FN8A 1EAIA 4RN6A 1C5QA 4E06H 3SI4H 3U98H 3AAVA 2VGCC 2OUAA 3PTNA 3LT3A 1QZ8A 1ELFA 2F9BH 1FPCH 1SSXA 2SNVA 4MQAA 1MZAA 1GJ7B 3OAAD 3LH1A 4E05H 1W3CA 1O36A 1UCYE 6GCHF 5FPYA 2PV9B 3VPKA 1LKBA 2QY0B 1W0JD 2A2XH 2PW8H 1FNIA 2KAIB 4MPUA 4CH2B 3KQEA 1SGQE 1D6RA 2QAAA 4R0IA 1TX6A 2O8TA 2G81E 4AC9A 3GYLB 3FZZA 1AKSA 1A5IA 3TJOA 2F9NA 2SNWA 3P8OA 1DT2A 3LGYA 5KGOA 1HJAB 4RSPA 5PTPA 4FUGA 1MU8B 1ZOMA 3RXKA 1TGCA 3TLOA 4MNWA 2FOMB 4DIHH 2GCTB 1CU1A 1O2XA 3ZV8A 4AFQA 3EAJA 4WMEA 2JKHA 1BJVA 3S9AA 2FDAA 2ZCLP 3MNCA 1TNIA 1BMLA 2XXLA 1F5RA 2AIPA 2H9HA 3QGNB 4Q7YA 5DP7A 1HBTH 1O3IA 2C3SA 5C2ZA 1O2ZA 2FI4E 2FWWA 3K9XB 1DXWA 3RP2A 2EI8A 2XC5A 2W3KA 4IMQA 2FOGA 2ZTXA 5ESTE 4THNH 1SGFA 3SV2H 2PKAA 1TABE 3W94A 4M9FA 1OYTH 2Z3EA 1NESE 1Y3YA 4JCNA 5EOKA 1P01A 2BY7X 3SU1A 1UK2A 2BMGB 3N7EA 1EX3A 5DN6D 1O5GH 2J38A 1XUFA 3ZZ6A 4ABFA 2A2QH 1PQ8A 2BD3A 4NCYA 1LVBA 1QR3E 7KMEH 1SC8U 1G3CA 2FX4A 2ZA5A 3QO6A 1AZ8A 4GHTA 1ZRKA 4A5TS 2D2DA 5JBAS 2K1QA 3BTEE 1FJSA 2CK3D 4X1RU 1ZPBA 4I8KA 3S9CA 5A8ZA 1O30A 2DE8A 2ZCHP 2PLXA 1O31A 5EQQA 4HTCH 3RC4A 1D3DB 3SJOA 3UR6A 2Y82A 3KIDU 1QHRB 4LOYH 5EQSA 3KN2A 3SNEA 1F5LA 4D8NA 1GL1A 4X2YA 3GY5A 1UO6A 5CHAB 1YGCH 1A4WH 2OD3B 1YKTA 1F0UA 3U8RH 4CHAB 1AHTH 4ZXXH 1P2IA 5DGJA 5F8XA 2SGFE 2IN2A 2EY4C 2G51A 1ZGVA 3GY7A 3LKWA 2AMPA 3EGKH 1OOKB 2IOTA 1P2NA 3T27A 4FUEA 2ESTE 1SLUB 1CBWC 1TMUH 3DUXH 1C9PA 3MH6A 2XBWA 1AO5A 3BTKE 5FXLA 2ZHEH 9ESTA 3VEQB 1O3BA 1O32A 2ZZUH 3P6ZB 5F6MA 4FUFA 3F9HA 6CHAB 1RXPA 2B7DH 1K1NA 2VWOA 2Z9JA 5L2YH 2RG3A 3CENA 4BTUB 1NC6A 4U2WA 2THFB 2BDCA 1YPHE 2VWNA 4K5ZA 3QUMP 4CRDA 2GV7A 1TONA 1DS2E 1ARBA 1O3OA 1V2QT 1O3EA 2QF5A 1GVZA 1NT1A 3P95A 4XE4A 3RUOA 2L74A 1NU9A 5C3NA 2WV5A 1BRAA 1BZXE 4O3TA 1H8ED 1O5BB 1VITG 1RFNA 1IQNA 2CJIA 2F9OA 1UVOA 1ANDA 2J2UA 3UFAA 4CRCA 4DT4A 1S82A 2ZDLA 2HVXA 1ELCA 3AW1A 1XKBC 3VGCB 3P8GA 4NG9H 3RXIA 1DWEH 4ZKOU 2BZ6H 5E0HA 1V2WT 1TB6H 3ZVCA 2Z3DA 4WH6A 5DJ7A 1EJNA 2B8OH 5J4QA 3RU4E 1VITF 1QA7A 4BNRA 3DSPA 1F92A 2ZHFH 5JB8S 1A3BH 4I86A 3SYJA 4XOJA 3UR9A 4CR9A 1ZSJA 2BDYA 3PB1E 3O8RA 3Q77A 4ZMAH 3OE7D 2ZC9H 1T32A 3KYGA 2JETC 4ZHLU 2F43B 4X8SH 3NK8A 1P10A 3NUMA 1Y3XA 3D62A 2R9PA 4I32A 1D4PB 3TIUA 4Z1MD 4H6SB 3A84A 2A7JA 1TA2A 2OCVB 2BQ6B 4B6FA 1PPFE 3SQEE 4AB9A 2V3MA 1SGTA 2BVRH 1LHDH 1HDTH 4YTAA 3UUZA 1C5LH 1AUTC 2D8WA 3N7DA 5AFZH 3KQCA 2VVUA 2YMSC 1RIWC 1MCTA 2G55A 4JMYA 4Z0KA 1P04A 1Y8TA 