2ZDKA

Exploring trypsin s3 pocket
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdkA02
1XUIA 4ZHMU 1WUNH 3RXQA 3TLOA 3QX5H 1QFKH 1HAHH 1C5NH 1O5GH 1PQ7A 1CA8B 1MCTA 1QBOA 2OXSA 1IQMA 1BMNH 3HATH 2FWWA 5K7RA 2WV4A 2WUCA 3M5LA 5FAHA 1OKXA 2AMPA 2QGRA 3BTGE 3P8FA 5FBIA 1O3LA 4YOGA 1LKAA 4BAQB 1TRNA 3SBKA 3IG6B 1OPHB 4BAOB 2V3OH 1C1SA 2BDYA 2FXRA 2VGCC 2GX4A 4AYVB 1ELAA 1G2LA 3GISB 3U8OH 3P8GA 3SJ9A 3V13A 2PHBA 1N8OB 3TGKE 2FYQA 3T2NA 1RXPA 4GSOA 4NWLA 2GCTB 1G37A 1C2EA 3CENA 1HXEH 2B8OH 4MPVA 3GY2A 3ZYEA 1GI4A 1QJ6B 2IOTA 2UUKB 1FXYA 3EA7A 2C3SA 1GVLA 2ZQ1A 1Z8GA 3TJOA 2B7DH 2ZWLH 2ZFRH 3PMHB 1X7AC 2FTMA 1O3HA 4TPYA 4CRDA 3BIVH 1VJ9U 3SU3A 1PPZA 2FI5E 4K1TA 1O33A 1GJAB 1PQ8A 2PKSB 2P8OC 4FUFA 4VGCC 1DT2A 1MMJN 1TPOA 4TWYA 1BTHH 1P11E 3O8DA 1Z1JA 2R2WU 1HJAC 2ZEBA 3SJOA 1SVPA 1V2QT 2BX3A 1HAVA 1ANDA 3Q3XA 1CSOE 1NU7B 3RXLA 2ANMH 3BTWE 2XWBI 2OCVB 1SGYE 2PUQH 2Q6GA 1QR3E 3KCGH 5LPRA 4B1TA 3HGNA 3GDVA 1IQNA 2PV9B 5EW1H 1GBEA 1P9UA 4IMZA 4MDSA 4KGAA 2Z3EA 1EZUC 1ZJDA 5F8ZA 4NIVA 2XC5A 1A5GH 1Y3YA 3ATWA 1K21H 3SOSA 2ILNA 1ESBA 3V7TA 1TX6A 3RMMH 1GMDF 2ZIQH 1SG8B 1V3XA 1EB2A 2W3IA 1H9HE 2ZQ2A 3TK5A 2BHGA 3DFLA 2CHAC 2KAIB 3SQHE 1S0QA 1T8NA 1BZXE 1UO6A 3RXRA 1TIOA 2YNAA 2SGEE 1WTGH 1AZZA 3RM2H 5EQRA 2A4OA 1C4V2 1W0ZU 2Q1JA 1A61H 3SGBE 2FOCA 2Y82A 1TGTA 3QTOH 2FI3E 5ESTE 3RM0H 3PWBA 2GV7A 2CMYA 1TX7A 3SGAE 1G9IE 1HIAA 4LZ1H 2W7UA 1KDQB 2J38A 1RTFB 2G5VA 5ABWA 2OBOA 3LC3A 1KLTA 3LJJA 1HAXB 1TGBA 2G5NA 1EOJA 5T3HA 1IQLA 1KXFA 1SLVB 1QNJA 1QQ4A 1SFQB 1K22H 1SC8U 8ESTE 1NRSH 2O8MA 4FXGH 4ABAA 1DICA 4KTUA 2ZDAH 1O3CA 1AQ7A 1BTWA 4GHTA 5LGOA 1P8VC 5IDKA 3P8NA 2CF9H 1XKBC 1MKXH 2FP7B 1JRTA 2AS9A 1CHOF 1OXGA 1ZSKA 3URCA 3A88A 1C2JA 3A89A 4DW2U 4NZQA 4DURA 3QZQA 4UFGH 1DY8A 1C5XB 3A85A 1ZTLA 1QL8A 4BOHA 4TY6A 1SGEE 1ZPCA 3ZZ6A 3F9HA 4U2WA 2BY8X 2ZFSA 3ATKA 1NFWA 1ELTA 2H9HA 3SJ8A 1CHGA 3C1KA 2CXVA 1GWAA 1XXFA 2GZ8A 3QN7A 2H6MA 2AERH 1O2ZA 2PGQB 1CT2E 3A7WA 1O2LA 4MQAA 1TYNA 4K8BA 4ZXYH 2BYAX 1A3EH 1YP9A 2VIOA 1O39A 1SSXA 3MH6A 2ZTYA 2BD5A 3A82A 3NPSA 3RUOA 5DO4H 3HPTB 1C1TA 1SGDE 4A6LA 5LPEA 2JKHA 2UUYA 3F68H 3OYPA 1KXDA 3RXJA 1O3EA 5GXPA 1FQ3A 1MTWA 3M7UA 2EI6A 3VXEH 2BOHB 4ISOA 1BTXA 1CGJE 4NA7A 3M3VA 2VWMA 1MBQA 3GY6A 6ESTA 1CHOG 1RIWB 1T4UH 2QA9E 3DFJA 3SHAH 5FCRA 1O2PA 2GCTC 3MU1A 1ARCA 2ZHQH 1K2I1 2IN2A 1C5RA 3SNDA 3U9AH 2C93B 3TVJB 1SPJA 1GL0E 1MTNC 4DGJA 1P2KA 4CH8B 3V0XA 2JETC 1IQEA 4WXVA 3T62A 1SGNE 1AWFH 1VITF 1H4WA 3E1XB 3T28A 3ZVBA 2VIVA 1QB6A 1ELGA 2Z7FE 1C1PA 3BTTE 2AMDA 2J2UA 2ZP0H 4Y71A 2ZHDA 4IGDA 1HFDA 4AFSA 2AGIX 3F6UH 1A0LA 2ZKSA 1UTLM 1O30A 1RS0A 1ZMNA 2CJIA 3SU4A 1GJ6A 2FLBH 1BRBE 3A8AA 3MI4A 4FVDA 3VPKA 4D7GA 1GBJA 4JZFH 2VIQA 1BTZA 3H5CB 2ZTXA 1HGTH 4JZDH 1GI0A 1TBZH 1FNIA 1F0TA 4J1YA 4Y6DA 3TK9A 2QC2A 1CT4E 6GCHF 3QO6A 1O3DA 4HZHA 4ABIA 3BTQE 1GI9B 3P17H 2O8WA 1MUEB 1FONA 4BXWA 1P57B 1V6DA 3ZZ9A 1EPTC 2Y6TA 2Z9GA 3JZ2B 1AO5A 1BBRH 3HKIB 3SUEA 1DPOA 1O2HA 2XBVA 1GHWH 1NROH 2AYWA 1F5LA 2OP9A 1LHCH 3ZZ5A 1TMUH 2SGPE 1D4PB 1H9IE 1UVOA 5EQQA 1C5OH 4LZ4B 3ZZBA 1HB0B 5I46H 4MG3A 1CBWB 1YKTA 4Y79A 1UHBA 1P2OA 4IC6A 1GCTC 1MKWH 1QIXB 1C1MA 5C20A 1A46H 4HFPB 1QA0A 3HKJB 2Z9KA 4NGAH 4ISIH 1GCDA 5JDUB 4FUJA 1S81A 1TBQH 2ZFQH 4E7RG 1GDQA 1O2XA 3AAVA 1XUGA 2VU8E 2UWPA 3BIUH 5BRRE 4IC5A 2Y5HA 1NS3A 1AUJA 1YYY1 4OGYA 1TRYA 3SI3H 3VEQB 1TAWA 4D9RA 4THNH 4WWYA 2A4RA 1C5WB 2Q6DA 3A8CA 4I8JA 3U8RH 1C1RA 1BOQA 1Y59T 1O34A 3GDSA 3DT0H 2F9PA 3M5OA 1AKSA 3RLYH 1W7GH 3EDXB 2A1DB 1TNKA 3TIUA 5EU8A 4INLA 4ZHAA 3QGNB 4ZKSU 3EYDA 1OWIA 3UIRA 1MKXK 2A5AA 1INCA 3AAUA 1BRAA 1RGQA 1DWEH 3TH4H 1YPMH 1EOLA 5B6OA 2TGAA 5T6FA 1KLJH 2FX6A 2XBWA 1GBCA 4U30A 1LVYA 1C2LA 2ZI2H 4LOYH 1HAVB 1LHEH 2AMQA 4NZLA 2DE8A 3K6ZA 2GGVB 1L1GA 4FUEA 3VB3A 3UY9A 1L1JA 3MNSA 1BHXF 1XVMA 1G3CA 3A7TA 1ID5H 4WY3A 5DGJA 4ZKOU 5JPMH 1TQ7B 1MU6B 4CHAB 1MTSA 4X2WA 4H6TA 5JB9S 1Y8TA 4X6PA 1SGFA 2BDBA 1UVSH 1ACBE 2NU4E 1QQUA 1RFNA 4UONA 3QWCH 3RXKA 3HGPA 2G00A 1J9CH 4NSYA 1O35A 4WMDA 1ZGIA 1J8AA 1NY22 2FPZA 3PMBB 2XC4A 3SN8A 1KXBA 1SOTA 3RXOA 4AFUA 3GYLB 3LU9B 1RTLA 1BBRE 1PJPA 1ZRKA 1DFPA 3A8BA 1O32A 1C1UH 3FVFB 2ZCHP 4B2BA 1ZSJA 4KP0A 4MVNA 3AASA 1HJ9A 1TWXB 1C4Y2 4XSKU 4JZIA 2A7CA 3TJNA 1V2MT 3I29A 5AF9H 1YF4A 4YO9A 1KYNA 1K1PA 1UTOA 4ISLA 2WYGA 3SNBA 1V2UT 1IOEA 3TU7H 5GWZA 3H7OA 1QL9A 2D1JA 2AGEX 1P2JA 1Z8IB 5C2ZA 1EJAA 1MQ6A 2ALPA 1NFXA 1TNJA 2BDIA 2ZDVH 3ELAH 2RCEA 3FZZA 4BAHB 1QJ1B 1GJ8B 5FPSA 1XKAC 3VGCB 2DE9A 2PSXA 3SHCH 1SMFE 1ZPZA 3BEFB 1ZGVA 2BD2A 2ODYB 3MNBA 2ZCLP 3B8JA 1DUEA 2R9PA 3GY3A 5DG6A 3QZRA 3ZVCA 2FODA 2O9QA 4JYUH 2GMTC 3PTBA 1BCUH 2BB4A 5DKMA 3SU1A 1TGNA 1CA0C 1EUFA 1TPPA 3ZYDA 2QF3A 1CE5A 4YT6H 1V2VT 1O5FH 1OOKB 2BLWA 2OC8A 4B2AA 1GBKA 1P03A 2QCYA 2TRMA 1WTHD 1Y3WA 1PQAA 2HGTH 1UK3A 1T4VH 4ZHLU 4TPIZ 2A0QB 3MO9A 3TH2H 2OUAA 4WXIA 3SV9A 1ELBA 1C1NA 1W7XH 3UTUH 4JMYA 2VVUA 1YLCA 1ANBA 1CGHA 1KTSB 1Y5UT 2ZDKA 3KGPA 5IYTA 4DT7B 4CH2B 5DP8A 1MCVA 3LH1A 2FOFA 1C5PA 1RIWC 1SGTA 1OYQA 1UCYK 3MO3A 1ESTA 3GCOA 5F8TA 