2ZDNA

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdnA02
3PWCA 1V2LT 3VFEA 2GKVE 4ABDA 1BTHH 1Y3UA 1TGCA 4U32A 3E90B 4XOJA 2WV5A 1C1PA 1IQGA 3A7TA 1F0TA 2G00A 4UONA 2FWWA 3TGIE 4HI3A 2A4RA 3BF6H 1GJ7B 1RJXB 2OQUA 7KMEH 2EEKA 1Q2WA 1BRAA 1HAVA 1KSNA 1AVXA 2HWLB 5GJ4B 5F03A 4AORA 1P2IA 2CXVA 3VGCB 1RIWC 2FZZA 3AVZA 2GZ7A 3GYLB 3HATH 3JZ2B 1K1IA 3SU1A 1IQHA 2Z9GA 1EZXC 1NZQH 4UFGH 1EJMA 4ZHLU 1M9UA 5AF9H 2VVVA 2GV6A 1J15A 2ZC9H 3U69H 1H9HE 1VZQH 1G3CA 1IQNA 5DKMA 3TPIZ 5A09A 1KTSB 1C1WH 1D6RA 4YO9A 3HK3B 4X2YA 3M5LA 2FOGA 5L2ZH 2ZPSA 1C1UH 3BTHE 1W10U 3RXBA 2P3UB 4K1EA 1ACBE 1TGBA 2P93A 2XW9A 4RKJB 3LPRA 4X6OA 3NWUA 1VITH 3AW1A 4GHQA 4I7YH 8KME2 1AFEH 1ORFA 3ATMA 5C3NA 1NU9A 1UTJA 1N6XA 1G2LA 3IG6B 4Q7ZA 2BDBA 2QXHA 3V0XA 3TH3H 1QIXB 4JYUH 5EQSA 2NU2E 2AYWA 4A6LA 1DUAA 2JETC 5B6OA 1GBLA 4JYTA 3KQDA 1MD7A 2WV4A 2Z3CA 1MTNB 1W7XH 2FLRH 1UHBB 1EZUC 4BTUB 3U98H 1UMAH 1YPJH 3C27B 1HPGA 5EU8A 3ZYEA 1GBJA 4ASHA 3ZVEA 1BITA 5AHGH 4DURA 1O2GH 2BD5A 1ZMNA 5LH8A 2Z3DA 1ZSLA 3ZZ8A 1AVWA 4CHAC 3ZZ7A 1HAGE 2UUYA 4TWYA 4KTSA 3NXPA 1P09A 1FIZA 1C1SA 1G2MA 3LH1A 1TNHA 2ANYA 1O31A 1SVPA 3QGNB 3MH7A 1GI0A 2ODPA 1WQVH 1AHTH 1HYLA 1LVMA 1PYTD 2PFEA 4AB9A 1O38A 4X2XA 4DOQA 5JBBS 2ZGBH 1RXPA 2XBVA 1ZMLA 1KDQB 4WXVA 2ZDKA 2SFAA 4OS5A 2TGPZ 3BTME 3DHKH 3MU0A 3RXFA 3TH2H 3GISB 1XUHA 4ABEA 1W12U 4F4OC 1QL9A 3VXFH 4ZKNU 2PGQB 1P3EA 1GJ6A 1THRH 2FPZA 2Y7XA 2F91A 3A7ZA 4CREA 4YM9A 1ELDE 5FCRA 1L1JA 2PUXB 4B1TA 1BHXB 3E0PB 2BDAA 2XXLA 3BV9B 1MQ5A 4Y71A 2FS9A 1YM0A 1YPGH 3TJNA 4YESB 1QB6A 1TFXA 3TNTA 1H9IE 2AMPA 5HMAA 4GCHF 1FLEE 2GVFA 3UOUA 1KXFA 3BTFE 4FUHA 1VR1H 1SG8B 4IC6A 4BOHA 1PYTC 1S81A 3PV4A 1SQTA 1TGNA 5HXFA 2F3CE 2XWBI 1XUJA 1IAUA 1O5CB 4X8UH 1P9UA 4Y7AA 2ILNA 2H2ZA 1C5MD 2FTMA 3PTBA 4NWKA 1XKAC 4YT6H 2FODA 3STIA 1OWEA 1P2OA 2C8ZB 2PR3A 4H42U 3M5OA 1G30B 2DUCA 1SGFG 1V2OT 1V2PT 8LPRA 1O2XA 1O2PA 1EASA 1G3EA 1OWHA 3KF2A 3ZYDA 1FAKH 1ZZZA 2VWOA 1RRKA 2NU3E 4B74A 2XBYA 3PO1C 1MZDA 4RSPA 2VU8E 1BA8B 1BTZA 1SB1H 2Z7FE 3S0NA 2ZCLP 4X1QU 4CBNA 3QTVH 3RC5A 4MPUA 4BXSA 1MTSA 2BOKA 2F9UA 3RXOA 1CU1A 2RG3A 1AVGH 4GLYA 2HPQH 3BEFB 4BTTB 1ELVA 4M7GA 1DY8A 3F9EA 1TOMH 1C1VH 1GJBB 1VCQA 4K60A 2BD9A 3LGUA 1NU7B 2TGDA 1EQ9A 2B7DH 4IN1A 1UVPA 1GGDC 5C2ZA 4ZXXH 3HPTB 3A7VA 2D8WA 2ZDNA 4THNH 1Z8GA 1O2OA 1QNJA 1ARCA 1ELBA 3O8BA 3TIUA 1GMDG 1L1GA 1HCGA 1RTKA 4FUCA 1QCPA 3SQHE 5J4QA 3A8DA 3GYMA 3RDZA 5E8EH 1GHBF 1GI5A 1NY22 1BCUH 5DP8A 5A0CA 1EPTA 1A46H 1ELEE 1XM1A 3SO3A 4I31A 3MFJA 1FY8E 7GCHF 1QBNA 1O5GH 3ZVFA 1BTUA 1FQ3A 4Z6AH 3TK5A 1LKAA 1DWBH 3PO1B 4IMQA 1O5DH 4AFUA 2TIOA 2C8YB 1XVOA 1NFUA 4FU7A 3FP7E 1GJCB 1SL3A 1OYTH 2ZDAH 3RXPA 3A7XA 1C1QA 1EJAA 4X6MA 1TPAE 1NPMA 3AAVA 3FP6E 3C1KA 3T28A 1NM6A 1YP9A 1A7SA 1F7ZA 2J38A 3ZVAA 1YLCA 5EQQA 2BDYA 1O2TA 1C4Y2 3KCGH 1A3BH 1GMCG 4IC5A 2A5KA 3A81A 1VGCC 5FBIA 2BB4A 1UVOA 2QXIA 4ABAA 1GHAG 2WYGA 1QA0A 2HRVA 1GDNA 4MNXA 1FDPA 1LHGH 4CR9A 1KLIH 1EUFA 3P92A 3SUDA 4X1SU 1QL7A 1C2LA 3DFLA 1PQ7A 4CRGA 4BAHB 1PQ5A 1QB9A 4ABHA 4E05H 4TPYA 2AERH 5E2OA 1QRWA 1ZYOA 1DWCH 2RA3A 2BQ6B 3L3TA 3H7TA 4D7FA 1DITH 2H5CA 3DUXH 1D3PB 2YNBA 1HDTH 4OS1A 4A1XA 1TNLA 1O3PB 1SGTA 1CHOG 1DFPA 2FI5E 4JK5A 4BXWA 1SFIA 1CT2E 1GI8B 4OS2A 2Z3EA 1PFXC 1QJ7B 4ZKRU 2IJOB 5A8ZA 2WPLS 1AE5A 2TPIZ 3F9FA 2O8LA 1ZJKA 1ZRBA 1VITG 1SGRE 1HAYB 2ZU4A 3E91A 1NT1A 1B0EA 1O2LA 5LGOA 1NRPH 1GGDB 5GDSH 1WYKA 4AOQA 3K6YA 1P2JA 5EXNA 1WUNH 5JBTA 3SUGA 5HM9A 4NGAH 3PB1E 3LC5A 2ZFQH 5TCCA 2W5EA 2XWAA 5JPMH 1BTYA 3LH3A 1K28D 4U01A 3IITA 1PPFE 1MBMA 2ZU2A 2J4IA 3QLPH 4AGKA 3SNAA 2STBE 4ZXYH 1HLTH 4UFEH 3ENSB 3ODFA 3Q76A 1XUGA 1TALA 3GY4A 1C1OA 2BDGA 2QYIA 3OY6U 2H1UA 2ZFFH 1T8MA 3LJOA 4J2YB 3W95A 1E37B 1UK3A 3ZV9A 1GHXH 1O3JA 1TMUH 1UTKA 1THSH 3UWJH 3BTEE 1Y8TA 1MBQA 3E8LA 3MU5A 3BG8A 2Z9KA 2VVUA 2Z6BD 3BTGE 3AAUA 3SI4H 4OS7A 5E0JA 2BY8X 3T25A 1GHYH 1SGQE 2Q6FA 5AFZH 1ZRKA 2FLBH 5E2PA 1P02A 2ZFTA 1AFQC 2ZDVH 4UD9H 1L2EA 1IQKA 2PV9B 2Y7ZA 4B76A 1TBRH 1TABE 4FUEA 3SU3A 2NU0E 1K1MA 1GBEA 1ETTH 1E35B 2V35A 1ZPCA 2ZDLA 2SGQE 1H8DH 1KXBA 2A0QB 2HOBA 3RXEA 3KQEA 3KQBA 1LHDH 2BZAA 1ZTJA 3TGJE 2P95A 5T6GA 3U8RH 1SLVB 3GCTF 3EGKH 1C2EA 5FHTA 4VGCB 2F9BH 3VGCC 9LPRA 5DGJA 2SGEE 1C5PA 2PKSC 1G3BA 2H9EH 1TPSA 2Q1JA 1GVLA 4I8HA 4XBCA 1O3FA 3S7KB 1YPKH 4O03A 1VCPA 2XNIA 3Q3XA 3SORA 1Y59T 4MDSA 2HGTH 3NCLA 4Q7XA 4SGAE 3LONA 3UR6A 3RXAA 1DE7H 1P57B 5E0GA 1W8BH 4OS4A 3SJ9A 5DP5A 1Z6JH 2CMYA 4WMDA 3MO6A 4DJZB 2QA9E 1EATA 1CHGA 4X6PA 3SOSA 4UFDH 2BHGA 2JH6D 4ABIA 2EI8A 3AASA 3P6ZB 1TGTA 1AE8H 1H1BA 1P9SA 1WAYB 2WUCA 3SJKA 1GG6C 1DWDH 2BZ6H 5E0HA 7LPRA 2ZGHA 1LQEA 1C5UA 1CA0B 1UTMA 1O3IA 3SI3H 3OTJE 1OWKA 6GCHG 3DD2H 1QGFA 2HPPH 3ZZCA 3D65E 1FAXA 5GCHF 4RKOB 1Z7KA 1BIOA 4R8TB 4O3TA 3U9AH 1EP5A 3MMGA 1AI8H 2GCTC 1S6HA 1QBOA 1TBZH 3W94A 2BDIA 5TJXA 2A7HA 1UVTH 1TWXB 2XC5A 2RA0A 3HK6B 1MKWH 1FUJA 1HAPH 4FUGA 3PMBB 4BAQB 4D7GA 1AB9B 1XUIA 1C5ZB 5CHAB 2J9NA 3BSQA 1C2FA 1TA2A 1P01A 1DICA 3ZZBA 1TYNA 1A0JA 1Y3YA 2AMDA 1C2HA 1A5IA 2BLOA 3MWIU 1YF4A 