2ZDSA

Crystal structure of sco6571 from streptomyces coelicolor a3(2)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
PRNFTLFTGQWADLPLEEVCRLARDFGYDGLELACWGDHFEVDKALADPSYVDSRHQLLDKYGLKCWAISNHLVGQAVCDAIIDERHEAILPARIWGDGDAEGVRQRAAAEIKDTARAAARLGVDTVIGFTGSAIWHLVAMFPPAPESMIERGYQDFADRWNPILDVFDAEGVRFAHEVHPSEIAYDYWTTHRALEAVGHRPAFGLNFDPSHFVWQDLDPVGFLWDFRDRIYHVDCKEARKRLDGRNGRLGSHLPWGDPRRGWDFVSAGHGDVPWEDVFRMLRSIDYQGPVSVEWEDAGMDRLQGAPEALTRLKAFDFEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of SCO6571 from Streptomyces coelicolor A3(2)
pubmed rcsb
source organism Streptomyces coelicolor
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 111
structure length 321
sequence length 321
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
A PF07582 AP_endonuc_2_N AP endonuclease family 2 C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2zdsA00
4PFHA 3QYSA 1XIBA 1XIFA 4XIMA 3KBJA 1S5MA 2HCVA 2G0WA 3KCJA 3TVAA 7XIMA 1XIDA 4G56A 3BDKA 5XIAA 1XIHA 4QDPA 9XIMA 1BXBA 1CLKA 1O1HA 2GVEA 1YX1A 3KBVA 3VNLA 1A0CA 1DIDA 4QDWA 3ITTA 2XISA 3VNIA 1XLBA 5EMLA 1XIGA 3UU0A 2XIMA 1QT1A 4ZB2A 4KW2A 3M0LA 1XINA 3BANA 5AVHA 3XIMA 1I60A 2OU4A 3QC0A 1XLFA 3ITVA 6XIAA 2X7WA 4YTTA 2G4JA 3C0SA 4QE4A 8XIMA 4YTUA 1XLIA 5B7ZA 1XLMA 3CQJA 3UXIA 3VNKA 4A8NA 3KCOA 2HK0A 3IUIA 4QE5A 3L23A 3IUHA 4HHMA 2GUBA 3IUDA 5B7YA 1XIMA 4E3VA 3M0HA 1XIEA 1XICA 5EMMA 3XISA 1MNZA 4K3ZA 5EMKA 3BZJA 2NQHA 1XISA 4XSMA 1GW9A 3AALA 4XIAA 1XLHA 4YTRA 3AYVA 1XLLA 3M0MA 3UA4A 4Q7IA 1A0DA 3FVMA 3VNMA 1XYAA 1I6NA 1XLKA 3C0LA 3OBEA 3QZAA 5H6HA 4DUOA 3AAMA 4GLEA 2QUNA 4LNCA 1XIIA 2ZVRA 2NQJA 3KCLA 5FA5A 4QE1A 3BZGA 3ITLA 5XINA 3KBSA 5I7GA 3U0HA 4EACA 3DBNA 4QEHA 5J8LA 4DVOA 3ITXA 1A0EA 1XIJA 2QULA 6XIMA 3DX5A 3JU2A 1DE5A 1DE6A 4ZB0A 3CQHA 1XLJA 1XYBA 4HHLA 3CQIA 4XKMA 5C9ZA 1XLDA 3UA3A 4XISA 3WQOA 5TNVA 4OVXA 1QUMA 1K77A 2HK1A 4US6A 3P6LA 2GLKA 2X7VA 4A8RA 3C0QA 4X63A 4A8IA 4J4KA 1XLAA 1XLCA 2NQ9A 2QW5A 3P14A 1S5NA 2XINA 1DIEA 2ZDSA 3BWWA 5EMJA 1D8WA 8XIAA 1TZ9A 3KBMA 2Q02A 3M0VA 1XYCA 4X61A 1XP3A 3QXBA 3KWSA 1XYMA 3ITYA 3KBWA 3N4AA 2J6VA 1BXCA 3NGFA 3TC3A 9XIAA 1XLGA 3KTCA 2QUMA 4YTQA 3XINA 4W4QA 1XYLA 3KBNA 3VNJA 2I56A 3CWHA 4K1GA 5H1WA 4HNOA 4HGXA 3U3HA 4GJJA 4ZB5A 3GNXA 1OADA 1MUWA 4GQBA 5AVNA 3CQKA 4ZBCA 3VYLA 4GJIA 4XSLA 3AYTA 4A8LA 2I57A 3M0YA 3M0XA 4QEEA 1XLEA 4PGLA 5XIMA 4EAYA 2GYIA 5B80A 3ITOA 3UVAA 1DXIA 3CNYA 3LMZA 4X60A 4YTSA 1QTWA
chains in the Genus database with same CATH superfamily
3AHVA 4ADUA 4FX7A 1XIFA 1S5MA 1G4TA 2W66A 1XBYA 1DQXA 2WJDA 5D2YA 4UR8A 1YX1A 2E4TA 2FGZA 4W8LA 1D3HA 2ISDA 2PS2A 2GZXA 2VRJA 2PDHA 1BLIA 2ATMA 4ZOEA 1XM3A 4OUEA 4DZAA 3K8LA 4TXEA 2XWEA 4JEQA 3M0HA 1SW3A 1VBJA 1XKJA 4AZCB 4MKSA 4YS1A 4QR6A 3N34A 2QJNA 4EF8A 2GDQA 1OFDA 3QY6A 1VH7A 1OSEA 3KVJA 4YPJA 2OVLA 3A4XA 2FH6A 2NQZA 3THCA 4BHYA 1IR1A 1YLVA 3ZWTA 3BK0A 2AL2B 1DE6A 4DO7A 2VFGA 3CIXA 4PH6A 2ACQA 4AH7A 3M5XA 3W1AA 1MW1A 3GXPA 4ZQMA 5AC7A 2Y1HA 3L0KA 3LB0A 3WJWA 2W9MA 1NFGA 3NZ1A 4ACZB 3PULA 4DBUA 4JL1A 3BOLA 3I3EA 4ASTA 1ZBCA 1MW2A 5M5DA 1W6TA 1M7XA 5A8GA 3UWQA 1VFSA 2BVYA 2VHLA 2RKXA 2DP3A 3QGKC 3IJIA 2X30A 4G6CA 1CLKA 4NJJA 4M6PA 3W24A 3BH4A 1DJGA 4ZB2A 3CV1A 1M7OA 4JDYA 2PDWA 3WQ5A 1RQEA 1RA0A 4D6EA 5LGZA 4AXNA 4IP7A 2PGEA 1S38A 3CIVA 5MKGB 4DYEA 1WOBA 1V0KA 2EO7A 3UERA 4PB5A 1Q4WA 3OODA 3LCXA 1J2BA 3KOFA 2Z29A 4LU0A 1O5XA 1Y0EA 1VR6A 2VFHA 2BZNA 3MA8A 3S1GA 2ZBTA 2VD8A 4HSOA 3TYBA 5TAOA 1DJZA 1T8XA 1BTMA 4D6CA 1TWSA 4TUFA 1XYFA 1US3A 1E9ZB 3GXTA 4OIFA 3PUGA 3PJWA 2WOQA 4S3BA 3HV9A 5LIKX 3TC6A 4E4PA 3IACA 1OYCA 1TA3A 1W9UA 1US0A 3SN4A 3RX2A 1E72M 3RMEA 1KCXA 3KTSA 3SSZA 1NWRA 3CH0A 4JQ3A 4QXIA 5H1WA 3V3WA 3E3HA 4PUDA 3K4DA 1MUWA 1R6WA 3LDVA 3OHMB 4ATWA 4DYKA 1LBFA 1S2CA 4K39A 4HN4A 1HJQA 1RP9A 4DZIA 3UXDA 3DZ1A 2RDWA 3PAOA 2WNZA 4ZOBA 4ES4A 3WD1A 3WK2A 2XPKA 2PFHA 1LLZA 2DSZA 3RUBL 1FTXA 4DWDA 2R14A 3WQCA 3HMCA 4FNSA 4O28A 4AC7C 4WDXA 3GBEA 1SJAA 4J7RA 1LM1A 5TD4A 3GXFA 3M4HA 3NPWA 5T9CE 2G97A 4QFUA 1Q6EA 5H8UA 1XICA 3M16A 3OVPA 3IVSA 3XISA 1HJSA 2XJ7A 4PTDA 1A0DA 3LXAA 4WLCA 4IMDA 4B15A 3AUOA 1FCBA 2AAAA 1DE5A 1XYBA 3GBDA 3JW7A 4O16A 4OOZA 1HKIA 3LBCA 3LGEA 3O0KA 5LNSA 4M56A 1ZBVA 2I9EA 5I77A 2E6YA 3TW9A 3W71A 2DT3A 2BVWA 3PY2A 3W28A 4U4MA 2C15A 3GK0A 1H09A 5MF5A 5D02A 4Y9NA 1BSIA 3HBLA 1H1ZA 3T0CA 4M7TA 3IK4A 3SIMA 1BFNA 2PODA 3H54A 2R9RA 3H2EA 1V3HA 3W85A 2VEGA 5EU9A 4DAFA 2XVGA 1J93A 3QF0A 1U1UA 2YIHA 4XD4A 5C9RA 3GDLA 1Q8JA 3BLPX 3TSDA 3GH5A 2GYIA 4CD4A 3W2LA 4U10A 2C1HA 3CAWA 1V5XA 1XIDA 2JGQA 1UZHA 2F84A 2P8CA 3GHSA 4IWWA 4IGMA 3SUTA 1ME9A 4P5UA 3P84A 5LHFA 1NWTA 3HQOA 4CCZA 3T05A 3APYA 1HL8A 3G24A 1V02A 3OVGA 2YB1A 6ALDA 2JIWA 2X8RA 1YNQA 1DQWA 3G1VA 3AS1A 1W3HA 1JEZA 2XHYA 3HZ3A 3DFTA 4BA0A 2Z4GA 1MQRA 4TVDA 4C6MA 4C7GA 3SURA 2AOSA 2Z0IA 5C9ZA 3M47A 1IZKA 1YNYA 4INFA 4DO5A 2QVNA 3NFUA 3P6LA 2O7QA 1QBBA 3AMCA 1HJWA 4YWSA 1QOQA 3FGCB 1ISZA 5E0KA 4GK8A 4HKPA 4ZA0A 3VKCA 4L4PA 1BRLA 3N4AA 3F2CA 4ZTXA 1XLGA 1JAEA 1W1IE 2DDXA 1FWFC 4Q22A 4F0HA 1XDLA 5BMWA 4PMJA 3BO9A 1DHPA 2EPLX 4FOKA 3WQGA 1DWIM 1JYVA 2FVKA 3AIEA 2DZWA 