3TPIZ 2VB0A 4D7FA 1OX1A 1TGCA 2A7HA 2ESTE 4TYDA 5E0JA 4X8VH 3NK8A 1GBHA 1TABE 4R0IA 1GHAF 2J34A 1AKSB 2B0FA 1F92A 3RXSA 4ZUHA 1BTUA 3U1IB 4H4FA 4ZROA 4ABGA 4GVUA 4ABEA 1SLXB 2GCHG 3S9BA 7KMEH 2ANYA 1GBFA 1O37A 1O2NA 8GCHG 2ZF0H 8GCHF 5J4QA 2Z3DA 2VWNA 1E38B 4U01A 1TBRH 1KDQA 2VVVA 2O8UA 1G2MA 1UJ1A 1PPEE 3GICB 1NN6A 2Z9IA 1TE0A 4GHQA 4HTCH 4R8TB 3K6YA 2F3CE 1G3EA 4NIYA 1OWKA 1HV7A 5HMAA 4F49A 1GJ9B 1KLIH 1FIZA 1MAYA 4WH8A 1QTFA 2F9VA 3STJA 4FUBA 4MLFB 3PO1C 1QURH 2QXGA 3M35A 3M7TA 3UQOA 1GMHF 1T31A 4ZMAH 1NFYA 4Y7AA 3UREA 5CE1A 1EJMA 2OQUA 4Q2KA 4X6MA 2A5IA 2GDDA 1IQHA 1TMBH 3P70B 4Q7XA 2RDLA 5EXLA 2FOMB 1VJAU 3GCHC 1FN8A 4FUDA 2EI8A 2OTVA 5E8EH 1H8DH 2J4IA 1KSNA 1V2PT 4JZ1A 4PROA 3ZZDA 5J4SA 1FY8E 4GCHG 2O8LA 1P02A 3A80A 3M36A 1AU8A 1O2YA 1HBTH 2ZU3A 4A7IB 2ZNKH 3UWIA 1AY6H 3RXPA 4BTIB 1LDTT 3SU5A 2AIPA 2LNCA 3ESTA 1O3IA 4I31A 1HXFH 2AH4X 4YLUA 1GDUA 1HJ8A 1QGFA 3LC5A 1LTOA 1DSTA 1JIRA 1EATA 4B76A 1A1RA 1HDTH 2EI7A 2GTBA 4K60A 2SGFE 3M61U 4JYVH 4Y7BA 2F9NA 1C5SA 1E36B 3FAOA 1ETTH 3Q3YA 2A4GA 3T26A 3PLBA 1O2WA 4AZ2B 2XW9A 4H6SB 2FZZA 1K1OA 4I32A 1A0JA 3MH7A 3P6ZB 3RU4T 3D49H 2FMJA 1NZQH 1O3GA 2BX4A 4B73A 2O8TA 2R0KA 4DIHH 1Q31A 4YM9A 3NXPA 4JK5A 3SQEE 4KKDA 2P59A 3DHKH 1DXWA 3URDA 3S9AA 4UFDH 3RU4D 1Q2WA 2D2DA 3SUDA 1SGIB 1Z7KA 3CS0A 1WSSH 2BVSH 2ANWA 3MOCA 4XBBA 1HAPH 3NWUA 1ARBA 5FCKA 3ZZ7A 1NRPH 3STIA 4A1XA 2RA3A 4O97A 1W13U 2WPIS 1TQ0B 2FOEA 1Y5BT 1FDPA 2PTNA 3LGTA 4Y0ZE 4ABJA 2FO9A 2Y81A 1U6QA 3BV9B 1O5AB 2BDGA 1IHTH 3U8TH 2J94A 1AFQC 1RRKA 1ZTKA 2GD4B 4X6NA 4J2YB 1SGFG 2GDEH 5DP7A 1D3TB 1LKBA 5GDSH 1FAXA 3D62A 2BLOA 1ANEA 1L1NA 2PTCE 2QV1A 3AVZA 4A1VA 3RXMA 1UK2A 2W7SA 1SGPE 5TCCA 1WCZA 3LIWA 4X1SU 2PKSC 3B23B 4MNWA 4DVAU 1GI5A 1WV7H 3C27B 5ETXA 2YOLA 3RXIA 1C2KA 2XCFA 2BY5X 3H7TA 1FY5A 3IWMA 2SNWA 3GCNA 1HAZB 1FMGA 1G3BA 2BDHA 4RN6A 1W14U 1S5SA 2VVCA 2Y80A 4CRBA 5EOKA 2ZECA 1A0HB 1MQ5A 3T29A 3ENSB 1OWEA 2BZAA 3E0NB 1LQEA 2STAE 1EQ9A 1K28D 1W3CA 1YCPK 2P16A 1S84A 4WMEA 1Z8RA 1W0YH 1N8OC 3MH5A 5CMXH 4IMQA 1TNGA 2R3YA 3JZ1B 5A0AE 1B5GH 1ZHMA 5F03A 1V2JT 4AB9A 2SGDE 1Z71A 3I78A 1T8OA 1O2UA 5AHGH 4IBLH 4X2XA 2BDCA 1FJSA 1YPEH 4AORA 5LPFA 4AB8A 2Z9LA 3VGCC 2FESH 4BTUB 4UDWH 3BTFE 3BSQA 5JB8S 4O3UA 3KN2A 2GCHF 1Y5AT 6CHAB 4FVBA 3RU4E 2G81E 1QHRB 3AW1A 1GPZA 4AGKA 3TJUA 4DG4A 2ZHFH 4SGBE 2Y5FA 1C5TA 2HVXA 2P3FH 1O36A 4INHA 4HI3A 2BMGB 2VNTA 1V2KT 1TPAE 3PMJA 4Y8YA 3F9EA 2TIOA 3LJOA 4OS4A 2ZDMA 1BMMH 1UK4A 2ZO3H 1C1QA 4ISHH 1KXCA 1GBBA 4X2VA 4OS2A 1HJAB 1QB1A 1NT1A 2ZCKP 2BD9A 4UFEH 4WF8A 3VXFH 3PWCA 5EQSA 5LH8A 2ZFFH 4WH6A 2WPLS 2Z94A 2ZG0H 2AEIH 4I7YH 4K2YA 2TGTA 1LVBA 1FLEE 4KELA 3RXDA 3Q00A 2ANKH 4WMFA 3KL6A 3SU0A 1H8IH 3MYWA 1CVWH 5F6MA 1SI5H 1KY9A 1Z6JH 1J16A 3ZVDA 1AB9C 1K1IA 2FDAA 4X1NU 3RMNH 2Z9JA 2ZGJA 1GBDA 2W3KA 3BTEE 3E91A 2FS8A 1O2RA 1YPHC 1BQYA 1D3QB 3QGJA 1BBRK 3TJVA 2WPMS 4I8LA 1YC0A 3KQDA 3BTME 1AD8H 2I6QA 5FX6A 4D76A 1AMHA 1P01A 9LPRA 2A32A 1B0EA 1GBIA 1FY4A 4INKA 5TJXA 3IITA 1AZ8A 3SU6A 4DJZB 4ABFA 2BLVA 3P95A 1J14A 1ZYOA 2WYJA 1O3FA 3QLPH 2AGGX 1EAWA 3UOUA 3S7KB 4Q80A 4CR5A 3Q3KA 2EEKA 1GCTB 1EKBB 2NU3E 2ZGBH 3GCTF 4ABDA 4B71A 5GCHF 4Q7YA 4A92A 1OWHA 5HXFA 1C5LH 1KXAA 3OX7U 1GG6B 2G8TA 1UTMA 2WUBA 2HNTC 1A4WH 1DVAH 5C1XA 1AFQB 2BY9X 1NFUA 1MTVA 3ZVEA 2R2MB 4IS5A 1O3KA 2H9TH 1LPZB 5A8ZA 2XC0A 1TALA 1ELDE 1NRRH 1P3CA 1EAXA 2ALVA 3KNXA 4ZKNU 2G55A 3QTVH 1GJDB 4YESB 1C5MD 2HRVA 3P8OA 3ZZCA 1F5KU 2AIQA 1D3DB 1SBWA 1TA6A 1FY1A 1IQJA 3S0NA 5I25A 2ULLA 1DLEA 1AUTC 4JCNA 1UCYE 3MU4A 1UTQA 2A45B 4XBCA 5L2ZH 1NRNH 4Q7ZA 2BQ7B 3ODDA 1QRZA 3KHVA 5JBAS 3PYHA 1C1VH 2NWNA 6LPRA 1E0FD 3MMGA 5EW2H 3RP2A 2OD3B 4RKOB 1XXDA 2ZU4A 1WAYB 1ZPBA 5A8XA 2BD4A 7LPRA 2GKVE 1HAGE 3RMOH 4Y10E 2UWOA 1EP6A 2VWLA 7GCHG 1OP8A 1AE8H 1V2LT 4MNVA 2GZ9A 3E90B 3PV4A 1S83A 2OBQA 3FANA 3UPEA 2PWXA 4OS1A 2ZPRA 5AVDA 4YZUA 1NO9H 1YPJH 1EXFA 3WY8A 1GJ5H 3K2UA 2TGPZ 1BMAA 3LGWA 1DANH 1P10A 1WBGB 1VITG 2STBE 1Y3UA 3PLPA 4CRCA 1FPHH 1TRMA 2PKAB 1O31A 3PMAB 3TNTA 2ZC9H 2ZDLA 1GI1A 3SORA 4CREA 1VCWA 2G52A 1OYTH 5BPEA 1NM6A 1HYLA 3QDZB 5HM9A 1OP2A 5JBBS 1YLDA 2Y7XA 1LHGH 1SQAA 1BITA 3K65B 3PB1E 1ZRBA 1TLDA 2CGAA 2VIWA 3BTDE 1O3JA 1DUAA 3LKWA 1DOJA 1Z1IA 2CHAB 4DIIH 3L33A 1OWJA 3L3TA 1FV9A 1P2NA 7ESTE 1GDNA 4BANB 2F91A 3KQBA 2HWLB 1L4ZA 1E35B 3SV8A 3T25A 3LGIA 1GJ7B 2BOKA 4ZXXH 1C5ZB 4MNXA 5DP3A 1L0ZA 1ZSLA 4OGXA 4CBNA 5C67A 2ZU1A 1JRSA 3A84A 1V2TT 4LK4A 2ZTZA 1JOUB 2QXJA 1BRUP 5FXLA 3V12A 4X2YA 1LQDB 1P0SH 1E37B 1HAYB 1SHYA 2C8ZB 3A83A 1QA7A 3SV6A 2P8OB 3UR6A 1C2HA 2BQ6B 3BEUA 1YPGH 1ELVA 3FFGA 3OSYA 1G3DA 3TITA 1F0UA 1GMCF 4YTAA 3BN9A 3SJIA 3OY5U 1UMAH 2VINA 3GY8A 1C5UA 1GHXH 1CO7E 1B0FA 1EAIA 5DPAA 3FZDA 3V3MA 4MNYA 5EPYA 1C2GA 2SFAA 1MD7A 4XBDA 4ZH8A 2CN0H 1DM4B 1UCYH 4UFFH 5A0CA 1TB6H 1UTKA 2QXHA 4ABHA 2OC7A 3Q77A 2AFQB 2UUJB 1SHHB 1XM1A 1DS2E 8LPRA 1UVPA 1GBTA 1BHXB 4Y76A 2PR3A 1WYKA 4NCYA 2BXTH 3ODFA 1HAOH 5T6DA 2P94A 1SLUB 2SGAA 5EPNA 4DY7B 2F9UA 1OP0A 1T7CA 1GHYH 1YBWA 2JH6D 4AOQA 2HNTE 3PTNA 3SV7A 