3TJVA 1UCYK 1GDUA 1SLWB 2QXGA 2UUFB 2W3KA 1RTFB 3RXDA 1WCZA 1AUTC 4KGAA 1K1JA 1WSSH 5K7RA 1S5SA 4K3JA 3MH6A 1XMNB 1W14U 1D3QB 2Y6TA 2ZGCA 3TVJB 1C5RA 3GY3A 1EX3A 1FI8A 2EI7A 3ELAH 3FAOA 1INCA 3LGIA 5DP9A 4IGDA 3BTWE 1YYY1 1C9PA 3A8AA 1WTHD 1YCPK 1BMMH 1Y3VA 1O3AA 2GX4A 1AO5A 3QUMP 2YOLA 1DT2A 1W0YH 3QZQA 3SQEE 2GP9B 1ZOMA 3EA9A 5F8XA 1AB9C 1VGCB 3ODDA 3ZVDA 2HALA 1GMHG 3T2NA 1HFDA 1KIGH 1N8OC 3JZ1B 2CF8H 1PQAA 1O3DA 1GCDA 1O39A 1V2RT 3GCHC 2ANKH 3F68H 3ATIA 4YOIA 1BRBE 2V3HH 2PKAA 1GI2A 1FN8A 4AFQA 2HLCA 2ANMH 4LOYH 2TGTA 1BBRE 1ZGVA 2O8TA 2ZU3A 1GVKB 3SHCH 1C5XB 1C2GA 1AMHA 1CA0C 1C1MA 1GJ8B 2A45B 3VXEH 4FU8A 2SNWA 2BY5X 2P8OB 1S83A 4KP0A 3TJUA 3UNSA 1NFXA 2ESTE 3GOVB 3LDXH 3MOCA 1H4WA 3K9XB 3V12A 3M3VA 4YLUA 3RMNH 3GDSA 1K1NA 1NRNH 1KXAA 5ESTE 3RXMA 3L6PA 1O34A 1GI3A 1GBTA 1BBRH 3P8GA 4ISNA 2DE8A 1SQAA 1P2NA 1W11U 4ZKOU 1DLEA 1E0FD 4K2YA 2J94A 1MAYA 3QDZB 4JK6A 2ULLA 1AQ7A 2QXJA 1KLTA 2I6QA 2OP9A 3BG4B 2OQ5A 1KDQA 1AFQB 3M37A 3P17H 1IHSH 5FBEA 1CGHA 1TRYA 1V2NT 1ZMJA 4X1RU 3SGQE 1LHEH 1BZXE 3OU0A 5TCAA 2G52A 2ZTXA 4XDEA 2OC1A 1EAWA 1KLJH 1ARBA 1CE5A 1J8AA 2J95A 2W7UA 2VH0A 2ANWA 4O3UA 4I8JA 4Y10E 4AGJA 4WXIA 3A88A 1SI5H 1TQ0B 2XCFA 4NCYA 2WINI 2ZZUH 1LO6A 4FUDA 1LQDB 1AN1E 4ABBA 4AFSA 4HTCH 4FU9A 1Z71A 1C4V2 1GI7B 4X8VH 1C5SA 1FMGA 1LHFH 1YPEH 3ATWA 2UWPA 2HNTE 1HAXB 3M7UA 2F9PA 3U1JB 1IOEA 1WBGB 1OKXA 2QIQA 3KEEA 5IYTA 2A2XH 1Q31A 1W0ZU 3TU7H 1QHRB 4B2CA 2PSXA 1WV7H 3SV9A 1KY9A 1VJ9U 4Y6DA 3TLOA 2Z9LA 6CHAC 1BRCE 1GBIA 2AH4X 5FX5A 2GT8A 4WH8A 1S85A 3GY2A 4B2BA 3B9FH 3ZZ4A 1NFYA 1TPOA 2ZNKH 3GCHB 2D26C 1EAIA 1L4ZA 3A7YA 4FUIA 4KELA 1DDJA 4NFFA 1QQ4A 3B8JA 1ZPZA 4CRFA 2VJ1A 1DSTA 1C5NH 3A83A 3KN2A 4TWWA 3IWMA 2XYAA 1BMLA 1GG6B 2VIOA 2BVSH 4NIYA 3RXIA 1UCYE 4JCNA 1K2I1 1ANBA 4BAMB 1DXWA 1BUIA 4AX9H 1BTWA 5EW1H 4INHA 2GDDA 2FESH 3FZDA 1QY6A 1EKBB 2GZ9A 3LOXA 3Q3KA 4Y7BA 4B2AA 1XX9A 1JIMA 2VH6A 3S9CA 5EQRA 1P11E 1FY3A 1ZGIA 2GV7A 1KTTB 3VB3A 3A8BA 1C5LH 4X1PU 4U2WA 1W3CA 5JBAS 2WPJS 4WMEA 5EGMA 2LPRA 1GHBG 1BTPA 1G37A 1EOLA 1J16A 1ELGA 3QGJA 4UDWH 7GCHG 1MTUA 1H8IH 4NSVA 1C1RA 1MAXA 1BJVA 3ZZ3A 1SGIB 2R0LA 4K1SA 2ZDMA 2QV1A 2AGEX 3UFAA 1CBWC 1SLXB 3ATLA 4Q7YA 1O32A 1C9TA 1DANH 2VWLA 2GMTC 1PPZA 5DPAA 3LKWA 5I46H 1S84A 3E3TA 4YTAA 1O5BB 3CS0A 2FP7B 1OWIA 5AFYH 6LPRA 1C4U2 3HGNA 2ZTYA 1C2KA 1EB1H 3LT3A 4INKA 3VB6A 4D9QA 1L1NA 3ZZ5A 1EZQA 1O2MA 1S0QA 1TMBH 1V2WT 3CS7A 2JETB 3GY6A 1RD3B 2AFQB 1ANEA 2ZG0H 3SN8A 2G4TA 2A2QH 2FOHA 3RM2H 1MMJN 1TB6H 1HGTH 2CV3A 1UHBA 4RN6A 4NIWA 3UNRA 3SBKA 2A1DB 1V2UT 3U8OH 1MD8A 2PKAB 3V3MA 3A7WA 1CO7E 1FY1A 1IQIA 1PQ8A 3PYHA 2OD3B 4CRBA 1O5EH 1CSOE 3U1IB 1GI6A 2CHAB 3F6UH 2PHBA 2GCHG 1O2IA 2JKHA 2BD8A 2QN5T 1KXDA 4GCHG 1PPBH 1OPHB 1AD8H 3A82A 2QF0A 4A5TS 4D9RA 1NFWA 2P16A 1O2UA 3SU6A 1F5KU 3RXLA 1KYNA 5JB9S 1SGEE 1TOCB 1KXEA 4AN7A 1B0FA 1O2ZA 2H5DA 1HJ9A 2SGDE 2ZCKP 3E0NB 2YNAA 1LPZB 2XC4A 1GPZA 2VIQA 1T8NA 3VB4A 4I32A 1C2JA 1W2KH 1JMOH 1CHOF 1VJAU 1T32A 2ODYB 3EQ0H 3P95A 5FPYA 3NZIA 3P8NA 2RCEA 4MPWA 2BXUH 3H7OA 5EOKA 5IDKA 4CH8B 1E34B 1HBTH 4I8GA 1C5VA 4B71A 4XSKU 2P59A 1DPOA 1GCTB 2ODQA 4IN2A 1HB0B 2DE9A 2IPHA 1GBCA 1JOUB 1ZHRA 2B8OH 3PLPA 1TX8A 3LGTA 1BBRK 1TX7A 1TQ7B 2R3YA 1LPKB 1O5AB 1YPMH 4NIXA 1MQ6A 3SNBA 1JXPA 2ZU1A 3EA8A 2FS8A 3MYWA 4HZHA 1IQMA 3T26A 2AGGX 2BY9X 5FPSA 2AS9A 1A0HB 3BTKE 4KTCA 1EJNA 2ZO3H 4Y0ZE 1BMNH 1OP8A 1QJ1B 3NPSA 2OC8A 1YLDA 2VWNA 4ZH8A 2H9TH 1GVZA 1GJ9B 3FP8E 2K1QA 5GIBA 1S6FA 3KIDU 3RLYH 2VNTA 5ESBA 1SGFA 1A61H 1GL0E 2QF3A 3UPEA 1O30A 1SHYA 5EPYA 2A5AA 4X0WU 3D23A 2WPIS 2CGAA 2ZPQA 5EXLA 3VB5A 2GCTB 5SGAE 1U6QA 1NS3A 5EXMA 4NA8A 3E6PH 1Z8RA 1LCYA 3UWIA 2KAIB 2XRCA 3SV2H 3ZVBA 3T29A 1RIWB 1C5YB 1ELAA 3EYDA 3SW2B 3GICB 1MKXH 2FEQH 4MNYA 3EAJA 3T62A 1HAIH 4MPXA 4WMFA 1EAUA 2OC7A 1P06A 1BQYA 1OWJA 3QO6A 2O8WA 4OS6A 2ZU5A 1W7GH 1EXFA 1UJ1A 4NWLA 3NKKA 1E38B 3K2UA 3KHVA 1DS2E 3T5FH 4ISOA 4E7RG 1NO9H 2OCVB 2SGFE 1ETRH 4E06H 5LPFA 3QX5H 2A7CA 8GCHF 3TH4H 4Y8ZA 1O2HA 1GI9B 5T3HA 3SV7A 5EG4A 4NSYA 5AVDA 1DM4B 1NC6A 1PJPA 1V2KT 1AGJA 2STAE 1BHXF 1GMCF 3UTUH 2FOFA 3GDVA 3RXJA 4ISLA 1LHCH 2ZCHP 3RLWH 1GJ5H 5A0AE 5JBCS 3M35A 3MO3A 4GAWA 3WY8A 2FXRA 5BPEA 1O2YA 6ESTA 3ZZ9A 3RC4A 2ZEBA 4NIVA 1GBFA 1GBMA 2PW8H 4H6TA 2UWLA 3ESTA 7ESTE 3V13A 3O8DA 3RU4E 2G5VA 4AG2A 1C2IA 1ANDA 1C5TA 2NU1E 1ZHMA 6CHAB 3I77A 3MI4A 1YKTA 2PTCE 3TK6A 1SR5C 1J9CH 2P94A 4MVNA 2VIWA 2G5NA 3M7QA 1NRRH 1OWDA 2ZKSA 1AZ8A 1GDQA 1B7XB 2G51A 2WUBA 3SU4A 3URDA 3LGWA 1D4PB 2B0FA 2O9QA 2PTNA 1UTOA 1YPLH 2Y82A 1QBVH 4YOJA 1SOZA 4MG3A 3BEIB 2VIDA 2ZGXH 1C5OH 1BJUA 1ESAA 1SGNE 3SUFA 2A32A 5HM2A 3A84A 4WH6A 3ZV8A 3RXTA 1NN6A 2VVCA 1V2QT 2BDCA 1C1TA 2CN0H 1A3EH 2ZFSA 1A5GH 1WTGH 1NTPA 2BDHA 4BNRA 1YC0A 1GI4A 1KXCA 2OBQA 2AMQA 3PWBA 4UFFH 3PTNA 1T8OA 1O2SA 1RGQA 4WF8A 2FOMB 1XUFA 2BTCE 3SV8A 2R2WU 1ZR0A 2BY6X 1GL1A 1CT0E 1YBWA 1F5LA 2H9HA 3RMOH 3D49H 1P8VC 1D9IA 1GBDA 1G32B 1K1PA 1GCTC 3NK8A 1A2CH 1JRTA 3OSYA 4YT7H 4DW2U 2C8WB 3FFGA 2RDLA 3S69A 4FVDA 3D62A 3SHAH 3O8CA 3MU1A 