2ZE2B

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 104
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B03
3E01B 5KG3A 1S1XB 4ZHRB 4ID5A 4ZP6A 3DOLA 1TKXA 1JLGA 1D1UA 2GC8A 3M9MB 5J2PB 2W9BA 4K4YA 4ECZA 1RT2A 1S1WA 3M8QB 5D3GB 4O3QA 2OPPB 4EO8A 5EDWA 2RDJA 2YNGB 3QZ8A 3PW2A 5C42B 1DLOB 3KK3B 4DL4A 1S0NA 1IKVA 3LALA 5L1JA 4J9SA 3RB3A 4NLQA 4KKOA 1HNVA 5KFUA 4Y2AA 4G1QB 3ICLA 4QW8A 5L1LA 3DDKA 4ED8A 1C1BB 1HPZA 4KV8A 2FVPA 1SV5A 2JC0A 2V9WA 4EBCA 3KJVB 5DGAA 2FJXA 3QGIA 5KT3A 5DQHA 3KMSA 3V6DA 4WYLA 2VA2A 3DRRB 4I7FB 1VRTA 4QWCA 2V0NA 4DL3A 2FVQA 3BGRA 4WXWA 1RTDB 4IKAA 3VQSA 1S1VA 1C0UB 4J9KA 3KLVA 4PUOA 4J9NA 2FLNA 3DM2A 5KFFA 4RW8A 1Z4UA 4URQU 4ECWA 4KV8B 2IC3B 3I5AA 3GIJA 3V6JA 2HMIB 3SFUA 1ZTTA 4F4ZA 3M9NB 5C5JA 3BJYA 3KLFA 3NKYA 3PVXA 5KFGA 3V6DB 3DLGA 1HNIB 1IM4A 1RTHA 1NHVA 2D3ZA 4I7FA 4K4XA 2IAJA 4NZ0A 3GV7B 3N6LA 5K14B 3NGDA 4O3SA 3DLKA 3H4BA 4NLRA 3Q8QB 1JKHA 3ITHA 4WXOA 1RYSA 3PZPA 1T3NA 4KHMA 2BE2A 3OL8A 3GV8B 1REVA 2R2TA 1JLQA 1S6PB 3KLIA 1HMVB 3MEDA 4WE1B 4R5PA 2IM0A 3HVAA 2UVRA 2XCAA 1JLBA 3LP1A 3IGVA 1DTTB 3BSAA 4DL7A 5KG5A 1S1XA 3LP0A 3TAMB 1S1TB 1TVRA 3M8PB 4H54A 3QGGA 4TY8B 3MR2A 5KFIA 2VG7A 3BSOA 5HROA 3FQLA 3HVWA 4WYWA 2W9CA 4LSLA 1T05A 4K4TA 3N6NA 2W9BB 3KK1B 3PJWA 4F50A 2ASJA 3GV5B 4ZHRA 1FKPB 3MEGA 1RT4B 5I42A 1TP7A 3PR5B 2AGQA 2D3UA 2HNDB 2FJVA 5KT2A 4ZVEA 3RBDA 3UQSA 3QLHA 5J2MB 3LP1B 2OPRA 1S1VB 2WHOA 1FK9B 3DI6B 3SFGA 1MU2B 4WFXA 1IKWA 5DQIA 4RNNA 2I5JA 3T5KA 1N56A 2OPQA 2J6UA 4MKAA 2JEGA 4IG0A 3NAIA 4K50A 4F4YA 4HKQA 3V81B 1JIHA 2UUTA 4KSEB 3RB4A 3UR0A 3IS9B 4NLSA 1QE1A 1RT4A 2BANB 5I42B 4NRTA 3OHBA 5EWEA 5CYMB 5EWFA 1HNIA 3DRRA 1SV5B 3Q8SB 3MR6A 1JLCB 3G6VA 3KHHA 5KFRA 3PW7A 4TXSA 5KFAA 2OPRB 5DQGA 3IRXA 4IG3A 5KT4A 3DI6A 4NLTA 2B43A 2XC9A 1HQEA 1RT7A 2YKMA 4M95A 4H4MB 2OPQB 4RUCA 5KFKA 3TVKA 1J5OB 3T5JA 4WZMA 5KFMA 1DTTA 1OS5A 3DM2B 1C1CA 1BQNB 4PWDA 1FKOB 1S1TA 1TVRB 3M8PA 5HBMA 2GIRA 4YQWA 1HYSB 2YNFA 1LWFB 4YR0A 1JLFB 5L9XA 3DLEB 3OLAA 1RT3A 1T05B 2AWZA 3JSMA 4KFBA 4F4XA 1JKHB 3ITHB 5J1EA 2F8EX 1FKPA 2C28A 5KG4A 2WK4A 2IAJB 1NNDA 1REVB 2WOMA 2VG5A 2YNIB 4IQXA 2HNZA 4ED1A 3T5HA 4R5PB 5J2QA 4RW4B 4IOBA 4Q8FA 4MK7A 2UVVA 1CSJA 2XGQA 4O4RA 4ECYA 2BE2B 5KG0A 4ED6A 1RT1B 4MFBB 3TAMA 1FKOA 3DRPA 4IDKA 5HBMB 2WRMA 4ZMMA 5KFEA 2WB4A 1HYSA 3G6XA 4RUAA 3OLBA 3H5SA 4IRKA 3QGHA 3QO9A 4YR2A 1RT3B 3LAMA 4TYAA 1S9FA 3LP2A 4IH7A 3CDUA 4K4VA 2D41A 1RT2B 5KFYA 2ASLA 5CYMA 2HNDA 3H98A 4J9OA 4B3OB 2XI3A 3D28A 4DG1A 2HNYB 1N6QA 4KB7A 4ZPCA 2BR0A 5I3UB 3QIPB 2AX1A 2WONA 3H59A 2B6AA 4ZPBA 4TQSA 1BQMA 3H4DA 5L1IA 1T03A 3QO9B 4ECSA 4Q8EA 5KFNA 2J6SA 1S6QB 4EBEA 1XR6A 4TY9A 1IKWB 1S9EA 4XPCA 3IS9A 2YNHA 4EYHB 5KFXA 3MF5A 3MFIA 3PJXA 1JLGB 2UUWA 4NLGA 1VRUA 1TKTB 3GYNA 3KHGA 3FFIA 2HWIA 3OL9A 4ED3A 2BRKA 3OL7A 1JX4A 4H4OA 4J9LA 5D3GA 3KNAA 5F8NA 3MECA 4MK8A 4WFYA 4QWEA 4IFYA 3MR3A 5C42A 2FLLA 3NMAA 4H4MA 2RF2B 1S9GA 4O44A 3V4IA 3KK3A 4R8UA 4MKBA 4RW6A 1LWCB 4RW4A 3C6UA 3CVKA 5DLGA 4YR3A 3PW5A 3HVTB 3KK2A 3RBEA 2ATLA 1BQNA 4PWDB 1XR5A 1EP4A 5HP1A 3BSNA 3E01A 3KLEA 1LWFA 5F9LA 5HLFB 3IN5A 4Y34A 4K4WA 3FFIB 4ECXA 4KFBB 1TKZA 3DLKB 5KFDA 5J1EB 2IM2A 2YNFB 2BQ3A 4KHRA 3DLEA 4EBDA 2RF2A 3V4IB 5F8HA 4J9PA 4XPEA 3G6YA 5J2QB 2FJWA 1RAJA 3CWJA 4RW7A 5EUHA 5JUMA 1TL3B 2ZE2A 4O4GB 2RKIB 3RAQA 4U6PA 1LW0A 4ED7A 1GX5A 2CJQA 2IBKA 4ZP8A 1N4LA 3T19A 2AGPA 3IG1B 1ZTWA 4ZVFA 1IKVB 1C1BA 1HPZB 4I2QA 4DEZA 2VA3A 1HNVB 4ECRA 5C25B 2VG6B 2R8JA 4F4WA 2EC0A 1TKTA 4EEYA 1U09A 1VRTB 1S49A 3JYTA 1TL3A 4O4GA 2BQRA 3PW4A 3N6MA 1RTDA 1RA7A 2ZD1A 2WTFA 1C0UA 3KLIB 3MEDB 3Q8PB 3DMJA 4KAIA 3M9OB 4RW6B 4ICLB 4RW9A 4IFVA 4TY8A 3KK2B 2C2RA 5F8GA 5HROB 3G86A 1QE1B 3CJ2A 1TL1A 4NLXA 5DLFA 3GIIA 3KLFB 1MMLA 3I0RA 3MEGB 3JYTB 1S0MA 4H4OB 5EWGA 2AX0A 2D7SA 5F8MA 2V4RA 2ZD1B 1KHVA 4MIBA 3GILA 3EPGA 1S9GB 3CJ3A 3QLHB 3I0SB 5J2MA 2AQ4A 2BQUA 4LQ9A 1RTJB 1HMVA 4RW9B 4WE1A 2XGPA 3H5XA 1JLEB 5DG8A 1LWEB 3NAHA 5KFSA 1N5YB 2J6TA 4PQUA 4NLPA 4K4UA 4IR9A 1JLFA 3BR9A 3C6UB 4ZP9A 5KG2A 1LW2A 4KO0B 4ZVGA 5F8IA 4Q45A 3NBPA 2BANA 5CYQB 1EETB 1HQUB 3C6TB 1S1UB 5F8JA 2VG6A 2OH2A 4GC7A 5FDLA 1JLCA 3IGNA 5KFTA 2IMWP 1TV6A 4K4SA 5KT7A 2W7PA 4JUZA 1R0AB 2IA6A 2ILYA 2R8HA 4QWAA 2W7OA 3H5YA 4DL5A 3CDEA 1LW0B 4IRDA 3DRPB 4IH6A 3MEEB 2IM3A 1FK9A 4DL2A 4O3NA 5KG6A 2R2RA 4YMEA 4MH8A 4QPXA 4M94A 3BQ2A 2I1RA 1S0OA 3KLHB 2RKIA 5KFZA 1K1SA 2XI2A 4I2QB 3NBPB 3EPIA 4QW9A 5KFWA 1TKXB 2I5JB 5C25A 2CKWA 1SUQA 4IG0B 3T5LA 3JSMB 1UWBA 4DG1B 2B5JA 2YNGA 5C24A 1IKXB 2R8IA 3M8QA 4TN2A 2ALZA 4WFZA 4RU9A 1NHUA 2HNZB 4URSA 1RT5B 1HARA 1RTJA 3V6HA 1GX6A 1SH3A 1HQEB 2W9AA 2JEJA 2IM1A 4FBTA 1RT6B 4J9QA 2FVCA 4KE5A 2IJFA 4MIAA 1J5OA 1YVFA 4EYIB 4ED2A 4IFVB 1VRUB 4KO0A 2QE5A 3BQ0A 5C24B 3RB0A 1C1CB 4ID5B 1KLMA 4Y2CA 3DRSB 3H40A 1TL1B 3MECB 2RDIA 3D5MA 4XO0A 3CJ0A 1D0EA 4R8UB 5JXSA 4IR1A 3NL0A 2OPSA 3DOKB 4TQRA 3QZ7A 5KFOA 4NLYA 2IC3A 4YP3A 3QIPA 4FS1A 4U7CA 3QIDA 1RT6A 3MTKA 4EO6A 1N48A 2YKNB 3LAKA 1S6QA 2HMIA 4NCGA 2E9RX 3KLHA 2YNHB 2W8LA 