3MU8A 1O3OA 1O2GH 3E8LA 2Z3CA 3ATLA 3RDZA 1PFXC 1TONA 3T5FH 1J15A 4Y11E 2FOAA 1ETRH 1Q3XA 1F7ZA 4ASHA 3K9XB 1AN1E 1YCPH 1ZMLA 3GY7A 4Z0KA 5CHAC 1AVGH 1THPB 2GT7A 1UTPA 4BTTB 2XBYA 3RC6A 1GVZA 1AI8H 1VCQA 2J95A 2XYAA 1L2EA 2CF8H 4KTSA 1DLKB 3B9FH 2SGQE 1BMLA 1XMNB 3E16B 1LVOA 1W11U 2QN5T 3R0FA 4U32A 3ZV9A 1F0RA 1OS8A 4CRAA 1M9UA 2P3UB 5HGGA 5DJ7A 1GBLA 1BT7A 2BZ6H 3EA9A 5K0HA 1YPHE 1BJVA 1E34B 4NA8A 2QY0B 1JXPA 1W12U 1C5VA 5EXMA 1ETSH 2PLXA 4FUIA 3PM3A 2EA3A 4K69A 1DWCH 2OINA 4B75A 1N6XA 1QRWA 3RC5A 4X1PU 5SGAE 3EAJA 2FLRH 1P9SA 2FM2A 1O2TA 2A5KA 1ELCA 2BY6X 3A87A 1N6YA 4ABBA 5E0GA 3UUZA 1D6RA 2WV5A 3E0PB 1UVUH 1EPTB 1O3MA 3OTJE 2PFEA 2LPRA 2GVFA 1LPKB 1O2MA 3SNAA 4UD9H 1GJCB 1YCPM 2HALA 1PPGE 4DOQA 1K1NA 2V35A 5A09A 3UQVA 1HPGA 2BQWB 5AFZH 3U69H 1EX3A 1GHBF 2P95A 4D9QA 2TGDA 2PKAA 1EZSC 2QXIA 3MFJA 1DSUA 3R3GB 3PLKA 1HLTH 3TH3H 1K1LA 4IN2A 1UTJA 1IQIA 3MNCA 3O8CA 1O5EH 4GLYA 3FP8E 4OS5A 1T8MA 3G01A 1O2JA 2IPHA 2VH0A 3SI4H 1LHDH 1MTUA 2VGCB 1C1WH 1NPMA 1YGCH 3OU0A 1CBWC 1BA8B 2FYRA 1ANCA 4M7GA 3KF2A 1V2NT 1GI3A 3PROA 2G4TA 3RXTA 3E3TA 5DP4A 5E2PA 1QY6A 1TMTH 1GVKB 3RXUA 4XOJA 3LOXA 1C9PA 2G51A 2V0BA 5F8XA 1C2DA 2JH5D 1P09A 2VIPA 5CHAB 1V2OT 2A31A 4X8SH 2GT8A 4O03A 3LGYA 3GCHB 5FX5A 1S82A 1ZLRA 1Z6EA 5L2YH 4K3JA 5L30H 1TNLA 3TGIE 2ASUB 1WQSA 2Z6BD 3UR9A 2WPKS 1DDJA 1XUKA 1QL7A 2ZPSA 3BTKE 2H9EH 2C8XB 1VR1H 1F5RA 1WQVH 3VFEA 4I8KA 1MKWK 2P93A 4GUXA 3O8BA 2PW8H 1H9LB 3F1SB 1AE5A 3LPRA 3RXVA 9ESTA 1AHTH 2QAAA 2FTLE 3EQ0H 1S6FA 1DWDH 1T8LA 2G4UA 1PPCE 4YOJA 1CQQA 1EB1H 4AYYB 1VITH 1AB9B 2FOBA 3E6PH 1EZXC 3MU0A 1W10U 4GPGA 4I8GA 1GI7B 1AFEH 1GL1A 2ZGHA 1HUTH 3UNSA 3QK1A 1G36A 1MZAA 2BVXH 4MPUA 5TCAA 4XE4A 4NA9H 1BJUA 2B5TB 3S69A 3F9GA 1DX5M 1SFIA 4E06H 3M5NA 3A7VA 1SR5C 1ZMJA 4WJG2 2WPHS 1C2MA 3GY4A 4K8YA 2TBSA 1FN6A 5T6GA 4X8TH 3RXCA 1THSH 3A7XA 4A5TS 3DD2H 2IJOB 3BG4C 5PTPA 3BG4B 2ZDNA 4RSPA 5L6NH 1WOFA 3SNEA 4AGJA 2A7JA 2VJ1A 1LVMA 3FP6E 1GBAA 1BTPA 4CR9A 1ORFA 5JBCS 1O0DH 1AGJA 4X8UH 3AW0A 1THRH 1BUIA 3U98H 3SGQE 4K1SA 1NESE 1S0RA 3KQCA 3DA9B 4NFEA 1ZTJA 3NUMA 1GGDC 1FAKH 1A5HA 2BVRH 1DITH 1CA0B 1SQOA 2GZ7A 1PYTD 1D3PB 5EGMA 1IAUA 1ZR0A 6GCHG 4K1EA 3CS7A 2J92A 3ZVFA 4CBOA 1MBMA 2CV3A 2H2ZA 1HAIH 2B9LA 3RLWH 1EAUA 3SUGA 1TNHA 1GGDB 1P3EA 4YLQH 1EP5A 1C2IA 4NIXA 1D9IA 3S9CA 3MTYA 1FZZA 1MAXA 4QT8C 4CRFA 1TX8A 1EZQA 1EJNA 3SW2B 1KTTB 3F9FA 3S7HB 1CU1A 4UE7H 1BIOA 2QIQA 3GOVB 1VZQH 1G30B 2HOBA 1XVOA 4NSVA 2BTCE 1JIMA 3ZZAA 4NIWA 3ZVAA 1QJ7B 2V6NA 4AG2A 4E05H 3W94A 3HK6B 3VB7A 1QBVH 1MU8B 1P12E 3T27A 1L4DA 1ZOMA 1Z8JB 3A7YA 3GCTG 5E0HA 1JMOH 5DK1A 5A8YA 1DE7H 1O5CB 3UWJH 5GCHG 1TOMH 3VB6A 5C3NA 1P05A 4X6OA 1P2IA 2GP9B 3UFAA 1SGRE 1C5QA 2HPQH 5DP5A 2ZU5A 1NU9A 4JZEH 1FI8A 4O9VA 1RD3B 1NTPA 1MZDA 1SGCA 3A86A 4FUGA 1P2QA 2H5DA 1F2SE 4A1TA 4AN7A 1C9TA 1SB1H 1PQ5A 4ZKRU 2F9BH 3MHWU 3P92A 1LPGB 3RXBA 5C1UA 4O3TA 2FEQH 4GAWA 5GJ4B 3ZZ8A 5JYIA 5EXNA 2C8WB 3D23A 3FP7E 4ZAEA 4X1QU 5FHTA 3QUMP 1ELEE 1K9OE 1Y3VA 3MWIU 4JYTA 2ZFPH 2ZFTA 2FX4A 1C4U2 1V2ST 3KQEA 5ESBA 1EPTA 2H1UA 1GJBB 2M5TA 3LT3A 5EODA 1CGIE 8KME2 1GJ4H 1MTNB 2KAIA 4F4OC 1TOCB 4Y8XA 1A5IA 1HNEE 4WVPE 1OWDA 1FUJA 3RXAA 2JH0D 5G4BA 2NU2E 1V2RT 4NG9H 4B2CA 1LO6A 1O3AA 1DWBH 2UWLA 2ZZUH 3LGVA 4AFQA 1VCPA 4XDEA 5C5OA 2XCNA 2OC1A 3SZNA 1YPLH 4SGAE 3VB4A 3O8RA 2V3HH 1S6HA 2HPPH 1QCPA 3PO1B 2R3UA 1BRCE 1C5YB 1GI6A 1O2OA 2C4FH 5FPTA 3RC4A 4DCDA 1O2QA 2ZGCA 1VGCB 2F83A 1KXEA 1TFXA 2F9OA 4AG1A 3LONA 1DY9A 1AVXA 5JBTA 3ZZ3A 1IQKA 2XWAA 4ISNA 5FBEA 1OSSA 3KIDU 2R0LA 1A3BH 2ZU2A 2K1QA 2XXLA 1LHFH 4TY7A 1NRQH 2ODPA 2I6SA 1P04A 3M7QA 3ZV8A 5A2MH 4HGCA 3SV2H 4BAMB 3RXGA 1ELFA 5HM2A 1RTKA 3RXHA 1BB0B 2SNVA 4I33A 4FUHA 5GIBA 2C90B 4AX9H 3EA8A 1TA2A 3SJKA 4RKJB 1CT0E 4FU9A 4H42U 1IHSH 5EG4A 3SNCA 2YNBA 3ATMA 3Q76A 3ZVGA 1C1OA 1TNIA 4E7NA 2FOGA 2NU0E 2GV6A 1ABIH 1GHVH 2W5EA 1YPKH 3OY6U 2XRCA 1T32A 3A81A 2GMTB 5H4IB 4MTBA 1LMWB 3M5MA 1O3PB 5DP6A 3TGJE 1PPBH 2J9NA 3MNXA 3CP7A 1TPSA 3SO3A 2A4QA 3M3TA 5A0BA 1FIWA 1TGSZ 4NFFA 5FPYA 3ZZ4A 2PSYA 3VB5A 1UHBB 1UTNA 1GI8B 2THFB 1O2SA 2RA0A 2H5CA 2ZHWH 1O3BA 4X0WU 3UNRA 1AIXH 1BDAA 1MH0A 1SQTA 4NWKA 2WINI 1GG6C 3MU5A 1G32B 3EE0B 4KTCA 2TPIZ 5E2OA 4I8HA 2BXUH 1SGQE 2UUFB 3UNQA 2HNTF 2FOHA 1F0SA 4ESTE 2XNIA 1BTYA 1QBNA 1QRXA 3LDXH 1O38A 3D65E 2QYIA 2ZPQA 2P3TB 2BD8A 3MH4A 1XX9A 3EGKH 1P2MA 3BEIB 2NU1E 1C2FA 2DUCA 2HLCA 4MPXA 4BXSA 3L6PA 3BF6H 1GMDG 1S85A 4OS7A 4YT7H 1JWTA 5DP9A 1GHAG 1RJXB 1HCGA 1K1MA 2BM2A 1Y3XA 2BD7A 2ODQA 1EASA 4B74A 1B7XB 5C1YA 4YOIA 3TK6A 1GMCG 2Y5GA 4XFQA 2XTTB 4Z6AH 4IW4E 4TWWA 1O2KA 1IQFA 1IQGA 1P06A 1V2WT 2ZA5A 5C5NA 2D26C 1VGCC 3N7OA 1XUFA 1W2KH 1H1BA 5HYOA 4FU8A 2VIDA 1J17T 3RXEA 2FIRH 1K1JA 3UOPA 1XUHA 3HK3B 2OLGA 4Y8ZA 3TNSA 3BG8A 2VWOA 1UVTH 2D8WA 4IN1A 2BDAA 1WU1A 3W95A 4FUCA 5AFYH 1FPCH 1HIAB 3ATIA 3GYMA 4Y0YE 1NC6A 1GMHG 2Y7ZA 3SUFA 4BAKB 2RG3A 4D8NA 1DXPA 2XBXA 1ZHPA 3I77A 1GHZA 2EC9H 2ZGXH 4BNRA 4JK6A 1O5DH 3U1JB 3LH3A 1O2VA 4MPWA 1MD8A 3A8DA 2BLQA 1YM0A 3NKKA 1SLWB 2A2QH 1N1LA 1SOZA 1O2IA 1ESAA 2ZHEH 2FI4E 4OS6A 3KEEA 1LCYA 1PPHE 2WPJS 3RMLH 1A7SA 3ITIA 2BD3A 1W8BH 3A7ZA 1AVWA 1KIGH 2PGBB 3M37A 4LXBH 3MO6A 4GCHF 2JETB 1GI2A 3GY5A 2OC0A 3DUXH 1ABJH 1JBUH 4UEHH 2Q6FA 4CRGA 2C8YB 3RXFA 6CHAC 3BTHE 2PUXB 1O5BB 1QB9A 1PPFE 4VGCB 1O3NA 1XUJA 4X1RU 3NZIA 4CHAC 1GBMA 1ZHRA 2QF0A 1FY3A 3M3SA 1A2CH 1GHBG 2BY7X 3GDUA 1HRTH 1SL3A 4AFZA 1AWHB 1PYTC 4FU7A 2OQ5A 2FS9A 3LGUA 3NCLA 4K5ZA 3SU2A 7GCHF 1ZZZA 2A2XH 2W26A 1ZJKA 2VH6A 5GPIB 1D6WA
