2ZE2B

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 104
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B03
1BQMB 3N6NA 2ILZA 4DL2A 4ED7A 2JLEA 4NLRA 4ZMMA 3MFIA 2AGPA 3M8QA 3RB6A 3PJWA 1FKPA 4F4WA 3H59A 4H4OA 1DTQB 2B6AB 4RNHA 4WYWA 4H54A 2W9CA 3IGVA 3RB4A 2IAJB 1XR5A 2OPPA 3BGRB 2R2SA 4ECQA 4IR9A 1S1UA 5KG3A 3KHLA 3GV8B 1S9GB 3DOLB 4I2QB 2R2TA 4RW9B 1S0NA 3CDWA 3MR2A 1JKHB 4WE1A 2ZKUA 3V4IA 4ZVGA 5DLGA 3H40A 3I0SA 4RW4B 3CJ2A 4O3OA 1JX4A 3QO9B 2WRMA 5D3GA 3M8PB 4J9PA 4F50A 1KLMB 4MFBA 3V6DA 3BSCA 4R8UA 4ECRA 4LQ3A 3NBPB 3V81B 3HVWA 5T14A 3GIKA 5C42B 4ECWA 4B3OA 4GC6A 4IOBA 3VQSA 2WONB 5HLFA 2HNDB 2C2RA 4O44A 5C24A 3Q8QB 3KMQA 1BQNA 2OPQB 4R5PB 4J9SA 3KJVA 5J1EB 4ECXA 2ZD1B 1SV5B 3QZ7A 2XWYA 4FBTA 4JV0A 4KV8A 2GIQA 3MTKA 5J2MB 3MFHA 4I7FB 4WFXA 3UQSA 4YQWA 4IH5A 1HPZA 1RT4A 5KFVA 3BSOA 1LW2A 1RAJA 4PUOB 4TY8B 1RTJA 2VG5B 4KKOA 3TVKA 5CYMA 2D3UA 2R2UA 2IM2A 4KO0B 2CKWA 3DM2A 2IC3A 1U09A 3UR0A 2R8GA 1C0UA 3V6KA 1MMLA 4I2PB 5F8HA 4WZMA 4LSNB 4ECSA 4K50A 1TV6A 4ZVEA 1RT7B 4M94A 4QPXA 3FQLA 4R0EA 1VRTA 1S0OA 2JEGA 1HMVA 1T05A 4Q0BB 4ED3A 5C25A 1K1SA 3CVKA 4IR1A 3KMSA 3IRXA 4KAIA 3NL0A 1SUQA 1VRUB 4LQ9A 2RKIA 2FLPA 4ECTA 5FDLA 1JLEA 1QE1A 5KG0A 3QZ8A 5KFQA 1JLBB 2W9AA 4QWCA 3H4BA 4NLXA 1TKZA 4ZP6A 4ED8A 2QE5A 2WHOA 3ICLA 3JSMA 1RTIB 1S1XA 4KSEB 4LSLA 2D41A 4NRUA 4NLGA 2IM0A 1TKTB 4IDKA 1UWBA 4DG1B 4EO8A 3ISNC 3PR5B 1K1QA 2WK4A 2D7SA 2XC9A 1C1BB 4WFZA 2YKMB 2HMIA 5DQHA 3NMAA 3H5UA 3QGIA 2VG6A 2BE2B 3KOAA 1LWEB 1HNIA 2HNYA 3MEDB 1RTDA 1FK9A 2R2RA 3DRPB 1D0EA 1RA7A 2YNFA 1RT2B 2WOMB 2FVQA 4XO0A 3KLGA 1N4LA 2IM1A 4MIBA 4RZRA 3ISND 2C2EA 3BSNA 3KLFA 1C0TB 5KG1A 2IMWP 5J2PA 1FKOB 2R8JA 3QLHA 5HBMB 2JEJA 3ITHA 4NLPA 1EETA 3KLEA 3G6VA 2ZE2B 3DMJB 1R0AA 4URQU 3M9OB 1S9EA 1JLAB 4KFBA 3KLHA 3KHRA 2ATLA 3PW4A 3I5AA 2AGOA 3EPIA 3PW0A 1IKXB 3CIZA 4YMEA 4ICLB 2XCAA 3DRRA 3TAMA 5I42A 4RUAA 4MK8A 4IFYB 1HYSA 4K4YA 4DL6A 4ZPDA 4O4GB 4EO6A 1RA6A 2D3ZA 1MU2B 4KE5A 4IG3B 2W8LA 4URSA 3KHHA 3CJ5A 3DI6B 3LAMA 4NCGB 3C6UB 3KK3A 4QW8A 1IKYB 1S10A 5DG8A 4ED2A 4KB7A 1XR7A 3LP1B 3QGGA 4Y3CA 5L1IA 3KHGA 1DTTB 2FVCA 2HNZA 3G86A 2WTFA 1C2PA 1T03A 2YNHB 1N5YA 3PZPA 4IG0B 4O3PA 3T5JA 2GIRA 1RT5B 3MECB 1JLGB 1ZETA 1JLQA 3QIPA 3H5SA 3DRSA 2OPRA 4J9OA 3DLGA 3Q8PB 4K4XA 5KG2A 4PWDA 