2G3FA 2PDUA 4HYWA 3UWUA 3KTXA 1AZ2A 4YMZA 4YTSA 1TPFA 4BQ5A 1FXPA 4AZHA 3ORWA 4HPHA 5GJPA 3OP2A 2A3CA 2OYKA 3TNOA 1K8XA 3WDQA 1H0GA 1TV8A 4AMAA 1DWHM 3WLHA 2QJHA 4QNEA 3N19B 2IMRA 3E12A 2V30A 3VA8A 4XKYB 1UP0A 1VFUA 3R0DA 4R9OA 4MY8A 3LTYA 2P0OA 1D3GA 1IF2A 3DYPA 4FF5A 5FACA 1WKYA 1EP2A 4RNIA 3PZ9A 1KKRA 4N7QA 1US2A 1VEOA 3UQNA 1ELSA 4AZGA 3S47A 1YIXA 1SO6A 1GYLA 1U30A 4XUGA 1QO2A 2F61A 1H50A 4MKNA 3S9IA 3U7BA 4YXGA 2HZGA 4LX4A 3G6LA 4LYQA 2OGYA 3WLLA 4OVXA 3RX3A 1WZKA 3IJLA 1BWKA 4C5ZA 3S83A 4J3WA 4DF2A 3SUSA 2BTMA 4PSPA 4S38A 4Q6XA 1NAL1 3KWSA 3MUZ1 2O9OA 2GWGA 1PYFA 2Y7DA 4Q8WA 1IXQA 3F2DA 4AD3A 4X2RA 3B3DA 8TIMA 1L9WA 1HUVA 3M0IA 3QZEA 1UQYA 2B7OA 1XPGA 4XBJA 3CAQA 2IKJA 2DSKA 5GVJA 4BFAA 2A3HA 3VGHA 4IPLA 4J3VA 2Z2BA 4L1XA 4FNPA 4NZ1A 3FX4A 5D9NA 5KITA 3CM4A 2GGIA 2ABBA 1HG3A 3KWXA 3WF1A 1ZNNA 1AH3A 4DI8A 3EDKA 4BS0A 4Z1DA 2HK0A 1TUFA 4LUTA 3VIHA 1CGYA 1WDDA 2AGKA 4LTSA 5G2WA 1UR3M 1QPNA 3FKKA 1XLHA 1Z89A 1V51A 4RK8A 3QZAA 3FNDA 2PU1A 2XFRA 1W3LA 1OM0A 1QI3A 4F4RA 1J96A 3ZWSA 5BCAA 3PB0A 3QFWA 1ISYA 4X0NA 1KXTA 2OOFA 2BV9A 1KRBC 4DZHA 2Z2UA 3E74A 4YNGA 3IV3A 1H5VA 1XHGA 1DIKA 2QJMA 4I5XA 3PAJA 4WDTA 1QK0A 2YZRA 3BARA 2PD5A 4JIIX 2BMBA 1IZCA 2D1ZA 1FDYA 4P8XA 5F1VA 1VKFA 5AKQA 1EJXC 1GYMA 1XV8A 2FYMA 3E49A 3ITCA 3SW6A 3UG4A 2XN2A 3EWYA 1MSSA 4JY8A 2DFAA 3GXIA 1OX6A 1LOLA 4MNMA 1TJ1A 3AOFA 3WF0A 3QSRA 1Q6CA 4P2VA 2OLAA 5D37A 1V8EA 1OFQA 2QHAA 2XN0A 3QV7A 1CLXA 6XIAA 3C8NA 2G0WA 5KMYA 1BXNA 4CKQA 4FP1A 3CL6A 3SFKA 3WLOA 2CFFA 1X6LA 4GVGA 2CLHA 5CZKA 4EE9A 1FKWA 3R13A 3VCNA 4M6QA 4DJDA 1XISA 3H4GA 1TPVA 1JDFA 1JI2A 1HVQA 4UBPC 1JDAA 3CH9A 4UB9A 2CIPA 1R2SA 3GDTA 4HT3A 4UTFA 1EP3A 1JI1A 4JFSA 2PC8A 1W56A 3VZZA 3L12A 1XIJA 2CHNA 5DX7A 3TZFA 2FTWA 2VZOA 5A6AA 3R8HA 3OYXA 5IDIA 5K7JA 3WIJA 4A8RA 2V3DA 3YPIA 3AISA 1UD5A 5DO8A 4KERA 2CXEA 5F2GA 1ISWA 4LBUA 4H9UA 1E1FA 1SVDA 1J2WA 1Q7MA 1HIZA 2R1MA 2VZSA 2XSBA 3BXWA 1K6AA 2DH3A 3R7MA 1UB3A 1E1CA 1GKRA 2XDFA 5AHLA 2CITA 2XH0A 2VUYA 2DJXA 4DM1A 3SCUA 1KM1A 1FWRA 1UW9A 4AYSA 1V08A 2WSKA 3WZ0E 1VQTA 1XIBA 1M6JA 2EJAA 2BHUA 3W84A 7ENLA 1H7OA 4GG9A 1XDMA 4E2BA 3GFXA 3UGVA 1DJIA 1KLYA 4H9TA 2NVCA 1ML1A 3M0LA 3RNDA 2R1KA 5AHNA 4ZTYA 4YTUA 1XD1A 5EKYA 5CLTA 1MFUA 3BOFA 3PBUA 2I9UA 5F1UA 3CB3A 3WQDA 1ITCA 3LRLA 1JQXA 1KQZA 2WCSA 4JFWA 1EC9A 2E7FA 3HB9A 4LVFA 3T9PA 3VE9A 5I07A 4H9VA 3WNKA 1JZ3A 4H00A 1NU5A 1RBLA 3FKRA 3V0UA 1KM3A 3AQUA 1GVFA 3WELA 1PIIA 2V5LA 3L2IA 2YW3A 4WCJA 2WZEA 3WNLA 3QEZA 4FIRA 1Y8BA 3PPFA 5I3FA 3VGFA 3LS9A 2NWSA 1O95A 4PBFA 2W6RA 3TK7A 4X22A 4TTUA 3O6CA 1AW2A 2WBGA 4PRRA 3AIRA 4PULA 1E43A 4Q8MA 5FEZA 1S1RA 3TV8A 2DUZA 3QR1A 4JTAA 4CD5A 4D6JA 3ZT5A 2ZZ2A 2PP0A 1E3ZA 3U4FA 3NGFA 4JGDA 3V5OA 3QOKA 3DUGA 1WOAA 3UR5A 4NP7A 4J5NA 4RE2A 1EP1A 3LCHA 2CNCA 4K7YA 3VOFA 3GS6A 4PTWA 1QATA 1TWIA 3UJSA 5DXXA 3W2JA 3SUWA 3EX4A 4D71A 2XWDA 2WQDA 4AXKA 3ES7A 1VBHA 2XIBA 5KZEA 3PZTA 3EWUA 1VD6A 1AVAA 3J7HA 4RW5A 8XIMA 3BMWA 1VFMA 2UV8G 3AXXA 1G1YA 1LORA 5JIPA 1YKWA 1VENA 3E0IA 4IZGA 1O66A 1ZJHA 2P8BA 3KDOA 3WMCA 1WPCA 3I4KA 3AWNA 2QZRA 4QLJA 3MI6A 3PZQA 3R1ZA 1P1MA 3E38A 1QJWA 1HN1A 4LAOA 4GFSA 1V02E 1J4EA 4H2HA 3MI3A 3R5EA 3F03K 1CX9A 1CYGA 4A2SA 3KRZA 4IFRA 2C18A 3M5VA 1DTUA 4DQWA 5FF7A 4JHOA 3HG4A 4W7VA 2HPIA 4YHGA 3LXBA 1QPQA 1F3EA 1QNSA 2DSUA 3OO2A 1MEIA 2QV4A 5LHEA 2YLAA 1QNPA 3D46A 2YCJA 4PMXA 5K2ZA 1WE5A 3UJ2A 2GVJA 4ZO9A 5I2UA 3L5MA 3CGTA 2E0PA 3D3AA 2V63A 3H4XA 1UHVA 3CQ0A 1FCQA 2EGZA 3W1QA 3ARXA 3BTNA 2W0UA 4Z17A 3DHPA 3ABXA 2MNRA 4YU1A 2GJPA 2WC3A 4KGJA 1JAKA 2HPMA 2DGAA 4A3UA 3C52A 3AZTA 3H26A 1YMYA 1MMFA 4M0XA 3W1TA 1S46A 4XD6A 1A5NC 1QDSA 4O8AA 3VC5A 5LA0A 2GUBA 4HJWA 3K1DA 3C3NA 4CU8A 3VNYA 3G8EA 5L9FA 1GQLA 1KXHA 3AYVA 3LNMA 4GVFA 5M3WA 4A35A 3F5LA 2YBTA 3ZMRA 1OEPA 4DVOA 1PX3A 5HJYA 3VXGA 2WJZA 2RUSA 4FAMA 2XIIA 4AIOA 2FDMA 5DN1A 3PBVA 2P3EA 1RAKA 3QW3A 5CEWA 2ZXBA 4MPQA 1EIXA 6REQA 2ZOXA 3TONA 4LPCA 4CQDA 3WNNA 4O19A 2ODOA 4J2MA 1XYCA 2Y70A 4U2ZA 4CQBA 3Q45A 1X38A 4P7RA 3KVKA 4U2YA 3JR2A 1FDJA 2OG9A 4O50A 2PF0A 5BRBA 2OWCA 3MMDA 1OC5A 2VX4A 1S5WA 2OZ8A 4JTFA 2OX4A 4Z0JA 1CGTA 4WX2A 3G3DA 1GUVA 3WD2A 2WVTA 3NL5A 4O1DA 3M5YA 2QUVA 4LW7A 2HCVA 3HURA 5H8MA 1EA9C 1NQ6A 3MI2A 5GPRA 4NJKA 2XIMA 3KVLA 1JL8A 4KWWA 3GG0A 3CUXA 3B9NA 5LNVA 3NQ8A 2NVAA 4O0KA 4GYFA 2C0AA 3SJ3A 1T99A 2HRWA 2Y88A 4RL3A 2G3MA 4JTHA 3PFRA 2NVDA 1BVNP 1XFCA 3C86A 4MGGA 1RQHA 1R85A 1K70A 2GDVA 3N15A 1SGJA 4FI4A 1XIIA 3M6DA 4B5TA 2AQOA 4KIEA 1G5AA 3IWPA 4R7JA 3L65A 3VE7A 2QCNA 1W1ZA 2X1RA 2X0SA 3R2GA 1JPIA 5IFPA 2VI0A 2C16A 3B0XA 1E6PA 4XZMX 3PBGA 2ZFAA 2FJUB 3HOJA 1L2QA 1X97A 2VZVA 2BOEX 2QS8A 1TTIA 4HQVA 2ONEA 2X40A 3W72A 3GW3A 3WDPP 3K1GA 1Q7ZA 1Y65A 2AQVA 3CK5A 3PFMA 2H3BA 1GOKA 2CPUA 2Z00A 4UZUA 3R25A 1MDLA 4JNYA 2PSNA 3VOIA 1P0DA 4K2SA 3VKKA 2OWWA 1V3KA 3RR1A 2I5QA 3NL6A 4GQ0A 1B0IA 3ZR4A 2D2HA 1OFEA 1KCKA 4FR6A 1MZHA 3TXVA 3N2BA 2PRLA 9XIMA 3RX4A 1FP9A 1U1JA 2YW4A 3BG3A 4L1WA 4I9JA 1SJDA 2QCMA 3MP3A 1L6WA 2V2HA 2G4JA 5RUBA 4WVXA 3GDBA 2MUCA 2IPFA 3L4WA 3WQEA 1FQ0A 4IXHA 4IG2B 4HNCA 2C7FA 1EWDA 3ARZA 1ZPTA 3R79A 5BZAA 3LGGA 3CZKA 2A7PA 