chains in the Genus database with same CATH superfamily
1XUIA 4ZHMU 1WUNH 3RXQA 3TLOA 3QX5H 1QFKH 1HAHH 1C5NH 1O5GH 1PQ7A 1CA8B 1MCTA 1QBOA 2OXSA 1IQMA 1BMNH 3HATH 2FWWA 5K7RA 2WV4A 2WUCA 3M5LA 5FAHA 1OKXA 2AMPA 2QGRA 3BTGE 3N7DA 3P8FA 5FBIA 1O3LA 4YOGA 1LKAA 4BAQB 1TRNA 3SBKA 3IG6B 1OPHB 4BAOB 4RI0A 2V3OH 1C1SA 2BDYA 2FXRA 2VGCC 2GX4A 4AYVB 1ELAA 1G2LA 3GISB 3U8OH 3P8GA 3SJ9A 3GS9A 3V13A 2PHBA 1N8OB 3TGKE 2FYQA 3T2NA 1RXPA 4GSOA 4NWLA 2GCTB 1G37A 1C2EA 3CENA 1HXEH 2B8OH 4MPVA 3GY2A 3ZYEA 4RT0A 1GI4A 1QJ6B 2IOTA 2UUKB 1FXYA 3EA7A 2C3SA 1GVLA 2ZQ1A 1Z8GA 3TJOA 2B7DH 2ZWLH 2ZFRH 3PMHB 1X7AC 2FTMA 1O3HA 4TPYA 4CRDA 3BIVH 1VJ9U 2WSSD 3SU3A 1PPZA 2FI5E 4K1TA 1O33A 1GJAB 1PQ8A 2PKSB 2P8OC 4FUFA 4VGCC 1DT2A 1MMJN 1TPOA 4TWYA 1BTHH 1P11E 3O8DA 1Z1JA 2R2WU 1HJAC 2ZEBA 3SJOA 1SVPA 1V2QT 5C94A 4RT1A 2BX3A 1HAVA 1ANDA 3Q3XA 1CSOE 1NU7B 3RXLA 2ANMH 3BTWE 2XWBI 2OCVB 1SGYE 2PUQH 2Q6GA 1QR3E 3KCGH 5LPRA 4B1TA 3HGNA 3GDVA 1IQNA 2PV9B 3EE7A 5EW1H 1GBEA 1P9UA 4IMZA 4MDSA 4KGAA 2Z3EA 1EZUC 1ZJDA 5F8ZA 4NIVA 2XC5A 1A5GH 1Y3YA 3ATWA 1K21H 3SOSA 2F43B 3F2HA 2ILNA 1ESBA 3V7TA 1TX6A 3RMMH 1GMDF 2ZIQH 1SG8B 1V3XA 1EB2A 5DSFA 2W3IA 1H9HE 2ZQ2A 3TK5A 1W0KD 2BHGA 3DFLA 2CHAC 2KAIB 3SQHE 1S0QA 1T8NA 1BZXE 1UO6A 3PRBA 3RXRA 1TIOA 2YNAA 2SGEE 1WTGH 1AZZA 2WV9A 3RM2H 2JDID 5EQRA 2A4OA 1C4V2 1W0ZU 2Q1JA 1A61H 3SGBE 2FOCA 3UAIC 2Y82A 1TGTA 3QTOH 2FI3E 5ESTE 3RM0H 3PWBA 2GV7A 2CMYA 1TX7A 3SGAE 1G9IE 1HIAA 4LZ1H 2W7UA 1KDQB 2J38A 1RTFB 2G5VA 4FETA 5ABWA 2OBOA 3LC3A 1KLTA 3LJJA 1HAXB 1TGBA 2G5NA 1EOJA 5T3HA 1IQLA 1KXFA 1SLVB 1QNJA 1QQ4A 2HLDD 1SFQB 1K22H 1SC8U 8ESTE 1NRSH 2O8MA 4FXGH 4ABAA 1DICA 4KTUA 2ZDAH 1O3CA 1AQ7A 1BTWA 4GHTA 5LGOA 1P8VC 5IDKA 3P8NA 2CF9H 1XKBC 1MKXH 2FP7B 1JRTA 2AS9A 1CHOF 1OXGA 3PV5A 1ZSKA 3SYJA 3URCA 3A88A 1C2JA 3A89A 4DW2U 4NZQA 4DURA 3QZQA 4UFGH 2JJ1D 1DY8A 1C5XB 3A85A 1ZTLA 4P00A 1QL8A 4BOHA 4TY6A 1SGEE 2WPDD 1ZPCA 3ZZ6A 2L6OA 3F3BA 3F9HA 4U2WA 2BY8X 2ZFSA 3ATKA 1NFWA 1ELTA 2H9HA 3SJ8A 1CHGA 3C1KA 2CXVA 1GWAA 1XXFA 2GZ8A 4F48B 3QN7A 2H6MA 2AERH 4YXWD 1O2ZA 2PGQB 1CT2E 3A7WA 1O2LA 4MQAA 1TYNA 4K8BA 1SKYE 4ZXYH 2JJ2D 2BYAX 1A3EH 1YP9A 2VIOA 2IJD1 1O39A 1SSXA 3MH6A 2ZTYA 2BD5A 3A82A 3NPSA 3RUOA 5DO4H 3HPTB 1C1TA 1SGDE 4A6LA 5LPEA 2JKHA 2UUYA 3F68H 3OYPA 1KXDA 3RXJA 1O3EA 5GXPA 1FQ3A 1MTWA 3M7UA 2EI6A 3VXEH 2BOHB 4ISOA 1BTXA 1CGJE 4NA7A 3M3VA 2VWMA 1MBQA 3GY6A 6ESTA 1CHOG 1RIWB 1T4UH 2QA9E 3DFJA 3SHAH 5FCRA 1O2PA 2GCTC 3MU1A 1ARCA 2ZHQH 1K2I1 2IN2A 1C5RA 3SNDA 3DSGA 3U9AH 2C93B 2KCPA 3TVJB 1SPJA 1GL0E 1MTNC 4DGJA 1P2KA 4CH8B 3V0XA 2JETC 1IQEA 4WXVA 3T62A 1SGNE 1AWFH 1VITF 3F0PA 1H4WA 3E1XB 3T28A 3ZVBA 2VIVA 1QB6A 1ELGA 2Z7FE 1C1PA 3BTTE 2AMDA 1FX0B 2J2UA 2ZP0H 4Y71A 3VG8A 2ZHDA 4IGDA 1HFDA 4AFSA 2AGIX 3F6UH 1A0LA 2ZKSA 1UTLM 1O30A 1RS0A 1ZMNA 2CJIA 3SU4A 1GJ6A 2FLBH 1BRBE 3A8AA 3MI4A 4FVDA 3VPKA 4D7GA 1GBJA 4JZFH 2VIQA 1BTZA 3H5CB 2ZTXA 1HGTH 4JZDH 1GI0A 1TBZH 1FNIA 1F0TA 4J1YA 4Y6DA 3TK9A 2QC2A 1CT4E 6GCHF 3QO6A 3OE7D 1O3DA 4HZHA 4ABIA 3BTQE 1GI9B 3ZIAD 3P17H 2O8WA 1MUEB 1FONA 4BXWA 1P57B 1V6DA 3ZZ9A 1EPTC 2Y6TA 2Z9GA 3JZ2B 1AO5A 1BBRH 3HKIB 3SUEA 1DPOA 1O2HA 2XBVA 1GHWH 1NROH 2AYWA 1KMHB 1F5LA 2OP9A 1LHCH 3ZZ5A 1TMUH 2SGPE 1D4PB 1H9IE 1UVOA 5EQQA 1C5OH 4LZ4B 3ZZBA 1HB0B 5I46H 4MG3A 1CBWB 1YKTA 4Y79A 1UHBA 1P2OA 4IC6A 1GCTC 1MKWH 1QIXB 1C1MA 5C20A 1A46H 3FO8D 4HFPB 1QA0A 3HKJB 2Z9KA 4NGAH 4ISIH 5F53A 1GCDA 5JDUB 3OAAD 4FUJA 1S81A 1TBQH 2ZFQH 4E7RG 1GDQA 1O2XA 3AAVA 1XUGA 2VU8E 2UWPA 3BIUH 5BRRE 4IC5A 3F2GA 2Y5HA 1NS3A 1AUJA 1YYY1 4OGYA 1TRYA 3SI3H 3VEQB 1TAWA 4D9RA 4THNH 4WWYA 2A4RA 1C5WB 2Q6DA 3A8CA 4I8JA 3U8RH 1C1RA 1BOQA 1Y59T 3DSPA 1O34A 2QE7D 3GDSA 3DT0H 5HIYA 2F9PA 3M5OA 1MABB 1AKSA 3RLYH 1W7GH 3EDXB 2A1DB 1TNKA 3TIUA 5EU8A 4INLA 4ZHAA 3QGNB 4ZKSU 3EYDA 1OWIA 3UIRA 1MKXK 2A5AA 1INCA 3AAUA 1BRAA 1RGQA 2PP6A 1DWEH 3TH4H 1YPMH 1EOLA 5B6OA 2TGAA 4Q63A 5T6FA 1KLJH 2FX6A 2XBWA 1GBCA 4U30A 1LVYA 1C2LA 2ZI2H 4LOYH 1HAVB 3PRDA 1LHEH 2AMQA 4NZLA 2LELA 2DE8A 3K6ZA 2GGVB 1L1GA 4FUEA 3VB3A 3UY9A 1L1JA 2YMSD 3MNSA 1BHXF 1XVMA 1G3CA 3A7TA 1ID5H 4WY3A 5DGJA 4ZKOU 5JPMH 1TQ7B 1MU6B 4CHAB 1MTSA 5C0TA 4X2WA 4H6TA 5JB9S 1Y8TA 4X6PA 1SGFA 2BDBA 1UVSH 1ACBE 2NU4E 1QQUA 1RFNA 4UONA 3QWCH 3RXKA 3HGPA 2G00A 1J9CH 4NSYA 1O35A 4WMDA 1ZGIA 1J8AA 1NY22 2FPZA 3PMBB 2XC4A 3SN8A 1KXBA 1SOTA 3RXOA 4AFUA 3GYLB 3LU9B 1RTLA 1BBRE 1PJPA 1ZRKA 1DFPA 3A8BA 1O32A 1C1UH 3FVFB 2ZCHP 4B2BA 1ZSJA 4KP0A 4MVNA 3AASA 1HJ9A 2QF5A 1TWXB 1C4Y2 4XSKU 4JZIA 2A7CA 3TJNA 1V2MT 3I29A 5AF9H 1YF4A 