1D3DB 1W13U 1ZSJA 2ZF0H 1Y3WA 1GBAA 1C5QA 1G3DA 2Y5GA 3I29A 4BAOB 5F8ZA 1T4UH 2GTBA 4MTBA 1N6YA 3SV6A 2A5IA 4IMZA 1AWHB 1GMHF 1UTPA 1YCPH 2ZGJA 1P2MA 1Z6EA 3FZZA 1LVYA 5DP6A 5EPNA 1SSXA 2FX4A 4SGBE 2TRMA 4BANB 2BLWA 1D6WA 4WWYA 1FONA 3BTDE 3SJOA 2QC2A 3GY7A 1IHTH 4H4FA 1QRXA 5C20A 1SBWA 3EA7A 2TBSA 1C5WB 1ZPBA 2BLQA 3ZZDA 2AEIH 5EODA 2G8TA 4YZUA 2BD3A 1WQSA 1UCYH 1ANCA 4XFQA 2PKSB 1O2JA 4CH2B 3A86A 1ESBA 3BTTE 1V2MT 3K6ZA 4PROA 1N8OB 4AB8A 2GMTB 5FXLA 4AZ2B 4XBBA 1DXPA 4IW4E 2V3OH 1ELFA 1FIWA 3GY8A 1A0LA 1AUJA 4UE7H 2ZI2H 3SGBE 3AW0A 1FPHH 2W7SA 1ZTLA 2Y81A 2GDEH 3UIRA 2ZHFH 4Y8YA 2FX6A 3KQCA 1C1NA 1MTNC 2FMJA 2WPMS 2A7JA 5T6FA 2A31A 4H6SB 4ABJA 3RXGA 1QFKH 1IQFA 1O2NA 1ZJDA 5LPEA 2AIQA 2FTLE 4UEHH 1S82A 4FUBA 5CMXH 2P3FH 3RP2A 3PMJA 4WVPE 3B23B 1LDTT 5L2YH 5F6MA 2FOEA 3SJIA 4E7NA 2BD4A 4O9VA 2SNVA 4J1YA 1OX1A 3SNEA 2EI6A 3RU4T 4HFPB 2A4QA 1F5RA 4F49A 3DT0H 1GHWH 4IS5A 5GXPA 1AKSB 2HVXA 5FCKA 3LC3A 4Y11E 1ZLRA 2BVRH 2ZPRA 4CRCA 2C3SA 3QN7A 1TRNA 2BQ7B 1K1LA 3RXKA 3PLKA 3M5NA 1ABJH 3MH4A 5DP4A 1QJ6B 3M36A 2J2UA 5C1YA 3M61U 2ZIQH 1V6DA 1SGYE 1MKWK 1J14A 1H9LB 1BT7A 1TA6A 3RXRA 2OTVA 3QZRA 1UVSH 3ITIA 4JZEH 2OBOA 2OUAA 3RMMH 2QCYA 3FANA 1TX6A 3QTOH 1F0UA 3PROA 1XVMA 2Y5FA 1MCTA 5L30H 3MO9A 2J92A 5A8YA 1SGPE 4TYDA 5C5OA 3UUZA 4CHAB 3OX7U 2W3IA 3MNXA 2V6NA 5JB8S 2BD7A 2W26A 1P10A 1JBUH 1YGCH 3HGPA 4DCDA 1XXFA 4XBDA 3H5CB 3PLBA 1O3HA 3UR9A 3O8RA 1GHZA 2D1JA 1DVAH 3A8CA 1HJAC 2CJIA 4MPVA 5LPRA 1P04A 3F1SB 4LZ4B 1V2JT 4I33A 2ALVA 1ZHPA 4X2WA 2FYRA 4K1TA 4KTUA 4Q80A 3V7TA 2VIVA 2ZA5A 4Y79A 5FAHA 2F9OA 1O3OA 1OXGA 1FPCH 4K69A 2UUJB 4A7IB 1GMDF 2JH0D 1K1OA 1Z1JA 2XCNA 2ZHWH 4LZ1H 1P2KA 1C2DA 5DP7A 4INLA 1O3GA 1EP6A 3QK1A 3MNSA 1Q3XA 3N7OA 1O2KA 1O2VA 4DIHH 1O35A 5A0BA 2ZTZA 3EDXB 5JYIA 4ZUHA 1T8LA 4X8SH 1A1RA 1DSUA 1TIOA 1DOJA 2G81E 2A4OA 2GZ8A 2NU4E 2Y5HA 3OY5U 4JZDH 4ZHMU 3RXVA 3T27A 2C93B 4JZ1A 4ESTE 1XUKA 1Z8IB 3TJOA 1Y5UT 2C4FH 5DJ7A 1DLKB 2OXSA 1GJ4H 5G4BA 2ZHQH 1IQEA 2BX3A 3LGYA 4ZAEA 2Z9IA 3A80A 1MU8B 3ZVGA 3ZZAA 2QY0B 4FUFA 1K22H 1EB2A 3E16B 2BMGB 3GDUA 1O2QA 4GUXA 2HNTF 4DY7B 3NUMA 1GHAF 3BEUA 3OYPA 1PPEE 1O36A 3RXHA 3RC6A 1AZZA 1UK4A 1BRUP 3SU2A 9ESTA 1P05A 1EPTB 2OLGA 2ZECA 4IBLH 3GCOA 4YLQH 4D8NA 2R2MB 2XC0A 4MQAA 3KGPA 1SQOA 4K5ZA 2UWOA 1IQJA 1E36B 1ESTA 3UNQA 1HJAB 2OC0A 2SGAA 1FN6A 2BQWB 1L4DA 3A89A 5I25A 4GHTA 3LGVA 3HKIB 3F9HA 1SGDE 5HYOA 2ZFPH 1GJDB 3R0FA 2FI3E 5DO4H 2VINA 3HKJB 3SNDA 3Q77A 1NESE 2FYQA 4LK4A 4ABFA 3CENA 4VGCC 3RUOA 3SU5A 4NA7A 1TE0A 5ETXA 2PSYA 5C1XA 2C90B 1J17T 2BOHB 1OYQA 1OOKB 2F83A 1HAZB 1O3LA 1O3CA 1O3NA 1VCWA 2F9VA 2QAAA 1HRTH 1HIAB 2FI4E 1LTOA 4A1VA 4Q2KA 3BN9A 2LNCA 3DFJA 1LVOA 1D3TB 1RFNA 3PM3A 1CBWB 2FM2A 3S7HB 3LU9B 1FV9A 2ZHDA 1MZAA 3M3SA 2AIPA 4ISHH 2QGRA 2ZQ1A 2WPKS 4ZHAA 1O2WA 2ZWLH 2Y80A 2B9LA 5T6DA 1TONA 2BXTH 1AKSA 1LVBA 2BX4A 1UTQA 1YCPM 1HAHH 1MTWA 5C67A 2O8UA 3R3GB 1YPHE 2AGIX 4MNWA 2VIPA 1GJAB 1CGIE 2Z9JA 2A4GA 1V2ST 2NWNA 2GD4B 1G9IE 1O5FH 3SJ8A 3LIWA 3VEQB 3A87A 1SMFE 1ABIH 4R0IA 1MKXK 2J34A 1N1LA 1WU1A 5CE1A 3L33A 1L0ZA 2CF9H 4JMYA 2Z94A 2KAIA 2Q6GA 2FOBA 1O3MA 1IQLA 1FY4A 4K8YA 2IN2A 3MH5A 5C1UA 4OGXA 2JH5D 1CGJE 2FOAA 1GBHA 4LXBH 4Y8XA 2FIRH 4JYVH 3BIUH 1DY9A 4CR5A 1GHVH 4ZMAH 4TPIZ 4AFZA 1TMTH 4X2VA 3SNCA 1UK2A 1HNEE 4ABGA 4BAKB 2I6SA 3M5MA 3BIVH 4A92A 5DG6A 4NFEA 2OINA 3QWCH 3TGKE 4WY3A 2HNTC 4NA9H 3ZVCA 3TK9A 3RXUA 3MTYA 3M3TA 1EPTC 1TPPA 1S0RA 2BYAX 2GGVB 1LMWB 4NZLA 1O2RA 4YOGA 3GCTG 3Q00A 4ISIH 1G36A 1Z8JB 1OP0A 5L6NH 2C8XB 4A1TA 2EA3A 4D76A 1C2MA 3UREA 3FVFB 1UO6A 4BTIB 4AG1A 1THPB 4WJG2 4DT7B 1CA8B 4DGJA 4CRDA 5FX6A 1TRMA 2GT7A 3SGAE 1EAXA 4Z0KA 1O0DH 4TY7A 3SU0A 4MNVA 1DX5M 1V2TT 5DK1A 5H4IB 3RM0H 3RXQA 1SHHB 1XXDA 3DA9B 2PUQH 1B5GH 3EE0B 5F8TA 2ALPA 3ATKA 1O3BA 1YPHC 4FVBA 1GI1A 1TNIA 4X1NU 3F9GA 3UQVA 5BRRE 4Y76A 4X6NA 3UQOA 1F92A 1HAVB 3VB7A 1PPCE 2P3TB 1GBBA 2VB0A 3RMLH 1XKBC 3UOPA 1SPJA 3BTQE 5GPIB 3TITA 4OGYA 2GCHF 1NROH 3CP7A 1ZTKA 3K65B 2V0BA 4ZKSU 2VGCB 1CVWH 2B5TB 2TGAA 1QA7A 3MNCA 4GSOA 1SOTA 1VITF 3E1XB 4I8LA 4I8KA 2XBWA 2UUKB 2ZQ2A 4DVAU 1OS8A 2BD2A 1FXYA 3MHWU 4MLFB 1K21H 2VWMA 1CT4E 1JWTA 1T7CA 2FOCA 5A8XA 1TBQH 3P8OA 1ELCA 1TGSZ 2ZP0H 4JZIA 1ELTA 3S9BA 1BMAA 2P8OC 5HGGA 5ABWA 1Y3XA 1ZSKA 1MCVA 4NG9H 1TAWA 1QR3E 5K0HA 2SGPE 5A2MH 1O37A 3U8TH 1V3XA 2BVXH 4DG4A 1P03A 3MU8A 1LPGB 3URCA 1QB1A 3MU4A 1Z1IA 4HGCA 1AU8A 1UTNA 1F2SE 4JZFH 3STJA 1HXFH 1QQUA 1X7AC 4TY6A 2THFB 1TNKA 1UTLM 1HAOH 1CQQA 1BTXA 3KL6A 1RS0A 1P0SH 1A5HA 3GY5A 3SZNA 1SGCA 4U30A 2G55A 4AYVB 2XTTB 1SLUB 3P8FA 2R0KA 4B73A 1HIAA 2FDAA 2EC9H 3PMHB 1GBKA 4XE4A 3KNXA 1P3CA 3M7TA 1FZZA 1EOJA 3RU4D 3PMAB 1WOFA 2FO9A 1BDAA 1ID5H 3Q3YA 2R3UA 4B75A 1RTLA 1HJ8A 1JRSA 5C5NA 1A4WH 1QRZA 1PPHE 1MH0A 2CHAC 1UVUH 4FXGH 5FPTA 1HV7A 2IOTA 1QURH 3SUEA 3TNSA 1F0SA 1BOQA 2ZFRH 1HXEH 1O3KA 2BM2A 3S9AA 5J4SA 4X8TH 1EZSC 4ZROA 3RXCA 3P70B 4GPGA 1O33A 2VGCC 2BY7X 5DP3A 2O8MA 3UY9A 1MTVA 4KKDA 2D2DA 5EW2H 4AYYB 2WPHS 3VPKA 2ASUB 4K8BA 1K9OE 1DWEH 2XBXA 4FUJA 1Y5AT 5CHAC 3BG4C 5GWZA 2F9NA 1O3EA 1FJSA 2WYJA 2PLXA 4GVUA 1BB0B 1GWAA 1FY5A 1PPGE 3RXSA 4NZQA 2BLVA 2H6MA 1FNIA 3G01A 4Y0YE 1TNJA 1P12E 1MU6B 2R9PA 1LKBA 3ZZ6A 3I78A 8GCHG 4QT8C 1SC8U 1QL8A 5PTPA 1T31A 3GCNA 1MUEB 1NRSH 1NRQH 8ESTE 3LJJA 4DIIH 1SFQB 2ZHEH 3A85A 1T4VH 1TNGA 1F0RA 1TLDA 1AIXH 5JDUB 1QTFA 1HUTH 4O97A 1AY6H 2G4UA 1AWFH 2Q6DA 1OP2A 1OSSA 1Y5BT 2PWXA 1ETSH 6GCHF 3MNBA 2PGBB 1P2QA 1V2VT 1DUEA 4CRAA 2M5TA 1JIRA 4CBOA 5GCHG