2NU0E 1CT4E 3Q00A 3URCA 3RXEA 1Y3VA 1HFDA 2BD8A 2BXUH 2GP9B 4OS7A 2F91A 4I8HA 1B0FA 1V2KT 2FODA 5EODA 1C5RA 2PP6A 1YLCA 3QZQA 2F4LA 2ZU5A 2ZGXH 1CA0B 2BX3A 4X6MA 1WBGB 3A87A 1UTLM 4I33A 1ETRH 3ENSB 1GI0A 3UTUH 2FIRH 3NPSA 1BRBE 4YT6H 1J8AA 3F3BA 4HG6A 2YNAA 1C5OH 4BTIB 2PUQH 4MNYA 1P2KA 3ZZ4A 1W2KH 3Q3XA 1QRXA 2G5NA 1GHXH 3G01A 2WYJA 1BRUP 2EI6A 3E91A 2OC0A 4FXGH 5EXLA 2QF3A 2VVVA 1TBQH 2R3YA 3M7UA 4FOUC 1GBEA 4MLFB 1Z8JB 1FY3A 2ZU2A 3LC5A 3F0PA 2C8ZB 1CE5A 4GAWA 2QE7D 2KCPA 3SNCA 2WINI 5IK2D 4MNVA 4CBNA 1QRWA 2WPMS 2OLGA 4HZHA 3UNSA 1KDQB 4B73A 1SBWA 1CT2E 1F5KU 4LZ1H 3QLPH 4KTCA 1FXYA 1IQEA 2HOBA 2R2WU 1RTLA 2Q1JA 3NKKA 2NU2E 1BTZA 3A7ZA 4AB8A 4HI3A 1ID5H 2STAE 3F2FA 3GCNA 1UVPA 4U30A 1MAXA 4H4FA 1ACBE 1DM4B 1GI6A 3PTBA 3TNTA 2A4QA 3F1SB 4INKA 1DY8A 4X8TH 1AMHA 5FCRA 1NZQH 1DVAH 2ALVA 1DFPA 1RTFB 1TFXA 3DT0H 1Q31A 2SGPE 4WVPE 3ATKA 5GJ4B 3UY9A 1WCZA 3E0PB 3NWUA 3RMMH 2R0LA 3FANA 1AFQC 2JDID 3V7TA 1ELDE 4JZFH 4FU9A 2EC9H 2BOKA 3FP7E 4MPVA 1H9LB 2P8OC 1TMBH 3F9GA 5B6LA 1ZLRA 3B23B 5HM2A 1UW7A 4TY7A 1KXEA 3KYFA 1GJ4H 4FU8A 3Q3KA 3EE0B 1O2OA 1XUJA 1C5VA 1O3CA 5DP6A 1EUFA 1C1VH 5GDSH 3AW0A 2PKSC 1C1NA 2ZDAH 1MTNC 1GCTC 1AD8H 4MPWA 1VJ9U 1BBRE 1NRNH 5KECA 1N6XA 1F7ZA 4K8YA 1ELVA 3RXCA 5EPYA 1WQSA 1O3AA 2RA0A 4BAQB 1XMNB 1Y3WA 5FHTA 4VGCC 2BQWB 4MDSA 3PLPA 4B2AA 3MNBA 1ELAA 1Z6EA 2BD5A 3F2HA 3UQVA 1O5FH 1SVPA 2ZDMA 1LO6A 3LDXH 2TGTA 4OS2A 4H6TA 4Y0YE 3ATWA 1C5TA 1O3FA 1S5SA 4FUJA 4PROA 2GMTC 1KTTB 4XBDA 3T2NA 3MOCA 1KTSB 2J92A 2KR7A 4Y71A 5FBIA 2CN0H 3SJKA 1GBBA 1PYTD 1AE5A 1DXPA 1MBQA 1P2OA 2GZ7A 4X2WA 3H09A 1MUEB 1QIXB 1F0TA 2J97A 4ABBA 2GJGA 3SGQE 1AB9C 1UHBA 4Y0ZE 3BG4C 1KXDA 1DE7H 2JJ2D 5GPIB 3QK1A 2O8MA 1EASA 1PQ7A 5G4BA 2I6QA 1TOCB 4O9VA 4OS6A 2ZDKA 1D6WA 1JRTA 2TPIZ 1HV7A 2FOEA 1M9UA 3GCTG 4ABHA 1FY8E 1GPZA 1WQVH 4IN2A 1GI4A 3A7VA 3ZYEA 1O2PA 4YOIA 1KLIH 1TA6A 3MH5A 2XBXA 4FETA 4MG3A 1S85A 1VZQH 3GS9A 3UNQA 2GV6A 2H9EH 3EQ0H 2AHME 4K69A 2G00A 1G3DA 4TWYA 4D9QA 3SGBE 1P2JA 2O8UA 1HAVA 1KYNA 3GCTF 3P70B 4QT8C 2AGEX 1O38A 4YM9A 1HYLA 1FUJA 1QL7A 1O2LA 3GY4A 7GCHG 2FZZA 4NGAH 1Z8RA 1HAZB 1YLDA 2G5VA 4ZKRU 4ZAEA 2G52A 1D3PB 4X0WU 1UK3A 3QN7A 3RMOH 2BD2A 3M37A 1XUIA 4ZHAA 1W0ZU 4BANB 2A7CA 1O39A 1ZMLA 1ESAA 2O9QA 3RLWH 1P06A 1TGTA 1GI2A 1W7XH 4OS5A 1Y3UA 7GCHF 1J9CH 3A80A 2W5EA 1AY6H 1SGYE 3A8CA 1EZQA 1PQ5A 1Z1JA 2JH5D 2FO9A 3ZV9A 1U6QA 1ZGIA 2YNBA 