4YO9A 1KYNA 1K1PA 1UTOA 4ISLA 2WYGA 3SNBA 1V2UT 1IOEA 3TU7H 5GWZA 3H7OA 1QL9A 2D1JA 2AGEX 1P2JA 1Z8IB 5C2ZA 1EJAA 1MQ6A 2ALPA 1NFXA 1TNJA 2BDIA 2ZDVH 3ELAH 2RCEA 3U28C 3FZZA 4BAHB 1QJ1B 1GJ8B 5FPSA 1XKAC 3VGCB 2DE9A 2PSXA 3SHCH 1SMFE 1ZPZA 3BEFB 3NRLA 1ZGVA 2BD2A 2ODYB 3MNBA 2ZCLP 3B8JA 1DUEA 2R9PA 3GY3A 5DG6A 4DT4A 5EJZA 3QZRA 3ZVCA 2FODA 2O9QA 4JYUH 4F55A 2GMTC 3PTBA 1BCUH 2BB4A 5DKMA 3SU1A 1TGNA 1CA0C 1EUFA 1TPPA 3ZYDA 2QF3A 1CE5A 2EQNA 4YT6H 1V2VT 1O5FH 1OOKB 2BLWA 2OC8A 4B2AA 1GBKA 1P03A 2QCYA 2TRMA 2XNDD 1WTHD 1Y3WA 1PQAA 2HGTH 1UK3A 1T4VH 4ZHLU 4TPIZ 2A0QB 3MO9A 3TH2H 2OUAA 4WXIA 3SV9A 1ELBA 1C1NA 1W7XH 3UTUH 4JMYA 2VVUA 1H8ED 1YLCA 1H8HD 1ANBA 1CGHA 1KTSB 1Y5UT 2ZDKA 3KGPA 5IYTA 4DT7B 4CH2B 5DP8A 1MCVA 3LH1A 2FOFA 1C5PA 1RIWC 1SGTA 1OYQA 1UCYK 3MO3A 1ESTA 3GCOA 4B6FA 5F8TA 2CK3D 3TPIZ 2VB0A 4D7FA 1OX1A 1TGCA 2A7HA 2ESTE 4TYDA 5E0JA 4X8VH 3NK8A 1GBHA 1TABE 4R0IA 1GHAF 2J34A 1AKSB 2B0FA 1F92A 3RXSA 4ZUHA 1BTUA 3U1IB 4H4FA 4ZROA 4ABGA 4GVUA 4ABEA 1SLXB 2GCHG 3S9BA 7KMEH 2ANYA 1GBFA 1O37A 1O2NA 8GCHG 2ZF0H 8GCHF 5J4QA 2Z3DA 2VWNA 1E38B 4U01A 1WDIA 1TBRH 1KDQA 2VVVA 2O8UA 1G2MA 1UJ1A 1PPEE 3GICB 1NN6A 2Z9IA 1TE0A 4GHQA 4HTCH 4R8TB 3K6YA 2F3CE 1G3EA 4NIYA 1OWKA 1HV7A 5HMAA 4F49A 3WW7A 1GJ9B 1KLIH 1FIZA 1MAYA 4WH8A 1QTFA 2F9VA 3STJA 4FUBA 4MLFB 3PO1C 1QURH 2QXGA 3M35A 3M7TA 3UQOA 1GMHF 1T31A 4ZMAH 3N7EA 1NFYA 4Y7AA 3UREA 5CE1A 1EJMA 2OQUA 4Q2KA 4X6MA 2A5IA 2GDDA 1IQHA 1TMBH 3P70B 4Q7XA 2RDLA 5EXLA 2FOMB 1VJAU 3GCHC 1FN8A 4FUDA 2W6ID 2EI8A 2OTVA 5E8EH 1H8DH 2J4IA 1KSNA 1V2PT 4JZ1A 4PROA 3ZZDA 5J4SA 1FY8E 4GCHG 2O8LA 1P02A 3A80A 3OFND 3M36A 1AU8A 1O2YA 1HBTH 2ZU3A 4A7IB 2ZNKH 2JIZD 3UWIA 1AY6H 3RXPA 4BTIB 1LDTT 3SU5A 2AIPA 2LNCA 3OEED 3ESTA 1O3IA 4I31A 1HXFH 2AH4X 4YLUA 1GDUA 1HJ8A 1QGFA 3LC5A 1LTOA 1DSTA 1JIRA 3KYFA 1EATA 4B76A 1A1RA 1HDTH 2EI7A 2GTBA 4K60A 2SGFE 3M61U 4JYVH 4Y7BA 2F9NA 1C5SA 1E36B 3FAOA 1ETTH 3Q3YA 2A4GA 3T26A 3PLBA 1O2WA 4AZ2B 2XW9A 4H6SB 2FZZA 1K1OA 4I32A 1A0JA 3MH7A 3P6ZB 3RU4T 3D49H 2FMJA 1NZQH 1O3GA 2BX4A 4B73A 2O8TA 2R0KA 4DIHH 1Q31A 4YM9A 3NXPA 4JK5A 3SQEE 4KKDA 1EFRD 2P59A 3DHKH 1DXWA 3URDA 3S9AA 2YMSC 4UFDH 3RU4D 1Q2WA 2D2DA 3SUDA 1SGIB 1Z7KA 3CS0A 5KEDA 1WSSH 2BVSH 2ANWA 2RFKC 3MOCA 4XBBA 1HAPH 3NWUA 1ARBA 5FCKA 3ZZ7A 1NRPH 3STIA 4A1XA 2RA3A 4O97A 1W13U 2WPIS 1TQ0B 2FOEA 5EJ1A 1Y5BT 1FDPA 2PTNA 2KZ4A 3LGTA 4Y0ZE 4ABJA 2FO9A 2Y81A 1U6QA 3BV9B 1O5AB 2BDGA 1IHTH 3U8TH 2J94A 1AFQC 1RRKA 1ZTKA 3UB0A 2GD4B 4X6NA 4J2YB 1SGFG 2GDEH 5DP7A 1D3TB 1LKBA 5CDFE 5GDSH 1FAXA 3D62A 2BLOA 1ANEA 1L1NA 2PTCE 2QV1A 3AVZA 4A1VA 3RXMA 1UK2A 3FN8A 2W7SA 1SGPE 5TCCA 1WCZA 3LIWA 4X1SU 2PKSC 3B23B 4MNWA 4DVAU 1GI5A 1WV7H 3C27B 5ETXA 2YOLA 3RXIA 1C2KA 2XCFA 2BY5X 3H7TA 1FY5A 3IWMA 2SNWA 3GCNA 1HAZB 1FMGA 1G3BA 2BDHA 4RN6A 1W14U 1S5SA 2L74A 2VVCA 2Y80A 4CRBA 5EOKA 2ZECA 1A0HB 1MQ5A 3T29A 3ENSB 1OWEA 2BZAA 3E0NB 1LQEA 2STAE 1EQ9A 1K28D 1W3CA 1YCPK 2P16A 1S84A 4WMEA 1Z8RA 1W0YH 1N8OC 3MH5A 5CMXH 4IMQA 1TNGA 2R3YA 3JZ1B 3DSOA 5A0AE 1B5GH 1ZHMA 5F03A 1V2JT 4AB9A 2SGDE 1Z71A 3I78A 1T8OA 1O2UA 5AHGH 4IBLH 4X2XA 2BDCA 1FJSA 1YPEH 4AORA 5LPFA 2F4LA 4AB8A 2Z9LA 3VGCC 2FESH 4BTUB 4UDWH 3BTFE 3BSQA 5JB8S 4O3UA 3KN2A 2GCHF 4M9FA 1Y5AT 6CHAB 4FVBA 3RU4E 2G81E 1QHRB 3AW1A 1GPZA 4AGKA 3TJUA 4DG4A 2ZHFH 4SGBE 2Y5FA 1C5TA 2HVXA 2P3FH 1O36A 4INHA 4HI3A 2BMGB 2VNTA 1V2KT 1TPAE 3PMJA 4Y8YA 3F9EA 2TIOA 3LJOA 4OS4A 2ZDMA 1BMMH 1UK4A 2ZO3H 1C1QA 2K8IA 2KCYA 4ISHH 2YMSB 1KXCA 1GBBA 4X2VA 4OS2A 1HJAB 1QB1A 1NT1A 2ZCKP 2BD9A 4UFEH 4WF8A 3VXFH 3PWCA 5EQSA 5LH8A 2ZFFH 4WH6A 2WPLS 2Z94A 2ZG0H 2AEIH 4I7YH 4K2YA 2TGTA 1LVBA 2GJGA 1FLEE 4KELA 3RXDA 4ZCNA 3Q00A 2J98B 2ANKH 4WMFA 3KL6A 3SU0A 1H8IH 3MYWA 1CVWH 5F6MA 2KFWA 1SI5H 1KY9A 1Z6JH 1J16A 3ZVDA 1AB9C 1K1IA 2FDAA 4X1NU 3RMNH 2Z9JA 2ZGJA 1GBDA 2W3KA 3BTEE 3E91A 2FS8A 1O2RA 1YPHC 1BQYA 1D3QB 3QGJA 1BBRK 3TJVA 2WPMS 4I8LA 1YC0A 3KQDA 3BTME 1AD8H 2RDEA 2I6QA 5FX6A 4D76A 1AMHA 1P01A 9LPRA 2A32A 1B0EA 1GBIA 1FY4A 4INKA 5TJXA 3IITA 1AZ8A 3SU6A 4DJZB 4ABFA 2BLVA 3P95A 1J14A 1ZYOA 2WYJA 1O3FA 3QLPH 2AGGX 1EAWA 3UOUA 3S7KB 4Q80A 4CR5A 3Q3KA 2EEKA 1GCTB 1EKBB 2NU3E 4TSFD 2ZGBH 3GCTF 4ABDA 4B71A 5GCHF 4Q7YA 4A92A 1OWHA 5HXFA 2XOKD 1C5LH 1KXAA 3OX7U 1GG6B 2G8TA 4TT3D 1UTMA 2WUBA 2HNTC 1A4WH 1DVAH 5C1XA 1AFQB 2BY9X 1NFUA 1MTVA 3ZVEA 2R2MB 4IS5A 1O3KA 2H9TH 1LPZB 5A8ZA 1E79D 2XC0A 1TALA 1ELDE 1NRRH 1P3CA 1EAXA 2ALVA 3KNXA 4ZKNU 2G55A 3QTVH 1GJDB 4YESB 1C5MD 2HRVA 3P8OA 3ZZCA 1F5KU 2AIQA 1D3DB 1SBWA 1TA6A 1FY1A 1NBMD 1IQJA 3S0NA 5I25A 2ULLA 1DLEA 1AUTC 4JCNA 1UCYE 3MU4A 1UTQA 2A45B 4XBCA 5L2ZH 1NRNH 4Q7ZA 2BQ7B 3ODDA 1QRZA 3KHVA 5JBAS 3PYHA 1C1VH 2NWNA 6LPRA 1E0FD 3MMGA 5EW2H 3RP2A 2OD3B 4RKOB 1XXDA 2ZU4A 1WAYB 1ZPBA 5A8XA 2BD4A 7LPRA 2GKVE 1HAGE 3F0OA 3RMOH 4Y10E 2UWOA 1EP6A 2VWLA 7GCHG 1OP8A 1AE8H 1V2LT 4MNVA 2GZ9A 3E90B 3PV4A 1S83A 2OBQA 3FANA 3N99A 3UPEA 2PWXA 4OS1A 2ZPRA 5AVDA 4YZUA 1NO9H 1YPJH 1EXFA 3WY8A 1GJ5H 3K2UA 2TGPZ 1BMAA 3LGWA 1DANH 1P10A 1WBGB 1VITG 2STBE 1Y3UA 