chains in the Genus database with same CATH superfamily
3PWCA 1V2LT 3VFEA 2GKVE 4ABDA 1BTHH 3F0PA 1Y3UA 1TGCA 4U32A 3E90B 4XOJA 2WV5A 1C1PA 1IQGA 3A7TA 1F0TA 2G00A 4UONA 2HLDD 2FWWA 3TGIE 1H8ED 4HI3A 2A4RA 3BF6H 1GJ7B 3VG8A 1RJXB 2OQUA 7KMEH 2EEKA 1Q2WA 1BRAA 2KX4A 2QF4A 1HAVA 1KSNA 1AVXA 2HWLB 5GJ4B 4RT0A 5F03A 4AORA 1P2IA 2CXVA 3VGCB 1RIWC 2FZZA 3AVZA 2GZ7A 3GYLB 3HATH 3JZ2B 1K1IA 3SU1A 1IQHA 2Z9GA 1EZXC 1NZQH 4UFGH 1EJMA 4ZHLU 1M9UA 5AF9H 2VVVA 2GV6A 1J15A 2ZC9H 3U69H 1H9HE 1VZQH 3DCLA 1G3CA 1IQNA 5DKMA 3TPIZ 5A09A 1KTSB 1C1WH 1D6RA 4YO9A 3HK3B 4X2YA 3M5LA 2FOGA 5L2ZH 2ZPSA 1C1UH 3BTHE 1W10U 3RXBA 2P3UB 4K1EA 3PRBA 1ACBE 1TGBA 2P93A 2EQNA 2XW9A 4RKJB 1NBME 3LPRA 4X6OA 3NWUA 1VITH 3AW1A 4GHQA 4I7YH 8KME2 1AFEH 1ORFA 3ATMA 5C3NA 2RFKC 1NU9A 1UTJA 1N6XA 1G2LA 3IG6B 4Q7ZA 2BDBA 2QXHA 3V0XA 3TH3H 1QIXB 4JYUH 5EQSA 2NU2E 2AYWA 4A6LA 5DN6D 1DUAA 2JETC 5B6OA 1GBLA 4JYTA 3KQDA 1MD7A 2WV4A 5C94A 4B6EA 2Z3CA 1MTNB 1W7XH 2FLRH 1UHBB 1EZUC 4BTUB 3U98H 1UMAH 1YPJH 3C27B 1HPGA 5EU8A 3ZYEA 1GBJA 4ASHA 3ZVEA 1BITA 5AHGH 4DURA 1O2GH 2BD5A 1ZMNA 5KEDA 2Z3DA 5LH8A 1ZSLA 3ZZ8A 1AVWA 4CHAC 3ZZ7A 4P00A 1HAGE 2UUYA 4TWYA 4KTSA 3NXPA 1P09A 1FIZA 1C1SA 1G2MA 3LH1A 1TNHA 2ANYA 1O31A 1SVPA 3QGNB 3MH7A 1GI0A 2ODPA 1WQVH 1AHTH 1HYLA 1LVMA 1PYTD 2PFEA 4AB9A 1O38A 4X2XA 4DOQA 5JBBS 2ZGBH 1RXPA 2XBVA 1ZMLA 1KDQB 4WXVA 2ZDKA 2SFAA 4OS5A 2TGPZ 3BTME 3DHKH 3MU0A 3RXFA 3TH2H 3GISB 1XUHA 4ABEA 1W12U 4F4OC 1QL9A 3VXFH 4ZKNU 2PGQB 1P3EA 1GJ6A 1THRH 2FPZA 2Y7XA 2F91A 3A7ZA 2XNDD 4CREA 4YM9A 1ELDE 5FCRA 1L1JA 2PUXB 2WHXA 4B1TA 1BHXB 3E0PB 2BDAA 2XXLA 3BV9B 1MQ5A 4Y71A 2FS9A 1YM0A 1YPGH 3TJNA 4YESB 1QB6A 1TFXA 3TNTA 2F4LA 1H9IE 2AMPA 5HMAA 4GCHF 1FLEE 2GVFA 3UOUA 1KXFA 3BTFE 4FUHA 1VR1H 1SG8B 4IC6A 4BOHA 1PYTC 1S81A 3PV4A 1SQTA 1TGNA 5HXFA 2F3CE 2XWBI 1XUJA 1IAUA 1O5CB 4X8UH 1P9UA 4Y7AA 2ILNA 2H2ZA 1C5MD 2FTMA 3PTBA 4NWKA 1XKAC 4YT6H 2FODA 3STIA 2KCPA 1OWEA 1P2OA 2C8ZB 2PR3A 4H42U 2JIZD 3M5OA 1G30B 2DUCA 1SGFG 1MABB 1V2OT 1V2PT 8LPRA 1O2XA 1O2PA 1EASA 1G3EA 1OWHA 3KF2A 3ZYDA 1FAKH 1ZZZA 2VWOA 1RRKA 2NU3E 4B74A 4P02A 2XBYA 3PO1C 1MZDA 4RSPA 2VU8E 1BA8B 1BTZA 1SB1H 2Z7FE 3S0NA 5CDFE 2ZCLP 4X1QU 4CBNA 3QTVH 3RC5A 4MPUA 4BXSA 1MTSA 2BOKA 2F9UA 3RXOA 1CU1A 2RG3A 1WXRA 1AVGH 4GLYA 2HPQH 3BEFB 4BTTB 1ELVA 4M7GA 1DY8A 3F9EA 1TOMH 1C1VH 1GJBB 1VCQA 4K60A 2BD9A 3KYGA 3LGUA 1NU7B 2TGDA 5KGOA 1EQ9A 2B7DH 4IN1A 1UVPA 1GGDC 5C2ZA 4ZXXH 3HPTB 3A7VA 2D8WA 2ZDNA 4THNH 1Z8GA 2GJGA 1O2OA 1QNJA 1ARCA 1ELBA 3O8BA 3TIUA 1GMDG 1L1GA 1HCGA 1RTKA 4FUCA 1QCPA 3SQHE 5J4QA 3A8DA 3GYMA 3RDZA 5E8EH 1GHBF 1GI5A 1NY22 1BCUH 5DP8A 5A0CA 1EPTA 1A46H 1ELEE 1XM1A 3SO3A 4I31A 3MFJA 1FY8E 7GCHF 1QBNA 1O5GH 3ZVFA 1BTUA 1FQ3A 4Z6AH 3TK5A 5HIZA 1QZ8A 1LKAA 1DWBH 3PO1B 4IMQA 1O5DH 4AFUA 2TIOA 2C8YB 1XVOA 1NFUA 4FU7A 2KFWA 3FP7E 1GJCB 1SL3A 1OYTH 2ZDAH 3RXPA 3A7XA 1C1QA 1EJAA 4X6MA 1TPAE 1NPMA 3AAVA 3FP6E 3C1KA 3T28A 1NM6A 1YP9A 1A7SA 1F7ZA 2J38A 3WW7A 3ZVAA 1YLCA 5EQQA 2BDYA 1O2TA 1C4Y2 3KCGH 1A3BH 1GMCG 4IC5A 2A5KA 3A81A 1VGCC 1H8HD 5FBIA 2BB4A 3DSGA 1UVOA 2QXIA 4ABAA 1GHAG 2WYGA 1QA0A 2HRVA 1GDNA 4MNXA 1FDPA 1LHGH 4CR9A 1KLIH 1EUFA 3P92A 3SUDA 4X1SU 1QL7A 1C2LA 3DFLA 1PQ7A 4CRGA 4BAHB 1PQ5A 1QB9A 4ABHA 4E05H 4TPYA 2AERH 5E2OA 1QRWA 1ZYOA 1DWCH 2RA3A 2BQ6B 3L3TA 3H7TA 4D7FA 1DITH 2H5CA 3DUXH 1D3PB 2YNBA 1HDTH 4OS1A 4A1XA 4F55A 1TNLA 1O3PB 1SGTA 1CHOG 1DFPA 2FI5E 2JJ2D 4JK5A 4BXWA 1SFIA 1CT2E 1GI8B 4OS2A 2Z3EA 1PFXC 1QJ7B 4ZKRU 2IJOB 5A8ZA 2WPLS 1AE5A 2TPIZ 3F9FA 2LELA 1ZJKA 2O8LA 1ZRBA 1VITG 1SGRE 1HAYB 2ZU4A 3E91A 1NT1A 1B0EA 1O2LA 5LGOA 1NRPH 1GGDB 5GDSH 1WYKA 4AOQA 3K6YA 3DSPA 1P2JA 5EXNA 1WUNH 5JBTA 3SUGA 5HM9A 4NGAH 3PB1E 3LC5A 2ZFQH 5TCCA 2W5EA 2XWAA 5JPMH 1BTYA 5FL7D 3LH3A 2V3MA 1K28D 4U01A 3IITA 1PPFE 1MBMA 2ZU2A 2J4IA 5HKKD 3QLPH 4AGKA 3SNAA 2STBE 4ZXYH 1HLTH 4UFEH 3ENSB 3ODFA 3Q76A 1XUGA 1TALA 3GY4A 1C1OA 2BDGA 2QYIA 3OY6U 2H1UA 2ZFFH 1T8MA 3LJOA 4J2YB 3W95A 1E37B 1UK3A 3ZV9A 1GHXH 1O3JA 1TMUH 1UTKA 1THSH 3UWJH 3BTEE 5DSFA 1Y8TA 1MBQA 3E8LA 3MU5A 3BG8A 2Z9KA 2VVUA 2Z6BD 3BTGE 3AAUA 3SI4H 4OS7A 5E0JA 2BY8X 3T25A 1GHYH 1SGQE 2Q6FA 5AFZH 1ZRKA 2FLBH 5E2PA 1P02A 2ZFTA 1AFQC 2ZDVH 4UD9H 1NBMD 1L2EA 1IQKA 2PV9B 2Y7ZA 4B76A 1TBRH 1TABE 4FUEA 3SU3A 2NU0E 1K1MA 1GBEA 1ETTH 1E35B 2V35A 1ZPCA 2ZDLA 2SGQE 1H8DH 1KXBA 2A0QB 2HOBA 3RXEA 3KQEA 3KQBA 1LHDH 2BZAA 1ZTJA 3TGJE 2P95A 5T6GA 3U8RH 1SLVB 3GCTF 3EGKH 1C2EA 5FHTA 4VGCB 2F9BH 3VGCC 9LPRA 1VKYA 5DGJA 4ZCNA 2SGEE 1C5PA 2PKSC 1G3BA 2H9EH 1TPSA 2Q1JA 1GVLA 5HIYA 4I8HA 4XBCA 1O3FA 3S7KB 