3W22A 2Q8XA 3RO8A 1I4NA 4H3DA 4JPGA 4Y2WA 3LMYA 1YXYA 1JGMA 1BWLA 1HO4A 1W1PA 4AX7A 4C6PA 2IPJA 4HOXA 4EXBA 1GJWA 1QPRA 3QTPA 4MJ4A 1BWVA 4R34A 2JE8A 4LJ3A 1W5PA 1B3OA 5FOOA 1KBJA 3PSWA 1WDQA 5HPCA 4F0SA 5FF2A 3EWCA 3W7OA 1FXQA 3LCLA 3IJ9A 1FX6A 1O68A 2ZX8A 4AFYA 1B3ZA 4EX4A 3VIPA 1KBLA 4KRZA 5AYZA 1XL9A 1UC4A 3E0WA 1VFHA 1C8YA 2WZHA 5DMNA 2BP1A 3URBA 2CLMA 3R11A 4Q8OA 1S2AA 1DTNA 4LH8A 3PZGA 3TTSA 4TR9A 4CNSA 2J47A 1SZNA 3NAVA 2IW0A 1XXXA 1AODA 1V3MA 3TYAA 1Y7VA 1ZS2A 1R9ZA 2ZUTA 3GTXA 1EJ7L 1O6IA 3F5KA 2VT0A 1MXDA 3LERA 1FWTA 5KZMA 4KWVA 4DJEC 3CPUA 1YEYA 2ISVA 1R46A 4HB7A 4BEUA 1VP5A 3SZ8A 3S2NA 4B5NA 4J28A 4Q4SA 4A21A 2A3AA 1MNSA 2R1PA 3AHXA 1Q6LA 2Y5JA 4GGHA 4JN6A 1MRQA 1LLWA 3CXOA 3CQIA 1ZUAX 2DEPA 1QAPA 3T40A 4MAVA 1HO1A 3QVQA 2JALA 4O4WA 5C7HA 3C0QA 1ICPA 4UOQA 2GSHA 5D9PA 1FUYA 1KQYA 3TMLA 4MJMA 1YRRA 5EGRA 3LBMA 2Q8LA 5M17A 2DQXA 1G0CA 3Q65A 1BEUA 3PJUA 3I4EA 3QHMA 4F0KA 3EKZA 2GVYA 2V69A 1YDYA 3BV7A 1H7NA 1WZMA 3BSHA 3L7RA 1Q8AA 1X6UA 4L9ZA 1V77A 2IKIA 4V2XA 3DN5A 2J78A 5DBUA 2Y2WA 2W62A 2RJGA 1O5QA 4U5KA 1XLEA 2FDSA 2OTDA 2EAWA 4B5SA 5E1QA 4QAWA 2E6DA 3COTA 3B40A 2GWNA 4XZNX 1EZWA 3VDGA 1AFSA 1DJHA 3VUPA 2GK1B 3TR9A 3GQYA 2FKPA 4C6CA 4J1OA 1EF3A 1GW1A 2VEMA 4CU6A 3E96A 3CU2A 1BGAA 1LG1A 1W31A 3RCMA 4QG8A 4B90A 3H2FA 4XZHA 3AHTA 2PP3A 4GO8A 5IHSA 1BGGA 4N0RA 1E6SM 1T6MA 1ISXA 3DC8A 4NJHA 2QT3A 3ARRA 3W6YA 4RE3A 4DO6A 3PZVA 4IG2A 2PDIA 3SGUA 1OD8A 1DIEA 3P5ZA 4NNAA 2OZ3A 3Q94A 4IJCA 4MZ8A 5DT7A 5A1AA 3B9OA 2QCLA 2O92A 1CENA 1I1XA 7REQA 3BAWA 4K8EA 1JCLA 2WMIB 4AHPA 4EWND 4NX5A 3DG6A 5G2HA 1FHDA 4S2CA 3VD9A 2WHKA 2ESCA 1TPH1 3UF9A 1TVNA 2OYLA 2VO5A 5I03A 3HTWA 4B3ZA 1PHWA 1HT6A 1ZBWA 4GYPC 3CUFA 3S6OA 5DLCA 3AIVA 3LBOA 1R3SA 2X7WA 2VQUA 3HPXA 3TJLA 1XLMA 2OEJA 3W88A 2NZLA 3IUHA 3L4YA 2DT0A 5ABHA 1B5TA 2E1WA 3H2OA 4BK9A 1TR9A 1H5YA 4OBRA 1OX4A 3ARVA 3QJAA 2POZA 1Z9AA 1OIMA 1V3IA 1EWEA 4DUVA 5A8NA 4PTXA 5CPSA 3EWBX 3ZS4A 2VURA 1FWCC 3PF3A 2A4AA 1RLDA 3VABA 3CEUA 4EP8C 5CSYA 1K9TA 3IJQA 2R82A 1JULA 3ABQA 4J3XA 5REQA 3AIWA 4C6NA 3H21A 4MMWA 4UTUA 5F4XA 1UZDA 3AU2A 4C6JA 2IQTA 3TW6A 4NX0A 2V8ZA 2FH8A 3GVWA 4UQ9A 4N9CA 4WDUA 2G96A 3PJXA 2VVSA 2X16A 2WMGA 3TZNA 3H2AA 4RDZA 1VBUA 2OSXA 4HJFA 3LHUA 2FB3A 5I23A 4ACZA 1EF2A 5AZ1A 4YVPA 1K9FA 1QPOA 2EJ1A 2YXOA 3H22A 2ZADA 2GVEA 5KZDA 3NPUA 3WJSA 1KNWA 3CHEA 1XG4A 4JYDA 5ABGA 1XLIA 3EDFA 3TFXA 1V7YA 1OGGA 3RPMA 1F05A 1C8QA 2C13A 3WMLA 3UG5A 4NIRA 3DFNA 3VD3A 4C6KA 4KCTA 5E5CA 5EMMA 4CGTA 2VGGA 5SWUA 4DJDD 2O4MA 4AB4A 3BAYA 3A5VA 5EFFA 1XRTA 1TQJA 5DQPA 1MEWA 5F2LA 3DBPA 4Q32A 4L1GA 3VDBA 2UBPC 4M82A 1MI3A 1ADSA 3CTLA 3SIZA 3TAKA 2HK1A 2O9TA 4LRTA 3MJMA 1IWPA 3W87A 1RPKA 1UWQA 2EPMX 3T2OA 4GPNA 1PE1A 4YL2A 1JNDA 1TCMA 2FVMA 2EXOA 5I02A 4YTQA 4CD8A 1ITUA 4ZQOA 4W4QA 1DYSA 4OV4A 3OB8A 2I56A 5AVNA 1S2TA 1SMDA 3BSGA 4PL2A 5CGQA 1GG0A 2P0IA 1EYWA 1JGIA 4RPQA 3EBVA 1TRIA 4RPPA 4IL2A 4LAZA 1DWJM 1EA0A 1PDYA 1XWYA 4GH3A 3AYRA 5D32A 3VOHA 2PZNA 5EMLA 2Y8VA 4BJHA 1XG3A 3HGSA 4S3AA 1KWGA 5JH2A 4JFVA 1PKYA 1HNYA 4J9JA 4OECA 1VFTA 1AZ1A 5BXTA 2P5NA 1JFHA 1Q2SA 1B3YA 2YDSA 2E3ZA 2ZWYA 1U5HA 2WHMA 1R2TA 4LYPA 5BU6A 4S1FA 4GINA 1W54A 1TPEA 1TPWA 3UJRA 3JU2A 1WCGA 2D69A 3M41A 3OPSA 4C60A 3TSBA 2H8ZA 4O13A 2A21A 2WVVB 1O94A 3B9DA 3N29A 1E0TA 4ATDA 3AS2A 3D5HA 4KWOA 2REQA 3W25A 1I2NA 3B0YA 3IRDA 5A6JA 3MBDA 2NT0A 4HVXA 1TJ2A 4IQJA 2J66A 1NWSA 2P3ZA 3I65A 3MVTA 3NXFA 2ZUSA 3QPYA 3W38A 4R7WA 1CDGA 4PTNA 3VIMA 1E1CB 4PSRA 3C2OA 2WZIA 3A3XA 4MZYA 5XIMA 3FIGA 5BWAA 2XSAA 4HBKA 3VNZA 3CWOX 4X60A 1G6CA 1H41A 3U4AA 1OT2A 1LT8A 3ZYZA 5EY5A 2TAAA 3CZLA 1JR1A 2JIEA 3NL2A 2R1NA 2FQIA 2BX7A 1ZL1A 4GWEA 4BY3A 2P50A 3QTGA 4ICMA 3GH7A 1GGOA 2DVXA 4FOUA 3WH7A 2CBVA 2BASA 3WLPA 3PNZA 3E2QA 4H4IA 2P53A 2Z2AA 3RIKA 1OK6A 3UG3A 1MWOA 4J3SA 2A3EA 3IARA 2PDGA 1ZP4A 3KP0A 5FEWA 3W26A 2JFEX 1P48A 3DFPA 4E2OA 2VR5A 3LTPA 4LVBA 1E55A 3GC4A 4S3GA 2HVNA 3MCOA 4RE0A 5I7GA 1R87A 2WZMA 2CXGA 3CO8A 1LCOA 3CL7A 4PEEA 4DLMA 4UTLA 3ZZ1A 1KM4A 1ODUA 3FEQA 3M43A 1CXHA 2JKPA 2EF9A 2PGFA 4H9XA 2XVPA 1A4MA 1IHIA 4MWAE 1YW1A 1UZ1A 2ZX5A 4GZ7A 4BWLC 5LKYA 1MXGA 2JF7A 3PG8A 2OYMA 1J0KA 2O56A 2WQPA 4QSFA 2VDHA 2PPGA 5C9WA 1PKLA 4DUWA 3UNDA 1BAGA 3OZPA 4W9TA 1KRCC 3CQKA 1Z3NA 4L6OA 4TVCA 2J8GA 1V6VA 1I9CB 4HCLA 2BS9A 3DKJA 3FGCA 2CWXA 3GZAA 4LCRA 2VJXA 4CN6A 4H01A 3SCNA 1VB9A 4ZOCA 3VAVA 1EEXA 2BGSA 1RD5A 5DRIA 5FEPA 3NOYA 2YJQA 4UXDA 1XINA 1EXPA 1S1PA 1PPIA 3D6NA 3HF3A 5I5RA 4DXXA 1ADOA 3PUDA 2HNEA 3CT2A 4XX6A 1NDZA 1AL8A 2QDDA 1LZOA 5D2VA 1HKKA 3G8RA 2CLFA 3GHTA 3MYPA 4LF1A 5H6HA 2YCKX 2VWTA 1W2PA 4OJYA 4ZFCA 2VFDA 4HU4A 5TIMA 5BOFA 3GR8A 3DYOA 5DCEA 1N55A 5JVLA 3H7RA 4JBRA 2FTYA 3ATZA 5IHRA 3K8MA 4IX0A 2EG7A 1YTKA 2ZIDA 5EMJA 1FKXA 3P8JA 1RK6A 1XCFA 3R8GA 1V3LA 1PDZA 1ZJBA 2H9AB 1SFSA 3OZYA 5JU6A 3DHFA 1OVDA 3GNDA 3URQA 3S8HA 5CZJA 3XINA 2QYGA 2J4GA 1W0MA 2VOTA 3REQB 3AMKA 1PIFA 2VGFA 4FA3A 1QVBA 1Z41A 4JNZA 3WMSA 5D04C 3FY1A 2PBGA 5DY2A 5DCBA 1QRQA 1LP6A 1X98A 4O11A 2A1YA 4LCSA 1HL2A 1S2WA 2VX7A 4RKAA 1XLBA 3FVDA 2V5JA 5AVHA 1FY6A 3MHUA 3WLNA 4B91A 7TAAA 4GFIA 2QGYA 2ZC8A 4REQA 2Z1WA 