3PLPA 4CRCA 1FPHH 1TRMA 2PKAB 1O31A 3PMAB 3TNTA 2ZC9H 2ZDLA 1GI1A 3SORA 2AHME 4CREA 1VCWA 2G52A 1OYTH 5BPEA 1NM6A 1HYLA 3QDZB 5HM9A 1OP2A 5JBBS 2KR7A 1YLDA 2Y7XA 1LHGH 1SQAA 1BITA 3K65B 3PB1E 1ZRBA 1TLDA 2CGAA 2KX4A 2VIWA 1O3JA 3BTDE 1DUAA 3LKWA 1DOJA 1Z1IA 2CHAB 4DIIH 3L33A 1OWJA 3L3TA 1FV9A 1P2NA 7ESTE 3CNRA 1GDNA 4BANB 2F91A 3KQBA 2HWLB 1L4ZA 1E35B 3SV8A 3T25A 3LGIA 1GJ7B 2BOKA 4ZXXH 1C5ZB 4MNXA 5DP3A 1L0ZA 1ZSLA 4OGXA 4CBNA 5C67A 2K0QA 2ZU1A 1JRSA 3A84A 1V2TT 4LK4A 2ZTZA 1JOUB 2QXJA 1BRUP 5FXLA 3V12A 4X2YA 1LQDB 1P0SH 1E37B 1HAYB 1SHYA 2C8ZB 3A83A 1QA7A 3SV6A 2P8OB 3UR6A 1C2HA 2BQ6B 3BEUA 5EJLA 1YPGH 1ELVA 3FFGA 3OSYA 1G3DA 3TITA 1F0UA 1GMCF 4YTAA 3BN9A 3SJIA 3OY5U 1UMAH 2VINA 3GY8A 1C5UA 1GHXH 1CO7E 1B0FA 5GNDA 1EAIA 2KCOA 5DPAA 3FZDA 3V3MA 5DN6D 4MNYA 5EPYA 1C2GA 2SFAA 1MD7A 4XBDA 4ZH8A 2CN0H 1DM4B 1UCYH 4UFFH 5A0CA 2EY4C 1TB6H 1UTKA 2QXHA 4ABHA 2OC7A 3Q77A 2AFQB 2UUJB 1SHHB 1XM1A 1DS2E 8LPRA 1UVPA 1GBTA 1BHXB 4Y76A 2PR3A 1WYKA 4NCYA 2BXTH 3ODFA 1HAOH 5T6DA 2P94A 1SLUB 2SGAA 5EPNA 4DY7B 2F9UA 1OP0A 1T7CA 1GHYH 1YBWA 2JH6D 4AOQA 2HNTE 3PTNA 3SV7A 3MU8A 1O3OA 1O2GH 3E8LA 1YLNA 2Z3CA 3ATLA 3RDZA 1PFXC 1TONA 3T5FH 1J15A 4Y11E 2FOAA 1ETRH 1Q3XA 1F7ZA 4ASHA 3K9XB 1AN1E 1YCPH 1ZMLA 3GY7A 4Z0KA 5CHAC 1AVGH 1THPB 2GT7A 1UTPA 4BTTB 2QF4A 2XBYA 2IPQX 3RC6A 1GVZA 1AI8H 1VCQA 2J95A 3H09A 2XYAA 1L2EA 2CF8H 4KTSA 1DLKB 3B9FH 2SGQE 1BMLA 1XMNB 3E16B 1LVOA 1W11U 2QN5T 3R0FA 4U32A 3ZV9A 1F0RA 1OS8A 3DCLA 4CRAA 1M9UA 1SQRA 2P3UB 5HGGA 5DJ7A 1GBLA 1BT7A 4HG6A 2BZ6H 3EA9A 5K0HA 1YPHE 5HIZA 1BJVA 1E34B 4NA8A 2QY0B 3FOAA 1JXPA 1W12U 1C5VA 5EXMA 1ETSH 2PLXA 4FUIA 3PM3A 2EA3A 4K69A 1DWCH 4XD7D 2OINA 4B75A 1N6XA 1QRWA 3RC5A 4X1PU 5SGAE 2J98A 3EAJA 1K0HA 2FLRH 1P9SA 2FM2A 1O2TA 2A5KA 1ELCA 3PV2A 2BY6X 3A87A 1N6YA 4ABBA 5E0GA 3UUZA 1D6RA 2WV5A 3E0PB 1UVUH 1EPTB 1O3MA 3OTJE 2PFEA 2LPRA 2GVFA 1LPKB 1O2MA 3SNAA 4UD9H 1GJCB 1YCPM 5CHBA 2HALA 4ACBA 1PPGE 1UW7A 4DOQA 1K1NA 2V35A 5A09A 3UQVA 1HPGA 2BQWB 5AFZH 3U69H 1EX3A 1GHBF 2P95A 4D9QA 2TGDA 2PKAA 1EZSC 3KQ5A 2QXIA 3MFJA 1DSUA 3R3GB 3PLKA 1HLTH 3TH3H 1K1LA 4IN2A 1QZ8A 1UTJA 1IQIA 3MNCA 3O8CA 1O5EH 4GLYA 3FP8E 4OS5A 1T8MA 3G01A 1O2JA 4B6EA 2IPHA 2VH0A 3SI4H 1LHDH 1MTUA 2VGCB 1C1WH 5B6LA 1NPMA 1YGCH 3OU0A 1CBWC 1BA8B 2FYRA 1ANCA 4M7GA 3KF2A 1V2NT 1GI3A 3PROA 2G4TA 3RXTA 3E3TA 5DP4A 5E2PA 2HVYB 1QY6A 1TMTH 1GVKB 3RXUA 4XOJA 3LOXA 1C9PA 2G51A 2V0BA 5F8XA 1C2DA 2JH5D 1P09A 2VIPA 2V7QD 5CHAB 1V2OT 2A31A 4X8SH 2GT8A 4O03A 3LGYA 1S6LA 3GCHB 5FX5A 1S82A 1ZLRA 3WWFA 1Z6EA 5L2YH 4K3JA 5L30H 1W0JD 1TNLA 3TGIE 2ASUB 1WQSA 2Z6BD 3UR9A 2WPKS 1DDJA 1XUKA 1QL7A 2ZPSA 3BTKE 2H9EH 2C8XB 5C0UA 1VR1H 2KM0A 1F5RA 1WQVH 3VFEA 4I8KA 1MKWK 2P93A 4GUXA 3O8BA 2PW8H 1H9LB 3F1SB 1AE5A 3LPRA 3RXVA 9ESTA 1AHTH 2QAAA 2FTLE 3EQ0H 1S6FA 1DWDH 1T8LA 2G4UA 1PPCE 4YOJA 1CQQA 4AC9A 1EB1H 4AYYB 1VITH 1AB9B 2FOBA 1VKYA 3E6PH 1EZXC 3MU0A 1W10U 4GPGA 4I8GA 5KGOA 1GI7B 1AFEH 1GL1A 2ZGHA 1HUTH 3UNSA 3QK1A 1G36A 1MZAA 2BVXH 4MPUA 5TCAA 4XE4A 4NA9H 1BJUA 2B5TB 3S69A 3F9GA 1DX5M 1SFIA 4E06H 3M5NA 3A7VA 1SR5C 1ZMJA 4WJG2 2WPHS 1C2MA 3GY4A 4K8YA 2TBSA 1FN6A 5T6GA 4X8TH 3RXCA 1THSH 3A7XA 4A5TS 3DD2H 2IJOB 3BG4C 5KECA 5PTPA 3BG4B 2ZDNA 4RSPA 5L6NH 1WOFA 3SZEA 3SNEA 4AGJA 2A7JA 2VJ1A 1LVMA 3FP6E 1GBAA 1BTPA 4CR9A 1ORFA 5HKKD 5JBCS 1O0DH 1AGJA 4X8UH 3AW0A 1THRH 1BUIA 3U98H 3SGQE 4K1SA 1NESE 1E1QD 1S0RA 3KQCA 3DA9B 4NFEA 1ZTJA 3NUMA 1GGDC 1FAKH 1A5HA 2BVRH 1DITH 1CA0B 1SQOA 2GZ7A 1PYTD 1COWD 1D3PB 5EGMA 1IAUA 2M2AA 5T1VA 1ZR0A 6GCHG 4K1EA 4ASUD 3CS7A 2J92A 3ZVFA 4CBOA 1MBMA 2CV3A 2H2ZA 1HAIH 2B9LA 3RLWH 1EAUA 3SUGA 1TNHA 1GGDB 2KCAA 1P3EA 4YLQH 1EP5A 1C2IA 4NIXA 1D9IA 3S9CA 2LP6A 3MTYA 1FZZA 1MAXA 4QT8C 4CRFA 1TX8A 1EZQA 1EJNA 3SW2B 1KTTB 3F9FA 3S7HB 1CU1A 4UE7H 1BIOA 2QIQA 3GOVB 1VZQH 1G30B 2HOBA 1XVOA 4FOUC 2BTCE 1JIMA 4NSVA 3ZZAA 4NIWA 3ZVAA 1QJ7B 2V6NA 4AG2A 5C17A 4E05H 3W94A 3HK6B 3VB7A 1QBVH 1MU8B 1P12E 3T27A 1L4DA 1ZOMA 1YY3A 1Z8JB 3A7YA 3GCTG 1JMOH 5DK1A 5E0HA 5A8YA 1DE7H 1O5CB 3UWJH 5GCHG 1TOMH 3VB6A 5C3NA 1P05A 4X6OA 1P2IA 2GP9B 3UFAA 1SGRE 1C5QA 2HPQH 5DP5A 2ZU5A 1NU9A 4JZEH 1FI8A 4O9VA 4Q4LA 1RD3B 1NTPA 1MZDA 1SGCA 3A86A 4FUGA 1P2QA 2H5DA 1F2SE 4A1TA 4AN7A 1C9TA 1SB1H 1PQ5A 4ZKRU 2F9BH 3MHWU 3P92A 1LPGB 3RXBA 5C1UA 4O3TA 2FEQH 4GAWA 5GJ4B 3ZZ8A 5JYIA 5EXNA 2C8WB 3D23A 3FP7E 4ZAEA 4X1QU 5FHTA 3QUMP 1ELEE 1K9OE 1Y3VA 3MWIU 3W1EA 4JYTA 2ZFPH 2ZFTA 2FX4A 1C4U2 1V2ST 3KQEA 5ESBA 1EPTA 2H1UA 1GJBB 2M5TA 3LT3A 5EODA 1CGIE 8KME2 2V3MA 1GJ4H 1MTNB 2KAIA 4F4OC 1TOCB 4Y8XA 1A5IA 1HNEE 4WVPE 1OWDA 1FUJA 3RXAA 4OM9A 2JH0D 5G4BA 2NU2E 1V2RT 4NG9H 4B2CA 1LO6A 1O3AA 1DWBH 2UWLA 2ZZUH 3LGVA 4AFQA 1VCPA 4XDEA 5C5OA 2XCNA 2OC1A 3SZNA 1YPLH 4SGAE 3VB4A 3O8RA 2V3HH 1S6HA 2HPPH 1QCPA 3PO1B 2R3UA 1BRCE 1C5YB 1GI6A 1O2OA 2C4FH 5FPTA 3RC4A 4DCDA 1O2QA 2ZGCA 3OEHD 1VGCB 2F83A 1YWUA 1KXEA 1TFXA 2F9OA 4AG1A 3LONA 1DY9A 1AVXA 5JBTA 3ZZ3A 1IQKA 2XWAA 4ISNA 5FBEA 1OSSA 3KIDU 2R0LA 1A3BH 2ZU2A 2K1QA 5EIYA 2XXLA 1LHFH 4TY7A 