1YPKH 4O03A 1VCPA 2XNIA 3Q3XA 3SORA 1Y59T 4MDSA 2HGTH 3NCLA 4Q7XA 4SGAE 3LONA 3UR6A 3RXAA 1DE7H 1P57B 5E0GA 1W8BH 4OS4A 3SJ9A 5DP5A 1Z6JH 2CMYA 4WMDA 3MO6A 4DJZB 2QA9E 1EATA 4AC9A 1CHGA 4X6PA 3SOSA 4UFDH 2BHGA 2JH6D 4ABIA 2EI8A 3AASA 3P6ZB 5C0UA 1TGTA 1AE8H 1H1BA 1P9SA 1WAYB 2WUCA 3SJKA 1GG6C 1DWDH 2BZ6H 5E0HA 7LPRA 2ZGHA 1LQEA 1C5UA 1CA0B 1UTMA 1O3IA 3SI3H 3OTJE 1OWKA 6GCHG 3DD2H 1QGFA 2HPPH 3ZZCA 1BMFD 3D65E 1FAXA 5GCHF 4RKOB 1Z7KA 1BIOA 4R8TB 4O3TA 3U9AH 1EP5A 3MMGA 1AI8H 2GCTC 1S6HA 1E1QD 1QBOA 1TBZH 3W94A 2BDIA 5TJXA 2A7HA 1UVTH 1TWXB 2XC5A 2RA0A 3HK6B 1MKWH 1FUJA 1HAPH 4FUGA 3PMBB 4BAQB 4D7GA 1AB9B 2JDID 2PP6A 1XUIA 1C5ZB 5CHAB 2J9NA 3BSQA 1C2FA 1TA2A 1P01A 4Q63A 1DICA 3ZZBA 1TYNA 4ASUD 1A0JA 1Y3YA 2AMDA 1C2HA 1A5IA 2BLOA 3MWIU 1YF4A 2KZ4A 1UCYK 1GDUA 3CNRA 3TJVA 1SLWB 2QXGA 2UUFB 2W3KA 1RTFB 3RXDA 1WCZA 2OK5A 1AUTC 4KGAA 1K1JA 1WSSH 5K7RA 1S5SA 4K3JA 3MH6A 1XMNB 1W14U 1D3QB 2Y6TA 2ZGCA 3TVJB 1C5RA 3GY3A 2M2AA 1EX3A 1FI8A 2EI7A 3ELAH 3FAOA 1INCA 3LGIA 1EFRD 4IGDA 5DP9A 3BTWE 2KR7A 1YYY1 1C9PA 3A8AA 1WTHD 1YCPK 1YWUA 1BMMH 1Y3VA 1O3AA 2W6ID 2GX4A 1AO5A 3QUMP 2YOLA 1DT2A 1W0YH 3QZQA 3SQEE 2GP9B 1ZOMA 3EA9A 5F8XA 1AB9C 1VGCB 3ODDA 3ZVDA 2HALA 1GMHG 3T2NA 1HFDA 1KIGH 1N8OC 3JZ1B 2CF8H 1PQAA 1O3DA 3FO8D 1GCDA 1O39A 1V2RT 3GCHC 2ANKH 3F68H 3ATIA 4YOIA 1BRBE 2V3HH 1COWD 2PKAA 1GI2A 1FN8A 4AFQA 2HLCA 2ANMH 4LOYH 2TGTA 1BBRE 1ZGVA 2O8TA 2ZU3A 1GVKB 3SHCH 1C5XB 1C2GA 1AMHA 1CA0C 1C1MA 1GJ8B 2A45B 3VXEH 4FU8A 2SNWA 2BY5X 2P8OB 2LP6A 1S83A 4KP0A 3TJUA 3UNSA 1NFXA 2ESTE 3GOVB 3LDXH 3MOCA 1H4WA 2QE7D 3K9XB 3M3VA 3V12A 4YLUA 3RMNH 3GDSA 1K1NA 1NRNH 1KXAA 5ESTE 3RXMA 3L6PA 1O34A 1GI3A 1GBTA 1BBRH 4FOUC 3P8GA 4ISNA 2DE8A 1SQAA 1P2NA 1W11U 4ZKOU 1DLEA 1E0FD 4K2YA 2J94A 1MAYA 3QDZB 4JK6A 2ULLA 1AQ7A 2QXJA 1KLTA 2I6QA 2OP9A 3BG4B 2OQ5A 1KDQA 1AFQB 3M37A 3P17H 1IHSH 5FBEA 1CGHA 1TRYA 1V2NT 1ZMJA 4X1RU 3SGQE 1LHEH 1BZXE 3OU0A 5TCAA 2G52A 2ZTXA 4XDEA 2OC1A 1EAWA 1KLJH 1ARBA 1CE5A 1J8AA 2J95A 2W7UA 2VH0A 2ANWA 4O3UA 4I8JA 4Y10E 4AGJA 4WXIA 3A88A 3F2HA 1SI5H 1TQ0B 2XCFA 4NCYA 2WINI 2ZZUH 1LO6A 4FUDA 1LQDB 1AN1E 4ABBA 4AFSA 4HTCH 4FU9A 1Z71A 1C4V2 1GI7B 4X8VH 1C5SA 1FMGA 1LHFH 1YPEH 3ATWA 2UWPA 3NRLA 2HNTE 1HAXB 3M7UA 2F9PA 3U1JB 1IOEA 1WBGB 1OKXA 2QIQA 3KEEA 4TT3D 5IYTA 2A2XH 1Q31A 1W0ZU 3TU7H 1E1RD 1QHRB 4B2CA 2PSXA 1WV7H 3SV9A 1KY9A 1VJ9U 4Y6DA 3TLOA 2Z9LA 6CHAC 1BRCE 1GBIA 2AH4X 5FX5A 2WSSD 5KECA 2GT8A 4WH8A 1S85A 3GY2A 4B2BA 3B9FH 3ZZ4A 1NFYA 1TPOA 2ZNKH 3F2GA 3GCHB 2D26C 1EAIA 1L4ZA 3A7YA 4FUIA 4KELA 1DDJA 4NFFA 1QQ4A 3B8JA 1ZPZA 4CRFA 2VJ1A 1DSTA 1C5NH 3A83A 3KN2A 4TWWA 3IWMA 2XYAA 1BMLA 1GG6B 2VIOA 2BVSH 4NIYA 3RXIA 1UCYE 4JCNA 1K2I1 1ANBA 4BAMB 1DXWA 1BUIA 4AX9H 1BTWA 5EW1H 4INHA 2GDDA 2FESH 3FZDA 1QY6A 1EKBB 2GZ9A 3LOXA 2WV9A 3Q3KA 4Y7BA 4B2AA 1XX9A 1JIMA 2VH6A 3S9CA 5EQRA 1P11E 1FY3A 1ZGIA 2GV7A 1KTTB 3VB3A 3A8BA 1C5LH 4X1PU 4U2WA 1W3CA 5JBAS 2WPJS 1FX0B 4WMEA 2LPRA 5EGMA 1GHBG 1BTPA 1G37A 1EOLA 1J16A 1ELGA 3QGJA 4UDWH 7GCHG 1MTUA 1H8IH 4NSVA 1C1RA 1MAXA 1BJVA 3ZZ3A 1SGIB 2R0LA 2J97A 2ZDMA 4K1SA 2QV1A 2AGEX 3UFAA 1CBWC 1SLXB 3ATLA 4Q7YA 1O32A 1C9TA 1DANH 2VWLA 2GMTC 1PPZA 5DPAA 3LKWA 5I46H 1S84A 3E3TA 4YTAA 1O5BB 3CS0A 2FP7B 1OWIA 5AFYH 6LPRA 1C4U2 3HGNA 2ZTYA 1C2KA 1EB1H 3LT3A 4INKA 3VB6A 4D9QA 1L1NA 3ZZ5A 1EZQA 1O2MA 1S0QA 1TMBH 1V2WT 5EJ1A 3CS7A 2JETB 2VBCA 3GY6A 1RD3B 2AFQB 1ANEA 2ZG0H 3SN8A 2G4TA 2A2QH 3OAAD 2FOHA 3RM2H 1MMJN 1TB6H 1HGTH 2CV3A 1UHBA 4RN6A 4NIWA 3UNRA 3SBKA 2A1DB 1V2UT 3U8OH 1MD8A 2PKAB 3V3MA 3A7WA 1CO7E 1FY1A 1IQIA 1PQ8A 3PYHA 2OD3B 4CRBA 1O5EH 1CSOE 2RDEA 3U1IB 1GI6A 2CHAB 3F6UH 2PHBA 2GCHG 1O2IA 2JKHA 2BD8A 2QN5T 1KXDA 1YLNA 4GCHG 1PPBH 4FETA 1OPHB 1AD8H 3A82A 2QF0A 4A5TS 4D9RA 1NFWA 2P16A 1O2UA 3SU6A 1F5KU 3RXLA 1KYNA 5JB9S 1SGEE 1TOCB 1KXEA 4AN7A 1B0FA 1O2ZA 2H5DA 1HJ9A 2SGDE 2ZCKP 3E0NB 2YNAA 1LPZB 2XC4A 1GPZA 2VIQA 1T8NA 3VB4A 3KYFA 1C2JA 4I32A 1W2KH 1JMOH 1CHOF 1VJAU 1T32A 2ODYB 3EQ0H 3P95A 5FPYA 3NZIA 1SQRA 2RCEA 3P8NA 4MPWA 2BXUH 3H7OA 5EOKA 5IDKA 4CH8B 1E34B 1HBTH 4I8GA 1C5VA 4B71A 4XSKU 2P59A 1DPOA 3UAIC 3GS9A 1GCTB 2ODQA 4IN2A 1HB0B 4M9FA 2DE9A 2IPHA 1GBCA 1JOUB 1ZHRA 2B8OH 3PLPA 1TX8A 3LGTA 1BBRK 1TX7A 1TQ7B 2R3YA 1LPKB 1O5AB 1YPMH 4NIXA 1MQ6A 3SNBA 1JXPA 2ZU1A 3EA8A 2FS8A 3MYWA 4HZHA 1IQMA 3T26A 2AGGX 2BY9X 5FPSA 2AS9A 1A0HB 3BTKE 4KTCA 1EJNA 2ZO3H 4Y0ZE 1BMNH 2YMSC 1OP8A 1QJ1B 3NPSA 2OC8A 1YLDA 2VWNA 4ZH8A 2H9TH 1W0JD 1GVZA 1E79D 1GJ9B 3FP8E 2K1QA 5GIBA 1S6FA 3KIDU 3RLYH 2VNTA 5ESBA 1SGFA 1A61H 1GL0E 2QF3A 3UPEA 1O30A 1SHYA 5EPYA 2A5AA 4X0WU 3D23A 2WPIS 2CGAA 2ZPQA 5EXLA 3VB5A 2GCTB 5SGAE 1U6QA 1NS3A 5EXMA 4NA8A 3E6PH 1Z8RA 1LCYA 3UWIA 2KAIB 2XRCA 3SV2H 3ZVBA 3T29A 3WWBA 1RIWB 1C5YB 1ELAA 3EYDA 3SW2B 3GICB 1MKXH 2FEQH 4MNYA 3EAJA 3T62A 1HAIH 4MPXA 4WMFA 1EAUA 2OC7A 1P06A 1BQYA 1OWJA 3QO6A 2O8WA 4OS6A 2ZU5A 1W7GH 1EXFA 1UJ1A 4NWLA 3NKKA 1E38B 3K2UA 3KHVA 1DS2E 3T5FH 4ISOA 4E7RG 1NO9H 2OCVB 2SGFE 1ETRH 4E06H 5LPFA 3QX5H 2A7CA 8GCHF 3TH4H 4Y8ZA 5EJLA 