4XVEA 1NVMA 1NFPA 2BGQA 3WFZA 1NOUA 4GRSA 1WV2A 1UIOA 4ZQCA 2DIEA 1TMLA 3TFCA 5ABFB 2ON3A 1Z48A 4JNMA 2P76A 1RSCA 1Z42A 2Z6JA 1K8ZA 1U5VA 4CNTA 3CHFA 3PN8A 3CUHA 3EKGA 1PB0A 2PTXA 1OC7A 4ZR8A 3M46A 1XH1A 1LUCA 4Q4RA 3B03A 3PHAA 1V6YA 3NSNA 3IVTA 3T8QA 4R5EA 3TCSA 1QNQA 4W7UA 1J01A 3Q4DA 5FJOA 2DIJA 3PB2A 3WN6A 4K36A 2PWDA 1E4MM 1PXGA 2ZYFA 3V5FA 1ZSXA 3O07A 5CPQA 1GKPA 4ZQPA 4ZE5A 4E2VA 4XG1A 1CI1A 4S3KA 3T0TA 3WG6A 1T0OA 3SY1A 2UWFA 3PP7A 4KFOA 3SO7A 4QEEA 1Q6QA 3L21A 4PZVA 1IT0A 5CJNA 1I45A 1NH6A 3B0VC 1EHNA 2Q09A 2W92A 1R47A 3MV01 3WNMA 3IRSA 4B4HA 4NZ5A 4LAKA 3W27A 4HOZA 1EKOA 3UZXA 1IYXA 1HJVA 4ZGYA 4DRSA 4M6VA 4W5ZA 2I7GA 3WQ6A 2OCZA 1V6UA 1REQB 2PGWA 3EEGA 1G69A 2BVTA 2PA6A 3DOPA 3AXIA 3RU6A 3VDAA 1VJIA 3HV8A 4OFCA 3IGSA 2PDFA 1NY1A 2YCEA 2ZTJA 2HE8A 1AL7A 1VFOA 4GIEA 3APTA 3CUZA 3LHVA 4GGBA 1HZYA 1H49A 1Q3NA 3V1PA 3NVDA 1LQAA 1SSGA 3NG3A 4UFJA 2CETA 2Y7GA 3PS7A 4W86A 5T26A 4UTHA 3A9BA 1RY0A 1U2YA 4L4LA 3E5BA 3QXBA 5CJMA 4W93A 1B90A 1J6OA 4N4QA 3L9CA 4LUSB 3OW1A 2V0TA 3MMTA 3OU8A 2VDGA 2ACSA 4XAPA 4FPSA 4O12A 4LBSA 1OFRA 4FHAA 3W1LA 1J79A 4JTDA 4M19A 2WVVA 2J27A 1OFAA 4S3EA 4A4AA 1B9BA 4NI3A 3TQPA 4Q8VA 3NCOA 1JCMP 3S42A 4AD1A 3NQVA 5E6ZA 3E02A 3GYCA 4H6EA 3FDKA 1TVLA 3W7CA 1TV2A 4DLFA 5ECVA 3BG5A 3MMWA 1W3TA 4PCTA 4HA4A 4LY8A 4TX9A 3SUVA 3LPGA 3W6MA 2KAUC 3JVAA 2YPIA 3STPA 2DQWA 4AZBA 1LL7A 4E2DA 4A3YA 3BAJA 1G7UA 4KCUA 3W7RA 3B9EA 3TU9A 3NDYA 5FJPA 1J5SA 1OCBA 1PL9A 4HA0A 3T7VA 4FX6M 3SEPA 2GJXA 3U8GA 2EHHA 2NUYA 4BI5A 3HN3A 3VK5A 3U2CA 2OODA 5U7SA 3EXSA 4UWMA 1H0IA 2WNNA 2Z28A 3ONBA 3BQ5A 1B3VA 2PAJA 3CMJA 3AYSA 4ECLA 4P7OA 1Q6DA 5A6BA 1YPFA 2D0HA 1YBQA 3HG3A 3WEOA 3TTQA 1O1ZA 1P0KA 2ADAA 3PBMA 2GOUA 2WKGA 4XAGA 4ZVJA 1CXEA 3V75A 3RK8A 3E5PA 4IGSA 4A8LA 1C93A 3QQWA 3M0XA 2PCEA 4MSSA 3CV2A 5B80A 2V68A 1KW1A 5LZLA 1H61A 4FOJA 2FJKA 1YDNA 3AXMA 4OE7A 3KVMA 4E5TA 2F2KA 2C79A 3XIMA 1QHZA 4CEXC 1GQKA 2J8FA 3QQ1A 3BG9A 3LENA 1Y5VA 3GIPA 4AD2A 2NUWA 5LXEA 4H8UA 4M3PA 2WNWA 1WKEA 4Y9MA 4C6DA 3M5ZA 3PUEA 1SQ7A 1UOKA 3CPRA 5FJIA 2ZZ1A 2V2CA 2PLMA 3GB6A 4RDYA 4JTCA 5D9OA 3QY8A 5C2XA 3M1ZA 4C1NA 4HA1A 3WQOA 1WDSA 3CB8A 3W2UA 3RLVA 1V93A 3IGXA 1E6QM 3ABOA 1GZ1A 1D7KA 2QPSA 3W70A 3MBFA 3N2MA 1JIBA 3WLJA 4I5RA 1UR9A 2V67A 3STEA 4NL1A 3B04A 4X61A 1LRNA 4GXMA 3VNDA 4JL2A 1RY8A 1UPPA 3N6QA 2PE4A 1GORA 3U7VA 1BVZA 2CZVA 5A8MA 1XGDA 2HVMA 3VMPA 2PDYA 2VELA 2D3LA 4YN5A 5E70A 3LHWA 2VWSA 3WDJA 4JFUA 3EMCA 2J75A 1QR7A 2XN1A 1NELA 3RRAA 3W37A 1FWSA 4XAYA 3OZOA 2XZ7A 3NNTA 3BVJA 4KFPA 2ZUNA 4JTLA 4LVGA 1YE4A 3PTDA 3QV8A 2QNEA 3OIHA 4JQ4A 4FR1A 2AL2A 1KC7A 1LJYA 1TPC1 3HU7A 3AALA 3W1MA 3N9KA 2IQ0A 3QR3A 5EMYA 3DAQA 3U0HA 1JPMA 1M7PA 3IJ8A 4CD7A 4ZB0A 4PE8A 2FHBA 2FZMA 4Y9OA 4O1CA 4HHLA 1WO2A 2ZUWA 3P62A 5AB3A 3S6DA 1E9IA 4FXJA 4JN8A 3QC3A 3F4NA 1P1XA 1EBHA 3L66A 3I6EA 4UTWC 1CB7B 3BMVA 4TOQA 3FJNA 2D0FA 2QDHA 3A12A 3PTKA 2Q02A 1WDPA 1R0MA 4F0MA 3B8IA 3TYUA 5FJJA 4HU3A 3WUBA 4LB4A 4B9ZA 2OPJA 2Y24A 3NYDA 4ILSA 5CZSA 2VFFA 2Z7GA 2XSXA 4QITA 3SRDA 3UXLA 1LBLA 4DI9A 3E2RA 2A0NA 2GQ9A 1XS2A 1QWGA 2VGBA 3WBYA 3LN3A 5LYRA 2ISWA 3EAUA 3NVTA 2BY3A 1T7LA 1S39A 2GJLA 4LUJA 5DMMA 4QDWA 1MDRA 3QMRA 1ZB5A 1N82A 3CV6A 1C90A 3KOWA 3LOTA 1RA5A 4G9PA 3AFBA 3GUGA 3CBWA 3O16A 1XRVA 3T2QA 3NOEA 1E4LA 3IUDA 3L4ZA 1HTIA 3PPCA 3UPMA 1RR2A 3AIUA 2OFJA 1BG9A 2VDIA 2IPGA 4JOMA 3TQKA 3RCYA 3DECA 3W4RA 4ZMGA 3U5YA 1XLKA 3TN3A 4JY9A 3SCTA 2GK1A 4K38A 1E56A 1WYIA 2VCBA 5I3JA 1I8JA 3MCNA 5E0CA 2BY0A 2YOCA 3OJGA 2XH4A 1KLZA 1PEZA 2NV9A 4XKMA 1OG6A 1PHQA 2WKJA 3QH2A 4N6FA 3MUXA 3T0AA 3TWBA 2VMFA 4I7VA 4A8IA 2VC9A 1E4NA 4JIRA 4GNKB 1Q13A 2CLPA 3MUCA 3CT7A 1OC6A 1FHLA 1V79A 4O4VA 3TQ0A 4H6RA 1XC4A 5FJTA 2Z27A 2YCLB 4GY1A 3I7SA 2VC7A 3DH7A 1XYMA 1O7AA 4UQEA 2J6VA 3DEQA 3V36A 3TXZA 1QHPA 1OFOA 4WKHA 3RLHA 1DV7A 1WZAA 3QHNA 3VUSA 4ZB5A 4GQBA 1PKNA 4K7VA 5CZ0A 5DCDA 5F2IA 3SM0A 5A95A 1E40A 2EPNA 4PBGA 2GGEA 1LF1A 3OYZA 1AJ2A 4LXFA 3QFEA 3TYEA 1KM5A 2CERA 2P10A 3UVAA 2QXWA 3F5JA 5A3HA 2V9DA 1DBTA 4K68A 1AJZA 1UD6A 1NJJA 2GQAA 5KEZA 1BHGA 2E9BA 4UR9A 4PMQA 4UOJA 1NARA 1I1WA 3THAA 1E5JA 1RD6A 2ZKMX 2NX9A 5CKSA 1QO5A 2G3JA 3EX1A 4JHZA 5AY7A 3C2VA 4NSBA 4S3CA 5CQ1A 3UZWA 1PO9A 1L6FA 1BD0A 1ZENA 4JTSA 3RXZA 1NWUA 1EXBA 2XGIA 1DPMA 1FVPA 2GGGA 3C2FA 1ICQA 1EFZA 4C1LA 3DG3A 1E9LA 1D3CA 3A9IA 4LFYA 5ECUA 4YYCA 3RAOA 1B4EA 1XLJA 2H90A 1IEWA 2FZBA 3H7UA 2E8ZA 1XLDA 5D4YA 2PLKA 3LGDA 1SZRA 1X8CA 3WQWA 4E4FA 3OQ8A 3UCQA 5D38A 3VC6A 5E93A 5K9CA 1OFPA 1CXIA 1NP0A 4F66A 3KDNA 1V6WA 4FEZA 1H51A 3QBUA 3W7QA 1DWAM 2PBOA 2WPBA 5BXSA 2D2JA 3ZT6A 1GVEA 2J25A 2JK2A 1AD4A 1NFBA 1UD2A 4C6QA 1BKHA 3AYTA 5DRCA 1X7FA 3TUUA 2WCGA 4IJBA 3T78A 2OB3A 3URNA 1Q6FA 1HKVA 4X9SA 1XCXA 5CGTA 3HG2A 4GX8A 4H7CA 4NVTA 2WLZA 2PUZA 3KHJA 4QAIA 3P0XA 1MEHA 5HATA 1UH4A 3MC5A 1JVNA 2JGYA 2C14A 4OV9A 4CNUA 1UUQA 2DSVA 4W7WA 2Z26A 3GHUA 3VD7A 5G1YA 3PWGA 4HMDA 5HUPA 3LZ3A 4WK9A 2VRKA 4FLSA 4OQVA 4RNFA 3S1XA 3KRUA 2F6XA 3G1SA 3PTQA 3EEZA 5K9DA 5HUOA 3A47A 1CXLA 1ZY9A 3VKJA 4YIWA 2FZ9A 1A3HA 4MDOA 2PTWA 3QR0A 2V3GA 3KBSA 3BW3A 4IIDA 1A0EA 1TQXA 3U5UA 4L61A 3V5CA 2EG6A 