1NRQH 2ODPA 2I6SA 1P04A 3M7QA 3ZV8A 5A2MH 4HGCA 3SV2H 4BAMB 3RXGA 1ELFA 5HM2A 1RTKA 3RXHA 1BB0B 2SNVA 4I33A 4FUHA 5GIBA 2C90B 4AX9H 2J97A 3EA8A 1TA2A 1NBME 3SJKA 4RKJB 1E1RD 1CT0E 4FU9A 4H42U 1IHSH 5EG4A 3SNCA 2YNBA 3ATMA 3Q76A 3ZVGA 1C1OA 1TNIA 4E7NA 2FOGA 2NU0E 4I86A 2GV6A 1ABIH 1GHVH 2W5EA 1YPKH 3OY6U 2VBCA 2XRCA 1T32A 3A81A 2GMTB 5H4IB 4MTBA 1LMWB 3M5MA 1O3PB 5DP6A 3TGJE 1PPBH 2J9NA 3MNXA 3CP7A 1TPSA 3SO3A 2A4QA 3FKSD 3M3TA 5A0BA 1FIWA 1TGSZ 4NFFA 5FPYA 3ZZ4A 2PSYA 3VB5A 1UHBB 1UTNA 1GI8B 2THFB 1O2SA 2RA0A 2H5CA 2ZHWH 1O3BA 4X0WU 1WXRA 1AIXH 1BDAA 3UNRA 1MH0A 1SQTA 4NWKA 1GG6C 2WINI 3MU5A 1G32B 3EE0B 4KTCA 2TPIZ 5E2OA 4I8HA 2BXUH 1SGQE 2UUFB 3UNQA 2HNTF 2FOHA 1F0SA 4ESTE 2XNIA 1BTYA 5FL7D 1QBNA 1QRXA 3LDXH 1O38A 2W6JD 2QYIA 2ZPQA 3D65E 2P3TB 3F2FA 2BD8A 3MH4A 1XX9A 3EGKH 1P2MA 3BEIB 2NU1E 1C2FA 2DUCA 2HLCA 4MPXA 4BXSA 3L6PA 3BF6H 1GMDG 1S85A 4ACAA 4OS7A 4YT7H 1JWTA 5DP9A 1GHAG 1RJXB 1HCGA 1K1MA 2BM2A 1Y3XA 2BD7A 2ODQA 2OK5A 1EASA 4B74A 1B7XB 5C1YA 4YOIA 4XRNA 3TK6A 1GMCG 2Y5GA 3WWBA 4XFQA 2XTTB 4Z6AH 4IW4E 4TWWA 1O2KA 1IQFA 1IQGA 1P06A 1V2WT 2ZA5A 5C5NA 2D26C 1VGCC 3N7OA 1OHHD 1XUFA 1W2KH 1H1BA 5HYOA 4FU8A 2VIDA 3MQKC 1J17T 3RXEA 2FIRH 1BMFD 1K1JA 3UOPA 1XUHA 3HK3B 2OLGA 4Y8ZA 3TNSA 3BG8A 2VWOA 1UVTH 2D8WA 4IN1A 2BDAA 1WU1A 2WZQA 3W95A 4FUCA 5AFYH 1FPCH 2J5UA 1HIAB 3ATIA 3GYMA 4Y0YE 1NC6A 1GMHG 2Y7ZA 3SUFA 4BAKB 2RG3A 4D8NA 1DXPA 2XBXA 1ZHPA 3I77A 1GHZA 2EC9H 3KYGA 2ZGXH 4BNRA 4JK6A 1O5DH 4Z1MD 3U1JB 3LH3A 4P02A 1O2VA 4MPWA 2WHXA 1MD8A 3A8DA 2BLQA 1YM0A 3NKKA 1SLWB 2A2QH 1N1LA 1SOZA 1O2IA 1ESAA 2ZHEH 2FI4E 4OS6A 3KEEA 1LCYA 5IK2D 1PPHE 2WPJS 3RMLH 1A7SA 3ITIA 2BD3A 1W8BH 3A7ZA 1AVWA 1KIGH 2PGBB 3M37A 4LXBH 3MO6A 4GCHF 2JETB 1GI2A 3GY5A 2OC0A 3DUXH 1ABJH 3OTPA 1JBUH 4UEHH 2Q6FA 4CRGA 2C8YB 3RXFA 6CHAC 3BTHE 2PUXB 1O5BB 1QB9A 1PPFE 4VGCB 1O3NA 1XUJA 4X1RU 3NZIA 4CHAC 1GBMA 1ZHRA 2QF0A 1FY3A 3M3SA 1A2CH 1GHBG 2BY7X 3GDUA 1HRTH 1SL3A 4AFZA 1AWHB 1PYTC 3AK5A 4FU7A 2OQ5A 2FS9A 3LGUA 3NCLA 4K5ZA 3SU2A 7GCHF 1ZZZA 2A2XH 2W26A 1ZJKA 2VH6A 5GPIB 1D6WA
chains in the Genus database with same CATH topology
1XUIA 4ZHMU 1WUNH 3RXQA 3TLOA 3QX5H 1QFKH 1HAHH 1C5NH 1O5GH 1PQ7A 1CA8B 1MCTA 1QBOA 2OXSA 1IQMA 1BMNH 3HATH 2FWWA 5K7RA 2WV4A 2WUCA 3M5LA 5FAHA 1OKXA 2AMPA 2QGRA 3BTGE 3P8FA 5FBIA 1O3LA 4YOGA 1LKAA 4BAQB 1TRNA 3SBKA 3IG6B 1OPHB 4BAOB 2V3OH 1C1SA 2BDYA 2FXRA 2VGCC 2GX4A 4AYVB 1ELAA 1G2LA 3GISB 3U8OH 3P8GA 3SJ9A 3V13A 2PHBA 1N8OB 3TGKE 2FYQA 3T2NA 1RXPA 4GSOA 4NWLA 2GCTB 1G37A 1C2EA 3CENA 1HXEH 2B8OH 4MPVA 3GY2A 3ZYEA 1GI4A 1QJ6B 2IOTA 2UUKB 1FXYA 3EA7A 2C3SA 1GVLA 2ZQ1A 1Z8GA 3TJOA 2B7DH 2ZWLH 2ZFRH 3PMHB 1X7AC 2FTMA 1O3HA 4TPYA 4CRDA 3BIVH 1VJ9U 3SU3A 1PPZA 2FI5E 4K1TA 1O33A 1GJAB 1PQ8A 2PKSB 2P8OC 4FUFA 4VGCC 1DT2A 1MMJN 1TPOA 4TWYA 1BTHH 1P11E 3O8DA 1Z1JA 2R2WU 1HJAC 2ZEBA 3SJOA 1SVPA 1V2QT 2BX3A 1HAVA 1ANDA 3Q3XA 1CSOE 1NU7B 3RXLA 2ANMH 3BTWE 2XWBI 2OCVB 1SGYE 2PUQH 2Q6GA 1QR3E 3KCGH 5LPRA 4B1TA 3HGNA 3GDVA 1IQNA 2PV9B 5EW1H 1GBEA 1P9UA 4IMZA 4MDSA 4KGAA 2Z3EA 1EZUC 1ZJDA 5F8ZA 4NIVA 2XC5A 1A5GH 1Y3YA 3ATWA 1K21H 3SOSA 2ILNA 1ESBA 3V7TA 1TX6A 3RMMH 1GMDF 2ZIQH 1SG8B 1V3XA 1EB2A 2W3IA 1H9HE 2ZQ2A 3TK5A 2BHGA 3DFLA 2CHAC 2KAIB 3SQHE 1S0QA 1T8NA 1BZXE 1UO6A 3RXRA 1TIOA 2YNAA 2SGEE 1WTGH 1AZZA 3RM2H 5EQRA 2A4OA 1C4V2 1W0ZU 2Q1JA 1A61H 3SGBE 2FOCA 2Y82A 1TGTA 3QTOH 2FI3E 5ESTE 3RM0H 3PWBA 2GV7A 2CMYA 1TX7A 3SGAE 1G9IE 1HIAA 4LZ1H 2W7UA 1KDQB 2J38A 1RTFB 2G5VA 5ABWA 2OBOA 3LC3A 1KLTA 3LJJA 1HAXB 1TGBA 2G5NA 1EOJA 5T3HA 1IQLA 1KXFA 1SLVB 1QNJA 1QQ4A 1SFQB 1K22H 1SC8U 8ESTE 1NRSH 2O8MA 4FXGH 4ABAA 1DICA 4KTUA 2ZDAH 1O3CA 1AQ7A 1BTWA 4GHTA 5LGOA 1P8VC 5IDKA 3P8NA 2CF9H 1XKBC 1MKXH 2FP7B 1JRTA 2AS9A 1CHOF 1OXGA 1ZSKA 3URCA 3A88A 1C2JA 3A89A 4DW2U 4NZQA 4DURA 3QZQA 4UFGH 1DY8A 1C5XB 3A85A 1ZTLA 1QL8A 4BOHA 4TY6A 1SGEE 1ZPCA 3ZZ6A 3F9HA 4U2WA 2BY8X 2ZFSA 3ATKA 1NFWA 1ELTA 2H9HA 3SJ8A 1CHGA 3C1KA 2CXVA 1GWAA 1XXFA 2GZ8A 3QN7A 2H6MA 2AERH 1O2ZA 2PGQB 1CT2E 3A7WA 1O2LA 4MQAA 1TYNA 4K8BA 4ZXYH 2BYAX 1A3EH 1YP9A 2VIOA 1O39A 1SSXA 3MH6A 2ZTYA 2BD5A 3A82A 3NPSA 3RUOA 5DO4H 3HPTB 1C1TA 1SGDE 4A6LA 5LPEA 2JKHA 2UUYA 3F68H 3OYPA 1KXDA 3RXJA 1O3EA 5GXPA 1FQ3A 1MTWA 3M7UA 2EI6A 3VXEH 2BOHB 4ISOA 1BTXA 1CGJE 4NA7A 3M3VA 2VWMA 1MBQA 3GY6A 6ESTA 1CHOG 1RIWB 1T4UH 2QA9E 3DFJA 3SHAH 5FCRA 1O2PA 2GCTC 3MU1A 1ARCA 2ZHQH 1K2I1 2IN2A 1C5RA 3SNDA 3U9AH 2C93B 3TVJB 1SPJA 1GL0E 1MTNC 4DGJA 1P2KA 4CH8B 3V0XA 2JETC 1IQEA 4WXVA 3T62A 1SGNE 1AWFH 1VITF 1H4WA 3E1XB 3T28A 3ZVBA 2VIVA 1QB6A 1ELGA 2Z7FE 1C1PA 3BTTE 2AMDA 2J2UA 2ZP0H 4Y71A 2ZHDA 4IGDA 1HFDA 4AFSA 2AGIX 3F6UH 1A0LA 2ZKSA 1UTLM 1O30A 1RS0A 1ZMNA 2CJIA 3SU4A 1GJ6A 2FLBH 1BRBE 3A8AA 3MI4A 4FVDA 3VPKA 4D7GA 1GBJA 4JZFH 2VIQA 1BTZA 3H5CB 2ZTXA 1HGTH 4JZDH 1GI0A 1TBZH 1FNIA 1F0TA 4J1YA 4Y6DA 3TK9A 2QC2A 1CT4E 6GCHF 3QO6A 1O3DA 4HZHA 4ABIA 3BTQE 1GI9B 3P17H 2O8WA 1MUEB 1FONA 4BXWA 1P57B 1V6DA 3ZZ9A 1EPTC 2Y6TA 2Z9GA 3JZ2B 1AO5A 1BBRH 3HKIB 3SUEA 1DPOA 1O2HA 2XBVA 1GHWH 