1O2HA 1GI9B 5T3HA 3SV7A 5EG4A 4NSYA 5AVDA 1DM4B 1NC6A 1PJPA 1V2KT 1AGJA 2STAE 1BHXF 1GMCF 3UTUH 2FOFA 3GDVA 3RXJA 4ISLA 1LHCH 2ZCHP 3RLWH 1GJ5H 5A0AE 5JBCS 3M35A 3MO3A 4GAWA 3WY8A 2FXRA 5BPEA 1O2YA 6ESTA 3ZZ9A 3RC4A 2ZEBA 4NIVA 1GBFA 1GBMA 2PW8H 4H6TA 2UWLA 3ESTA 7ESTE 2J98B 3V13A 3O8DA 3RU4E 2G5VA 4AG2A 2CK3D 1C2IA 1ANDA 1C5TA 2XOKD 2NU1E 1ZHMA 6CHAB 3I77A 1UW7A 3MI4A 5GNDA 1YKTA 2PTCE 3TK6A 1SR5C 1J9CH 2P94A 4MVNA 2VIWA 3MQKC 2G5NA 3M7QA 1NRRH 1OWDA 2ZKSA 1AZ8A 1GDQA 1B7XB 3KQ5A 2G51A 2WUBA 3SU4A 3URDA 3LGWA 1D4PB 2B0FA 2O9QA 2PTNA 3UB0A 1UTOA 1YPLH 2Y82A 1QBVH 4YOJA 1SOZA 4MG3A 2KM0A 3BEIB 2VIDA 2ZGXH 1C5OH 1BJUA 1ESAA 1SGNE 3SUFA 2A32A 5HM2A 3A84A 4WH6A 3ZV8A 3RXTA 1NN6A 1OHHD 2HVYB 2VVCA 3OE7D 1V2QT 2BDCA 3PRDA 1C1TA 2CN0H 1A3EH 2ZFSA 1A5GH 1WTGH 1NTPA 2BDHA 4BNRA 1YC0A 1GI4A 1KXCA 2OBQA 2AMQA 3PWBA 4UFFH 3PTNA 1SKYE 1T8OA 1O2SA 1RGQA 4WF8A 2FOMB 1XUFA 2BTCE 3SV8A 2R2WU 1ZR0A 2BY6X 1GL1A 1CT0E 1YBWA 1F5LA 2H9HA 4ACBA 3RMOH 3D49H 1P8VC 1D9IA 1GBDA 2K0QA 1G32B 4ACAA 1K1PA 1GCTC 2EY4C 3NK8A 1A2CH 1JRTA 3OSYA 4YT7H 3DSOA 4DW2U 2C8WB 3FFGA 2RDLA 3S69A 2QF5A 4FVDA 3D62A 3SHAH 3O8CA 3MU1A 1D3DB 1W13U 1ZSJA 2ZF0H 1WDIA 1Y3WA 1GBAA 1C5QA 1G3DA 2Y5GA 3I29A 4BAOB 5F8ZA 1S6LA 1T4UH 2GTBA 4MTBA 1N6YA 3SV6A 2A5IA 4IMZA 1AWHB 1GMHF 1UTPA 1YCPH 2ZGJA 1P2MA 1Z6EA 3FZZA 1LVYA 5DP6A 5EPNA 1SSXA 2FX4A 4SGBE 2TRMA 4BANB 2BLWA 1D6WA 4WWYA 1FONA 3BTDE 3SJOA 2QC2A 3GY7A 1IHTH 4H4FA 1QRXA 5C20A 1SBWA 3EA7A 2TBSA 1C5WB 1ZPBA 2BLQA 3N99A 3ZZDA 2AEIH 5EODA 2G8TA 4YZUA 2BD3A 1WQSA 1UCYH 1ANCA 4XFQA 2PKSB 4Q4LA 1O2JA 4CH2B 3A86A 1ESBA 3BTTE 1V2MT 3K6ZA 4PROA 1N8OB 4AB8A 2GMTB 5FXLA 4AZ2B 4XBBA 4XRNA 1DXPA 4IW4E 2V3OH 1ELFA 3FN8A 1FIWA 3GY8A 4OM9A 1A0LA 1AUJA 4UE7H 2ZI2H 3SGBE 3AW0A 1FPHH 2W7SA 1ZTLA 2Y81A 2GDEH 3UIRA 2ZHFH 4Y8YA 2FX6A 3KQCA 1C1NA 1MTNC 2FMJA 2WPMS 2A7JA 5T6FA 2A31A 4H6SB 4ABJA 3RXGA 1QFKH 2AHME 1IQFA 1O2NA 1ZJDA 5LPEA 2AIQA 2FTLE 4UEHH 1S82A 3WWFA 2WZQA 4FUBA 5CMXH 2P3FH 3RP2A 3PMJA 4WVPE 3B23B 1LDTT 5L2YH 3PV2A 5F6MA 4Z1MD 2FOEA 3SJIA 4E7NA 2BD4A 4O9VA 2SNVA 4J1YA 1OX1A 3SNEA 2EI6A 3N7DA 4HFPB 3RU4T 4HG6A 2A4QA 1F5RA 4F49A 3DT0H 1GHWH 4IS5A 5GXPA 1AKSB 2HVXA 5FCKA 3LC3A 4Y11E 1ZLRA 2BVRH 2ZPRA 4CRCA 2C3SA 3QN7A 1TRNA 2BQ7B 1K1LA 3RXKA 3PLKA 3M5NA 1ABJH 3MH4A 5DP4A 1QJ6B 3M36A 2J2UA 5C1YA 3M61U 2ZIQH 1V6DA 1SGYE 1MKWK 1J14A 1H9LB 1BT7A 1TA6A 3RXRA 2OTVA 3QZRA 1UVSH 3ITIA 4JZEH 2OBOA 2OUAA 3RMMH 2QCYA 5T1VA 3FANA 1TX6A 4I86A 3QTOH 1F0UA 3PROA 1XVMA 2Y5FA 1MCTA 5L30H 3MO9A 2J92A 5A8YA 1SGPE 4TYDA 5C5OA 3UUZA 2KCOA 4CHAB 3OX7U 2W3IA 3MNXA 2V6NA 5JB8S 2BD7A 1P10A 2W26A 1JBUH 1YGCH 3HGPA 4DCDA 1XXFA 4XBDA 3H5CB 2WPDD 3PLBA 5F53A 1O3HA 3UR9A 3O8RA 1GHZA 2D1JA 1DVAH 2IPQX 1HJAC 2CJIA 3A8CA 4MPVA 5LPRA 1P04A 3F1SB 4LZ4B 1V2JT 4I33A 1K0HA 2ALVA 1ZHPA 4X2WA 2FYRA 4K1TA 4KTUA 4Q80A 3V7TA 2VIVA 3FKSD 4B6FA 2ZA5A 4Y79A 5FAHA 2F9OA 1O3OA 1OXGA 1FPCH 4K69A 2UUJB 4A7IB 1GMDF 2JH0D 1K1OA 1Z1JA 2XCNA 5EJZA 2ZHWH 4LZ1H 1P2KA 1C2DA 5DP7A 4INLA 1O3GA 1EP6A 3QK1A 3MNSA 1Q3XA 3N7OA 1O2KA 1O2VA 4DIHH 1O35A 5A0BA 2ZTZA 3EDXB 5JYIA 4ZUHA 1T8LA 4X8SH 1A1RA 1DSUA 1TIOA 5B6LA 1DOJA 2J98A 2G81E 2A4OA 2GZ8A 2NU4E 2Y5HA 3OY5U 4JZDH 4ZHMU 3RXVA 3T27A 2C93B 4JZ1A 4ESTE 1XUKA 1Z8IB 3TJOA 1Y5UT 2C4FH 5DJ7A 1DLKB 2OXSA 1GJ4H 5G4BA 2ZHQH 1IQEA 2BX3A 3LGYA 4ZAEA 2Z9IA 3A80A 1MU8B 3ZVGA 3ZZAA 2QY0B 4FUFA 1K22H 1EB2A 3E16B 2BMGB 3GDUA 1O2QA 4GUXA 2HNTF 4DY7B 3NUMA 1GHAF 3BEUA 3OYPA 1PPEE 1O36A 3RXHA 3RC6A 1AZZA 1UK4A 1BRUP 3SU2A 3SZEA 1P05A 1EPTB 2OLGA 2ZECA 4IBLH 9ESTA 3GCOA 4YLQH 4D8NA 2R2MB 2XC0A 4MQAA 3KGPA 1SQOA 4K5ZA 2UWOA 1IQJA 1E36B 1ESTA 3UNQA 1HJAB 2OC0A 2SGAA 1FN6A 2BQWB 1L4DA 3A89A 5I25A 4GHTA 3LGVA 3HKIB 3F9HA 1SGDE 5IK2D 5HYOA 2ZFPH 1GJDB 3R0FA 2FI3E 5EIYA 5DO4H 2VINA 3HKJB 3SNDA 3Q77A 1NESE 2FYQA 4LK4A 4ABFA 3CENA 4VGCC 3RUOA 3SU5A 4NA7A 1TE0A 5ETXA 2PSYA 5C1XA 2C90B 3SYJA 1J17T 2BOHB 1OYQA 1OOKB 2F83A 1HAZB 1O3LA 1O3CA 1O3NA 1VCWA 1KMHB 2F9VA 2QAAA 1HRTH 1HIAB 2FI4E 1LTOA 4A1VA 4Q2KA 4YXWD 3BN9A 2LNCA 3DFJA 1LVOA 1D3TB 1RFNA 3PM3A 1CBWB 2FM2A 2KCYA 3S7HB 3LU9B 1FV9A 2ZHDA 3EE7A 1MZAA 3M3SA 2AIPA 4ISHH 2QGRA 2ZQ1A 3AK5A 2WPKS 4ZHAA 1O2WA 2ZWLH 2Y80A 2B9LA 5T6DA 1TONA 3H09A 3F0OA 2BXTH 1AKSA 1LVBA 2BX4A 1UTQA 1YCPM 1HAHH 1MTWA 5C67A 2O8UA 3R3GB 1YPHE 2AGIX 4MNWA 2VIPA 1GJAB 3ZIAD 1CGIE 2Z9JA 2A4GA 1V2ST 2NWNA 2GD4B 1G9IE 1O5FH 3SJ8A 3LIWA 3VEQB 3A87A 1SMFE 1ABIH 4R0IA 1MKXK 2J34A 1N1LA 1WU1A 5CE1A 3L33A 1L0ZA 2CF9H 4JMYA 2Z94A 2KAIA 2Q6GA 2FOBA 1O3MA 1IQLA 1FY4A 3OEHD 4K8YA 2IN2A 3MH5A 5C1UA 2IJD1 4F48B 4OGXA 2JH5D 1CGJE 2FOAA 1GBHA 4LXBH 4Y8XA 2FIRH 4JYVH 3BIUH 1DY9A 4CR5A 1GHVH 1W0KD 4ZMAH 4TPIZ 4AFZA 1TMTH 4X2VA 3SNCA 1UK2A 1HNEE 4ABGA 4BAKB 2I6SA 3M5MA 3BIVH 4A92A 5DG6A 4NFEA 2OINA 3QWCH 3TGKE 4WY3A 2HNTC 4NA9H 3ZVCA 3TK9A 3RXUA 3MTYA 3M3TA 1EPTC 1TPPA 1S0RA 2BYAX 2GGVB 1LMWB 4NZLA 1O2RA 4YOGA 3GCTG 3Q00A 4ISIH 1G36A 1Z8JB 1OP0A 5L6NH 2C8XB 4A1TA 2EA3A 4D76A 2YMSD 1C2MA 3UREA 3FVFB 5C0TA 1UO6A 2K8IA 4BTIB 