4QWDA 5K14A 1S1UA 3KJVA 1S97A 1TQLA 1LW2B 2AGOA 4NLOA 1WNEA 3GQCA 3UDLA 3BREA 2OPSB 3DOKA 4KBIA 5KFQA 3GIMA 3C6TA 5F8LA 4RNHA 5KFVA 4GC6A 4Y3CA 4ED0A 4ECQA 4B3OA 1RA6A 3PW0A 5L1KA 2HNYA 1ZETA 3HKWA 1N6QB 1JLBB 2VG7B 2C2DA 1DLOA 5KFCA 3LP0B 4Q0BA 1EP4B 5HP1B 5KFHA 3MEEA 3KHRA 3T1AA 4HYKA 5F9NA 2W9CB 4DL6A 2FVRA 2ZKUA 5KFJA 1TKZB 2XCPA 5DG7A 3ISNC 2R8GA 1C0TB 3EZUA 4ZVHA 2WCXA 4FBUA 4TLRA 3TQ1A 1RTIA 1UWBB 4LSNA 4FS2A 3DMJB 4IFYB 4RW7B 2GIQA 1JLQB 1S6PA 1JLAB 3RB6A 2R2UA 1IKYB 3DYAB 2FVSA 1LWCA 2ILZA 3CJ4A 3V81A 3Q8RB 3HVTA 4O44B 3H2LA 2ASDA 2DPIA 3KLGB 1W25A 5KG1A 3E51A 4WZQA 2R2SA 3OHAA 4Q43A 1RDRA 2JLEA 3KLEB 4J9RA 5J2NA 5KT6A 1SH0A 3IRXB 4IG3B 4X2BA 1RTHB 4ECTA 4I2PB 3SI8A 3MFHA 4NRUA 4NYZA 3DRSA 2FLPA 1T94A 3KMQA 1IKYA 3DYAA 4ECUA 1DTQB 1LWEA 2ZE2B 2XWYA 3KHLA 2YKNA 1SH2A 2R8KA 1MU2A 4ICLA 4NCGB 5KFPA 4K4ZA 3KOAA 3OSNA 3OSPA 4O3PA 2C2EA 4RZRA 3IG1A 3GIKA 2C22A 2V4QA 3V6KA 4I2PA 3CJ5A 2OPPA 4RNFA 5KG7A 2UVWA 3DOLB 2WOMB 3LANA 3FSIA 2AU0A 3KK1A 4RNOA 3UPFA 1K1QA 1S4FA 2UVUA 1DTQA 2YNIA 3FDSA 3I0SA 4IRCA 4MFBA 1RT1A 4LSNB 3HHKA 4URGA 4IDKB 3FRZA 4KKOB 1QAJA 2E9TA 4J9MA 2E9ZA 1JLEA 4JV0A 1JLAA 1C2PA 1N5YA 1XR7A 4ZPAA 4NLWA 1S48A 2HAIA 4ZPDA 5KT5A 4G1QA 3MR5A 3LP2B 2O5DA 1QUVA 4Q0BB 2B5JB 1C0TA 5DG9A 1RYRA 1IKXA 3PHEA 3BGRB 3I0RB 1KHWA 5DGBA 4ECVA 3H5UA 4O3OA 1QAIA 4LQ3A 4NLDA 2W8KA 2WONB 1RT5A 1BQMB 1S10A 1RTIB 4RNMA 2B6AB 4PUOB 3BSCA 1T03B 1RT7B 2YKMB 4RW8B 2HWHA 4Q44A 4R0EA 3DLGB 3FQKA 4QWBA 1S9EB 1KLMB 4O3RA 1SUQB 3ISND 2JC1A 4PQUB 5J2NB 2IJNA 4IH5A 3OL6A 1JXLA 4NLVA 1EETA 1HQUA 3KLGA 4ZP7A 3RAXA 4JV1A 4NLUA 3PR4A 3I5CA 2JEFA 2DPJA 2QV6A 4OL8A 3BQ1A 5CYQA 4G3IA 2JEIA 4TYBA 5J2PA 1I6JA 3CO9A 5FDLB 4MK9A 1S1WB 1TV6B 2BRLA 5T14A 2VG5B 1R0AA 3QYYA 5I3UA 3CDWA 3I5BA 5KFBA 5HLFA 4JV2A 4LSLB 5KFLA 3CIZA
chains in the Genus database with same CATH superfamily
1ZBTA 3HJFA 2BYCA 2NUHA 4KY3A 3L3CA 2XZTB 5G0RB 1VK8A 1S5ZA 3P5TL 1KVIA 1IBLF 2PFFB 2J0WA 4ZP6A 1F1BB 3DOLA 3NWRA 3HHLC 3R8YA 3GG0A 2W9BA 2GC8A 3M9MB 2OEJA 4HACA 1N36J 2NSBA 1WI6A 3TJAA 1KFSA 2HRUA 4QOTA 4P2XA 3O6QA 2YNGB 2QC3A 4EU0A 5BYSA 3KK3B 1XK8A 4B3TF 2BOPA 1HD0A 1IKVA 1FFGB 2CXEA 1RLCL 2KYZA 5JMNA 3CXCR 4J9SA 3LH2S 4NLQA 4DV5J 3RB3A 5IZHA 4QW8A 2KVIA 2IIHA 7FD1A 1BD6A 2RUGA 4TKTA 3ZZ0A 4WFNQ 2QMUB 2JC0A 2A1BA 1HBMB 2MHNA 3KJVB 4QPTA 1U1MA 2V50A 2FJXA 3QGIA 4PG7A 5LJ3Y 1CULA 2LQJA 4QQBA 3T1HJ 2EW9A 2HG4A 4OI1A 2L3MA 4AQYJ 2FVQA 3CCQS 1X4CA 3LGHA 1UFKA 1CQNA 1C0UB 3KUGA 4AT1B 5CD4A 3KLVA 2LMIA 2Z2ZA 2Y3YA 1V3ZA 4PYAA 4OJHA 1CC8A 1ZZNA 1WSVA 1HFEL 1B0PA 2IC3B 4LRBA 4QWDA 2A18A 3FGVA 1WC5A 2DGXA 3M9NB 5C5JA 1FNXH 3Q22A 2GIFA 1HBOA 1PYTA 3PVXA 1D9AA 2O01C 3V6DB 1MN7A 1P1LA 4I7FA 3OTEA 2CQHA 3AY0A 1UA1A 1APSA 2CJAA 3DLKA 1VQPS 4NLRA 2YQ3A 3CD0A 3MOJB 1R8BA 3NCPA 1NMEB 2Q66A 1RYSA 1YHQS 1FDDA 3HO1A 1F5BA 3DGPA 1QAXA 3HT3A 2NREA 3GV8B 2EK6A 2H1YA 3IM8A 3SXLA 4ZVPB 2IM0A 4R5PA 2FDNA 3PKMA 1TUVA 3PEHA 2GHVC 3VVUA 2XCAA 2VL1A 3NS6A 2FJDB 1S1XA 3LP0A 3O8WA 4PXBA 5E7OB 4ZLNA 2BJ3A 3FBFA 3W3SA 5KFIA 2VG7A 3BSOA 5HROA 1UW9A 2RILA 3K59A 2DXDA 3VAFA 2JFKA 1J2VA 2MLYA 3FK4A 3GG1A 2HIQA 3KK1B 3I31A 4F50A 9ATCB 2ASJA 4ENOA 4HTIA 1FKPB 2QFIA 1DZ5A 3UWTA 1L3TA 5AE3A 2PGCA 3ZZTA 2XQCA 3G8SA 2ZH7A 5AT1B 3OPKA 5DETA 5J2MB 1PIEA 1V5IB 3PXGa 2HFUA 2KM8B 2B56A 4NXNF 1FK9B 5BYRA 1VQ6S 1MU2B 3AOAA 4WFXA 3NNAA 3G71S 1FJCA 1U25A 3THTA 2Z8QA 4MKAA 5HMWA 4DQRA 3GCWP 1NZAA 4K50A 3R97A 4UUWA 3CPWR 3V81B 3L7UA 3HFVA 2MKCA 5G4DA 3PM9A 4DXLA 4NLSA 1QE1A 1RT4A 4NRTA 1RUSA 3OHBA 1SQFA 4DUZJ 5CYMB 1N32J 3M8ZA 1JLCB 2MSSA 4ZA1A 1RAIB 2OMOA 2DH8A 4MYUA 3WX4A 4IUFA 2WW4A 3J81U 5KFAA 3D6MB 4IG3A 2I9SA 2A10A 1AZSB 1XBWA 2CJ9A 4P71A 4RLEA 2MKHA 3VZHA 2Y1LB 4ZCLA 5LMUF 3HFKA 2YKMA 3CE8A 1VQKS 4CT8A 4QR0A 4KT0C 4ZIWA 3MR7A 3GLJA 1S57A 3I9ZA 4WWSA 3T5JA 4QU7A 1WOSA 5HMXA 4KGXB 3U7JA 4WZMA 3DM2B 1C1CA 1BQNB 4YQWA 2GIRA 2BJ1A 1M5SA 1S6UA 1MROB 4F3MA 1LWFB 1JLFB 1F9HA 5CXTA 2BOAA 3ELHA 2CQ2A 3KDOA 4UT4A 3ENQA 4JI2J 2V2KA 2D69A 1FE0A 4CYUA 2MKSA 3M30A 4A8QA 1TMMA 5K8MA 2E1MC 2L08A 2WK4A 2RIJA 2DITA 1NNDA 4QZVB 5H9EK 2WOMA 3NGTA 1RWPB 2HNZA 2JHEA 3T5HA 2P8IA 2HYIB 3AQPA 4RW4B 3QWUA 4IOBA 4F2SA 4E2FB 2K1RB 3RUBL 3WZ0A 3W62A 2XGQA 2YTCA 3QSIA 4MFBB 4N56A 5HBMB 2G13A 2XSFA 4USKA 4WK1A 2L41A 4KGMA 5JVHQ 4DV4J 3SV4A 3TARA 3QFHA 4RUAA 2J0QD 3H5SA 2HGLA 6FDRA 1NSKL 2KO1A 2JH3A 1BMQB 2RE1A 3QGHA 1X9MA 1FVQA 5AXMA 1MMDA 2I0XA 4Q2MA 5T7LB 3D9BA 4DX8H 2XHCA 2E5JA 1WG1A 5E3AA 3UVJB 2D41A 1AUSL 3MUVP 3H98A 1N52B 4B3OB 3A12A 5AXKA 3RJMB 4B3TJ 4UY85 4NA2A 2Z56B 1N6QA 1S7IA 3QJJA 4I4BA 2FZGB 4ZPCA 3Q89A 3MMCA 3VTIA 1ZZFA 2N4DA 1Y10A 2IMOA 4DI6A 1FFWB 1ZM9A 3QIPB 2VF3A 3H4DA 3ILOA 2ACMA 2GV1A 4B08A 5L1IA 4L76A 3MOZA 5CAAA 2R42A 4OI2A 4OYZA 3CGIA 4NASA 4Q8EA 3A4TA 1S6QB 5GMEA 2A3JA 2HGMA 3G9CA 3R2CJ 2QA2A 1NK8A 2QSFA 1Y4ZB 1S9EA 4XPCA 2PEHA 5D0RA 3CB4A 3PV8A 2HVEA 4X4SA 4W92B 4C3KA 3CT9A 2IY5B 3BBBA 1HWLA 4NLGA 1KNZA 3ILIA 3EE3A 1IJEB 4DV7J 3KNAA 1HA1A 1H2VZ 2RQ4A 2R7TA 4QWEA 2FQQB 5BJRA 