1E34B 1E38B 4WXVA 1E1QD 2VINA 3OYPA 3UIRA 3MO6A 2XNDD 1A2CH 3E1XB 4NA9H 1GHVH 3ZZ9A 2C8XB 1A46H 4Y8ZA 1IQHA 2A5IA 1O3GA 2DE9A 1HAIH 3PMHB 1LHEH 4I8LA 3URDA 1BTXA 1ABIH 1C5WB 4TY6A 5FPTA 3P92A 1E36B 1K22H 4OS1A 1K21H 1C4V2 3SJ9A 2FMJA 1GI9B 5T1VA 2ODPA 2Z6BD 3KNXA 2QXHA 1UCYK 1O5DH 1W8BH 3VB4A 1VR1H 1DPOA 1NRQH 1SFIA 3A8DA 3SV7A 2TRMA 3SNDA 3VB3A 2P95A 3PROA 2V3OH 3DD2H 1LMWB 3V3MA 1D3TB 2D1JA 1UJ1A 2H2ZA 1E35B 1FX0B 1C2MA 1QTFA 2AH4X 1T4UH 4RT0A 2CHAB 1CGJE 1QRZA 2HVYB 5C1UA 1ZMJA 3BTHE 1XM1A 1BTUA 3OTJE 2UUFB 5JPMH 1E1RD 1L0ZA 2VIPA 1NM6A 4M7GA 1J17T 3TJVA 4TWWA 1H8IH 1C2KA 5T3HA 1ZSLA 4SGBE 1CGIE 1P12E 2C90B 2AEIH 1HNEE 1SGPE 2OTVA 8LPRA 2A5KA 3H5CB 1ANBA 3FP8E 1H9IE 1LHFH 2QF0A 4OGYA 1Y5UT 1G3EA 1RTKA 3UWIA 4INHA 2M5TA 3BN9A 4D76A 1D9IA 1O2RA 3SORA 1EP6A 1EPTC 2P3UB 2VJ1A 1LQDB 2ANWA 3ZZ8A 2W3IA 2PGBB 3PV2A 1CHOG 1G37A 2UUKB 1A1RA 1TQ0B 1JWTA 4Y76A 1TX8A 5LPEA 4MNXA 4YLQH 1QCPA 2Y5FA 4X8UH 4LZ4B 3M3SA 4DIIH 1YYY1 1AN1E 2G8TA 1SGRE 5L30H 4AFSA 3OSYA 4ISNA 2P16A 1AWHB 4K1EA 2AYWA 1P2QA 2IJD1 3ATMA 3RXGA 2ZFRH 3QDZB 1CHOF 4DURA 1NN6A 2F9VA 4NZQA 3N99A 3R3GB 1OP8A 1C5MD 1C5ZB 5DP8A 1CA8B 1GBHA 3ODFA 2PFEA 4B71A 5F8TA 5C5OA 4GVUA 3S0NA 1P11E 2BX4A 2FTLE 3AK5A 1OP2A 1P2MA 1LHCH 2P93A 1GBTA 4YESB 1O2WA 4JZDH 5FPSA 1OS8A 5CE1A 1T8LA 4NIWA 2AGIX 2GCTC 2R2MB 3RXHA 2P59A 2WSSD 1O3KA 4ABDA 1AZZA 1GI7B 3A89A 1EOJA 2QXGA 1RJXB 4ZKSU 1ESTA 3OY5U 4UFEH 2ZF0H 2QCYA 3PRDA 4JK6A 2AMDA 3UOUA 2EA3A 2UUJB 4IC6A 1V2RT 1SGIB 1TIOA 5EPNA 1MZDA 1GBFA 2PSXA 2O8LA 1W12U 1LVYA 3I77A 3E16B 1UK4A 1QQUA 2FLBH 3WWBA 4FVBA 1CBWB 1BMAA 1TNGA 1TMTH 3DFLA 3BEIB 3GDVA 4IW4E 2IJOB 2W26A 4AOQA 1SL3A 3PMBB 1ESBA 3QGJA 1FZZA 2P94A 5K0HA 1SGNE 1A5GH 1XVMA 4XFQA 1O2QA 4FUDA 3H7TA 3FO8D 1GL0E 3LJJA 3PV5A 4AYYB 2EEKA 3F9FA 2FI5E 3EA9A 1HIAB 3KCGH 3AAUA 1LPKB 1HLTH 3LGTA 4XBBA 1K28D 2CMYA 1RGQA 1B5GH 1ELEE 1L1GA 3HKIB 4CREA 2C8YB 4MVNA 1MQ5A 3Q3YA 3STJA 4MPXA 1QJ1B 1DWDH 2ZTZA 2L6OA 1WUNH 2FESH 1Z6JH 4K3JA 2AFQB 1H8DH 5C1YA 2JH0D 4B2BA 1EATA 2FOBA 1TNHA 3MU5A 2R0KA 1NFXA 2GDDA 2GKVE 1UTOA 4O97A 1BTYA 1GI5A 1C2EA 3CP7A 3GICB 1IQFA 2HPPH 4X1SU 2PUXB 1GJAB 1WU1A 4NZLA 3ZZ5A 3B8JA 1PQAA 5DK1A 2ZFSA 2Y5HA 4CHAC 1ZTKA 5T6GA 1G3BA 5K7RA 7LPRA 4ACAA 4Y7AA 1K1LA 1O2IA 1QBOA 2VIQA 2W7UA 2OBQA 2QC2A 1C5SA 3GCOA 1N6YA 3GISB 4BAOB 5ETXA 3T26A 3GY2A 3RU4T 2WPHS 1TPOA 3AASA 2UUYA 1XUGA 2ZI2H 4Y10E 2OQ5A 