4AG1A 1THPB 4WJG2 4DT7B 1CA8B 4DGJA 4CRDA 5FX6A 1TRMA 2GT7A 3SGAE 1EAXA 4Z0KA 1O0DH 4TY7A 3SU0A 4MNVA 1DX5M 1V2TT 5DK1A 5H4IB 3RM0H 3RXQA 1SHHB 1XXDA 3DA9B 2PUQH 1B5GH 3EE0B 5F8TA 2ALPA 3ATKA 1O3BA 1YPHC 4FVBA 1GI1A 1TNIA 3FOAA 4X1NU 3U28C 3F9GA 3UQVA 5BRRE 4Y76A 4X6NA 3UQOA 1F92A 1HAVB 2L6OA 3VB7A 1PPCE 2P3TB 1GBBA 2VB0A 3RMLH 1XKBC 3UOPA 1SPJA 3BTQE 5GPIB 3TITA 4OGYA 2GCHF 1NROH 3CP7A 1ZTKA 2L74A 3K65B 2V0BA 4ZKSU 2VGCB 1CVWH 2B5TB 2TGAA 1QA7A 3MNCA 4GSOA 1SOTA 2V7QD 1VITF 3E1XB 2YMSB 4RT1A 4I8LA 4I8KA 2XBWA 2UUKB 2ZQ2A 3F3BA 4DVAU 1OS8A 2BD2A 1FXYA 3MHWU 4MLFB 1K21H 2VWMA 1CT4E 1JWTA 1T7CA 2FOCA 5A8XA 1TBQH 3P8OA 1ELCA 1TGSZ 2ZP0H 4JZIA 2JJ1D 1ELTA 3S9BA 1BMAA 2P8OC 5HGGA 5ABWA 1Y3XA 1ZSKA 1MCVA 4NG9H 1TAWA 1QR3E 5K0HA 2SGPE 5A2MH 1O37A 3U8TH 5CHBA 1V3XA 2BVXH 4DG4A 2KCAA 1P03A 3OFND 3MU8A 1LPGB 3URCA 1QB1A 3MU4A 4DT4A 1Z1IA 4HGCA 1AU8A 4RI0A 1UTNA 1F2SE 4TSFD 4JZFH 3STJA 1HXFH 1QQUA 1X7AC 4TY6A 2THFB 2F43B 1TNKA 1UTLM 1HAOH 2J5UA 1CQQA 5C17A 1BTXA 3KL6A 1RS0A 3PV5A 1P0SH 1A5HA 3GY5A 3SZNA 1SGCA 4U30A 2G55A 4AYVB 2XTTB 1SLUB 3P8FA 2R0KA 4B73A 1HIAA 2FDAA 2EC9H 3PMHB 1GBKA 4XE4A 4XD7D 3KNXA 1P3CA 3M7TA 1FZZA 1EOJA 3RU4D 3PMAB 1WOFA 2FO9A 1BDAA 1ID5H 3Q3YA 2R3UA 3OTPA 4B75A 1RTLA 1HJ8A 1JRSA 5C5NA 1A4WH 1QRZA 1PPHE 1MH0A 2CHAC 1UVUH 4FXGH 5FPTA 1HV7A 2IOTA 1QURH 3SUEA 3TNSA 1F0SA 1BOQA 2ZFRH 1HXEH 1O3KA 2BM2A 3S9AA 5J4SA 4X8TH 1EZSC 4ZROA 3RXCA 3P70B 4GPGA 1O33A 2VGCC 2BY7X 5DP3A 2O8MA 3UY9A 3F2FA 1MTVA 4KKDA 2D2DA 5EW2H 4AYYB 2WPHS 3VPKA 2ASUB 4K8BA 1K9OE 1DWEH 2XBXA 4FUJA 1Y5AT 5CHAC 3BG4C 5GWZA 2F9NA 1O3EA 1FJSA 1YY3A 2WYJA 2W6JD 2PLXA 4GVUA 1BB0B 1GWAA 1FY5A 1PPGE 3RXSA 4NZQA 2BLVA 2H6MA 1FNIA 3G01A 4Y0YE 1TNJA 1P12E 1MU6B 2R9PA 1LKBA 3ZZ6A 3I78A 8GCHG 4QT8C 1SC8U 1QL8A 5PTPA 1T31A 3GCNA 1MUEB 1NRSH 1NRQH 8ESTE 3LJJA 4DIIH 1SFQB 2ZHEH 3A85A 1T4VH 1TNGA 1F0RA 1TLDA 1AIXH 5JDUB 1QTFA 1HUTH 4O97A 1AY6H 2G4UA 1AWFH 2Q6DA 1OP2A 1OSSA 1Y5BT 2PWXA 1ETSH 3N7EA 6GCHF 3MNBA 2PGBB 1P2QA 1V2VT 1DUEA 4CRAA 2M5TA 1JIRA 4CBOA 3OEED 3W1EA 5GCHG
chains in the Genus database with same CATH topology
3PWCA 1V2LT 3VFEA 2GKVE 4ABDA 1BTHH 1Y3UA 1TGCA 4U32A 3E90B 4XOJA 2WV5A 1C1PA 1IQGA 3A7TA 1F0TA 2G00A 4UONA 2FWWA 3TGIE 4HI3A 2A4RA 3BF6H 1GJ7B 1RJXB 2OQUA 7KMEH 2EEKA 1Q2WA 1BRAA 1HAVA 1KSNA 1AVXA 2HWLB 5GJ4B 5F03A 4AORA 1P2IA 2CXVA 3VGCB 1RIWC 2FZZA 3AVZA 2GZ7A 3GYLB 3HATH 3JZ2B 1K1IA 3SU1A 1IQHA 2Z9GA 1EZXC 1NZQH 4UFGH 1EJMA 4ZHLU 1M9UA 5AF9H 2VVVA 2GV6A 1J15A 2ZC9H 3U69H 1H9HE 1VZQH 1G3CA 1IQNA 5DKMA 3TPIZ 5A09A 1KTSB 1C1WH 1D6RA 4YO9A 3HK3B 4X2YA 3M5LA 2FOGA 5L2ZH 2ZPSA 1C1UH 3BTHE 1W10U 3RXBA 2P3UB 4K1EA 1ACBE 1TGBA 2P93A 2XW9A 4RKJB 3LPRA 4X6OA 3NWUA 1VITH 3AW1A 4GHQA 4I7YH 8KME2 1AFEH 1ORFA 3ATMA 5C3NA 1NU9A 1UTJA 1N6XA 1G2LA 3IG6B 4Q7ZA 2BDBA 2QXHA 3V0XA 3TH3H 1QIXB 4JYUH 5EQSA 2NU2E 2AYWA 4A6LA 1DUAA 2JETC 5B6OA 1GBLA 4JYTA 3KQDA 1MD7A 2WV4A 2Z3CA 1MTNB 1W7XH 2FLRH 1UHBB 1EZUC 4BTUB 3U98H 1UMAH 1YPJH 3C27B 1HPGA 5EU8A 3ZYEA 1GBJA 4ASHA 3ZVEA 1BITA 5AHGH 4DURA 1O2GH 2BD5A 1ZMNA 5LH8A 2Z3DA 1ZSLA 3ZZ8A 1AVWA 4CHAC 3ZZ7A 1HAGE 2UUYA 4TWYA 4KTSA 3NXPA 1P09A 1FIZA 1C1SA 1G2MA 3LH1A 1TNHA 2ANYA 1O31A 1SVPA 3QGNB 3MH7A 1GI0A 2ODPA 1WQVH 1AHTH 1HYLA 1LVMA 1PYTD 2PFEA 4AB9A 1O38A 4X2XA 4DOQA 5JBBS 2ZGBH 1RXPA 2XBVA 1ZMLA 1KDQB 4WXVA 2ZDKA 2SFAA 4OS5A 2TGPZ 3BTME 3DHKH 3MU0A 3RXFA 3TH2H 3GISB 1XUHA 4ABEA 1W12U 4F4OC 1QL9A 3VXFH 4ZKNU 2PGQB 1P3EA 1GJ6A 1THRH 2FPZA 2Y7XA 2F91A 3A7ZA 4CREA 4YM9A 1ELDE 5FCRA 1L1JA 2PUXB 4B1TA 1BHXB 3E0PB 2BDAA 2XXLA 3BV9B 1MQ5A 4Y71A 2FS9A 1YM0A 1YPGH 3TJNA 4YESB 1QB6A 1TFXA 3TNTA 1H9IE 2AMPA 5HMAA 4GCHF 1FLEE 2GVFA 3UOUA 1KXFA 3BTFE 4FUHA 1VR1H 1SG8B 4IC6A 4BOHA 1PYTC 1S81A 3PV4A 1SQTA 1TGNA 5HXFA 2F3CE 2XWBI 1XUJA 1IAUA 1O5CB 4X8UH 1P9UA 4Y7AA 2ILNA 2H2ZA 1C5MD 2FTMA 3PTBA 4NWKA 1XKAC 4YT6H 2FODA 3STIA 1OWEA 1P2OA 2C8ZB 2PR3A 4H42U 3M5OA 1G30B 2DUCA 1SGFG 1V2OT 1V2PT 8LPRA 1O2XA 1O2PA 1EASA 1G3EA 1OWHA 3KF2A 3ZYDA 1FAKH 1ZZZA 2VWOA 1RRKA 2NU3E 4B74A 2XBYA 3PO1C 1MZDA 4RSPA 2VU8E 1BA8B 1BTZA 1SB1H 2Z7FE 3S0NA 2ZCLP 4X1QU 4CBNA 3QTVH 3RC5A 4MPUA 4BXSA 1MTSA 2BOKA 2F9UA 3RXOA 1CU1A 2RG3A 1AVGH 4GLYA 2HPQH 3BEFB 4BTTB 1ELVA 4M7GA 1DY8A 3F9EA 1TOMH 1C1VH 1GJBB 1VCQA 4K60A 2BD9A 3LGUA 1NU7B 2TGDA 1EQ9A 2B7DH 4IN1A 1UVPA 1GGDC 5C2ZA 4ZXXH 3HPTB 3A7VA 2D8WA 2ZDNA 4THNH 1Z8GA 1O2OA 1QNJA 1ARCA 1ELBA 3O8BA 3TIUA 1GMDG 1L1GA 1HCGA 1RTKA 4FUCA 1QCPA 3SQHE 5J4QA 3A8DA 3GYMA 3RDZA 5E8EH 1GHBF 1GI5A 1NY22 1BCUH 5DP8A 5A0CA 1EPTA 1A46H 1ELEE 1XM1A 3SO3A 4I31A 3MFJA 1FY8E 7GCHF 1QBNA 1O5GH 3ZVFA 1BTUA 1FQ3A 4Z6AH 3TK5A 1LKAA 1DWBH 3PO1B 4IMQA 1O5DH 4AFUA 2TIOA 2C8YB 1XVOA 1NFUA 4FU7A 3FP7E 1GJCB 1SL3A 1OYTH 2ZDAH 3RXPA 3A7XA 1C1QA 1EJAA 4X6MA 1TPAE 1NPMA 3AAVA 3FP6E 3C1KA 3T28A 1NM6A 1YP9A 1A7SA 1F7ZA 2J38A 3ZVAA 1YLCA 5EQQA 2BDYA 1O2TA 1C4Y2 3KCGH 1A3BH 1GMCG 4IC5A 2A5KA 3A81A 1VGCC 5FBIA 2BB4A 1UVOA 2QXIA 4ABAA 1GHAG 2WYGA 1QA0A 2HRVA 1GDNA 4MNXA 1FDPA 1LHGH 4CR9A 1KLIH 1EUFA 