1O6XA 4PG5A 4WFBQ 3MR3A 1IBMJ 1TELA 3FMWA 3R7NB 1UW4A 2GZOA 3AOBA 3IP0A 4CO3A 3C6UA 3UNYA 3PW5A 4LF5F 3HVTB 2DEJA 4U67Q 3BKFA 1UP1A 3DNCA 4DDFA 1BQNA 3GIRA 2MB0B 2NCKL 4DSKA 2IHR1 3RW6A 2MZSA 5HLFB 1FRIA 4EUVA 2GQQA 1R0BG 3EUNA 2VJUA 2HVZA 4LR7A 5L9NA 2J5AA 1TKZA 4ECXA 2JJ4D 5GMKa 1X0PA 2F5GA 5F41A 5AJ3J 4JI5J 2X1FA 2CPHA 3D6TB 3I82A 4OYPA 1IWAA 1YDLA 4X4VA 2NXCA 2E5IA 2C2KB 3S7RA 4DZDA 5J2QB 3K17A 1RGVA 1HWKA 5EUHA 5JUMA 4O4GB 2ZBRA 4OYXA 4MKYA 4JOUA 4U6PA 5D0EA 2BXJA 3CCTA 3PIOQ 4USVA 1U6BA 2KFNA 3QJLA 1GMVA 3M05A 4P10A 2IBKA 1VJWA 2WVDA 1T9WA 1TFWA 4L3NA 4F36A 4OZ3A 1YJRA 4DR5J 1TR0A 1WC3A 2CQCA 2FY8A 2ZJQQ 2DRAA 4DV0J 1RSCA 2WVFA 4F4WA 2J7WA 2Z58B 5DM7Q 1FRXA 3D1HA 5L39A 1TKTA 1UFLA 4K5RA 4EI2A 1S7HA 2DCUB 1TL3A 4B3RJ 4AXJA 1NEEA 2DBBA 3OD2A 2ZD1A 1C0UA 3KLIB 1TL4A 3SDEA 3BO2A 3Q8PB 2WZ1A 3DMJA 5I3PA 1WDTA 4FXWA 5E3CA 1IN0A 4ICLB 4A8XA 4IFVA 3NRBA 3PEJA 4FDFA 4YB7A 5M2UA 2C2RA 4CI0B 4DWIA 4LFAF 1Q5VA 3EDQB 1UVLA 1TL1A 2QFJA 3CCRS 2VPWB 1I94F 4O0IA 2CNNB 3Q86A 3KLFB 1H0HB 1I51B 3M2UA 4P2MA 2KG0A 4DV3F 1S0MA 2HS4A 5EWGA 2ZD1B 1FWPA 3PYDA 5CZXA 3EPGA 4ILRA 4YDXA 1L3VA 1S9GB 1UZHA 1MNEA 2JDJA 2AQ4A 3I0SB 2ZH4A 1RTJB 4WE1A 2XGPA 2B4PA 3MGJA 3R27A 5LXRA 3EGZA 3HHLB 4QBUA 1LWEB 5KFSA 2LLZA 5M2RA 3M6XA 2D1CA 4K4UA 2CPYA 2NQPA 2DIVA 3C6UB 4ZVGA 4OMFG 2MZ1A 3BV8A 3S01A 1KTVA 4OZ1A 1ZAVA 4DFMA 2VG6A 2M4MA 5FDLA 5E5NA 1VQ9S 2LEBA 1B4SA 1SJ1A 5JJBA 2DNHA 4Z37A 1U24A 1R0AB 2IA6A 4Z2XA 1VFJA 2R8HA 4X4RA 4DL5A 4B3SJ 4KTQA 4IRDA 3WX8A 3DRPB 2FJBB 4IH6A 3MEEB 3TOQA 2IM3A 1RI7A 1J5EF 4ANEA 2YY3A 4MH8A 2ZWOA 1H72C 4JP8A 2HBRB 3NBPB 1FEHA 2ZVIA 4XDDA 4AD6A 2E1RA 2U1AA 5C25A 2AZ1A 4JV2A 3JTOA 3M8WA 4RR5A 2ZC3A 2A0FB 3T5LA 1DBDA 2GA7A 4Y00A 1VOMA 2YNGA 1Q79A 5DDOC 1CEZA 2UUCF 3EVMA 1XNQF 2F63A 1NAQA 3LGNA 1LNQA 1WOOA 3SSSA 4TN2A 3GJQB 4ANCA 2ALZA 2KN4A 3EYZA 1Y3KA 1U1QA 4YY3F 4LF7J 1DHMA 1MG7A 2XMWA 1RT5B 2Y0BB 1X5OA 2LKZA 4P6QA 5A8RA 1VIXA 1RTJA 3AJ1A 3PYFA 4I0WA 5ETTA 1WF0A 2DVIA 3J7ZT 3FNNA 1ZH5A 2B9XA 2IYIA 3UNGC 1XEZA 3K2YA 1Q5YA 2LU1A 1Z2LA 1NJYA 1AXQA 1CG2A 2LP4A 4EYIB 4QYRA 1S4EA 4WJBA 4KO0A 2IRYA 2BMBA 2IA0A 4HEA9 4HL9A 4OYWA 3DRSB 1IR2A 3M4XA 1Q1KA 2R7UA 3MECB 2RDIA 1IBLJ 2E1AA 3KJQB 4QYZK 5JXSA 3MEKA 1P1TA 3DOKB 1Q81T 2QEXS 3MD3A 3B54A 5KFOA 3C15B 2JOQA 4LF8F 1UJ5A 3QIDA 1RT6A 3C14B 3VF0B 3RR7A 1MWZA 3TVZA 2MQMA 2HMIA 1FRKA 5AXNA 1RABB 3CD5A 2GMLA 4QCLA 1FXRA 3KJNB 5E2QA 5ETKA 4BS2A 2HRYA 1G1XA 5K14A 1S1UA 3KJVA 2HPUA 2WAQD 2OELA 1WKLA 3D66A 5IC4B 1S97A 4FKXA 2GX8A 3BREA 4JI1J 3Q24A 2GJFA 2W4DA 5KFQA 1ZYQA 2K3IA 3I96A 4DPOA 2KT3A 1RA6A 5L1KA 5IT9U 3HKWA 1G3OA 2F65A 4USWA 5H9FJ 3ZFVA 2HHHF 1FJ7A 1P9YA 2XSJA 3R1LA 2QG9B 2ZFHA 4I56A 4Q0BA 4D3HA 1TK5A 5HP1B 3WC0A 5DM6Q 3N01A 3CDAA 3T1AA 4CTAA 3KHRA 5F9NA 2W9CB 2XWXA 3MMBB 5FJ4A 1SJRA 1WC1A 2L9DA 2ZKUA 2Y0SD 3TX0A 1C0TB 1E6VA 1ZM2A 3EZUA 4RL1A 4K2XA 2MZJA 2QA1A 3R7BB 2Y1RI 3JTPA 1D8ZA 1YKWA 1QM9A 1HI1A 1LV5A 1GTEA 1WOPA 5IWAJ 2YBVA 1OSDA 3PYEA 1RWNB 2J7UA 3NXZA 1JLQB 3KUHA 1JLAB 5GAGU 2WVCA 2KYXA 3CJ4A 2ILZA 2QJ3A 1NK9A 1T3OA 2PD1A 3Q8RB 1K8AT 3V2UC 1UWAA 3H2LA 3DKDA 2B9WA 1R8AA 3F41A 4J90A 4LIRA 2DPIA 4F7VA 1PAUB 2DHGA 2LDYA 3KLGB 4JI0F 1RWOB 4P9SA 5KG1A 1J27A 2GAGC 2GMHA 3H0PA 3I87A 2JLEA 3KLEB 2BX6A 3R6GB 4J9RA 2BDPA 1S59A 3GFHA 4LUBA 2AJ1A 1WD6A 3MHYA 2MMYA 1SJ3P 4NYZA 9RUBA 3SYZA 2FLPA 1T94A 3IWXA 3KMQA 2G2YA 2BEFA 2M7SA 4ECUA 2ADBA 3O2IA 1LWEA 3GP9A 4NZ7A 3FUYA 4CLKA 5GAEU 2YKNA 1FNOA 3HLUA 4ZVRB 5B0CA 4DV2F 2H54B 3HZGA 1PGZA 1Q53A 4YEAA 3TZYA 2Q79A 5KFPA 2R7VA 4NPOA 3OSNA 5HI7A 2V94A 2E5GA 1M1KT 4C8LA 2C22A 1O8BA 3ZZOA 2V4QA 2MKKA 3P6YC 2OPPA 2RAQA 1O51A 2V8PA 4LFBJ 2CPZA 1PBUA 4RNOA 3EX7B 1YWXA 4LMZA 2P2CB 3QRQA 1DTQA 2YNIA 2EPIA 3O1LA 2AD9A 2DNRA 2CVEA 3X1LB 2DCLA 3HKZD 2W4PA 1OYDA 2H9ZA 1EIYB 1C2PA 3TVYA 5LJ5Y 2APOA 1N5YA 1E6YB 2L48A 1YRTA 2JL9A 1QSSA 2DHSA 3CCLS 2OP5A 5IQ6A 1SL2A 3P96A 2NXEA 4N76A 4G1QA 2AF6A 2AJ0A 2FZKB 2O5DA 4LREA 4Q0BB 2CPXA 2MYFA 2WSFC 1C0TA 1E6VB 1W26A 2HFNA 2ZDOA 4CLSA 1NK0A 3IBWA 7AT1B 2ABYA 4P74A 1JNZB 4FXDA 2IYGA 4WBFA 4P72A 1RWKB 4NLDA 2W8KA 2WONB 2ZNYA 2D9OA 4OI4A 4ZS6A 4DBQA 2HFZA 3NMRA 1EKRA 1RBLA 1R6VA 1KLNA 4RNMA 2QYCA 2BJEA 2WSEC 3AJ2A 2KT2A 3WQPA 2Q6CA 3GPAA 2YKMB 3FBBA 4RW8B 2ZOMA 1G4CA 2HWHA 2CJBA 3TW0A 4Q44A 6FD1A 4NYPA 1D09B 2CNLB 4H4KA 1S9EB 4DR6F 5CCLA 4OYIA 2YX4A 4KGKA 5ETVA 4IH5A 4PQUB 1SPBP 2QGFB 2B0GA 3UVJA 2N82B 5LL6d 2VONA 1X4GA 2DPJA 1WELA 2QV6A 3FMBA 3BQ1A 2RHSB 4BWMA 2JEIA 4DR3J 4OX9F 4AL7A 5FDLB 3C46A 1Q8KA 2X3GA 1KVJA 3HM9A 4Y2IA 1N5SA 4RWXA 4NI2B 3QFWA 3M2VA 2EFPA 1OY8A 2G0CA 2JSXA 1SJ4P 2QIFA 2GVDB 3BPSP 5KAKA 1JWWA 4LSLB 2DHHA 4DR2F 1UJ4A 3E01B 2FLOA 4D3GA 4X65J 1UEVA 4PCQA 4ZHRB 2C3OA 3C19A 2MSTA 3UDVA 1RAFB 2H5EA 1RK8A 2NLWA 3OV7A 2OTJS 1WDDA 5A0YA 1O5JA 4LF6J 2HHVA 1OY6A 1KTQA 2G2OA 3MCOA 1RT2A 3H20A 3L4BC 2OPPB 4KYZA 4EO8A 2AP6A 2HFSA 4HT5A 5C42B 2KHDA 2IDLA 1RKIA 4C0BA 2OI2A 2Z30B 4PWWA 3TX8A 4DL4A 3K5NA 3PNIA 3QRRA 3GCXP 2MQ8A 1KSPA 2ATCB 4JI6F 2KXHA 2QT7A 4KKOA 