1NFWA 1MAYA 3WY8A 2V6NA 2VH0A 5FX5A 2J98B 1P03A 3MI4A 4UFDH 6CHAC 5IDKA 1VKYA 5EQRA 5JB9S 1SGCA 4CH8B 1O2UA 4FUCA 1C5UA 3CS0A 5LPFA 5FL7D 1UVUH 2ZGCA 1HB0B 6ESTA 3E3TA 3OEED 5GCHG 1WDIA 2FOAA 3ZVFA 2JIZD 2G4UA 1K9OE 2JETB 1JBUH 2KM0A 2SFAA 4ABAA 2VWMA 1O3DA 1OX1A 1TQ7B 2RA3A 1SKYE 3EYDA 2BDBA 1MKXH 1WAYB 3SGAE 2ZHQH 4UE7H 2IPQX 1DOJA 1C1WH 1KY9A 2CGAA 1HXEH 2FI3E 3RU4D 3TGKE 2BY6X 2HNTC 3TK6A 1RIWB 3BF6H 1TPAE 3NZIA 2FOHA 4ZH8A 3VGCC 2QV1A 3KQDA 1DLEA 1S6HA 2OQUA 3BTDE 2ZCKP 3D49H 1GG6C 3EDXB 3OU0A 2GZ9A 1Q2WA 3Q76A 5FCKA 1XKAC 1AU8A 3MYWA 4F55A 1EP5A 2BM2A 2BHGA 3M36A 5HXFA 1PPZA 3LGWA 2TGPZ 1EJMA 1ELBA 5HMAA 1AWFH 1DITH 1ETSH 5HGGA 1GHYH 1SR5C 1E0FD 1EXFA 2BY9X 3K6ZA 1BDAA 3KGPA 2ANKH 1G30B 3H7OA 1ZHMA 3SV9A 1C2IA 1PFXC 2KCYA 1AKSB 3RXUA 1DWCH 3BTFE 1MTVA 3A85A 1HAYB 3ZVGA 3ZYDA 4DW2U 2QYIA 2ZDVH 2A4RA 3OY6U 3W1EA 2ZQ1A 1YCPM 1ZJDA 2J34A 2PTNA 1FN8A 3R0FA 3TNSA 3LGUA 1H4WA 2HLDD 5FAHA 1KXCA 1V6DA 2F9UA 3DSGA 1TAWA 3ZZ3A 2C93B 5A0AE 2WPIS 3L6PA 4R8TB 1P3EA 2FEQH 4KKDA 1ZR0A 3M7QA 1FMGA 1RD3B 3A7YA 1QL8A 1FV9A 1VITH 4DVAU 1GGDC 3P8FA 3C27B 4WXIA 4AFZA 2P3TB 1O3MA 2AERH 1VGCC 2PKAB 1C1MA 1F0RA 4TYDA 1G32B 2FP7B 1TBRH 3M61U 4ABEA 3LIWA 4BAHB 1EZXC 1OPHB 2RDLA 4IS5A 5GIBA 1XX9A 4CRAA 1GHZA 3VG8A 1SLVB 1WV7H 4Y11E 1O2KA 1YPLH 2GT8A 1C9TA 1XUKA 1HRTH 2NU3E 1W14U 4DGJA 1YLNA 4A7IB 1MKWH 2Z94A 1J16A 2Y7XA 1F0SA 4DCDA 1O3NA 4JYTA 2Q6GA 2M2AA 1CQQA 3U8OH 2ODQA 3MWIU 5I25A 4XBCA 1FY4A 4I7YH 1YCPK 3BTWE 3RC5A 1O2GH 2F3CE 1SOZA 1YC0A 2F9PA 1EOLA 3PMAB 4ZKNU 2LP6A 1C1OA 1THPB 1GVLA 1ZYOA 2P8OB 1IHTH 1SGFG 1GJBB 2BQ7B 1EPTA 1ZTLA 2J9NA 3TVJB 1BBRK 1W13U 1EAXA 1ELTA 4X6OA 1K1IA 2AIQA 3A82A 2WZQA 1TRYA 2HGTH 5E2PA 1P3CA 2ZIQH 2VWLA 4ABJA 4Q80A 3SOSA 2PKSB 1GBAA 2PGQB 1CSOE 4UONA 2VBCA 3B9FH 1MTNB 1SI5H 1GCTB 5DP9A 2XW9A 3BTGE 1K1JA 5EG4A 2HRVA 4UFFH 1VCWA 2LPRA 4YO9A 2A31A 1X7AC 3K2UA 4LXBH 1TLDA 2KAIA 4AORA 3I78A 1V3XA 1EQ9A 4A1XA 3C1KA 3L3TA 2XC0A 3SHAH 3QWCH 1SQRA 3GCHC 1WXRA 1FN6A 5C94A 5LPRA 1UTNA 4B74A 4RT1A 1LPZB 2NU4E 3P17H 3MNSA 1O35A 4TSFD 2GMTB 2WPDD 2GX4A 4D9RA 3OEHD 4INLA 3UWJH 1HUTH 3ZZBA 5DO4H 3PLBA 2ZECA 2BXTH 4IN1A 1Y5AT 3OX7U 5C0UA 2QA9E 1AB9B 2WPJS 3SO3A 3BG4B 1HAXB 3PO1C 2XCFA 1RS0A 1GCDA 1C5YB 3EA7A 3SUEA 5AFYH 3MU1A 2A1DB 1GI8B 1HXFH 4AG2A 4YXWD 4YLUA 1P02A 1DICA 1FDPA 3GOVB 1MCVA 5L6NH 4I8GA 1G2LA 3QTOH 5DP3A 3RMNH 2ODYB 2H6MA 1V2MT 1SQAA 