3P92A 3SUDA 4X1SU 1QL7A 1C2LA 3DFLA 1PQ7A 4CRGA 4BAHB 1PQ5A 1QB9A 4ABHA 4E05H 4TPYA 2AERH 5E2OA 1QRWA 1ZYOA 1DWCH 2RA3A 2BQ6B 3L3TA 3H7TA 4D7FA 1DITH 2H5CA 3DUXH 1D3PB 2YNBA 1HDTH 4OS1A 4A1XA 1TNLA 1O3PB 1SGTA 1CHOG 1DFPA 2FI5E 4JK5A 4BXWA 1SFIA 1CT2E 1GI8B 4OS2A 2Z3EA 1PFXC 1QJ7B 4ZKRU 2IJOB 5A8ZA 2WPLS 1AE5A 2TPIZ 3F9FA 2O8LA 1ZJKA 1ZRBA 1VITG 1SGRE 1HAYB 2ZU4A 3E91A 1NT1A 1B0EA 1O2LA 5LGOA 1NRPH 1GGDB 5GDSH 1WYKA 4AOQA 3K6YA 1P2JA 5EXNA 1WUNH 5JBTA 3SUGA 5HM9A 4NGAH 3PB1E 3LC5A 2ZFQH 5TCCA 2W5EA 2XWAA 5JPMH 1BTYA 3LH3A 1K28D 4U01A 3IITA 1PPFE 1MBMA 2ZU2A 2J4IA 3QLPH 4AGKA 3SNAA 2STBE 4ZXYH 1HLTH 4UFEH 3ENSB 3ODFA 3Q76A 1XUGA 1TALA 3GY4A 1C1OA 2BDGA 2QYIA 3OY6U 2H1UA 2ZFFH 1T8MA 3LJOA 4J2YB 3W95A 1E37B 1UK3A 3ZV9A 1GHXH 1O3JA 1TMUH 1UTKA 1THSH 3UWJH 3BTEE 1Y8TA 1MBQA 3E8LA 3MU5A 3BG8A 2Z9KA 2VVUA 2Z6BD 3BTGE 3AAUA 3SI4H 4OS7A 5E0JA 2BY8X 3T25A 1GHYH 1SGQE 2Q6FA 5AFZH 1ZRKA 2FLBH 5E2PA 1P02A 2ZFTA 1AFQC 2ZDVH 4UD9H 1L2EA 1IQKA 2PV9B 2Y7ZA 4B76A 1TBRH 1TABE 4FUEA 3SU3A 2NU0E 1K1MA 1GBEA 1ETTH 1E35B 2V35A 1ZPCA 2ZDLA 2SGQE 1H8DH 1KXBA 2A0QB 2HOBA 3RXEA 3KQEA 3KQBA 1LHDH 2BZAA 1ZTJA 3TGJE 2P95A 5T6GA 3U8RH 1SLVB 3GCTF 3EGKH 1C2EA 5FHTA 4VGCB 2F9BH 3VGCC 9LPRA 5DGJA 2SGEE 1C5PA 2PKSC 1G3BA 2H9EH 1TPSA 2Q1JA 1GVLA 4I8HA 4XBCA 1O3FA 3S7KB 1YPKH 4O03A 1VCPA 2XNIA 3Q3XA 3SORA 1Y59T 4MDSA 2HGTH 3NCLA 4Q7XA 4SGAE 3LONA 3UR6A 3RXAA 1DE7H 1P57B 5E0GA 1W8BH 4OS4A 3SJ9A 5DP5A 1Z6JH 2CMYA 4WMDA 3MO6A 4DJZB 2QA9E 1EATA 1CHGA 4X6PA 3SOSA 4UFDH 2BHGA 2JH6D 4ABIA 2EI8A 3AASA 3P6ZB 1TGTA 1AE8H 1H1BA 1P9SA 1WAYB 2WUCA 3SJKA 1GG6C 1DWDH 2BZ6H 5E0HA 7LPRA 2ZGHA 1LQEA 1C5UA 1CA0B 1UTMA 1O3IA 3SI3H 3OTJE 1OWKA 6GCHG 3DD2H 1QGFA 2HPPH 3ZZCA 3D65E 1FAXA 5GCHF 4RKOB 1Z7KA 1BIOA 4R8TB 4O3TA 3U9AH 1EP5A 3MMGA 1AI8H 2GCTC 1S6HA 1QBOA 1TBZH 3W94A 2BDIA 5TJXA 2A7HA 1UVTH 1TWXB 2XC5A 2RA0A 3HK6B 1MKWH 1FUJA 1HAPH 4FUGA 3PMBB 4BAQB 4D7GA 1AB9B 1XUIA 1C5ZB 5CHAB 2J9NA 3BSQA 1C2FA 1TA2A 1P01A 1DICA 3ZZBA 1TYNA 1A0JA 1Y3YA 2AMDA 1C2HA 1A5IA 2BLOA 3MWIU 1YF4A 3TJVA 1UCYK 1GDUA 1SLWB 2QXGA 2UUFB 2W3KA 1RTFB 3RXDA 1WCZA 1AUTC 4KGAA 1K1JA 1WSSH 5K7RA 1S5SA 4K3JA 3MH6A 1XMNB 1W14U 1D3QB 2Y6TA 2ZGCA 3TVJB 1C5RA 3GY3A 1EX3A 1FI8A 2EI7A 3ELAH 3FAOA 1INCA 3LGIA 5DP9A 4IGDA 3BTWE 1YYY1 1C9PA 3A8AA 1WTHD 1YCPK 1BMMH 1Y3VA 1O3AA 2GX4A 1AO5A 3QUMP 2YOLA 1DT2A 1W0YH 3QZQA 3SQEE 2GP9B 1ZOMA 3EA9A 5F8XA 1AB9C 1VGCB 3ODDA 3ZVDA 2HALA 1GMHG 3T2NA 1HFDA 1KIGH 1N8OC 3JZ1B 2CF8H 1PQAA 1O3DA 1GCDA 1O39A 1V2RT 3GCHC 2ANKH 3F68H 3ATIA 4YOIA 1BRBE 2V3HH 2PKAA 1GI2A 1FN8A 4AFQA 2HLCA 2ANMH 4LOYH 2TGTA 1BBRE 1ZGVA 2O8TA 2ZU3A 1GVKB 3SHCH 1C5XB 1C2GA 1AMHA 1CA0C 1C1MA 1GJ8B 2A45B 3VXEH 4FU8A 2SNWA 2BY5X 2P8OB 1S83A 4KP0A 3TJUA 3UNSA 1NFXA 2ESTE 3GOVB 3LDXH 3MOCA 1H4WA 3K9XB 3V12A 3M3VA 4YLUA 3RMNH 3GDSA 1K1NA 1NRNH 1KXAA 5ESTE 3RXMA 3L6PA 1O34A 1GI3A 1GBTA 1BBRH 3P8GA 4ISNA 2DE8A 1SQAA 1P2NA 1W11U 4ZKOU 1DLEA 1E0FD 4K2YA 2J94A 1MAYA 3QDZB 4JK6A 2ULLA 1AQ7A 2QXJA 1KLTA 2I6QA 2OP9A 3BG4B 2OQ5A 1KDQA 1AFQB 3M37A 3P17H 1IHSH 5FBEA 1CGHA 1TRYA 1V2NT 1ZMJA 4X1RU 3SGQE 1LHEH 1BZXE 3OU0A 5TCAA 2G52A 2ZTXA 4XDEA 2OC1A 1EAWA 1KLJH 1ARBA 1CE5A 1J8AA 2J95A 2W7UA 2VH0A 2ANWA 4O3UA 4I8JA 4Y10E 4AGJA 4WXIA 3A88A 1SI5H 1TQ0B 2XCFA 4NCYA 2WINI 2ZZUH 1LO6A 4FUDA 1LQDB 1AN1E 4ABBA 4AFSA 4HTCH 4FU9A 1Z71A 1C4V2 1GI7B 4X8VH 1C5SA 1FMGA 1LHFH 1YPEH 3ATWA 2UWPA 2HNTE 1HAXB 3M7UA 2F9PA 3U1JB 1IOEA 1WBGB 1OKXA 2QIQA 3KEEA 5IYTA 2A2XH 1Q31A 1W0ZU 3TU7H 1QHRB 4B2CA 2PSXA 1WV7H 3SV9A 1KY9A 1VJ9U 4Y6DA 3TLOA 2Z9LA 6CHAC 1BRCE 1GBIA 2AH4X 5FX5A 2GT8A 4WH8A 1S85A 3GY2A 4B2BA 3B9FH 3ZZ4A 1NFYA 1TPOA 2ZNKH 3GCHB 2D26C 1EAIA 1L4ZA 3A7YA 4FUIA 4KELA 1DDJA 4NFFA 1QQ4A 3B8JA 1ZPZA 4CRFA 2VJ1A 1DSTA 1C5NH 3A83A 3KN2A 4TWWA 3IWMA 2XYAA 1BMLA 1GG6B 2VIOA 2BVSH 4NIYA 3RXIA 1UCYE 4JCNA 1K2I1 1ANBA 4BAMB 1DXWA 1BUIA 4AX9H 1BTWA 5EW1H 4INHA 2GDDA 2FESH 3FZDA 1QY6A 1EKBB 2GZ9A 3LOXA 3Q3KA 4Y7BA 4B2AA 1XX9A 1JIMA 2VH6A 3S9CA 5EQRA 1P11E 1FY3A 1ZGIA 2GV7A 1KTTB 3VB3A 3A8BA 1C5LH 4X1PU 4U2WA 1W3CA 5JBAS 2WPJS 4WMEA 5EGMA 2LPRA 1GHBG 1BTPA 1G37A 1EOLA 1J16A 1ELGA 3QGJA 4UDWH 7GCHG 1MTUA 1H8IH 4NSVA 1C1RA 1MAXA 1BJVA 3ZZ3A 1SGIB 2R0LA 4K1SA 2ZDMA 2QV1A 2AGEX 3UFAA 1CBWC 1SLXB 3ATLA 4Q7YA 1O32A 1C9TA 1DANH 2VWLA 2GMTC 1PPZA 5DPAA 3LKWA 5I46H 1S84A 3E3TA 4YTAA 1O5BB 3CS0A 2FP7B 1OWIA 5AFYH 6LPRA 1C4U2 3HGNA 2ZTYA 1C2KA 1EB1H 3LT3A 4INKA 3VB6A 4D9QA 1L1NA 3ZZ5A 1EZQA 1O2MA 1S0QA 1TMBH 1V2WT 3CS7A 2JETB 3GY6A 1RD3B 2AFQB 1ANEA 2ZG0H 3SN8A 2G4TA 2A2QH 2FOHA 3RM2H 1MMJN 1TB6H 1HGTH 2CV3A 1UHBA 4RN6A 4NIWA 3UNRA 3SBKA 2A1DB 1V2UT 3U8OH 1MD8A 2PKAB 3V3MA 3A7WA 1CO7E 1FY1A 1IQIA 1PQ8A 3PYHA 2OD3B 4CRBA 1O5EH 1CSOE 3U1IB 1GI6A 2CHAB 3F6UH 2PHBA 2GCHG 1O2IA 2JKHA 2BD8A 2QN5T 1KXDA 4GCHG 1PPBH 1OPHB 1AD8H 3A82A 2QF0A 4A5TS 4D9RA 1NFWA 2P16A 1O2UA 3SU6A 1F5KU 3RXLA 1KYNA 5JB9S 1SGEE 1TOCB 1KXEA 4AN7A 1B0FA 1O2ZA 2H5DA 1HJ9A 2SGDE 2ZCKP 3E0NB 2YNAA 1LPZB 2XC4A 1GPZA 2VIQA 1T8NA 3VB4A 4I32A 1C2JA 1W2KH