4MFEA 5U4NA 4WSJA 1DL3A 4O52A 1XQLA 4FX8A 4J4KA 3WBXA 4MG4A 3LK6A 4Y8EA 1XFBA 1Q4NX 1BKSA 3TMQA 2YX0A 2PDLA 1SZGA 1UWIA 4EPEC 2O9PA 3M07A 1TG7A 1PTGA 3GTNA 5FF3A 3CUIA 3GTIA 1SZFA 4HSNA 1GG1A 1VS1A 3GX9A 5AECA 1JFXA 3HIJA 1RJRA 3ZR5A 4F48A 4XBKA 3LM7A 4HZ7A 4GI4A 4TV5A 3JZEA 2Y4SA 1TE6A 2QPUA 3LV5A 4JKKA 1VBGA 1NIUA 4QCEA 1SUXA 4FXSA 1KM0A 2NX1A 4R9XA 1XIGA 4FS9A 1AA1B 3GVRA 2L5HA 2GVGA 4JXCA 6CGTA 6TIMA 4D6FA 3BGAA 5FESA 3BC9A 2WM0A 1M3UA 4DO4A 2NQLA 4LUIA 2YFNA 3KZPA 4KEZA 3A4WA 3TX9A 3EWZA 2WBKA 4RV3A 5HPOA 1DJXA 1E70M 4Q7IA 4CNNA 1L2UA 1OK4A 3O6AA 3C0LA 4JQAA 3D47A 1C8XA 3HA1A 2FZ8A 4CLMA 5HINA 3ITLA 2WNQA 2XH2A 2EKGA 3L4VA 1H7WA 2DJLA 2QULA 4JTGA 4Y7EA 1H63A 1Y5XA 3EPOA 3N18A 1KXVA 4MNJA 1W37A 2RDTA 4KT2A 3P2VA 3VKDA 1JZ7A 1CCWB 2DZUA 3MY9A 3LHYA 1FWWA 1E73M 4BF5A 1QASA 5CSUA 2HTMA 1LL4A 4TU1A 1W9BM 3SBFA 3TJIA 2X0HA 3BCFA 1U1HA 4OUIA 2Y8UA 1IXOA 5I09A 3A4JA 1GQIA 5A6TC 3QPEA 4NZJA 3EA1A 3M0YA 4CN1A 1TUXA 3I6TA 1UR4A 2V3FA 3WUEA 5A8PA 1Q7QA 4YWIA 4IGHA 2UZ9A 4AZCA 7A3HA 1B2YA 1DWFM 3G22A 3VNIA 1LRQA 3G1DA 1IIGA 4ZXOA 1XW8A 1SW0A 4PTMA 1GJUA 3M7WA 3N4EA 1JJKA 1RP8A 2G8ZA 1OZMA 3A21A 3GXNA 4AWSA 5B7YA 3PZIA 2OO6A 2Z7KA 1SPQA 5LA1A 4IGNA 3POHA 4DPQA 3T6CA 1TV4A 3SAZA 3SQMA 3BZGA 4XVDA 4Z42C 4BF7A 1ZFJA 3HJZA 3KM8A 4JX4A 4ZXLA 4M24A 3AMGA 3BLIA 4OWGA 3OG2A 2GOKA 1KV5A 4AY1A 4LEFA 4W8AA 4Z1YA 2ZICA 4XUYA 2ACRA 1RZMA 4CVWA 3W29A 2FMNA 3WLSA 1AJ0A 9XIAA 1Q6OA 4NNCA 4W84A 2QDGA 1ECEA 4IP4A 1G67A 1OIFA 4LYKA 2ISSA 3GSMA 5H2ZA 5M2FX 2CHOA 1QI2A 4NUWA 3MS8A 4PGLA 3IIXA 4PODA 4GZIA 3WLTA 2Q3RA 1DKWA 4R3UA 3BURA 2HV5A 3OLDA 4IMGA 3UYCA 2CLEA 3MHFA 1UD8A 2H3DA 2HEJA 3B8DA 1A3WA 4YJ5A 1M41A 1PX8A 1E5NA 2RDXA 1K4GA 3R0KA 3AICA 4PMOA 4IQLA 1W1B1 4Z2LA 2JKEA 4IT1A 3GDMA 2PDQA 4P8UA 1ZAHA 5A6SA 2FZDA 4B4FA 3DFYA 4DX3A 2RJHA 1HKWA 1A5UA 1ZP3A 3ZLGA 5FKYA 4JYFA 3VIFA 1WX0A 1X39A 2Z6IA 4QJ1A 2LLEA 2OXNA 3W7EA 2PDMA 2D2GA 3T44A 4DN1A 5C0QA 3W7HA 3CAKA 2DT1A 3AWOA 1I75A 3QV9A 5HNTA 1B54A 3WSUA 1DWGM 5I0DA 4RDWA 4WOQA 5REQB 1LRTA 4ORMA 4GE8A 4UTWA 2QJJA 3STCA 3FFSA 1H7PA 1IEXA 1NOFA 1ZQ5A 5IOBA 1Q85A 1ZTVA 4IX2A 4HN8A 1CECA 6TAAA 2PTZA 4GXWA 1AMYA 2J24A 3PPGA 3NM3A 3GIQA 4IUGA 4MWAC 1TA3B 3OVRA 5EYWA 5FI8A 2Q71A 4KWSA 5CPLA 1SZEA 1Q66A 4QGCA 1ZALA 2P1FA 3BSMA 2G4FA 3KBVA 1UR8A 5BXRA 1PUDA 1PWMA 2VOMA 3LXCA 5B7ZA 3DGBA 2IXUA 2JKAA 1KFWA 2YB4A 3WYZA 1W5OA 3GNPA 1KV8A 5A2CA 3QZ6A 4X2PA 3RJXA 4EPDC 2PU0A 4AHQA 4DWSB 2J9ZA 1WP6A 2DZAA 2FMOA 2FHFA 1VC4A 3DDMA 2I17A 4KPLA 4DHGA 4DBEA 4HNVA 3CQHA 4XQ6A 3CYVA 1MQQA 1FWNA 1TIWA 4FIQA 3GHRA 3T08A 3N14A 4GUHA 1JDEA 2BY2A 2OOGA 3KRBA 4J35A 1DVJA 3USZA 3A3HA 3VX1A 5HQMA 1EO7A 2GJNA 3CV7A 3FSUA 4LVDA 5C6MA 3DI1A 3PWIA 2UY5A 3KHDA 2OWXA 3GXMA 2W91A 4M1RA 3P82A 4POCA 1XBVA 1HJXA 3A4AA 4OU1A 2WPGA 1SM9A 4C5YA 2DORA 5LIYX 3LM3A 4P7QA 2Y5EA 1IEVA 4WY0B 4HSHA 1FBAA 2X42A 4JICA 1KFKA 3MQTA 3TJXA 2IUZA 3UZJA 3K13A 3P81A 2BDQA 4NYYA 1A5AA 4JZ5A 3RITA 3WDIA 3NEHA 2KX9A 3IJ7A 3GTHA 2YDQA 4DJED 4PFMA 3ZIZA 3VOGA 1JYWA 2A3LA 1QI0A 2A5HA 2CLIA 3W7IA 2PLCA 2Q6ZA 4AQLA 3T81A 1KTCA 2WM1A 3M64A 4FO4A 4I6VA 1C91A 4AF0A 3SCSA 4BQ2A 2J7GA 3G18A 2J74A 3OA5A 3BPWA 4QEHA 5J8LA 1ZU8A 4R27A 1EDGA 1R3QA 4Q3MA 3TQVA 1J0IA 3DCPA 1E6NA 3TTEA 3BAXA 3TLLA 1L6GA 4US6A 3THDA 5AZ0A 4UQCA 2J7BA 1R38A 1XSJA 1PIGA 4PUEA 1G4SA 2C19A 4QG6A 2V3EA 2CW6A 3ABSA 1G4EA 3DYMA 2AGTA 1C3FA 4UCGA 4E8DA 4DF0A 4UTKA 3EZ4A 2G95A 2CKSA 3GD6A 4XTDA 4CCDA 4ICCX 4DB7A 4K1GA 3CMGA 1EH9A 2IKGA 3W73A 3WD0A 3A22A 1U83A 1H7XA 2VEPA 2AAMA 3UD6A 1N8IA 3RPDA 1W3IA 3FA3A 2WVSA 3B97A 4PUUA 3HQNA 5EFDA 3A3WA 1CLVA 2OQYA 4QDPA 1REQA 3IGHX 1F6PA 5FCZA 1FWIC 2YFOA 1FDZA 1YTDA 3P61A 3AI0A 5DMLA 1U33A 3W76A 3CZEA 4CNPA 3GFZA 3C0JA 4S3JA 2VQTA 5D05A 3UWZA 5GQBA 2W79A 1SJBA 1VPYA 1TV3A 4GC3A 4XD5A 3UA4A 3C5QA 2QKFA 1EC8A 2OLSA 2QUNA 1GKQA 2G37A 3K46A 5FIPA 3UETA 1SYTA 3GO2A 3ITXA 3EX6A 4KRTA 3AMLA 2X05A 3UYIA 3IAPA 3TN6A 1GYNA 3PG9A 4JR5A 3ZJKA 1HF6A 4LCQA 3ARUA 4S39A 1GWJA 4D6IA 2WVUA 4IMAA 1JYNA 4H7VA 1GVQA 1EQPA 3S2LA 3ITYA 2CBUA 3B4YA 1KXQA 4I7UA 3K5XA 4L9YA 5D8WA 4F8XA 3BLFA 4A05A 3RRXA 3HQ1A 1JZ2A 3NQ7A 3N3MA 3CASA 4QSHA 3ZJ6A 3UR7A 3UEQA 1UCWA 4P8VA 4AEOA 5KZ6A 2V81A 1MQPA 1PBGA 1X1OA 3K8KA 2A79A 4HCDA 3E0LA 1H62A 1RQBA 4V15A 4RLIA 3VOCA 3TA6A 1QOPA 1TZZA 1A0CA 3NO5A 3TYDA 4UFKA 2WK2A 1EIBA 2DIKA 5CSRA 1AH4A 2TRSA 3GXDA 4XZLX 3UXIA 2OT0A 2PI6A 2Z1VA 2ZX9A 4B16A 4M80A 1OG0A 1V0NA 1HGYA 4HK7A 3SY5A 4V1XA 4C6IA 2VGIA 4PA8A 5FJUA 1M65A 3M44A 4G8TA 3CZGA 4ZQRA 2Z1BA 2YYUA 1S2UA 2J13A 5LA2A 3H6OA 1ZRQA 3N6HA 1V6XA 2W67A 2E77A 2D23A 2OKOA 3BOXA 3TOYA 2QEZA 2BOGX 3QKEA 3VIJA 1ICSA 2CZDA 1ONWA 3VKBA 6ENLA 1DEDA 2YXXA 1TZ9A 4WJEA 3SCWA 3W1UA 1TFVA 4D9PA 1BG4A 3GU9A 4L80A 4FNUA 3LPPA 1JPDX 3O1NA 3FW6A 1UASA 1MW3A 3F4CA 3QV6A 1FCVA 3EB3A 2ZRXA 1H3GA 2ZRWA 1EJWC 2WC7A 3U3HA 3VYLA 1QNOA 1A47A 1O5RA 4GNVA 4WZHA 3EOOA 1IZJA 4EAYA 1UJPA 4TMCA 3CWNA 2QJIA 1QXLA 4IHCA 3Q37A 3KCJA 2Y61A 2GVLA 4L56A 1E9YB 1HP4A 1F3XA 3WQVA 4LOCA 1UH3A 1F74A 1GPWA 1P0EA 3GZ3A 1MXSA 5C5YA 4QISA 4IPPA 2VZTA 2E9LA 5ABFA 4E3VA 4JTRA 3W7MA 1DORA 1V7AA 3AXKA 