2WV4A 4F49A 1A0HB 2KX4A 1C2FA 4GUXA 1PJPA 3SQHE 1BTPA 3MU0A 3PM3A 2G4TA 2Z7FE 2W7SA 1QB1A 3UNRA 2GZ8A 2F83A 3F9EA 5BRRE 2ZFTA 1C2JA 2TGAA 4A6LA 1C5XB 1OP0A 3PWCA 2A45B 2J5UA 4D7FA 4XSKU 2CV3A 2QXIA 1KLTA 2C8WB 1V2OT 4A1VA 1C2LA 2SGQE 4FUHA 2ILNA 2ZU4A 5HM9A 2K8IA 2BD7A 2PSYA 4F48B 1NROH 1AI8H 1UCYH 4FUIA 4RI0A 1DUAA 4CBOA 1A7SA 2J94A 1T8NA 1ELGA 2KCOA 1TYNA 2TBSA 2Y6TA 4X1NU 5JBCS 2BLWA 1DANH 2UWLA 1KXFA 3GDUA 3U1JB 1A0JA 4O03A 3LGIA 1OYQA 3QTVH 3RXRA 3ZZDA 2HNTE 5A8YA 1O37A 1V2JT 1MU6B 1ORFA 1YWUA 3MH4A 2ALPA 2WUCA 1BRCE 3UAIC 1H9HE 5H4IB 2R3UA 1QBVH 2ZO3H 2GCHG 3E90B 4ABGA 3MU4A 3ZZCA 1WYKA 5IYTA 2HPQH 1LVMA 2FXRA 1W7GH 5B6OA 4HFPB 3S7HB 3F6UH 1S83A 3MHWU 4NFEA 1OWJA 1DWBH 3BIUH 1S84A 1UTQA 1VCQA 5EW2H 3RXSA 4BAMB 1W0YH 1NRSH 3EA8A 4H42U 3I29A 1IQGA 2ZQ2A 3SZEA 4TT3D 1COWD 2BDAA 2Q6DA 1B0EA 1L1NA 1NS3A 3PRBA 1QJ7B 4DY7B 1P9SA 2GCHF 2H5DA 1O2MA 3M3TA 1LVOA 1DDJA 2OXSA 4ZXYH 1OWDA 2YMSD 3ZIAD 1G2MA 1P05A 5DP4A 5A0CA 4KTSA 1OWIA 2XC4A 5C1XA 4Q7ZA 4AZ2B 1NRPH 3SJ8A 3HK6B 4IGDA 5JBBS 3T62A 1GI1A 2AGGX 3UOPA 1PPGE 4ESTE 2EI7A 2XBVA 3SZNA 3LJOA 1QQ4A 2Z9IA 1OSSA 3GYMA 1N8OC 4YOGA 2A4GA 1C1PA 1BUIA 3D65E 1GVKB 3SN8A 1BMFD 2VGCB 1HJ9A 3V12A 2BY5X 1IHSH 5C17A 1SQOA 2BTCE 2V3HH 3FVFB 2VH6A 3RDZA 4K60A 1A61H 1LTOA 4U32A 2OC1A 3SNAA 5LH8A 4FUBA 1D3QB 3BTME 2VVCA 8ESTE 1T7CA 3MTYA 5FBEA 2NU1E 4DG4A 5AVDA 1BIOA 5KEDA 4UFGH 4LK4A 1S6LA 1Y59T 5DSFA 1E37B 2ZU3A 3S7KB 4A92A 1C1TA 3A86A 4Y8XA 3A8AA 1JRSA 1F2SE 1K0HA 2BLVA 1FY1A 1WTGH 3RXQA 2OINA 5HYOA 1QL9A 1O2VA 4NFFA 2V35A 4F4OC 4FVDA 4ZHMU 2BVXH 4D7GA 2VU8E 2B0FA 4Y8YA 1V2NT 1T8OA 4GPGA 2CHAC 3DHKH 1KMHB 1YF4A 4JZEH 1MBMA 3KHVA
chains in the Genus database with same CATH topology
2V0BA 2Y7ZA 3RXPA 2AMQA 2SGDE 2Z9GA 3E6PH 3IWMA 1TGSZ 1FIZA 4NIYA 2P3FH 4K8BA 1LKAA 1FPHH 4GHQA 5JBTA 3N7OA 2WPLS 4CRGA 3ZZ7A 3A7TA 1P57B 1NY22 1CO7E 5T6DA 4NSVA 4NA7A 3A7WA 5TCCA 3NXPA 5A8XA 1BHXB 1IQMA 1S6FA 1UTMA 4CRFA 1H1BA 5FX6A 5TJXA 1NFUA 1A3EH 3SU3A 1QNJA 4Y79A 3VB7A 2QN5T 2ANMH 1JOUB 3M7TA 1GBKA 1KXBA 3O8BA 1YP9A 3A8BA 1MQ6A 2J95A 3RM2H 1NFYA 1ZSKA 4WMDA 1GHAG 1HJAC 3BTQE 1KSNA 4K1TA 4AX9H 2VIDA 3DA9B 3BV9B 1V2UT 5ESBA 1EJAA 3T29A 2WYGA 4KGAA 3UQOA 3LU9B 2ZWLH 3BEUA 3O8CA 3U69H 1IQLA 3SV6A 3FFGA 3O8DA 4X2VA 1UMAH 1BOQA 1FIWA 1UHBB 2ZFFH 3SUDA 1O2SA 1P0SH 1UTKA 1QB6A 2A5AA 4BXSA 1FI8A 1GHAF 4ZROA 1GJDB 1QB9A 3RXTA 2VB0A 3E8LA 1KDQA 