2OFGX 5KFUA 4Y2AA 3SSRA 2DD8S 4W98A 3RTVA 3DDKA 2D3OR 4FF4A 3K5PA 4F04B 1SV5A 2YWGA 3FC9A 3VVTA 3ZNJ1 1ROFA 4EZ6A 3JQKA 3UI3A 1Y11A 4KRWA 2I38A 3UCUP 4N7TA 5IT9Y 3V6DA 1AZSA 1Y9OA 2OKQA 4WYLA 2VA2A 1K0TA 2VJVA 3MURP 2DO4A 1B0TA 4GKKJ 4WXWA 5F0WA 1RTDB 2P9CA 2XS5A 1B3TA 1S1VA 1R8PA 5ITHA 1WACA 3TNVA 5DZ6A 5A6WA 2VC0A 2PA8D 2VICA 2LXFA 2VV5A 4URQU 4ECWA 4KV8B 3ILJA 3GIJA 3HFZB 1DFDA 2DHAA 1X5PA 1VHFA 1FT8A 2ASYA 2CRLA 2BJ7A 2CWXA 2FB0A 2G1HA 4FNHA 1BLUA 3QNWB 3KLFA 3M2UB 4GVBB 2BJ9A 2AZ3A 3I56S 1WWHA 3DLGA 1IM4A 1RTHA 3NGSA 2WVEA 3T41A 3H7HB 1VBXA 3NGDA 1UVMA 3HZEA 3Q8QB 1FA0A 4DUYJ 2EG1A 2XM3A 2ZJRQ 1UKUA 3P3DA 3NNCA 2BE2A 5D4OA 3HHLA 2CPJA 3OL8A 2MLXA 4M5GA 1JLQA 3KLIA 1WC0A 4WE1B 2OFHX 1JNRB 2LQ8A 2QA4S 1SJFA 3TJ8A 3MAQA 1JLBA 1HBUA 5MLCV 2GNKA 5K9FA 1AW0A 1RWUA 1ZA1B 4H54A 3TAMB 2YKOA 4TY8B 2Y1JA 3KKFA 1F3FA 2HRTA 5F3TA 1RXOB 3ISZA 4QIWD 2W9CA 3L7PA 3ENVA 3TZWA 2E5LF 2BM0A 4JI2F 2ZBPA 2MY7A 4I1TA 4W4MA 2W9BB 3GV5B 2VUGA 1RT4B 1U26A 1KC8T 2HNDB 2FJVA 2RMLA 3QSYB 3NCQA 2X1AA 5HQMA 3U1MA 4O0NA 1VISA 3UQSA 4X62J 3QLHA 3EGVA 3FSYA 1M1HA 3LP1B 2OPRA 4GO5X 1S1VB 3UFCX 5M2PA 4DF8A 2I2YA 3DI6B 4B9LA 3G2XA 3LW5C 2IRUA 3NGRA 2I5JA 3NS7B 5LT5A 2J6UA 2JEGA 3TA1A 3NAIA 3W2WA 1FO1A 4K8RA 2A2CA 2GVZB 1WKJA 5HVGA 2MXYA 4CM2A 3PCOB 1U1NA 2C2OB 1HIYA 4KSEB 2OEMA 4WP9A 3H2VE 3LGMA 2XS2A 3B4DA 1M5HA 4F2RA 5EWEA 1HNIA 3E3XA 1EQ0A 5A8KB 4TXSA 1G7CB 3FVYA 4KGVB 1H98A 3IRXA 2CWKA 4F25A 1SQEA 5D0GA 5BR8J 2F4FA 4M95A 4FKYA 4B3SF 3HULA 2CPFA 3ZTOA 2HAFA 2MDAA 4OV6A 2OMLA 4Y0FA 4C8YA 1NUEA 1DTTA 1XMOJ 2VPXB 2W2MP 5HBMA 1S1TA 3M8PA 2XNQA 3O3LA 2DNZA 1EB0A 1F5AA 3C2PA 4OI6A 1T05B 1VQMS 1FFSB 1B0VA 1DQ8A 2FC9A 3JSMA 4KFBA 3M2RB 3OXLA 1HHTP 4F4XA 4DSLA 4JI4F 5J1EA 2F8EX 2RJZA 1RAEB 1REVB 2J9DE 2YNIB 4NI2A 4RUHA 5B7WA 4IQXA 1T9XA 4KIAA 1M5OC 3MM5A 4MK7A 1OWXA 4USTA 3JSRA 4ED6A 1RT1B 2QZ8A 4BHQA 5KFEA 4YB5A 2WB4A 5K8NA 3MUTP 3GB0A 3QO9A 4PG8A 3LAMA 1R8HA 2GGPA 2ZUAA 4TYAA 1IUJA 3VQTA 1NSQA 4IH7A 3EVOA 3OTCA 3CTRA 1U2RA 4K4VA 4JBCA 1Y0HA 3AAWB 4DMZA 2ASLA 4B9SA 4DPXA 4J9OA 1GXLA 3ENWA 4J9UE 3D28A 1VJQA 2UXCJ 4CO1A 4JI6J 1H3DA 2ZC4A 4KB7A 2K1RA 3GTYX 4ZLJA 1MMNA 1KFDA 4C48A 1OIAA 3HSZA 5I3UB 1PJ5A 2AX1A 2WONA 1WHYA 4DPUA 4TQSA 1BQMA 1K47A 5LM7E 2DRBA 1U7LA 4OYBA 1YGYA 1WTBA 2XMUA 1XR6A 2CPDA 4TY9A 1VQOS 2MQLA 2YNHA 3DOMA 3IFEA 4Y28C 4IQMA 1P6TA 4YDDB 1N5VA 2XEXA 4NX9A 1Z1ZA 2XYHB 4DCJB 1YITS 1VRUA 1TKTB 2JVRA 3FFIA 4BCAA 2EFNA 4LIWA 1JX4A 2OJ3A 5D3GA 2XY7A 4KJIA 3B4MA 5DJBA 2H51B 3M7VA 1ICEB 3NMAA 2RF2B 1S9GA 4O44A 3V4IA 3H8YA 3KFWX 4U95A 1TL7B 5C7PA 1S77D 3BM7A 4RW6A 1HWJA 4RW4A 3CVKA 3M1VB 3PDNA 3R5CA 2AKWB 3FRYA 5DLGA 3UCGA 4CIOA 3RBEA 3RR8A 1RWXB 2H4WB 4BC7A 4WP8A 1ZAXA 1MROA 3AH6A 3LQVA 3KLEA 5EX0A 1TAUA 1HHSA 3BF4A 4ZDNA 3ZZPA 2E7XA 4TU9A 3MWBA 4E98A 2DRDA 3DLEA 4MAKA 2DH7A 2RF2A 3V4IB 2DEIA 5F8HA 1YIJS 1RAJA 3AT1B 3CWJA 4F0MA 4K0KF 1TL3B 2ZE2A 2HKEA 2RKIB 3RAQA 1CJKA 4K2JA 2CQGA 4ED7A 1GX5A 5GADU 2CQDA 1A7GE 3VAKA 4ZP8A 2E5LJ 1AYEA 3OUYB 2XS7A 4DS4A 4DFPA 1FEEA 5AJ3F 1TFYA 2SXLA 2RU9A 2VA3A 2DJWA 4ZCKA 4DEZA 3J7YU 1F3VA 1SKWA 4LF4J 1VQ5S 2R7RA 3HSDA 2Z0GA 2MGZA 1OYEA 1VC0A 2UUBJ 1R27B 1RHMB 1RCXB 1CJUA 2DH9A 2VU5A 2J9DA 1U09A 2FYXA 3NOCA 3VGTA 4AE5A 1N0UA 4O4GA 3DXBA 3H90A 3X3UA 1XNRJ 4YFUA 3N6MA 1RTDA 1FXDA 4DZ6A 4AQYF 1HLWA 4C11B 4DUZF 4L75A 3R5GA 4CH7A 4KAIA 3DRYA 1MLAA 2B4UA 3M9OB 1VQ4S 4RW6B 2FHOB 3M1VA 1H73A 4ERDA 1KDNA 3EJMA 4NWBA 4IYQA 5HROB 1P8GA 3G86A 4CLLA 2KG1A 3W9IA 5LMUJ 1FRLA 3H42A 3GIIA 2VQFJ 2EVZA 1H7WA 1NBEB 1KQFB 3J7YI 3PX4A 2UV8G 1MMLA 5BR8F 2V8DA 2W1BA 3CC7S 4E0DA 4PWUA 3MM9A 2IVMA 5B0DA 5F8MA 2DGSA 2UXBJ 3OJSA 1RWMB 2V2QA 3R7SB 3MMJA 3R5BA 5GADI 2Q6BA 2BE9B 2X7IA 3T6BA 4RW9B 7FDRA 1X4DA 2AYEA 2BA9A 1OO0B 2Z2MA 4A8MP 4BC9A 5DG8A 1FRJA 4ILLA 1V6HA 3NAHA 2DGWA 3M6VA 4PQUA 3CJKA 3CCES 3BR9A 4ZP9A 3SV3A 3DDIA 1EJ7L 5KG2A 4DPYA 4KO0B 3K0JA 4Q45A 3NBPA 1TMJA 4FVCA 2JFDA 4LVOP 2OH2A 1LKZA 2YX7A 3IGNA 2RT3A 4QJVA 5L46A 4DV4F 1N33J 1TV6A 3WC2A 1DJ0A 1CC7A 1I3OB 2DNYA 2JLFA 3MCSA 3H5YA 3M8YA 1IJFB 1JXEA 4C0HA 3BDPA 4NXMJ 1LW0B 4DSJA 2DGQA 2VKZG 2VZ9A 4UZCA 3HCXA 3A1YG 4M94A 3TEGA 2I1RA 1S0OA 4RO0A 4I2QB 3W2WB 1PC5A 4A47A 4QW9A 3EPIA 1PO6A 2C3YA 2I5JB 2RQCA 1YJ9S 2CKWA 4AFFA 5JVGQ 2UZAA 3JSMB 3K58A 4DG1B 2KI2A 1T9UA 2QLBB 2KXNB 1GH8A 2KZMA 3UDCA 5CCMA 3M8QA 2L9NA 1JXVA 3C66A 4ZVTB 4CLFA 4X4TA 1NHUA 2YPZA 2HNZB 2NS1B 2ZNZA 1KBRA 4EMDA 1U2FA 4JYAF 3PG9A 3TP2A 1D9DA 4UOFA 1SH3A 2W9AA 4C6AA 2FGOA 2IM1A 4FBTA 3UN5A 1KN6A 2ZM6J 2EFVA 3HX9A 4OZ5A 4ED2A 2N3OA 1IBMF 2HQGA 8ATCB 2UUAJ 4LF5J 2QRRA 3TYTA 1C1CB 3AJDA 2MKYA 2EKYA 4C8OA 4Y2CA 4KH1B 1CBKA 4OIXA 1MW7A 1H2TZ 2VDIA 4JV5F 3QZ7A 4TQRA 5IV4A 2J8AA 4G65A 4NLYA 3TZXA 3DDNA 5E41A 1NPKA 4ZCMA 2V63A 1X9SA 4FYYB 2YKNB 1RCOB 2ACYA 3D4JA 3R1HA 2AJQA 4IOCQ 2ROEA 5HL7Q 2G2ZA 3KLHA 2XBPA 2OSQA 2E44A 1QUPA 5U47A 3VR1A 3B8HA 3JQJA 1Y3JA 3FBEA 4UW2A 4WIIA 1JJ2R 1U0HB 2N4CA 3Q83A 5IQQA 3ZTQA 1WNEA 4K0KJ 2VKRA 4USUA 2OPSB 4KBIA 1VQSA 3GU0A 1BWEA 1RWWB 3SCKE 