2YBVA 2XFWA 2Y7FA 3OBKA 4XIAA 3N2TA 2E67A 3ARWA 3VM5A 4AMCA 1RCXB 1R3YA 4ZO8A 1EJTC 2FPVA 5FA5A 3S2CA 1TVPA 2PGRA 2ZA3A 4AYGA 1E6XM 4HCHA 3TC7A 5PTDA 1TV5A 1VYPX 5A6KA 3IGUA 1QNVA 3Q67A 3TYCA 3AO0A 1A50A 3OGRA 3FAWA 4O8RA 4FLOA 3EA3A 3HM7A 5BWFA 5HDRA 1WB0A 3W74A 3ZJ7A 4BEQA 4Q4MA 2DY3A 2POTA 3SCQA 4S2BA 1V4YA 3QYQA 2W63A 2CEQA 4M1BA 3G1HA 3MDWA 2NWRA 4LUSA 3VIKA 4PC8A 1O12A 1GHSA 1A5MC 4HPNA 1RVKA 3LD5A 4W89A 1ZCOA 5E0FA 1W3KA 4IM4A 3O06A 1F8MA 3EB2A 1AW5A 3R43A 5MKGA 4FB7A 2WMIA 1XLFA 5BU9A 2WW5A 3W82A 2BG5A 5D8ZA 1LWIA 4HHMA 5K3VA 2QLYA 5CAKA 5IDZA 3OGSA 4I6KA 2VX5A 3QLLA 2GQ3A 2NW0A 3T55A 5AHMA 1H7RA 7CGTA 1WKDA 3AHYA 5D2TA 1ZBKA 1XUUA 4U33A 4A3QA 5ABEA 4BF9A 4B92A 3EOEA 1K1DA 1W1YA 2PF8A 1TJPA 1HXJA 1JUBA 3ANYA 2ZDSA 3QPZA 2ISFA 3NWRA 1KA9F 4B5WA 1VJZA 5BNKA 3I7RA 3W7DA 3LLXA 2HWGA 3MVIA 2AL1A 1AUSL 1KFCA 4C65A 1ESWA 1PZ1A 2Y0FA 4GUFA 3AZSA 1SSDA 2ZUMA 4RNHA 2VNCA 3KRSA 1J12A 3L0NA 2BHZA 3R12A 3ZSTA 2OSWA 3TH6A 4JQ2A 5I3DA 1R3RA 4AU0A 2XTKA 2QCDA 4I8YA 3AIQA 4MUPA 3R58A 4GVHA 1OB0A 5FJRA 4MM1A 2VCCA 1R9YA 1W9XA 1V0LA 3G2GA 3NJ3A 3POCA 1HL9A 4HZMA 5EPDA 3JUGA 4K6AA 4CCCA 3LHTA 4LANA 4KS0A 5I78A 4WKFA 4HPJA 3H70A 2NV2A 2TMDA 4GA8A 3NQFA 3MWCA 5LIWX 1KR0A 3ICJA 4ML9A 2NQJA 3MPGA 3RLUA 1IT8A 4UTMA 4L6DA 5D2WA 4ADSA 4GUGA 3MSGA 4DJFD 1KCLA 1TV7A 2HXUA 4GD0A 4AIUA 4L64A 4DF1A 3G1RA 4GH1A 2X7VA 4QBXA 1GPFA 1CGWA 3DENA 1R5YA 3WD4A 1UBSA 4PUNA 1PKMA 2X2GA 3B8VA 3U9IA 2VFIA 4IIHA 2D24A 3URAA 1W9PA 1LG2A 1MZRA 1KM2A 2C8NA 1R30A 3P8IA 4XKYA 4GZEA 2VP8A 2HDJA 1ZLPA 4X0VA 1WXYA 4HZ6A 2YGYA 5JUVA 4CNOA 1FRBA 2CCRA 3UBPC 3LG3A 1FH7A 2Y5SA 1UKQA 1PZ0A 4CD6A 3PJTA 4L9XA 2QCDB 3NURA 2ZRZA 3LMZA 3FJLA 3JS3A 2C1IA 3N9RA 5FSDC 1LWHA 4C90A 3VD5A 4GX9A 3WO8A 3BDKA 1O1HA 3BJFA 4DAIA 4H8HA 7ODCA 2W3ZA 1VCVA 2EPOA 4ROPA 4MJZA 3KOYA 2AKZA 1PTAA 1H1NA 4P8WA 3F4VA 5HR7A 1L8PA 1QMLA 1UP2A 3OQEA 3KLLA 4YTRA 2ZXDA 3MZNA 4EOUA 1XYAA 4ZQNA 2CWNA 2YL6A 4M7SA 4GLEA 4RE4A 3NQDA 1GZJA 5D33A 5XINA 5L6UA 1P4CA 1TPDA 4IIFA 3VGGA 3EMZA 4GQQA 1R7OA 3NQGA 3WL0A 3GUWA 3NQEA 3S9ZA 4UUIA 4WXZA 3KE0A 3WK3A 3VOJA 1TO3A 1TELA 3RU8X 3A64A 3PBYA 3GIYA 1N7KA 3WBAA 3WLRA 6PTDA 1VPQA 4C6EA 4G7EB 1R3TA 2GQ8A 4HIBA 3L5LA 1W2VA 3ALGA 4NAEA 1NQKA 2B7NA 3GG8A 1YTEA 4WOZA 2NUXA 4C1NB 1Q2RA 1XF0A 2JF6A 1IXNA 4ROQA 1UR1A 2QCEA 1ZJIA 3K4AA 2DZVA 4KEMA 1AH0A 4TO8A 4E4UA 4EPBC 4UCFA 1QTWA 2FIQA 4KESA 4PMRA 4MTVA 1EQCA 1XIHA 1LLOA 3GNNA 2YCIX 2X2YA 4D6GA 2ZE3A 9RUBA 1EPVA 3BJSA 3GAKA 2QMJA 3C0SA 5DEZA 4KF1A 6A3HA 4IUOA 3P67A 4Z2HA 3PZMA 4Q8PA 3UPWA 4DXVA 2XGBA 1LDCA 1XR2A 3EB4A 3HGRA 5I3IA 3KP1A 3LV6A 4MHBA 3MSYA 4ATLA 2EKCA 3KS5A 1N8WA 4F40A 2QF7A 4LUYA 4IIBA 1YHTA 2IKHA 3HPSA 4LQ1A 1PZ3A 4NAEB 4MB3A 2VFEA 1R9XA 2ASHA 1AD1A 4GUJA 1ME8A 3WH6A 4AHOA 2E8YA 1E51A 3G6MA 5C9UA 2WMJA 3NDOA 2PCQA 4MAZA 1J18A 3RFAA 2ZZ6A 1C92A 4UIOA 3M7SA 2AMGA 1TTJA 1GOOA 3KBNA 4K1WA 1XD0A 1UMLA 4QX4A 3S6TA 4JS3A 2ALRA 3N6JA 4OT7A 1DQUA 1KCZA 1CGUA 4XIMA 5C70A 5G4HC 4H6KA 4YVVA 4AZ5A 2Y8KA 2HBXA 1VLWA 4AX6A 4OHQA 1THFD 1YDOA 2OEKA 4LUTB 5A69A 3QC0A 1OF8A 4I9AA 4AVOA 4LV4A 5K9XA 2J7CA 4NQ1A 2XM1A 4KCVA 1GVSA 3SR7A 1HKMA 1RV8A 4PL1A 2INZA 3D3FA 6REQB 1SO5A 3FVMA 1F73A 4J3UA 1B31A 3KOXA 2JEQA 1E71M 3HGOA 4UTIA 5AYIA 1J0JA 4KWUA 3WCZA 3SCOA 1I2QA 5HNUA 2BBFA 5I3HA 3ZQ9A 5HBFA 3NQBA 4JIPA 2V38A 2B7PA 3I3BA 2V5BA 3W00A 4IQEA 4XBSA 4NXSA 4NAFA 4UFIA 4O10A 3S0CA 4EXQA 2VEIA 3W9ZA 2PDBA 3CEPA 1UUMA 1VRXA 1SFTA 4KQNA 3ARSA 2V5CA 3IJ6A 3EWXA 3I68A 1QU4A 3FJ4A 3FK4A 4UMCA 4ACYA 3NSMA 1V6TA 4KETA 3MANA 3UCCA 1UKTA 5BW6A 4EPKA 2XVLA 3FA4A 2W61A 5T91A 1TTPA 4D8LA 2UY3A 2HJPA 2R24A 1GTHA 1WQ5A 4KEUA 4DBSA 1Z44A 2WB5A 4PUWA 5M1TA 2DUAA 4NAFB 2GSJA 4H1ZA 1UA3A 3TEVA 3NPXA 3C3UA 4RW3A 2DZBA 2QUTA 3RM4A 3IUIA 4ADTA 5MHBA 3T8LA 3N11A 1JD9A 4FNRA 3NQ6A 4XTIA 4LB3A 1Q6RA 1NDVA 4CQ8A 3KX6A 3VZYA 4Y90A 1RJQA 4LEQA 2ICSA 1KRAC 2CU0A 4F2TA 2ZWZA 4X3ZA 3GW0A 1R7AA 4JTTA 3N73A 5LGXA 3UPBA 1I0BA 1F3TA 3WF2A 2WJFA 2WSYA 1WKFA 1A5KC 1E4IA 3BUVA 1GOIA 1T5AA 4MJ2A 4UMBA 5DF0A 3ZLFA 1VEPA 1KGWA 5CG7A 5C7VA 3RYSA 5BXPA 3G1FA 3TR2A 2PD9A 1A4LA 1VYRA 4MZ1A 4Q8QA 2A3BA 3IPWA 2FZNA 4PCFA 5TF0A 4WY0A 2WWDA 4D1JA 3BAKA 1X8FA 4V27A 4ERIA 4URIA 3S5YA 2X41A 3UY7A 2V6AA 1A3XA 3ZJ8A 1I2PA 1U5JA 1LOSA 4GQGA 4MY9A 1GCYA 3H23A 4O54A 3E0FA 3T0DA 3GU1A 5HXMA 3HMJG 4FLQA 4G2DA 3WLKX 4GVIA 3TVAA 2PB1A 3ZT7A 3FN9A 2ZVIA 2D22A 3NZPA 5LNWA 2YBUA 3B4UA 3MUAA 4LS2A 1RVGA 8CGTA 1TRDA 4O1AA 3EA2A 1BYAA 3SI9A 3TROA 3LTSA 1O60A 3VZXA 2HSAA 2ZQ0A 3RM9A 3KS6A 1CGXA 2TYSA 1B1YA 3BLOA 4KIRA 3UWEA 2YA0A 1BQCA 1IXPA 1K7FA 4Q4OA 5DBTA 1M04A 4GYJA 5GJNA 1SO3A 3L4XA 1W9VA 1FH8A 2FVLA 2W4XA 4HOWA 3OHIA 3LA4A 3NQCA 2FGBA 3GKAA 4PCPA 5GNYA 6XIMA 2H8XA 4IPJA 2BOFX 3ZLHA 3WBEA 4AWUA 1EEPA 1KB3A 1UWTA 1XLCA 1K02A 1RCOB 4GIYA 1SJCA 3PM6A 3PUOA 4GO9A 1A53A 1X1NA 2ZX7A 4UR7A 3T2PA 1JQVA 2WSQA 3LLDA 2DZTA 3FHAA 1EO5A 4W88A 1L6YA 3AUJA 1BRLB 1H11A 3BMXA 4HMNA 3U2ZA 2A7RA 2PWUA 1O5KA 1L8NA 1TSIA 1FWEC 7REQB 1EJVC 2PWHA 4IICA 2F7FA 4E0CA 4ERAA 3TJ4A 1IEIA 3H53A 4JIHA 3N1AA 3WJXA 5HA7A 4ZO6A 1XUZA 5HULA 1K03A 4ZODA 5EBAA 2XH7A 1QT1A 3W1NA 