4WMFA 5BPEA 4WY3A 3MO3A 2BD9A 2PTCE 3RXOA 1CVWH 3HGPA 1SLWB 1W10U 2BDHA 1SQTA 1ZRBA 1O5AB 4ZUHA 3LPRA 4JZ1A 2I6SA 3RXBA 3KL6A 4JZIA 3SU4A 1BHXF 1O5CB 1DLKB 2A0QB 1C2GA 2XRCA 1FY5A 5J4SA 1GJ5H 1VCPA 2GD4B 4NA8A 1MD7A 1HAVB 2NWNA 1O2NA 1QFKH 5EGMA 4RKOB 2XWBI 4X2XA 1ZZZA 1OWKA 3S9BA 2BLOA 3SJIA 1BJUA 2O8WA 2C4FH 1ZHRA 4GCHG 3TJUA 3CS7A 2A7HA 1YBWA 4KP0A 1HAPH 1SB1H 1O2HA 1TPPA 5CHAC 1T31A 2A4OA 2BVSH 1C1QA 1O33A 1TRNA 1O0DH 3BSQA 1PYTC 2FOCA 2FTMA 5AF9H 1JMOH 1DSUA 4GCHF 2VIWA 1GDNA 2OC7A 3T28A 1C5NH 1XXDA 2OBOA 2ZPSA 3LC3A 2FYQA 3M35A 3VB6A 4X1PU 1CGHA 1KLJH 2XWAA 4AN7A 1YPJH 2XYAA 3TH3H 3BTTE 4UD9H 3VXFH 2VIVA 6LPRA 4JK5A 3L33A 2HALA 3RXLA 3BG8A 1Q3XA 3FZDA 2H5CA 3ELAH 2ZEBA 1T8MA 3A7XA 1MD8A 2BDGA 3A88A 3SU0A 1BA8B 1DUEA 1DX5M 2OC8A 1THSH 1GJCB 2XCNA 1BMNH 3SUGA 3A81A 3ATLA 5F03A 1L1JA 1Z1IA 4J1YA 2GGVB 1YPMH 2ZGHA 1JXPA 4O3UA 4WF8A 5SGAE 4KELA 4TPYA 1O3JA 5JYIA 1Z8GA 1NTPA 2ZPQA 3U8TH 1NPMA 5A0BA 2PWXA 3LH3A 2GVFA 1HGTH 1GG6B 1TRMA 4NSYA 1C4U2 1UTJA 1YPEH 1BITA 5GCHF 3D23A 3ZVBA 1PPHE 1SPJA 1TE0A 4WJG2 3P8NA 1O3HA 2ZG0H 2Z3CA 1LQEA 3RXFA 2XNIA 2ZKSA 3M5LA 2PHBA 3ESTA 2J4IA 3TGJE 2ZDNA 1LDTT 1WSSH 1ZJKA 2ZTYA 4CRBA 1W11U 2FX6A 3GY6A 4ISHH 3M5OA 2Z9LA 1TBZH 2ULLA 1QJ6B 2Y81A 1IQJA 2XTTB 1EB1H 1ANCA 1C1RA 1O2JA 2ZFQH 1GBMA 1QBNA 4Y7BA 5E0JA 1GBCA 3STIA 1YCPH 1V2TT 2Y5GA 1S81A 8KME2 4AYVB 1SGEE 4A1TA 1GBJA 5DP5A 5LGOA 1MMJN 3KF2A 1HPGA 1K1MA 2FLRH 1PPEE 3SBKA 3IG6B 1B7XB 3DFJA 2FPZA 1BBRH 3PV4A 3T5FH 4IBLH 1OXGA 1ZHPA 5C20A 2HNTF 5EXMA 4B76A 1EAWA 1FLEE 1GGDB 1Y5BT 3RXMA 1O3PB 2Z9KA 4B75A 4BOHA 4AG1A 1AQ7A 2BYAX 1P09A 1VGCB 1DY9A 3BIVH 1BCUH 3PWBA 1L4DA 5E2OA 3E0NB 5EXNA 1ETTH 1KIGH 4DT7B 1AVXA 1QA0A 1NU7B 1GMHG 7ESTE 4CR5A 3PYHA 1N1LA 2VIOA 5DKMA 1C2HA 2SGEE 3SU5A 3SU2A 2BDIA 1BTWA 1VJAU 1EZSC 1EKBB 1MTWA 4WWYA 4I8JA 1TNKA 2SGAA 1CA0C 1MKXK 3LGVA 1FQ3A 3MNXA 3TITA 1GMHF 3M3VA 1AIXH 2ZHWH 1V2ST 3HKJB 1K2I1 1QY6A 1IQKA 2FS8A 4U01A 2LNCA 1XUHA 1OWEA 1TNJA 4Q2KA 3RM0H 1PPCE 4I31A 3ZZAA 5CMXH 4BTTB 2YOLA 1GWAA 2RCEA 1ANEA 1RRKA 4ISOA 1AFQB 3K6YA 4YOJA 4YT7H 3FP6E 1MTUA 1AVGH 5E8EH 3V0XA 1TX7A 2H9TH 4NIXA 1HCGA 2FM2A 1ZPZA 3TGIE 1BQYA 1TALA 5JDUB 2ZFPH 1INCA 1GBLA 5TCAA 5DPAA 1PPBH 2UWPA 4E7RG 3NCLA 3TH2H 3TPIZ 2B9LA 1C1SA 2WUBA 1WTHD 3TK5A 4GLYA 3GCHB 4BAKB 1O2YA 1NO9H 3TU7H 1V2VT 1DSTA 2ASUB 1GI3A 1V2LT 3RC6A 1SFQB 2QXJA 2BD4A 3LONA 5ABWA 2BB4A 1AFEH 