4U96A 5KFVA 2AW0A 4ED0A 1VLYA 2M8DB 1F0XA 4M5LA 4ZVUB 1JLBB 2VG7B 1WORA 1LFWA 3B6BA 1DLOA 1SL0A 2V8VA 5KFCA 3LP0B 4LF9J 1H2UX 5KFHA 4F0HA 2RNEA 3HDSA 3S8SA 4NA1A 1CS4B 2HHXA 1FX2A 4C98A 3U1LA 3H2UB 5KFJA 2XCPA 1U45A 2GJIA 1H38A 3ISNC 2R8GA 1HI8A 2U2FA 3FEXB 2DXFA 2HZAA 4N77A 5BYQA 1S76D 1I1GA 4FBUA 4FYVB 2IVYA 3TQ1A 4OI0A 4QYZJ 4M1KA 1RTIA 1UWBB 3CJSA 4JB8B 2JLGA 1XMQJ 1NK6A 3DMJB 2JX2A 1KONA 2BKOA 1XJWB 2P5VA 4DUYF 2XSJB 4DV6F 4DV7F 3K8WA 4ILMA 1TL7A 2FVSA 1IKYB 3DYAB 1H6KX 1LWCA 4C0OC 2YQ1A 3V81A 4JI8J 3HVTA 2LXIA 3MAAA 1IR1A 2EI5A 4OI3A 4DQIA 2NPFA 3PO5A 2PI5A 1W25A 3I55S 3D1QA 3PO4A 1NCLA 4WZQA 5HVHA 1QAYA 3OFHA 2XNRA 1SH0A 3BGUA 4ZCIA 5IT0A 3IRXB 3P5BP 2VFUA 3HHLD 4ECTA 3M6UA 3SI8A 3BEGB 3AB2B 4OYAA 3K5OA 3P4UB 3QAEA 2G0IA 4A8WA 3AXMA 1VI7A 3L09A 4TVAB 3UCZP 2GVDA 3CC4S 2CPIA 3KHLA 1NM2A 2QMXA 2Z57B 1SH2A 3PX6A 2HFOA 2R8KA 2OO4A 3K5MA 1OJ4A 5HVFA 4NCGB 5B08A 5CABA 1PJ7A 2H48B 3CSKA 3KOAA 2RRNA 1SC3B 2PA3A 3QATA 3UDEA 1IBKJ 3CULA 1BHNA 3MD1A 3ZZUA 2DNLA 3NGKA 2N7CA 1PILA 3PRVA 2CFXA 2MTLA 1FJGJ 4I2PA 5CA5A 1T95A 2AJFE 3JSBA 1SCJB 5HAOA 2UVWA 2AU0A 1Q8IA 4NXMF 3J7AN 1CJUB 4OX8A 3NY0A 2RQMA 3MPUB 5K5MA 4LRAA 1S4FA 1HHQA 5IOLA 2ZHBA 2K2PA 2UVUA 4USHA 2OHDA 4AL6A 1RT1A 3HHKA 3JQMA 4IDKB 3QAUA 1TAQA 4F8RA 3L95X 1DAXA 1YZ6A 3RGIA 2RU3A 4M5KA 4USIA 3M8SA 1U1OA 3NOGA 2UUCJ 1XNQJ 1XR7A 4CO5A 1T02A 2AEFA 4ZPAA 4OJ3A 1S48A 2HAIA 2IFXA 3N5FA 3B78A 5KT5A 2V34A 4OX7A 3MR5A 1S79A 3RRHA 1PKUA 5T7LA 1JMTA 1QUVA 4J9VA 2VOPA 2OGUA 3PTWA 1LOUA 4UTGA 1NKCA 2CZVC 3A8JA 2FHJA 1PG5B 2ROGA 3PHEA 3GSIA 2YWHA 3NP5A 4UQTA 4I64A 3IM9A 3NEKA 1RLDA 3MM9B 3NCRA 1QAIA 1S6OA 1KOHA 1B7FA 4LQ3A 5HSPA 4ER8A 5ETQA 5B0AA 3N5BA 3CJRA 3G87A 4Q5VA 1K44A 1RTIB 2J8SA 2MKIA 4PUOB 4GVBA 3OTOF 1RT7B 4OHXA 2H65B 2CDQA 2J0XA 4BDPA 2OLWA 2VC1A 4BWJA 3TZZA 3EXYA 1FWLA 3OR1A 2G4BA 1N5TA 1KLMB 1JK9B 2WBRA 1SUQB 3ISND 2AHOB 2IJNA 4BBYA 2M70A 3CIMA 3GE9A 3HI9A 2VIHA 2AT1B 4JV1A 4MIWA 1CJVB 4ZKAA 1C4CA 2W2NP 3I5CA 2GS8A 2F4VJ 3Q23A 2HBZB 4G3IA 4L74A 4UOCA 1Q7YT 3CO9A 4MK9A 4F4AA 1BC6A 1S1WB 2YXLA 1AFIA 3QYYA 4ELTA 3MTJA 4HVZA 1WF1A 1GXUA 2BJ8A 3I5BA 2GHWA 2HVIA 2DGUA 1KD1T 3EDRB 2DO0A 3EXCX 3OJUA 2LA4A 3CCWA 3TA0A 5KG3A 3IWNC 4KQZA 2AEJA 1T0TV 1TKDA 4E8UA 1UTAA 3K89A 1JLGA 3GR1A 1N34J 1M1GA 1T7PA 4LRCA 3LWLA 4ZLPA 4K4YA 2ZH2A 2ERRA 5T41A 4O3QA 2EC2A 1T9VA 3EZOA 1NZ8A 3ZO7A 4ZIVA 2W4CA 2W2OP 2RDJA 2X1BA 3PW2A 4CQ1A 2R9LA 1BY9A 4NOHA 1DLOB 3U02A 4X65F 4OHVA 1S0NA 2DISA 4WP3A 1OMSA 4CTAB 3BGLA 1Q7LB 3ICLA 3MMBA 4OQJA 3ZTRA 1MWYA 4DR1J 4ETXA 4KV8A 2V9WA 1U6ZA 1YX2A 1RQ0A 3P45B 4MT1A 3PFEA 4Q2LA 4F26A 4FVMA 3AXKA 5D4LA 1U0HA 3DOMB 1R7IA 2HZVA 4WCEQ 1LWXA 4I7FB 3CJ8A 1YG0A 2V0NA 4X66J 2DIUA 4DL3A 4JI0J 3BGRA 2BVZA 5J1PA 3VQSA 1B64A 4AUKA 4J9KA 4PUOA 1HW9A 4J9NA 3C15A 2VASA 2FLNA 1S72S 5KFFA 5E3PA 1Z4UA 1HNXJ 3I32A 4M5JA 3MDFA 4LT6A 1X8DA 2F40A 5A6PA 3MXHP 2IVFB 3OR1B 2HMIB 1TU0B 3SFUA 2PI4A 2PEBA 3ADAC 4DR5F 3HP6A 3NKYA 1VMBA 1ZPWX 3CD6S 1FDNA 3R3TA 4RKUC 1V3RA 4LBIA 5F3ZA 1NHVA 2DK2A 2F7VA 4RJVA 1HNWF 2HHPA 2XY6A 4K4XA 2IAJA 4K59A 3GV7B 2CA9A 3N6LA 4GVLA 5K14B 4O3SA 3ETOA 1FD2A 1JKHA 3ITHA 3G82B 3F44A 1LXJA 1SB6A 4KHMA 3VAMA 4DX5A 1REVA 2R2TA 1S6PB 3HVAA 1NO8A 1HMVB 2NSCA 4HLBA 2UVRA 4QR2A 5LMNJ 1RAOA 1VYAA 1Q8BA 4ED4A 4TU8A 1OQ3A 3NS5A 5KG5A 1TVRA 3G8QA 3QGGA 1Y5LB 3FBCA 4B3MF 4M5DB 2KT5A 5DDPC 2AYGA 2DR5A 4S0MA 2QX0A 2DR8A 1T05A 1QDUB 3RRKA 5A0YB 1GXTA 2DNMA 3N6NA 1DRZA 1K0VA 3PJWA 3M30B 4OX6A 1IQTA 3RBXA 4ZHRA 1N0VC 3MEGA 1WI8A 5I42A 2ZVSA 3O5TB 1TP7A 3LOUA 5ADZA 3PR5B 1RADB 1UAWA 2D3UA 2M3DA 3HSGA 3MCMA 4P7VA 1SIZA 2KJWA 3GJTB 3IRWP 3VGSA 1G2EA 1AFJA 4LJMA 5I4MA 4KHPF 2DB1A 1KOOA 2FPHX 2RDDA 3OXFA 5E3QA 4UZBA 2Y9HA 3P49B 3R6LB 1SKSA 5IWAF 5DQIA 4C11A 3GWCA 1N56A 1REGX 1WEYA 3SQOP 4M5MA 2VQEJ 4LF2A 3Q0AA 1YTYA 2W2QP 2B51A 3CDBA 4HKQA 3D6HB 4UF4A 1GQEA 3W8GA 2LCWA 4EK2A 4QIVA 1JIHA 2UUTA 1HI0P 2R3VA 4NE9C 3RB4A 3UR0A 3IS9B 3OL9A 2KM8C 5EWFA 2KU7A 1BE4A 2MZTA 3UR3C 3Q8SB 4GKJF 2OD6A 1P9QC 5KFRA 3W5ZA 3TI0A 2MZQA 1CULB 3EZ5A 4A4JA 2DGTA 2C3MA 2OPRB 1N33F 5DZ7A 2HS0A 1FVSA 5KT4A 3DI6A 4NLTA 2XC9A 4DCOB 4RBVA 3W2VB 4H4MB 4M5IA 1F2GA 1ACMB 1JJ4A 5KFKA 2HFVA 2W01A 2XY5A 4ES2A 2KRRA 4XK8C 4ES1A 3F73A 5FIIA 3HJVA 4OX9J 4PWDA 1QTNB 1FKOB 1TVRB 3D2WA 4DV2J 2RD5C 4X4UA 1HYSB 2YNFA 1XERA 3C16B 3DLEB 3JSYA 4EGLA 2KVQE 1RT3A 1VCTA 3OTBA 3GYXB 1UZDA 1NJXA 3DHXA 1JKHB 3ITHB 4I69A 2C28A 4B9UA 1LK7A 1CJKB 2IAJB 4CLTA 5ETSA 1F60B 4JI7J 2YH0A 2ALYB 3D3CJ 2AYMA 3VALA 4ED1A 2DNPA 2DNNA 1K73T 4NCAA 4Q8FA 1FDAA 4N5SA 1CSJA 2HQFA 4O4RA 3VHQA 2BE2B 2CIMA 1U1PA 3TAMA 3MPYA 2CJKA 3DRPA 2WRMA 3SQGA 1ZM3A 4OLPA 3SSQA 1N54B 5GAEI 4ZMMA 3G6XA 3FEYB 4J91A 1RT3B 4TU7A 3D0IE 1NRKA 4HDHA 2G0JA 4CWBA 3QBCA 3G8TA 3CDUA 2YQ0A 1RT2B 5KFYA 3T1YJ 1WHVA 3D0HE 5CYMA 2HNDA 3MI7X 1RJJA 3BR8A 4PXCA 3IR5B 2F8HA 2HNYB 3SDEB 2DR7A 2DR6A 3QT7A 2UP1A 2LXUA 2CNOB 2ZBIA 1WC6A 2BR0A 3C3LA 4NMLA 3TR5A 3IAS9 4O23A 3IA0A 2WBMA 3H59A 2ATLA 2B6AA 2EFOA 4ZPBA 4CRJA 3W63A 1T03A 4FN5A 