2QGHA 2ZA1A 4AW7A 1GQNA 5HR6A 1CXKA 3EKLA 2W5FA 4RZ5A 2D0GA 4Q4PA 4GY0A 3Q58A 1G01A 3ELFA 4HNNA 1OJXA 1F61A 5CBBA 1F6YA 3ZVHB 2BWGA 1B9ZA 1XBZA 1W9DM 1XLLA 1WXJA 4W8BA 1K9DA 3TN5A 5HQLA 4JX5A 1OWQA 4A2RA 3GU2A 3LHZA 1I2RA 2DVTA 3N17A 3HGJA 2Z1KA 4GOAA 2GGHA 1CW2A 1GQJA 3NL3A 3QRHA 1UD3A 3LNPA 2QMKA 1NSJA 4Y6GA 2RH9A 4XB3A 4O57A 2E28A 1Q5MA 1S2VA 4F79A 3W75A 5J5RA 5AHIA 4Q6JA 3H4WA 1OD0A 1VJSA 3WEMA 4TIMA 3VVGA 3QN3A 3W1RA 5G1TA 1UWRA 4KKXA 4PMDA 1VEMA 3WJZA 3HQPA 4JTKA 3LQGA 3CWHA 4GJJA 1YQ2A 1Y5WA 3HJEA 3MKCA 1OQFA 3WUGA 4LT9A 4KRUA 2XIQA 1LYXA 4GXPA 3P3BA 3W07A 4P7NA 3WBWA 5CH9A 4G56A 3B05A 3AJ7A 3CC1A 4OZOA 1F9CA 1ENUA 1J9YA 1PX4A 1I60A 1MW0A 5IRPA 5LNRA 1E6RA 3HO8A 3MP5A 2PTDA 2J9XA 3NQMA 4LYRA 1YBQB 1LQ0A 4N42A 3ENLA 4UNLA 3S1WA 4Y8FA 1GTEA 3CS2A 4ZL1A 1MNZA 1X1ZA 1GK8A 3W2KA 1HFBA 4DY1A 1C7SA 2DZSA 4LRSA 4EK7A 2HQAA 4MWAA 4LNCA 5KETA 1J0YA 3P93A 1TWDA 4IFKB 1E1EA 3KXQA 1FWJC 5JMUA 3ZM8A 1FFRA 1CBGA 3FYPA 3C6CA 4PMNA 5HNRA 4NT0A 2I14A 2VM8A 2VKZG 5HMEA 1CZ1A 1PV8A 3TNBA 3O7UA 1GONA 1UKOA 2YCLA 4NZ4A 4IISA 3OZMA 4V28A 2EPKX 4QHRA 4QS6A 1MO0A 3QHOA 2E6AA 1G4PA 4HNTA 2AQWA 2NLYA 3MO7A 1XSIA 2E1DA 4ZBCA 4AZIA 1ZAIA 1PYMA 4US5D 4L6HA 1DXFA 4UC5A 1M1BA 4JKMA 2FFCA 2RAGA 4RXGA 1TPUA 3L4UA 4LC6A 3IEBA 4EWJA 1RH9A 2HNHA 2CKRA 3W02A 4XO6A 3EOSA 5FEXA 5BOEA 4W87A 3NYZA 1A5BA 3EPNA 4MY1A 3UZZA 3TW7A 3UCDA 1UKPA 4GC4A 4ORIA 1EL3A 4F0RA 4O1FA 1JRBA 4E8CA 4TX8A 1JPHA 1XIEA 3VD4A 3B9AA 4MB4A 4ERGA 3VNMA 4Q33A 3IIVA 4O17A 2ZVRA 1ONEA 4WGXA 3TIMA 2J9YA 3GWQA 2OGJA 3F7JA 3S5OA 1W17A 4XISA 2DT2A 1DJNA 1ME7A 3FXYA 2WKLA 3TTYA 4HD5A 4JTUA 1CEOA 2WSRA 3P14A 3ZSSA 1NM9A 4CQAA 2YXGA 2R94A 3FV9A 1J0HA 3M0VA 4N2YA 1XJBA 3NIYA 4AWEA 1G94A 2CLOA 4BQ3A 2ABAA 3MJYA 4ZE4A 2XIOA 3OLGA 4AEEA 3QQ0A 4YLWA 2GDUA 4QQUA 1ADDA 1U22A 2OKTA 3WMBA 1FWDC 3A5FA 3LYEA 3C61A 4KCWA 3SJNA 2NSXA 3VGDA 5AC5A 2H9AA 2SFPA 4WSHA 4E8GA 7XIMA 2ZA2A 3GR4A 4E6MA 2B31A 2D20A 2YYTA 2XG9A 2QAPA 2O7SA 1K8YA 2DZXA 4F2BA 4S3DA 3E6EA 4H8NA 5A6LA 2VX6A 3MKKA 2E68A 2DH2A 1JCTA 4XK2A 1BTCA 2PWFA 3CHCA 2QR6A 3T4CA 1GW9A 4XAFA 4Z1CA 4DPPA 1QNRA 2C91A 3RG6A 1W5NA 5HMDA 3CJPA 2RGLA 1QW9A 1M5WA 1F5ZA 1P0NA 3UWYA 4GY7A 1SU5A 5A6MA 3SQLA 3ZVIA 4AC1X 4MDPA 4D72A 3VGBA 3PVFA 4BZYA 2FFIA 2J6XA 5HK4A 1E15A 4K8GA 3SCRA 1W8SA 4C7DA 3QKZA 3P5YA 3VDCA 2VRQA 4DBWA 4KGLA 4WQ6A 4JAWA 1Z7AA 2O4QA 5ENLA 3AZRA 3GVGA 4BWLA 4N6EA 4REQB 3ALFA 1MYRA 1R8LA 2PDNA 1H1YA 4C6OA 4C6FA 1J0ZA 4A3RA 4GKLA 1SR0A 3H55A 4OGZA 3K4WA 4LS0A 3KL5A 4GJIA 4JD4A 4XSLA 1TMHA 3IANA 1OGBA 2XGZA 3ITOA 4NY2A 1ZGDA 1W1VA 3W7JA 4AD4A 3TP4A 1OBAA 3NPVA 3EWWA 3OVQA 3A6OA 1XPYA 5CGMA 4KW2A 4NXKA 4GIAA 4HU8A 5F7UA 3GKFA 1EX1A 3VTRA 3P80A 3INPA 1VBRA 1P5BA 4AVFA 4UFLA 4DJEA 1M01A 4NNBA 2BSLA 1VIWA 1XIMA 2QPXA 3V1HA 3V4BA 4GIRA 3LY0A 3MDUA 3QSTA 4M6UA 3TKFA 3N2CA 3M0MA 1VFFA 4HK5A 4O14A 3EX2A 4Z1AA 3T07A 4S23A 1W5QA 2ZX6A 4PTVA 2TPSA 1LBMA 1JCNA 2QCHA 4TV6A 2YL9A 4J3ZA 1S5TA 5TNVA 2WAGA 3BLLA 3MUIA 1CXFA 1VYSX 2ZZ4A 4US5A 4G7EA 2HXTA 3E0VA 4JIEA 2QDEA 3UZYA 2Q01A 1EUNA 1XQKA 1WA3A 4J27A 1BF2A 3KTCA 3NEVA 2D73A 4PRWA 3GRIA 1X96A 1DP0A 3O6YX 3CLWA 5G1MA 3GNXA 3W6LA 2IQDA 3U2EA 4U31A 4I8DA 4AY7A 4WHBA 3DFSA 4E3TA 2V5KA 1LWJA 2PC4A 2ZDRA 3N12A 2PTYA 3M6YA 5FAGA 2GJRA 4HHPA 4IXXA 2DU2A 4MUZA 5A94A 1J11A 3MZ2A 5DXYA 4R88A 3FDGA 3NSXA 2BGNE 2WWCA 1S3TC 3ANUA 1AQHA 3UXKA 1B57A 4UNIA 1WAWA 3O9NA 3VNLA 4P61A 4ML4A 4JTQA 3O05A 4EANA 3W1PA 3LPFA 3U57A 4JTJA 4RX0A 3UW6A 1T8QA 1V03A 1CGVA 5CPNA 2HBVA 4L4MA 2YDAA 2YSWA 2Z24A 4DWSA 1PAMA 1FWBC 2FB2A 4D8ZA 4N4PA 5C55A 3P60A 1WXZA 3UWWA 3WL1A 1WAUA 4HPGA 3EDEA 1OHLA 1TMQA 5KTLA 4D1IA 4Q8UA 5CBJA 1LL6A 5BMXA 1V3JA 3ERPA 3UJEA 3B8UA 2VTFA 2DUXA 4KBXA 4UFMA 2ZRYA 4YHEA 3LU2A 1NP2A 4UTJA 3ES8A 5AYXA 3AU6A 4NYUA 4Q7BA 4UQAA 3ARYA 1GEQA 1WUEA 5TQLA 2KZHA 3C56A 4IH3A 1C9DA 4G7FA 4O18A 1IEQA 3R8RA 1NDYA 1QHOA 1AK5A 3BLDA 3TC3A 1KFJA 2ATSA 4QP0A 1EUAA 3LSBA 3FSTA 1QI4A 2GUUA 4FMVA 4UNKA 1K8CA 2Y85A 1GVRA 4PB4A 2PWEA 4DUXA 2ZUUA 3KEHA 4QTGA 4Z08A 2CHRA 1OCJA 4HYRA 2A6NA 2F9RA 3W7PA 5HWMA 4UQBA 2XISA 2PURA 4LSBA 5LIUX 3W3OA 3Q2DA 3SCPA 3I3DA 3NGJA 1TREA 1UG6A 3UFYA 4QRNA 3CIWA 2A7NA 2PDPA 1WNOA 3C2EA 4QG9A 2XFYA 5CBIA 3GG1A 3OLEA 1S5VA 1XSKA 3DHDA 3W2MA 2DSWA 5I3GA 4WXYA 2GSEA 3SDOA 5HMFA 3IS4A 1TKKA 1SFLA 3W7GA 4I7WA 4LS1A 5FF4A 5C2GA 4EACA 1J5TA 2YA2A 1S3HA 3EPMA 4PUKA 3PBWA 2GFTA 3L68A 4FXRA 3VU2A 4B5VA 3UA3A 3DC0A 3W2NA 3VIOA 3EGJA 3HPFA 5BRPA 3G3MA 3T4WA 3OG3A 4RZBA 2QIWA 1B30A 4PMUA 3DKLA 1UKSA 1TB3A 2V2DA 1KGXA 5D30A 1B3WA 2GUYA 3ISIX 1D2KA 4G5DA 4QROA 4JFTA 1EJRC 3LLFA 3WENA 8XIAA 1F4HA 3HPZA 1D8CA 4CCEA 1WDRA 4MOZA 4LAMA 2P88A 1TTQA 1ECQA 4NU7A 4GI6A 3DFHA 1QBAA 3GR7A 2RDUA 4FZIA 4MWAD 4O1EA 3IIZA 1KM6A 3H12A 2NX3A 4FNQA 4NG3A 3RJYA 4MADA 4F9JA 2HMCA 4QCFA 4H9YA 3AIBA 2FHCA 1W3NA 3ARPA 3VDHA 4WKAA 4H8VA 5C2CA 2ZC1A 3H2MA 2DV0A 1NF0A 3VCRA 2J7EA 4Y9AA 9CGTA 1M53A 3GNOA 2AMXA 3IAQA 4YCPA 3R94A 5A8QA 5CLWA 2E40A 4PB3A 2B81A 3BGGA 3O63A 4R7OA 2J7DA 5FAJA 2FLIA 4UMAA 3S5ZA 4MYXA 1KO0A 3DHUA 1UJQA 1VHNA 3W0KA 3UT0A 4D6DA 1UH2A 3BGJA 1GOXA 1VIZA 3QLDA 2ALDA 