1J15A 2BY8X 3GDSA 3HGNA 3VB5A 2QIQA 2ANYA 4VGCB 1P9UA 3IITA 4UEHH 1GJ6A 1UVSH 4Q7XA 2ZU1A 4KTUA 1GDQA 5F8ZA 1SOTA 2GT7A 2ZPRA 1GBDA 4X8VH 3U1IB 1HAOH 1OKXA 3RXJA 4K1SA 1SHYA 1ARCA 1IOEA 1Z8IB 1FAXA 1TNLA 3GY8A 3PO1B 4AGJA 2CF8H 3T25A 1EZUC 1BMMH 1GHWH 2QGRA 4IC5A 1V2PT 3ITIA 1MH0A 2JH6D 3VFEA 2XBYA 3QX5H 4XDEA 3MU8A 1AUJA 5C67A 1T4VH 2FS9A 3RXDA 1MKWK 1UVTH 4NIVA 4B1TA 3SV8A 1A5HA 3U9AH 1IAUA 3RXAA 1G36A 1JIMA 4OS4A 5DG6A 2ZP0H 1S0QA 1GHBG 1HAGE 5L2ZH 2GDEH 1XXFA 3ATIA 1TGBA 5EU8A 2CF9H 3TJNA 4X1QU 1O2TA 3JZ2B 5I46H 3ZVAA 2BZAA 1K1PA 2ZHDA 3PMJA 1JIRA 4MTBA 3V13A 3VXEH 1OWHA 2ZGBH 4ABIA 1SG8B 3M5MA 1EAUA 1O3LA 3ODDA 4AFUA 1GHBF 2PR3A 3SUFA 5A09A 4ISLA 1P8VC 1UTPA 2CXVA 3M5NA 4FU7A 3HPTB 1TOMH 3MFJA 1HJ8A 1SLXB 3SHCH 4GSOA 3MH7A 1A0LA 2ZGJA 3W95A 3QZRA 1IQIA 5E0GA 3UREA 2ZNKH 3TH4H 3SW2B 3JZ1B 1SGDE 5T6FA 1KXAA 3BEFB 1GJ9B 1HIAA 1TGNA 1CT0E 3K65B 1TWXB 3RXVA 4DOQA 1O34A 3LOXA 1GMDG 2TGDA 4JYVH 3ZVEA 1YPHC 4BXWA 1QURH 1AVWA 3MMGA 3ZVDA 4NWLA 1BTHH 3FAOA 3HATH 2DUCA 4SGAE 1CHGA 1BT7A 4TPIZ 4ISIH 5EW1H 8GCHG 4OGXA 1L2EA 2Y80A 1YM0A 1K1OA 4X6PA 2STBE 2HLCA 9LPRA 4HGCA 1ZPCA 3AVZA 4IMZA 1GMDF 1BB0B 1S0RA 2D26C 2GTBA 3MO9A 1YPGH 2WPKS 3SNBA 1N8OB 3RMLH 1GDUA 4E7NA 4J2YB 3UPEA 3TK9A 8GCHF 1Z7KA 1EB2A 1ZMNA 3GY3A 3KEEA 5GXPA 1WOFA 2FOFA 1SHHB 3SU6A 5C5NA 1GMCG 3PLKA 2Q6FA 1MTSA 2H1UA 4WH8A 1THRH 1C1UH 1GBIA 2BLQA 2B5TB 4YZUA 1ZTJA 1FAKH 1NRRH 3HK3B 1L4ZA 1XVOA 1AE8H 4ASHA 1O5EH 2BOHB 1C5PA 1QGFA 2FYRA 1TPSA 4Z6AH 4JYUH 1GJ8B 1GMCF 2A32A 2AS9A 2IPHA 1J14A 2UWOA 3A83A 1LCYA 5AHGH 1ABJH 4RKJB 3F68H 2VNTA 3S69A 1AGJA 2HWLB 2OP9A 1YPKH 4X6NA 2TIOA 4K2YA 4DJZB 1HAHH 4AGKA 1LHGH 3RLYH 1SMFE 6GCHG 1C4Y2 1Z71A 1C2DA 4B2CA 1FONA 1EPTB 3SI3H 1G9IE 4NWKA 4Y6DA 3KQBA 4UDWH 5A2MH 1LPGB 5GWZA 1EAIA 4RN6A 1C5QA 4E06H 3SI4H 3U98H 3AAVA 2VGCC 2OUAA 3PTNA 3LT3A 1ELFA 2F9BH 1FPCH 1SSXA 2SNVA 4MQAA 1MZAA 1GJ7B 4E05H 3LH1A 1W3CA 1O36A 1UCYE 6GCHF 5FPYA 2PV9B 3VPKA 1LKBA 2QY0B 2A2XH 2PW8H 1FNIA 2KAIB 4MPUA 4CH2B 3KQEA 1SGQE 1D6RA 2QAAA 4R0IA 1TX6A 2O8TA 2G81E 3GYLB 3FZZA 1AKSA 1A5IA 3TJOA 2F9NA 2SNWA 3P8OA 1DT2A 3LGYA 1HJAB 4RSPA 5PTPA 4FUGA 1MU8B 1ZOMA 3RXKA 1TGCA 3TLOA 4MNWA 2FOMB 4DIHH 2GCTB 1CU1A 1O2XA 3ZV8A 4AFQA 3EAJA 4WMEA 2JKHA 1BJVA 3S9AA 2FDAA 2ZCLP 3MNCA 1TNIA 1BMLA 2XXLA 1F5RA 2AIPA 2H9HA 3QGNB 4Q7YA 5DP7A 1HBTH 1O3IA 2C3SA 5C2ZA 1O2ZA 2FI4E 2FWWA 3K9XB 1DXWA 3RP2A 