1NROH 2AYWA 1F5LA 2OP9A 1LHCH 3ZZ5A 1TMUH 2SGPE 1D4PB 1H9IE 1UVOA 5EQQA 1C5OH 4LZ4B 3ZZBA 1HB0B 5I46H 4MG3A 1CBWB 1YKTA 4Y79A 1UHBA 1P2OA 4IC6A 1GCTC 1MKWH 1QIXB 1C1MA 5C20A 1A46H 4HFPB 1QA0A 3HKJB 2Z9KA 4NGAH 4ISIH 1GCDA 5JDUB 4FUJA 1S81A 1TBQH 2ZFQH 4E7RG 1GDQA 1O2XA 3AAVA 1XUGA 2VU8E 2UWPA 3BIUH 5BRRE 4IC5A 2Y5HA 1NS3A 1AUJA 1YYY1 4OGYA 1TRYA 3SI3H 3VEQB 1TAWA 4D9RA 4THNH 4WWYA 2A4RA 1C5WB 2Q6DA 3A8CA 4I8JA 3U8RH 1C1RA 1BOQA 1Y59T 1O34A 3GDSA 3DT0H 2F9PA 3M5OA 1AKSA 3RLYH 1W7GH 3EDXB 2A1DB 1TNKA 3TIUA 5EU8A 4INLA 4ZHAA 3QGNB 4ZKSU 3EYDA 1OWIA 3UIRA 1MKXK 2A5AA 1INCA 3AAUA 1BRAA 1RGQA 1DWEH 3TH4H 1YPMH 1EOLA 5B6OA 2TGAA 5T6FA 1KLJH 2FX6A 2XBWA 1GBCA 4U30A 1LVYA 1C2LA 2ZI2H 4LOYH 1HAVB 1LHEH 2AMQA 4NZLA 2DE8A 3K6ZA 2GGVB 1L1GA 4FUEA 3VB3A 3UY9A 1L1JA 3MNSA 1BHXF 1XVMA 1G3CA 3A7TA 1ID5H 4WY3A 5DGJA 4ZKOU 5JPMH 1TQ7B 1MU6B 4CHAB 1MTSA 4X2WA 4H6TA 5JB9S 1Y8TA 4X6PA 1SGFA 2BDBA 1UVSH 1ACBE 2NU4E 1QQUA 1RFNA 4UONA 3QWCH 3RXKA 3HGPA 2G00A 1J9CH 4NSYA 1O35A 4WMDA 1ZGIA 1J8AA 1NY22 2FPZA 3PMBB 2XC4A 3SN8A 1KXBA 1SOTA 3RXOA 4AFUA 3GYLB 3LU9B 1RTLA 1BBRE 1PJPA 1ZRKA 1DFPA 3A8BA 1O32A 1C1UH 3FVFB 2ZCHP 4B2BA 1ZSJA 4KP0A 4MVNA 3AASA 1HJ9A 1TWXB 1C4Y2 4XSKU 4JZIA 2A7CA 3TJNA 1V2MT 3I29A 5AF9H 1YF4A 4YO9A 1KYNA 1K1PA 1UTOA 4ISLA 2WYGA 3SNBA 1V2UT 1IOEA 3TU7H 5GWZA 3H7OA 1QL9A 2D1JA 2AGEX 1P2JA 1Z8IB 5C2ZA 1EJAA 1MQ6A 2ALPA 1NFXA 1TNJA 2BDIA 2ZDVH 3ELAH 2RCEA 3FZZA 4BAHB 1QJ1B 1GJ8B 5FPSA 1XKAC 3VGCB 2DE9A 2PSXA 3SHCH 1SMFE 1ZPZA 3BEFB 1ZGVA 2BD2A 2ODYB 3MNBA 2ZCLP 3B8JA 1DUEA 2R9PA 3GY3A 5DG6A 3QZRA 3ZVCA 2FODA 2O9QA 4JYUH 2GMTC 3PTBA 1BCUH 2BB4A 5DKMA 3SU1A 1TGNA 1CA0C 1EUFA 1TPPA 3ZYDA 2QF3A 1CE5A 4YT6H 1V2VT 1O5FH 1OOKB 2BLWA 2OC8A 4B2AA 1GBKA 1P03A 2QCYA 2TRMA 1WTHD 1Y3WA 1PQAA 2HGTH 1UK3A 1T4VH 4ZHLU 4TPIZ 2A0QB 3MO9A 3TH2H 2OUAA 4WXIA 3SV9A 1ELBA 1C1NA 1W7XH 3UTUH 4JMYA 2VVUA 1YLCA 1ANBA 1CGHA 1KTSB 1Y5UT 2ZDKA 3KGPA 5IYTA 4DT7B 4CH2B 5DP8A 1MCVA 3LH1A 2FOFA 1C5PA 1RIWC 1SGTA 1OYQA 1UCYK 3MO3A 1ESTA 3GCOA 5F8TA 3TPIZ 2VB0A 4D7FA 1OX1A 1TGCA 2A7HA 2ESTE 4TYDA 5E0JA 4X8VH 3NK8A 1GBHA 1TABE 4R0IA 1GHAF 2J34A 1AKSB 2B0FA 1F92A 3RXSA 4ZUHA 1BTUA 3U1IB 4H4FA 4ZROA 4ABGA 4GVUA 4ABEA 1SLXB 2GCHG 3S9BA 7KMEH 2ANYA 1GBFA 1O37A 1O2NA 8GCHG 2ZF0H 8GCHF 5J4QA 2Z3DA 2VWNA 1E38B 4U01A 1TBRH 1KDQA 2VVVA 2O8UA 1G2MA 1UJ1A 1PPEE 3GICB 1NN6A 2Z9IA 1TE0A 4GHQA 4HTCH 4R8TB 3K6YA 2F3CE 1G3EA 4NIYA 1OWKA 1HV7A 5HMAA 4F49A 1GJ9B 1KLIH 1FIZA 1MAYA 4WH8A 1QTFA 2F9VA 3STJA 4FUBA 4MLFB 3PO1C 1QURH 2QXGA 3M35A 3M7TA 3UQOA 1GMHF 1T31A 4ZMAH 1NFYA 4Y7AA 3UREA 5CE1A 1EJMA 2OQUA 4Q2KA 4X6MA 2A5IA 2GDDA 1IQHA 1TMBH 3P70B 4Q7XA 2RDLA 5EXLA 2FOMB 1VJAU 3GCHC 1FN8A 4FUDA 2EI8A 2OTVA 5E8EH 1H8DH 2J4IA 1KSNA 1V2PT 4JZ1A 4PROA 3ZZDA 5J4SA 1FY8E 4GCHG 2O8LA 1P02A 3A80A 3M36A 1AU8A 1O2YA 1HBTH 2ZU3A 4A7IB 2ZNKH 3UWIA 1AY6H 3RXPA 4BTIB 1LDTT 3SU5A 2AIPA 2LNCA 3ESTA 1O3IA 4I31A 1HXFH 2AH4X 4YLUA 1GDUA 1HJ8A 1QGFA 3LC5A 1LTOA 1DSTA 1JIRA 1EATA 4B76A 1A1RA 1HDTH 2EI7A 2GTBA 4K60A 2SGFE 3M61U 4JYVH 4Y7BA 2F9NA 1C5SA 1E36B 3FAOA 1ETTH 3Q3YA 2A4GA 3T26A 3PLBA 1O2WA 4AZ2B 2XW9A 4H6SB 2FZZA 1K1OA 4I32A 1A0JA 3MH7A 3P6ZB 3RU4T 3D49H 2FMJA 1NZQH 1O3GA 2BX4A 4B73A 2O8TA 2R0KA 4DIHH 1Q31A 4YM9A 3NXPA 4JK5A 3SQEE 4KKDA 2P59A 3DHKH 1DXWA 3URDA 3S9AA 4UFDH 3RU4D 1Q2WA 2D2DA 3SUDA 1SGIB 1Z7KA 3CS0A 1WSSH 2BVSH 2ANWA 3MOCA 4XBBA 1HAPH 3NWUA 1ARBA 5FCKA 3ZZ7A 1NRPH 3STIA 4A1XA 2RA3A 4O97A 1W13U 2WPIS 1TQ0B 2FOEA 1Y5BT 1FDPA 2PTNA 3LGTA 4Y0ZE 4ABJA 2FO9A 2Y81A 1U6QA 3BV9B 1O5AB 2BDGA 1IHTH 3U8TH 2J94A 1AFQC 1RRKA 1ZTKA 2GD4B 4X6NA 4J2YB 1SGFG 2GDEH 5DP7A 1D3TB 1LKBA 5GDSH 1FAXA 3D62A 2BLOA 1ANEA 1L1NA 2PTCE 2QV1A 3AVZA 4A1VA 3RXMA 1UK2A 2W7SA 1SGPE 5TCCA 1WCZA 3LIWA 4X1SU 2PKSC 3B23B 4MNWA 4DVAU 1GI5A 1WV7H 3C27B 5ETXA 2YOLA 3RXIA 1C2KA 2XCFA 2BY5X 3H7TA 1FY5A 3IWMA 2SNWA 3GCNA 1HAZB 1FMGA 1G3BA 2BDHA 4RN6A 1W14U 1S5SA 2VVCA 2Y80A 4CRBA 5EOKA 2ZECA 1A0HB 1MQ5A 3T29A 3ENSB 1OWEA 2BZAA 3E0NB 1LQEA 2STAE 1EQ9A 1K28D 1W3CA 1YCPK 2P16A 1S84A 4WMEA 1Z8RA 1W0YH 1N8OC 3MH5A 5CMXH 4IMQA 1TNGA 2R3YA 3JZ1B 5A0AE 1B5GH 1ZHMA 5F03A 1V2JT 4AB9A 2SGDE 1Z71A 3I78A 1T8OA 1O2UA 5AHGH 4IBLH 4X2XA 2BDCA 1FJSA 1YPEH 4AORA 5LPFA 4AB8A 2Z9LA 3VGCC 2FESH 4BTUB 4UDWH 3BTFE 3BSQA 5JB8S 4O3UA 3KN2A 2GCHF 1Y5AT 6CHAB 4FVBA 3RU4E 2G81E 1QHRB 3AW1A 1GPZA 4AGKA 3TJUA 4DG4A 2ZHFH 4SGBE 2Y5FA 1C5TA 2HVXA 2P3FH 1O36A 4INHA 4HI3A 2BMGB 2VNTA 1V2KT 1TPAE 3PMJA 4Y8YA 3F9EA 2TIOA 3LJOA 4OS4A 2ZDMA 1BMMH 1UK4A 2ZO3H 1C1QA 4ISHH 1KXCA 1GBBA 4X2VA 4OS2A 1HJAB 1QB1A 1NT1A 2ZCKP 2BD9A 4UFEH 4WF8A 3VXFH 3PWCA 5EQSA 5LH8A 2ZFFH 4WH6A 2WPLS 2Z94A 2ZG0H 2AEIH 4I7YH 4K2YA 2TGTA 1LVBA 1FLEE 4KELA 3RXDA 3Q00A 2ANKH 4WMFA 3KL6A 3SU0A 1H8IH 3MYWA 1CVWH 5F6MA 1SI5H 1KY9A 1Z6JH 1J16A 3ZVDA 1AB9C 1K1IA 2FDAA 4X1NU 3RMNH 2Z9JA 2ZGJA 1GBDA 2W3KA 3BTEE 3E91A 2FS8A 1O2RA 1YPHC 1BQYA 1D3QB 3QGJA 1BBRK 3TJVA 2WPMS 4I8LA 1YC0A 3KQDA 3BTME 1AD8H 2I6QA 5FX6A 4D76A 1AMHA 1P01A 9LPRA 2A32A 1B0EA 1GBIA 1FY4A 4INKA