5ETMA 1W2BR 5DS7A 3M6WA 1FXLA 5KFNA 2J6SA 1Q95G 3T9ZA 2GMJA 1U1KA 1IVZA 1IKWB 3IS9A 3D7SB 2MY8A 2UXCF 3CCMS 2DNKA 5B09A 5J1NA 2DYAA 3MF5A 3MFIA 1HNZJ 3DLBA 2UUWA 3KHGA 5MAOA 3GYNA 3AD8C 2CQ1A 4ED3A 3OL7A 2C3UA 4H4OA 1GEHA 2EKNA 3AA8A 2KJVA 3MPWA 4P7TA 3MECA 1HL6A 4MK8A 4X84A 4IFYA 5F8NA 5A76A 5C42A 1ZOTA 3ILLA 1NXIA 4R8UA 3KG0A 4MKBA 1RISA 4YR3A 4FPRA 5A2QY 3MM5B 2CZ9A 2COLA 2LDIA 4JI5F 4PWDB 1XR5A 2FZCB 1M5PC 1HD1A 5HP1A 3BSNA 1BWVA 2NR0A 3KG4A 4OZ2A 5F9LA 3N28A 4LF9F 1LK5A 5GAHI 5HJXA 4Y34A 4A8KA 2GGPB 4K4WA 3FFIB 1T11A 4F3QA 4KFBB 2CJXB 3DLKB 1PYSB 2M52A 3KDNA 3G4SS 2V4JB 5D78A 5RUBA 2B4OA 1YJWS 3F0NA 3SCIE 2Y8YA 4I67A 4EBDA 2M8HA 3ZXWA 2QL9B 3DXSX 2NPIA 4F4KA 3G6YA 1GK8A 1WF2A 4HACB 4RW7A 3FCHA 4B3MJ 4DX6A 3MUMP 5ETLA 1SVDA 1LW0A 1SI9A 4DV0F 1V9OA 3MMAB 2QYGA 4DV6J 1NH8A 1VGYA 3GFYA 3ZZRA 2AIRB 3T19A 4ANDA 3IG1B 4CLPA 4DV1J 2J0SD 1ZTWA 2HIYA 2K7JA 4ZVFA 4I2QA 5L38A 2QL5B 2R4FA 4ECRA 1QY7A 5C25B 2HK3A 2MEWA 4OYMA 2R8JA 1VQLS 4UY8T 1VQYA 3HHDA 3THPA 2UU9F 4YHHF 1HBMA 2XMVA 3K57A 1MN9A 2KL8A 4ED5A 4PRFA 2CZ4A 4EEYA 2Q43A 4KHPJ 1VRTB 1R8CA 2FHJD 4LR8A 3JYTA 2BACA 1O0PA 1YBAA 4G6VB 2MJUA 3EVWA 5HANA 2OEKA 5DDRC 1RA7A 4L6V3 1RHJB 3MEDB 4C8KA 4A8FA 4P52A 1KQKA 4GKKF 2DY9A 5DDQC 2A2DA 2ZZMA 5C2GA 1GNKA 2UXDJ 4RW9A 2CNKB 1WHWA 3KK2B 3BN7A 2UUBF 5F8GA 4OJGA 1WC4A 4FNIA 2NXUA 1EKSA 3THVA 5DLFA 5L8RC 1N5QA 2PC6A 2DNOA 1RHUB 4LF1A 1X4AA 4C4WA 2KXFA 1GTHA 3I0RA 1B7YB 1L3KA 3MEGB 2GQ2A 4P73A 3A8IA 1FCAA 5HATA 4C8NA 2LVWA 4X4OA 4F0KA 2D7SA 2V4JA 4CH1A 2V4RA 1S99A 3GILA 4LFCF 1EARA 2HVDA 3RU0A 1NK7A 4DR4F 4F67A 3R9LA 3QLHB 2GQCA 3DU5A 2BQUA 1SL1A 3BH7B 3H5XA 2WVBA 4NXNJ 4A8SA 4FYDA 1JLEB 1JJCB 1ZS6A 1N5YB 3NNHA 2ZM6F 1F5CA 1JLFA 1UL3A 2PO4A 1TK8A 1LW2A 4X4PA 1TZ0A 2C1EB 2H5IB 3PHTA 5AXLA 5F8IA 1UETA 4CDIA 4PAAA 4CLZA 3TEHB 2XB2D 3C6TB 5F8JA 4DJBA 1UMJA 1ZAWA 1S12A 2X51A 5GAHU 4DQSA 1RKJA 4K4SA 4JV5J 5KT7A 1KR4A 2W7PA 5B0BA 1NK4A 1U1LA 4ZVSB 2IDEA 3GYGA 1NDCA 3HF5A 2ROPA 4R0JA 1WUUA 3ZTSA 5FLXY 4EZ9A 5LXYA 4ES3A 3R5JB 5K8OA 2GCFA 1SJQA 2RQKA 4O3NA 2R2RA 4YMEA 1RE1B 2LU2A 3HSJA 2XZDB 4R25A 1RWVB 3BQ2A 2RKIA 2C2NA 1K1SA 2P9EA 4V19X 3NLCA 1TKXB 5KFWA 3MAHA 2HVHA 2ZITA 1SUQA 4NL5A 1U8WA 1M90T 1OPZA 1WEXA 1WEZA 2J7KA 2VBYA 3HD1A 1UWBA 3OT9A 5ETPA 2JZ5A 5C24A 4UOGA 4ATNA 2XMJA 5LSOA 1YLXA 3PYGA 4CP5A 4PZVA 2B7BB 4WFZA 4RU9A 3J80Y 2IBOA 8AT1B 1RHRB 2O1PA 3MM6A 5IC6B 1F6TA 4HHUA 1YBUA 4DV5F 1YZ7A 2CQ3A 3W61A 4U9RA 1VK3A 1R3NA 3LUYA 4DR7F 4DR2J 1OQ6A 3TUZC 2JEJA 2VB6A 1RT6B 1SQGA 2FVCA 3C14A 4KE5A 2K7KA 4A46A 3OR2B 5DQGA 3ETMA 4J9QA 3BPDA 1YVFA 2X1GA 3I9V9 2ZJPQ 1XMOF 1VRUB 5GMDA 5C24B 3RB0A 4ID5B 1KKHA 1R43A 1Y00A 3AFGA 4HHHA 2ZHAA 2PMWA 4LF6F 1TL1B 4X4QA 1JJHA 2K3KA 1RHKB 2ZEJA 3CJ0A 3KNGA 1Y5IB 3J80U 1UVNA 1D0EA 3MM6B 1NH7A 3FJ2A 4RBTA 4WIQA 4R8UB 2V9KA 3IR7B 3NL0A 2OPSA 4DF4A 3TUPA 3UD3P 3IR6B 4JI8F 4FS1A 1XC9A 2V8GA 3VGUA 2PE8A 3MTKA 4EO6A 1TUWA 1HBOB 1S6QA 1VS3A 2WW8A 4OHZA 4ZK7M 2E9RX 4MMOA 3DFEA 5A8WB 1B70B 4B9NA 1A6LA 2C2ZB 2NUUG 4C97A 4X4NA 2DNQA 4K7QA 2VFVA 1VQ8S 4NLOA 3IAM9 3GQCA 2YH1A 1X4FA 3GIMA 2M9KA 4HH1A 1U6FA 1FTRA 1WG5A 3DLJA 1VC6A 2HQCA 5ETRA 2VH7A 4ECQA 3MMCB 4UOHA 3PW0A 3MMAA 2HNYA 1RACB 2F9DA 3EMTA 1BGXT 1N6QB 3GFXA 4MKVA 2C2DA 1AT1B 2XZWA 4RU2A 4DQPA 1X4BA 1QTMA 4OFZA 4Y2KA 3BO4A 3MM8B 4ZJLA 1XNRF 3MEEA 3MM7B 4OJ1A 2LEAA 2VFTA 3C8YA 1XIQA 2V5HG 3UE2A 4DL6A 2FVRA 5HMYA 2PN6A 1TKZB 4DHVA 2VOOA 4WF9Q 1PCAA 4ITSA 4Y65A 3SCLE 2RRAA 4TLRA 4ZPVR 4FS2A 1VQ7S 2UXDF 4OHYA 1IWGA 3HHEA 3LO3A 3W64A 2D9PA 2R2UA 4I68A 4G1PA 4DSEA 3BKUA 5KOXA 1YBTA 4NEYA 1UA0A 2RS8A 1SKUB 2MQNA 2BKPA 5A8RB 1M0SA 2XO6A 4OV1A 3OHAA 2HHWA 4LFCJ 4Q43A 1RDRA 1XMQF 3PFOA 2I8EA 5J2NA 2JRSA 2NZCA 4IG3B 2NXJA 2GO9A 5HK4A 4X2BA 4I2PB 3BN4A 3MFHA 1VBYA 3UD5A 4NRUA 3W2VA 1F2HA 4J7CA 1HWUA 3DRSA 3ONQA 4DU7A 4DLEA 2GW8A 4U7UD 3DHWC 3JXOA 2WB1D 1DTQB 5LSLA 2ZE2B 1SKRA 1X31C 1FJGF 2R7XA 2RUSA 3SEOA 4ICLA 3OVAA 4WK3A 2XLIA 2XYGB 2DTJA 4B9MA 2BZ2A 3FSXA 4O3PA 1DARA 4GO7X 2HURA 2PT0A 4LFAJ 4ALZA 2KB2A 3N4WA 3FCWA 4U8YA 3IG1A 1G6BA 4DOZA 5IS2A 3GIKA 4CLWA 1VIOA 4GRSA 2KKHA 4NYOA 3T9NA 3J7A1 2F4VF 5KG7A 3DOLB 2WOMB 3LANA 4PEOA 3N79A 1R89A 2GJ2A 4ZN1A 3U1NA 5D77A 3UPFA 1K1QA 4WU3A 1QSLA 4AL5A 4N41A 2ZZTA 1EAYC 3I0SA 2BUNA 4MFBA 2E1PA 3FDSA 4URGA 4IRCA 3FRZA 3SQGB 4NCBA 2CAJA 1W2IA 5HJYA 1QAJA 2E9TA 3Q8UA 2LYVA 2POKA 4LRDA 2AV5A 4JV0A 2FJEB 1JLAA 2YWWA 2E9ZA 1CS4A 4NLWA 4B02A 2HHUA 1XQIA 1M5KC 5FD1A 4YOEA 3CC2S 5DO2A 3TRGA 4LR9A 3H25A 3LP2B 2MLZA 4HHJA 2B5JB 3A8KA 3GJSB 5DG9A 1RYRA 1IKXA 2IJRA 3A8EA 4NMXA 1KQSR 3D67A 4JI4J 5DGBA 1KHWA 1Q4RA 3H5UA 2HEKA 4ZVQB 4A48A 3CCZA 2EK1A 1RU2A 3VAGA 1HR0F 2HHTA 3LPEA 4PKDB 4BLGA 2UUAF 5E0OA 1BQMB 1PAEX 1S10A 2HBQB 2Y8WA 2DGOA 2MQPA 5HMZA 2B6AB 1JB0C 2M88A 2NXNA 3VWSA 3M8RA 4UUXA 1YQHA 4R0EA 3KYLA 1F9EB 2J76E 4QWBA 1NSAA 2XMMA 3IXQA 4O3RA 3ULHA 3ZZZA 3OL6A 1EETA 1HQUA 3RAXA 2AJ2A 1YK9A 4NLUA 1SIWB 1NPRA 1A9NB 3I4HX 4X66F 5CYQA 4WFAQ 3PIPQ 5J2PA 1I6JA 3S6EA 3T1YF 3A3OB 1UCNA 2K8GA 1SC1B 