2EI8A 2XC5A 2W3KA 4IMQA 2FOGA 2ZTXA 5ESTE 4THNH 1SGFA 3SV2H 2PKAA 1TABE 3W94A 1OYTH 2Z3EA 1NESE 1Y3YA 4JCNA 5EOKA 1P01A 2BY7X 3SU1A 1UK2A 2BMGB 1EX3A 1O5GH 2J38A 1XUFA 3ZZ6A 4ABFA 2A2QH 1PQ8A 2BD3A 4NCYA 1LVBA 1QR3E 7KMEH 1SC8U 1G3CA 2FX4A 2ZA5A 3QO6A 1AZ8A 4GHTA 1ZRKA 4A5TS 2D2DA 5JBAS 2K1QA 3BTEE 1FJSA 4X1RU 1ZPBA 4I8KA 3S9CA 5A8ZA 1O30A 2DE8A 2ZCHP 2PLXA 1O31A 5EQQA 4HTCH 3RC4A 1D3DB 3SJOA 3UR6A 2Y82A 3KIDU 1QHRB 4LOYH 5EQSA 3KN2A 3SNEA 1F5LA 4D8NA 1GL1A 4X2YA 3GY5A 1UO6A 5CHAB 1YGCH 1A4WH 2OD3B 1YKTA 1F0UA 3U8RH 4CHAB 1AHTH 4ZXXH 1P2IA 5DGJA 5F8XA 2SGFE 2IN2A 2G51A 1ZGVA 3GY7A 3LKWA 2AMPA 3EGKH 1OOKB 2IOTA 1P2NA 3T27A 4FUEA 2ESTE 1SLUB 1CBWC 1TMUH 3DUXH 1C9PA 3MH6A 2XBWA 1AO5A 3BTKE 5FXLA 2ZHEH 9ESTA 3VEQB 1O3BA 1O32A 2ZZUH 3P6ZB 5F6MA 4FUFA 3F9HA 6CHAB 1RXPA 2B7DH 1K1NA 2VWOA 2Z9JA 5L2YH 2RG3A 3CENA 4BTUB 1NC6A 4U2WA 2THFB 2BDCA 1YPHE 2VWNA 4K5ZA 3QUMP 4CRDA 2GV7A 1TONA 1DS2E 1ARBA 1O3OA 1V2QT 1O3EA 1GVZA 1NT1A 3P95A 4XE4A 3RUOA 1NU9A 5C3NA 2WV5A 1BRAA 1BZXE 4O3TA 1O5BB 1VITG 1RFNA 1IQNA 2CJIA 2F9OA 1UVOA 1ANDA 2J2UA 3UFAA 4CRCA 1S82A 2ZDLA 2HVXA 1ELCA 3AW1A 1XKBC 3VGCB 3P8GA 4NG9H 3RXIA 1DWEH 4ZKOU 2BZ6H 5E0HA 1V2WT 1TB6H 3ZVCA 2Z3DA 4WH6A 5DJ7A 1EJNA 2B8OH 5J4QA 3RU4E 1VITF 1QA7A 4BNRA 1F92A 2ZHFH 5JB8S 1A3BH 4XOJA 3UR9A 4CR9A 1ZSJA 2BDYA 3PB1E 3O8RA 3Q77A 4ZMAH 2ZC9H 1T32A 2JETC 4ZHLU 4X8SH 3NK8A 1P10A 3NUMA 1Y3XA 3D62A 2R9PA 4I32A 1D4PB 3TIUA 4H6SB 3A84A 2A7JA 1TA2A 2OCVB 2BQ6B 1PPFE 3SQEE 4AB9A 1SGTA 2BVRH 1LHDH 1HDTH 4YTAA 3UUZA 1C5LH 1AUTC 2D8WA 5AFZH 3KQCA 2VVUA 1RIWC 1MCTA 2G55A 4JMYA 4Z0KA 1P04A 1Y8TA 2NU0E 1CT4E 3Q00A 3URCA 3RXEA 1Y3VA 1HFDA 2BD8A 2BXUH 2GP9B 4OS7A 2F91A 4I8HA 1B0FA 1V2KT 2FODA 5EODA 1C5RA 1YLCA 3QZQA 2ZU5A 2ZGXH 1CA0B 2BX3A 4X6MA 1WBGB 3A87A 1UTLM 4I33A 1ETRH 3ENSB 1GI0A 3UTUH 2FIRH 3NPSA 1BRBE 4YT6H 1J8AA 2YNAA 1C5OH 4BTIB 2PUQH 4MNYA 1P2KA 3ZZ4A 1W2KH 3Q3XA 1QRXA 2G5NA 1GHXH 3G01A 2WYJA 1BRUP 2EI6A 3E91A 2OC0A 4FXGH 5EXLA 2QF3A 2VVVA 1TBQH 2R3YA 3M7UA 1GBEA 4MLFB 1Z8JB 1FY3A 2ZU2A 3LC5A 2C8ZB 1CE5A 4GAWA 3SNCA 2WINI 4MNVA 4CBNA 1QRWA 2WPMS 2OLGA 4HZHA 3UNSA 1KDQB 4B73A 1SBWA 1CT2E 1F5KU 4LZ1H 3QLPH 4KTCA 1FXYA 1IQEA 2HOBA 2R2WU 1RTLA 2Q1JA 3NKKA 2NU2E 1BTZA 3A7ZA 4AB8A 4HI3A 1ID5H 2STAE 4U30A 3GCNA 1UVPA 1MAXA 4H4FA 1ACBE 1DM4B 1GI6A 3PTBA 3TNTA 2A4QA 3F1SB 4INKA 1DY8A 4X8TH 1AMHA 5FCRA 1NZQH 1DVAH 2ALVA 1DFPA