3AMDA 2VD9A 4ZSUA 3N2OA 3REQA 4GUIA 3NDZA 3VPLA 1DJYA 4F3HA 1KTBA 2GLKA 4UOZA 3QM3A 3WDHA 3CYJA 4JKLA 1EDQA 4FSAA 2Z1XA 2IS7A 3G0UA 3PANA 1BYDA 1N8FA 3H2CA 3MT1A 2CBJA 4XZ9A 5DANA 1E0WA 1Z32X 3WH5A 2R1LA 5DFAA 4WRHA 5TBOA 4DWSC 4G1KA 3BW2A 1ONRA 2X09A 4PBEA 5HOSA 3CNYA 2WLYA 5E9XA 4IOTA 3D0CA 2HS6A 3F1QA 3QGAC 1XDJA 1TYGA 3N9SA 3EOUA 3MP4A 2PWGA 4IMFA 4KMQA 3R4IA 4GI8A 4MWAB 4DJDC 1AG1O 2EBNA 1PJ9A 5EBUA 5CJ5A 5LIXX 4I9MA 1QOXA 4ZENA 4QJ3B 3KOZA 4PMYA 4JEJA 3P0WA 5DY3A 4QE1A 3FHQA 2G41A 2FPTA 1L6SA 3BICA 3WLIA 3GE7A 3S3GA 3ZR6A 1PVNA 3P74A 4C6LA 4GCXA 2QJGA 3LSCA 3EOLA 2GGJA 4JX6A 1DXEA 3RN6A 2J7FA 2E5CA 5C8BB 1LT7A 3KBWA 4FXFA 2OO0A 1PTDA 2QUMA 2ANUA 1AQ0A 4NRSA 5A2AA 4WIWA 3NXLA 5D2XA 4QM1A 1A80A 2QVHA 4K8HA 1W32A 2VEFA 1OFBA 3AJXA 4JQ1A 1JZ6A 3G5EA 3N3TA 8A3HA 5DMYA 1FHVA 2CZEA 2B7QA 3IV8A 5FD0A 3TSMA 1AW1A 4U28A 4A3HA 1EB3A 4YTTA 3LRMA 4XZWA 4MYAA 4O0QA 4B5XA 3KL0A 3CQJA 4R85A 1Z8AA 5A5WA 3APGA 4PRTA 4QJ5B 3ZVHA 2R6OA 1ODZA 4R53A 1F4AA 2Z25A 5CC7A 1W3JA 4H9ZA 2CZFA 3L5AA 1C7TA 3DBNA 3PZNA 4IMEA 5GNXA 2JQXA 2XFFA 1RBOB 1KKOA 1KTNA 1ITXA 2ZE0A 4XWUA 4QJ4B 3R0UA 4RJEA 3WQFA 1BSLA 4EXAA 3WKZA 2NQ9A 2VL4A 3JRKA 4LVAA 3ZO9A 4IJRA 4AEFA 3W7LA 4AAJA 1CWYA 3GFYA 3O2LA 1IE7C 2Q8ZA 2D3NA 4WD0A 2CLLA 4EVZA 1JF6A 3G1XA 3OTRA 2WHLA 4LY4A 1XH2A 3VNJA 4BCEA 4DIAA 1TZ7A 4BKNA 2B0MA 1GVYA 4U5IA 1JXKA 1PSCA 2GL5A 3SECA 1P6CA 1TWZA 1MFVA 2CZ5A 3VKAA 2BXYA 3L4TA 1W1A1 1QW8A 3MSRA 3W7KA 4FLRA 3EMQA 2FTPA 3HFYA 4F0LA 2BFGA 3SN1A 3UR8A 4PCNA 3MTWA 3R89A 4CVUA 1VGAA 4AVNA 2EQDA 2O0TA 3MW7A 4AG0A 4H19A 1CNVA 4LNYA 1XKYA 2NQHA 2PRMA 5FF0A 5GJMA 3OOQA 4ALDA 1EGVA 2X1UA 1HJUA 4IIEA 4DNHA 2ZCGA 4EIVA 1H60A 3NM1A 4NILA 3SGGA 3AS0A 3LX9A 1T40A 2X1TA 3MO4A 5I00A 4IPNB 1PCKA 4NZ3A 3NR0A 4HMCA 5HMSA 3L2MA 2FPYA 3ONCA 1UWSA 4ZEPA 3RDKA 3E2VA 5HAOA 2I5IA 3NO3A 3E1F1 1GOQA 4B5UA 2D2OA 3MV11 1GVIA 1OX5A 1FOBA 1XP3A 3VCCA 5AYYA 4HPXA 3DG7A 3I10A 5JBEA 4LALA 3ANVA 1QWKA 1A5LC 3FLUA 3MHGA 3VM7A 5EA9A 1AQFA 1XH0A 1EDTA 3TE9A 2R91A 1E6ZA 5H91A 1UP3A 1R2RA 1FH9A 3O3RA 4W5UA 1DXIA 2ACUA 4JCLA 3ARTA 4EF9A 3CZJA 3P7YA 4D8AA 4DWSD 2BXZA 5IM51 3G77A 3OEXA 4Q4QA 4C1KA 1K7XA 3F4WA 2C6QA 5A6BD 4N9BA 1RJPA 5KSWA 1IWBA 1T41A 5D9MA 3O0FA 3KLKA 1YPIA 3O6DA 1JUKA 4XSMA 3NZGA 4ICNA 5EMUA 2BY1A 3WNPA 3VI2A 1ITQA 4GBDA 2HROA 2PDJA 3KL3A 3PZOA 2IXVA 3UJFA 3N4FA 1VZWA 3RILA 1GEHA 2ZUVA 3FOKA 2OT1A 1Q65A 1W1TA 3VINA 3WH8A 2WC4A 1YPXA 4DZ5A 3WNOA 2E5BA 4PN2A 4JN7A 2GPTA 4ENLA 5CC6A 4L4OA 2J79A 2QCCA 3TTOA 1YADA 3GVQA 2CBIA 1TE1A 1JDCA 2XVKA 4AWTA 5HJLA 1YNPA 1Z6KA 2MANA 3BJTA 1DJQA 4GHRA 2OX1A 2VZUA 1P6BA 2EEXA 4TTGA 2C1GA 4C6BA 5I79A 3R10A 1OADA 4HU0A 1HVXA 3LCGA 1FHUA 1UQZA 4J2PA 2WV8A 4DXKA 4Q7NA 4Z0SA 3VMOA 4NKCA 4GYKA 5M03A 2G3NA 3QYSA 3KBJA 1R3VA 1H4PA 3ITGA 4GJ1A 3W83A 3TN4A 1KBIA 3EXTA 3BANA 3MB9A 3UP8A 1Q6GA 1PS9A 2CC0A 3NQAA 3ATYA 4A8NA 3DERA 4TX6A 3B8WA 1QW7A 1W91A 3IVUA 1KFLA 3GY1A 1KGUA 2QAFA 1UOZA 4OTKA 3NZQA 5CAHA 1F07A 2XZ9A 1VCGA 4ZZ9A 5CPOA 4QIUA 1TR1A 3DX5A 2X0YA 4O53A 3THUA 4I3GA 3O15A 1MVYA 1K77A 3SSJA 2RFGA 2VEKA 4N9DA 4WY0F 3PWAA 1K3UA 3CPGA 4JTIA 2QW5A 3WEZA 3A24A 1E3XA 3M0KA 1JCYA 2Z1SA 4MFDA 2VR2A 4MIMA 3ME3A 4MF4A 5G4WA 4RUBA 1V0MA 1LTDA 1HKJA 1XYLA 3CZ8A 3ZOAA 3HFTA 2Y89A 1UWAA 2PDXA 3LCIA 4WGHA 4JIQA 4NI8A 2BVDA 2OZTA 1R3WA 2J88A 1J10A 3OBAA 4DBDA 1OF6A 1YYAA 3SQSA 3CMFA 3NA8A 2J8TA 3ITTA 1GOWA 1QCWA 5J04A 4N9EA 4PMVA 3UWVA 2A6LA 1EOKA 1GZGA 1EBGA 2Y62A 3SGZA 3L23A 2OLHA 2VUNA 4PEKA 4K3ZA 5HWNA 3S4TA 2C0HA 2HE5A 3MYOA 5C54A 5FSEC 1O4UA 4MB1A 2AKMA 1MUMA 3S5SA 2VCAA 1RALA 1B4KA 4JCMA 4AD5A 1F3WA 1F76A 4RV8A 4DELA 2HVOA 3H24A 4OBTA 4J40A 2I1OA 3SUUA 2TODA 1K7EA 3BCDA 3GC5A 3AS3A 1IWAA 4Q4KA 1EPXA 3PPHA 3KUMA 2UY2A 3W7NA 5CC5A 3JZUA 2Y7EA 1VPXA 4IQDA 3IK2A 5FL1A 1B3XA 1G7VA 2WMFA 1HW6A 3NO1A 2WHJA 4CQCA 3NUKA 1GOMA 4WJ8A 3K30A 1EOMA 3IIOA 3L67A 1JCJA 3G1YA 4WEVX 4GCAA 5AC4A 4FF7A 1PWLA 1ZAJA 4NJGA 3LRKA 4N02A 3A23A 5LSMA 1IIHA 1RUSA 2J62A 3BQ6A 3WJYA 1EX5A 4GNJA 1Q45A 3WLQA 3QY7A 1UYQA 3SY8A 3S46A 4R33A 4C91A 1UPMB 3RM8A 1I0DA 3RPTA 1P6WA 5BYWA 1KFEA 2F6UA 3LCWA 3WQPA 1XGEA 1EJUC 1M9HA 3OIXA 3BL3A 4B3KA 2G50A 1LROA 4TVUA 4TMBA 4A29A 1NTHA 4HHHA 5F4SA 4OKDA 1IQ8A 5IXEA 3DESA 4DUOA 1T96A 5JH1A 4A22A 1UC5A 5CSSA 1XC6A 3N25A 3UVIA 5T8GA 5J5DA 3IIPA 2H6RA 2NXGA 1LQ2A 4DEFA 2V82A 3UY8A 2ZZ5A 4I90A 1RLCL 1QUMA 4DYJA 4C7FA 3V0SA 4OOUA 7PTDA 4HZ8A 4M51A 3LCFA 3K2GA 1EYEA 3PK7A 2JEPA 2F38A 4PUJA 4WJXA 1D7FA 4KFNA 1C8VA 2B4GA 2XYLA 1BXCA 2DW7A 5G5IA 1F2JA 3KW3A 3B8TA 3U2OA 3S2JA 1A5OC 4HGXA 4XV0A 5G4EA 2X1SA 1TJ0A 5AC8A 1VFLA 3SFWA 4A6GA 4LV9A 2OQHA 4EKJA 3FYOA 4HTBA 3HG5A 1POJA 5AHEA 1RPXA 2RGMA 4B3LA 1GNXA 3WDRA 4X9YA 1E0VA 4Z2IA 3CUJA 3G0SA 1KRMA 1M68A 2IPWA 2FGLA 1TIMA 3S2MA 4HP5A 4AY8A 2Q3OA 5CXPA 4M29A 1WDWA 1JG9A 3U6WA 2EG8A 3II1A 3SCVA 3PNUA 5EMKA 3SADA 3CL8A 3T09A 7TIMA 2BXVA 1PZ2A 4LBRA 5F4WA 1SFJA 3FEMA 1SR9A 1EZ2A 5EB8A 1JZ4A 1OX4B 4CUCA 1M7JA 1QFEA 3GLCA 1NOWA 4UFHA 1XGZA 1E0XA 2PZ0A 4BI6A 2V5DA 5E9AA 3RF9A 2PMQA 1RXOB 1FWAC 4O0ZA 3ZXWA 5CPTA 4GYPA 4XD3A 1A5SA 2ZTKA 1P0BA 4NZFA 4HK6A 4FNTA 3VGEA 5A8