2OUGA 2AEMA 2Q3PA 3OFEA 4Z7CA 4OZLA 3J7Z5 4RWWA 1X4EA 4M63A 4DS5A 2VG5B 4OZ0A 1AROP 5I3UA 3RYLA 3CDWA 3LA0A 1N36F 3AA9A 1NDPA 2QL7B 3PY8A 2K06A 4CLUA 5KFBA 2QA4G 3UD4P 5KFLA 4RX6A 4DR3F 4USJC 1XTZA 1S1XB 2EWHA 3MPVA 1CJTB 1B99A 2RVJA 4DPWA 4V1Ak 1T9YA 4ID5A 4A8OA 1TKXA 1D1UA 5J2PB 3BYPA 1URNA 4ECZA 4LBHA 3W5YA 1S1WA 3M8QB 3W65A 1T9TA 5D3GB 5EDWA 3CNQP 3QZ8A 1N8RT 2BABA 1Q86T 2V8HA 1OY9A 4KGZB 3VGVA 8RUCA 2F8MA 5SUHA 2HHSA 3BH6B 1BUXA 3LALA 3ZTPA 2KFZA 5L1JA 4JYAJ 4PG6A 1NK5A 1HNVA 3IWLA 3OQ2A 4G1QB 5D4NA 5L1LA 4P75A 1TUGB 4ED8A 1C1BB 1HPZA 2FVPA 3POTB 5CH7B 2KZZA 3HPOA 3A13A 1D9FA 1NPPA 2NYHA 4EBCA 1Q16B 1WG4A 5DGAA 3HK2A 5KT3A 4K4ZA 3KXDA 4KC5A 4JI3F 4HH0A 5IXUA 3DN9A 5DQHA 5FLXU 3KMSA 1XWLA 3DRRB 2W24A 3CW2C 1VRTA 2VHGA 4QWCA 1Z2ZA 1K9MT 1QD1A 3RAMA 3UN3A 3CD7A 1A0OB 4IKAA 5ETOA 1NKBA 1NDKA 1NLKL 3CO0P 1GMUA 4FXVA 3AQOA 2V6AA 2L9WA 3DM2A 3KJFB 4RW8A 2PDAA 1H7XA 2DNGA 3TUJC 2HHHJ 3I5AA 3MPDA 3V6JA 1FESA 3GFZA 1ZTTA 3VCDA 4F4ZA 3BJYA 1X4HA 3BS9A 1FX4A 5LSRA 3QJPA 5KFGA 2Z4PA 2ZH9A 3PX0A 1HNIB 3HHNB 2D3ZA 4I6WA 1U4BA 4GKJJ 4NZ0A 1YSJA 4DFJA 1H74A 4C8MA 1PYOB 3H4BA 1KVKA 4DN9A 1FI4A 4WXOA 2KTQA 1SC4B 5C2CA 2HGNA 4QR1A 2KH9A 3PZPA 1T3NA 2UU9J 2V69A 1GT8A 2FHKA 2X3DA 4YUDA 4DLGA 3BZQA 1Q8LA 3MEDA 2OD4A 5D15A 2HHQA 2BKNA 3CJKB 5GVQA 1X60A 2YKQA 3LP1A 3IGVA 5A2QU 1DTTB 3BSAA 4DL7A 1VC5A 1FF2A 3MM8A 1S1TB 3M8PB 2QLFB 2XMTA 3R5DA 3MR2A 2BE7D 1NB2A 3TWZA 4HTJA 4KR0B 5K8PA 3JB9k 3FQLA 2BW7A 3HVWA 4WYWA 4LSLA 1FKAF 1IM6A 4K4TA 2YKAA 4DX7A 3PRBA 2JVOA 1MSWD 5I3QA 2CG8A 3CCUS 2EBGA 3CF5Q 1HW8A 4C7QA 3T1HF 2AGQA 1LEOA 2DKOB 5KT2A 2ZH5A 4ZVEA 2C3PA 2UXBF 2YWFA 1WSRA 3IC1A 3F56A 3QWPA 5A8KA 3RBDA 3MCNA 3D0GE 2HBYB 3PJ9A 4PPZA 2XLJA 2N3LA 3ET6B 2HS3A 2WHOA 4PPDA 2MQQA 2KFYA 4PQAA 3SFGA 2HSEB 1IKWA 2VDHA 2VPZB 3W66A 4RNNA 3T5KA 2OPQA 1F9FA 1VBKA 2CQBA 3FEZA 5GAGI 4IG0A 2EEYA 2OSRA 4L3KA 1WKKA 4F4YA 1SBRA 3TQEA 4EFAC 2YWEA 2E7VA 3HXMA 1CVJA 5I42B 2BANB 3TO8A 1WJ9A 1V5VA 3M32B 5EN1A 5HN0A 5CYJA 3DRRA 1SV5B 3MR6A 4C9DA 3G6VA 4ZITA 3KHHA 5HO4A 4WTOB 4DCPB 3PW7A 1QSYA 1FHTA 3QPIA 3GR0A 1RTZA 4CYUB 4QIFA 1VR6A 3OVSA 2RS2A 3IMQJ 1UVKA 4ZPTR 5IM0A 2B43A 2LEPA 1HQEA 1RT7A 3VAJA 4DSFA 2OPQB 2YPYA 4WTYA 5EX3A 4FYWB 2PMHA 2G9OA 3OR2A 4RUCA 1I94J 4P2SA 3RZAA 3TJ9A 3TVKA 1J5OB 3BDEA 3TANA 2MQOA 3V5RA 5KFMA 1OS5A 1HBNA 2ZKTA 4YB1P 5IV3A 1WTFA 4PYDA 4YR0A 2DR9A 4Z7YA 5L9XA 3OLAA 4WU2A 2AWZA 4DN0A 1IQZA 2XULA 3FZBA 3SBMA 1NHKL 1FKPA 3A3NB 5KG4A 3JAMY 2G1DA 3BGOP 4DSIA 2LA6A 4PXDA 1X7VA 1Q78A 4LF8J 3UN2A 5DRKA 2VG5A 4XTTA 4OZJA 3W1YC 3J81j 4FF2A 4R5PB 5J2QA 2VFSA 1DY3A 2UVVA 3W8PA 1M5VC 4XIUA 4ECYA 3DGPB 2W25A 5KG0A 5A8WA 5IFMA 1FKOA 4IDKA 1HYSA 3C16A 1Q0NA 1TTHB 3OLBA 4IRKA 4DL0C 1TK0A 4YR2A 3WIUA 2GO8A 3GJRB 4M8LA 2EG2A 2LFVA 1OSCA 1LFPA 1S9FA 3LP2A 1NJIT 1L5UA 1LQ9A 1U49A 4PXEA 1VLOA 2YWKA 4TNOA 1EQMA 2CG4A 1FDBA 2F3JA 2H3EB 2XI3A 4CT9A 2ZH1A 4DG1A 4DQQA 3JTNA 2FGCA 3NG8A 4L72B 2RB7A 3W9JA 2A6MA 4IO9Q 2B7CB 1EZZB 2BV3A 3NGUA 3Q2TC 2FJAB 3NWGA 3IBFB 1UEUA 1RB0A 2B9YA 3QO9B 5HQLA 2BM1A 2M2BA 2KHCA 4FYXB 4DV1F 4ECSA 2CQPA 1NB7A 3IBCB 4EBEA 1URRA 3FCVA 3OTOJ 1UVJA 2FHMA 4EYHB 4ZN3A 3DLLQ 3GONA 2MHEA 4U8VA 1VQNS 2E5HA 5KFXA 2GVZA 1U48A 1D3WA 1JLGB 1R0CB 3PJXA 4YHHJ 4M5HA 4ID8A 5ETNA 3S1TA 2HWIA 1PSDA 1ELOA 2FD2A 3RRGA 2BRKA 1RU1A 1UEKA 1CPZA 4WFYA 4P2FA 2FLLA 5F0UA 4H4MA 3CMQA 2QTWA 2GHPA 3KK3A 3WBZA 1HNWJ 1LWCB 1U02A 1UFWA 3LPYA 1UVIA 2OIHA 4CLYA 3LTOA 1VDHA 3KK2A 2EBEA 2O3DA 4U7UK 5KOWA 1NJZA 1EP4A 1WHXA 5EHHA 3E01A 3M2VB 1LWFA 3OBIA 1FD8A 3N9UC 5CD4H 3IN5A 3D6FB 4CNZA 3OTDA 5KFDA 2KRBA 2DHXA 3ZNUA 4CO2A 5J1EB 2IM2A 5G0RA 3DU6A 2YNFB 2BQ3A 1KWMA 4KHRA 3AD9C 4ETZA 2FTRA 3I4PA 4J9PA 4XPEA 2B3TB 2PIIA 5CQGA 3KG1A 4DFKA 2FJWA 1Y5NB 2DGVA 4Y2MA 3EM1A 2PFDA 1NKEA 4LVNP 2Q1LA 3E8OA 2WSCC 2B8QA 1NSPA 2DY1A 4ZVOB 2HQIA 1AUDA 2CJQA 2ZUGA 1R31A 3WHIA 1AA1B 4AYBD 1N4LA 1FTCA 2HZCA 2ZWPA 3I6PA 4KPCA 2BW2A 2AGPA 1HQ2A 3CCSS 3W60A 1IKVB 2XHWA 1C1BA 1HPZB 1JQGA 3POTA 2V2ZA 1HNVB 5B0EA 2XMAA 2VG6B 2ZHOA 3MM7A 3Q2SC 3CMES 5D0HA 1U47A 4ELUA 2DXEA 4L73A 5E3RA 2AJ4A 4A8YA 2EC0A 2KDOA 4RPFA 1X5SA 2C2MB 1SC6A 2FY1A 1S0VA 1S49A 4C2MA 1RAGB 4QIGA 2BQRA 3PW4A 2CYYA 2WTFA 4LBPA 1RZMA 4DV3J 2EFGA 3N0VA 2VFRA 1QLNA 2FIUA 1RAAB 3L7OA 4OHWA 1X5TA 2LQ5A 3P8BB 4MJKA 3V4MA 4TY8A 5IT4A 3AOCA 4M5DA 4PR6A 1QE1B 2RH3A 4LSZB 3CJ2A 2LECA 4NLXA 2XLKA 1ZPVA 2Z2LA 3D54A 2P6SA 3DCAA 2R7OA 3IO1A 3KUEA 4C3LA 5K20B 4QU6A 4DPTA 3U27A 5H9FK 3JYTB 4H4OB 4DU8A 1GFWB 2AX0A 4MIBA 1KHVA 2FUG9 3Q8VA 3DC2A 4B9VA 2O67A 1N88A 2W2PP 3G82A 3CJ3A 5J2MA 3AB4B 3BBFA 4DUTA 3HMJG 4LQ9A 2H4YB 1HMVA 4NA3A 3D3BJ 1TL5A 1HBUB 2V2VA 2J6TA 3L9ZA 1RBOB 4NLPA 4NEZA 4IR9A 2QLJB 3T3FA 4JI7F 2CPEA 2R7SA 1XMBA 3OVBA 4N8OA 2MZRA 3CCJS 1N32F 1Q82T 2BANA 5CYQB 1EETB 1HQUB 1S1UB 2QN6B 2E7WA 5BXIA 4GC7A 1JLCA 1ZM4A 4C3MA 1YJVA 4TLQA 5KFTA 2IMWP 3FZ2A 1RBAA 2B9EA 3TAQA 4JUZA 3J81Y 1RHQB 3SIPB 2ILYA 5IM0B 4QWAA 2W7OA 3DRXA 4B3RF 3CDEA 5B0GA 3AHPA 4G1IA 5EGYA 2DT9A 3K5LA 3ET6A 1T8EA 1HR0J 2W7AA 3RG6A 1FK9A 4DL2A 5KG6A 1RP5A 4QPXA 5AE2A 2O66A 4N8NA 2QSWA 3KWMA 3KLHB 3R5AA 4I6AA 5KFZA 2XI2A 4RBUA 1AB8A 2JNJA 1KRPA 4C8ZA 4IG0B 2CVIA 2CQIA 3HD2A 3M32A 1PC4A 2EXUA 2YKPA 2B5JA 1U2CA 1W7WA 3K8VA 1IKXB 1UPMB 3Q8YA 2R8IA 1QVFR 3OFGA 4OLOA 2AYBA 1ZA2B 3GSDA 4USMA 2ZH6A 3T6JA 3WDOA 4YS2A 4URSA 2J9EA 1EX8A 3ENAA 1HARA 5D4PA 1GAOA 3V6HA 2F9JA 2XTJP 1GX6A 2LQBA 1HQEB 2YVSA 4K5SA 3CCVS 1HBNB 2IJFA 1QVGR 4MIAA 1J5OA 1QJHA 3CJTA 3HVRA 4IFVB 2GAHC 2QE5A 3BQ0A 1KLMA 4Q7AA 3O44A 3H40A 3VAIA 2XMKA 2F1FA 3D5MA 4XO0A 2NYIA 2QMWA 3OW2R 2XYPB 3M2RA 4DR7J 4IR1A 4CZCA 4CH0S 2C42A 4FPIA 4DR6J 2YX1A 4PG4A 2IC3A 4YP3A 3EGWB 5H9EJ 4JI1F 3QIPA 1R6YA 1BXNA 2MJNA 1DQ9A 4U7CA 1IBCB 2VD3A 1RAHB 1V3SA 2MPUA 2R7QA 2IRXA 4J5OA 3LAKA 2HLTA 5LOQA 3W5XA 4DR1F 1N48A 1VHIA 3EICA 5E33A 1FJEB 4NCGA 4XAKA 2YNHB 2ZOFA 2W8LA 2HQDA 2B4VA 1TQLA 2H5JB 4J37A 4W90B 4LRFA 1LW2B 2ZOGA 2AGOA 1C4AA 1FERA 1YRUA 3E2EA 2JWNA 3UDLA 2VBZA 3DOKA 3QRPA 4ZLLA 4JI3J 4YB6A 3C6TA 2VODA 5F8LA 4RNHA 2E66A 1YJUA 2BBEA 4GC6A 4Y3CA 3EWGA 4B3OA 1PJ6A 1YRXA 2P6TA 1ZETA 1L3SA 6AT1B 4RUBA 1HNXF 1X0FA 3BB5A 4ZPWR 1FRMA 2AMCB 2VBWA 1EP4B 3BBCA 5CHCB 2ZBQA 3MAAB 4CM0A 3DGVA 4F3OA 4HYKA 2MKJA 2XG8A 3JAMU 1YJTA 3CUNA 2RSQA 3AD7C 5DG7A 4GMKA 5D8HB 3UO0A 3A3PB 2ADCA 4I6YA 3HT0A 4CO0A 4ZVHA 1U8SA 3MZIA 2WCXA 4X62F 1HNZF 2RRBA 1MWQA 1VBZA 2CADA 4LSNA 3PACA 2HK2A 1NJWA 4IFYB 4RW7B 4M5NA 3RW7A 1HWIA 1D8YA 2GIQA 3R2DJ 3SMZA 1S6PA 4X64F 5LMNF 1FE4A 4OZNA 3RB6A 1E6YA 3ZC4A 1SXLA 1I5OB 1OPIA 4O44B 3CJQA 2XO7A 4HI1A 2ASDA 2VPYB 2PSZA 1KS2A 2UV8A 1NDLA 1KEKA 1EHWA 2CQ0A 3E51A 3QGPA 2R2SA 4CNYA 4XDCA 1YI2S 4KH0B 2OTLS 4LF4F 2HWTA 2MGZB 1XN9A 5KT6A 5THWA 1IXKA 1ITPA 2V68A 1RTHB 2IPOB 4ZJOA 4J9LA 2R7WA 4V19J 4YN3B 2HW3A 1P27B 5D6GA 4X64J 2D74B 1IBKF 2ZZNA 1IKYA 3DYAA 5AE1A 4LFBF 4H4KC 2XWYA 5KTQA 1KQGB 3FKBA 1CLFA 4F02A 3D68A 3PKYA 1MU2A 3US5A 2VQEF 2CUYA 4FP9A 3VV2B 2BJDA 3OSPA 1LXNA 3BKTA 3PRDA 1DQAA 2CQ4A 3SCJE 2HQ3A 4QIEA 2C2EA 4RZRA 3OUYA 2VQFF 2HLUA 4ZOSA 2PMZD 4ELVA 1HKAA 1FWKA 3V6KA 3CJ5A 3K7RA 3SZ2A 4RNFA 3FSIA 3RBZA 3KK1A 5HQ8A 2OAUA 2Z2YB 3GMGA 4NZ6A 1GMWD 4FF1A 4MYTA 2D3O1 3G6ES 2QO3A 3BYRA 4Y6IA 1KP6A 4LSNB 5SZTA 1FNMA 4KKOB 3TA2A 1BQXA 1NU4A 2P9GA 4J9MA 4IOAQ 4AXIA 1JLEA 3OXGA 2ZH3A 4B17A 2M0GB 5B0FA 3UW1A 4UQGA 3G96A 3TAPA 4MTPA 1CJTA 1YJNS 2RHQB 3LF0A 3JS9A 4N47A 4HDGA 4ZPDA 2E1CA 2FC8A 2N7YA 3VZIA 3KTQA 4KPYA 3WIVA 3W9HA 2GFFA 2E29A 4IO1A 4FZVA 1UJ6A 3CMAS 1X9WA 1L3UA 3B82A 4HT7A 1ULRA 1GMWA 4FF3A 3BGRB 3I0RB 4ECVA 3D1OA 4PABA 4O3OA 1U0SA 1CJVA 3W7BA 3ZZYA 2QLWA 1RT5A 1VRQC 2M5YA 2V67A 3GZ7A 2J9CA 2CDRB 2ZH8A 4WPAA 2A6OA 4DR4J 2I6WA 2ZDPA 1DURA 1UPPA 3OFFA 3QT6A 3BSCA 1T03B 1CQMA 3QMQA 4EWTA 1PBAA 3DLGB 2B8PA 3FQKA 3CEDA 5CZVA 4CCHA 1YJ7A 2EFQA 4WKRA 2JC1A 3QT5A 5J2NB 1JXLA 2VBXA 4NLVA 3TUIC 3KLGA 4ZP7A 2NZ4A 1J5EJ 3BGFA 3PR4A 1FRHA 2Y1IA 2JEFA 2QLXA 3BO3A 4OL8A 1IR0A 3DLHA 4B9TA 4YY3J 1U1RA 4TYBA 3EGNA 4LF7F 4OYOA 4CO4A 2LQ9A 5H1SV 2ZBCA 1TV6B 1Y7PA 2BRLA 2CJYB 4WKYA 3QQCD 5T14A 3VAHA 4ZJQA 1R0AA 3AODA 3LWMA 4HI2A 3QT8A 4HR2A 5HLFA 1N34F 3CIZA
chains in the Genus database with same CATH topology
1ZBTA 3HJFA 2BYCA 2NUHA 3L3CA 5G0RB 1VK8A 3P5TL 1IBLF 2PFFB 2J0WA 4ZP6A 3DOLA 3HHLC 3GG0A 2W9BA 2GC8A 3M9MB 2NSBA 1WI6A 1KFSA 2HRUA 4QOTA 3O6QA 2YNGB 4EU0A 5BYSA 3KK3B 1XK8A 4B3TF 2BOPA 1HD0A 1IKVA 2KYZA 3CXCR 4J9SA 3RB3A 3LH2S 4NLQA 5IZHA 4QW8A 2KVIA 7FD1A 1BD6A 2RUGA 4TKTA 3ZZ0A 4WFNQ 2JC0A 2A1BA 1HBMB 2MHNA 3KJVB 4QPTA 1U1MA 2FJXA 3QGIA 4PG7A 5LJ3Y 2LQJA 4QQBA 2EW9A 2HG4A 4OI1A 2L3MA 2FVQA 3CCQS 1X4CA 1CQNA 1C0UB 3KLVA 2LMIA 1V3ZA 4OJHA 1CC8A 1ZZNA 1HFEL 1B0PA 2IC3B 2A18A 3FGVA 2DGXA 3M9NB 5C5JA 1FNXH 3Q22A 1HBOA 3PVXA 1D9AA 2O01C 3V6DB 1P1LA 4I7FA 3OTEA 2CQHA 3AY0A 1UA1A 1APSA 2CJAA 3DLKA 1VQPS 4NLRA 2YQ3A 3CD0A 3MOJB 1R8BA 3NCPA 2Q66A 1RYSA 1YHQS 1FDDA 3HO1A 1F5BA 3DGPA 1QAXA 3HT3A 2NREA 3GV8B 2EK6A 3SXLA 3PKMA 2IM0A 4R5PA 2FDNA 1TUVA 3PEHA 2GHVC 2XCAA 2VL1A 3NS6A 2FJDB 1S1XA 3LP0A 3O8WA 4PXBA 5E7OB 3W3SA 5KFIA 2VG7A 3BSOA 5HROA 2RILA 3K59A 2JFKA 1J2VA 3GG1A 2HIQA 3KK1B 3I31A 4F50A 2ASJA 4HTIA 1FKPB 1DZ5A 3UWTA 1L3TA 5AE3A 2PGCA 3ZZTA 3G8SA 2ZH7A 3OPKA 5DETA 5J2MB 3PXGa 2KM8B 2B56A 4NXNF 1FK9B 5BYRA 1VQ6S 1MU2B 4WFXA 3NNAA 3G71S 1FJCA 1U25A 3THTA 2Z8QA 4MKAA 5HMWA 4DQRA 1NZAA 4K50A 4UUWA 3CPWR 3V81B 2MKCA 5G4DA 3PM9A 4NLSA 1QE1A 1RT4A 4NRTA 3OHBA 5CYMB 1JLCB 2MSSA 4ZA1A 4IUFA 2OMOA 2DH8A 4MYUA 3WX4A 5KFAA 5DQGA 4IG3A 2I9SA 2A10A 1XBWA 2CJ9A 4RLEA 3VAFA 2HYIB 2MKHA 3VZHA 5LMUF 4ZCLA 4FYDA 3HFKA 2YKMA 3CE8A 1VQKS 4CT8A 4QR0A 4KT0C 3I9ZA 4QU7A 3T5JA 5HMXA 4WZMA 3U7JA 3DM2B 1C1CA 1BQNB 4YQWA 2GIRA 4F3MA 1M5SA 1MROB 1S6UA 1LWFB 1JLFB 5CXTA 2CQ2A 3ENQA 2V2KA 1FE0A 2MKSA 3M30A 4A8QA 5K8MA 2E1MC 2L08A 2WK4A 2RIJA 2DITA 1NNDA 4QZVB 2WOMA 2HNZA 2JHEA 3T5HA 4F2SA 3AQPA 4RW4B 3QWUA 4IOBA 2K1RB 3WZ0A 2XGQA 2YTCA 4MFBB 4N56A 5HBMB 2G13A 2XSFA 2L41A 4WK1A 5JVHQ 4KGMA 3SV4A 3TARA 2J0QD 1QVFR 1KVIA 4RUAA 3H5SA 2HGLA 6FDRA 2KO1A 2RE1A 2JH3A 3QGHA 1X9MA 1FVQA<