4DL4A 5HP1A 3D28A 3MEGA 2UVWA 1TVRB 3OLBA 1TL3B 2XCPA 4PQUB 2ASLA 1HARA 4QWAA 2RF2A 3GQCA 2YNGB 5J2NA 3IG1B 3CJ4A 4J9RA 4EEYA 4NLDA 3RB0A 5KFFA 3IS9B 1HQEB 3RBEA 2FLNA 5KFGA 4QWBA 3G6YA 2HWIA 3HVTB 1T94A 2C28A 5KFKA 1LWCA 5CYQB 4JUZA 2YNIA 4KHRA 1JLFA 3RB3A 3GYNA 2FJVA 4G1QA 4Y34A 4GC7A 1IKVA 1RT1A 3M8QB 3PR4A 1S0MA 3OLAA 1FKPB 5K14A 4NRTA 1TKXA 4IRCA 1S1TA 3DLKA 3FFIA 3I0RA 4H4OB 4TYAA 2W9CB 4IFVA 1S1VA 3EZUA 5KFUA 4QW9A 2OPPB 5KFPA 1S1UB 3PVXA 2BRLA 4NZ0A 3CJ0A 4EBDA 4JV1A 3IGNA 3DOKA 3BR9A 5KFRA 4WE1B 1S6PA 5KG5A 3V4IB 4F4ZA 3I0SB 4TQRA 5DG7A 1LW0A 3HKWA 4NLVA 3QGHA 5D3GB 5F8LA 4O3RA 4MFBB 4U6PA 3V6DB 1GX5A 4R8UB 4NYZA 3QYYA 3MEEA 4B3OB 5KG7A 1SH3A 3BQ1A 5HLFB 4O44B 5C24B 5KT2A 1BQNB 2XI2A 1T3NA 1S6QA 3KJVB 4RW6A 3KK2A 4RNNA 1REVA 3T1AA 4ZHRA 4KV8B 4Y2CA 3KK1A 1S49A 1HPZB 1RT4B 3RBDA 2AGQA 3KLIA 1LW2B 5F8GA 3FRZA 3OSNA 3V6HA 1TQLA 1RTJB 4KKOB 5CYMB 3OSPA 2R8HA 3C6TA 2IC3B 3DM2B 2RDJA 2DPIA 1C0UB 4NLUA 1RT6A 1TV6B 3I5CA 4U7CA 4RNMA 5KFDA 3M9NB 2J6TA 5EWFA 1S9FA 4YP3A 3NAHA 4IH6A 1VRTB 3KNAA 1HNVA 1HMVB 1T05B 1TL1A 2WOMA 5C25B 4O3NA 4NLOA 2E9ZA 2W8KA 3LP0A 2UUWA 2AU0A 3LP2A 3IRXB 5I3UA 5KT5A 4Q44A 3OL6A 1DLOA 1SUQB 3DLEA 4ID5A 3FDSA 2RKIB 4WZQA 1RTHA 2HWHA 3SFGA 5FDLB 1JLEB 1QE1B 2B5JA 1WNEA 2W9BA 2XGPA 4QWDA 3GV5B 1EP4A 4ZP7A 2VG7A 1TKZB 5HROA 4OL8A 4RW7A 4FS2A 3JSMB 2FVSA 4J9KA 2OPSA 3JYTA 4NLQA 1S1XB 4LSLB 5DQIA 4TQSA 4G3IA 4Q43A 1J5OA 2IA6A 1N6QA 3BREA 4IDKB 2C22A 1UWBB 3E01A 1YVFA 2I5JA 5J2QA 5KT6A 1C1CA 2YKNA 4O3QA 5EWEA 4Y2AA 4DL3A 3PW2A 1RT3A 4MKAA 2HMIB 3CJ3A 4HYKA 1JLCA 4IRKA 4DL7A 2WB4A 2V0NA 1IKWA 2WCXA 1KHWA 2VG6B 2JC1A 1HNIB 1S1WA 2HNYB 4RW8B 1FK9B 1RTDB 5DG9A 4WXOA 5KFCA 4RU9A 3CWJA 2BANA 2YNFB 3DYAA 4K4WA 2ASDA 3KLGB 3CDUA 1LWFA 4WFYA 2OH2A 2I1RA 3KLFB 3FQKA 4Q8EA 5J2PB 4NLYA 5KT4A 3QLHB 5F8MA 3TQ1A 5DGBA 4EYHB 2XGQA 2FJWA 3ITHB 1JIHA 1RDRA 4URGA 4J9MA 1EETB 3KLEB 4TY9A 3N6MA 1R0AB 4TYBA 3LANA 1BQMA 5F9NA 3T19A 3FSIA 1S9EB 4KFBB 3KLHB 1NHVA 3Q8RB 4JV2A 2JC0A 2V4QA 4H4MB 2UVUA 3UDLA 1DTQA 2B6AA 3DRRB 3OL7A 3TAMB 5I42B 2IAJA 3T5LA 3BGRA 3I5BA 1HYSB 4K4ZA 4ZVFA 5KFMA 1W25A 1TVRA 3EPGA 4ZPBA 5KG4A 1S9GA 1HQUB 3DOLA 4I2QA 4RW9A 4MK7A 3BQ2A 5KFEA 3GV7B 5L9XA 1OS5A 1JKHA 4Q8FA 3DDKA 3GILA 2DPJA 4RW4A 2BQUA 3PW5A 3QO9A 4J9LA 3M8PA 3KK3B 1ZTWA 3HVTA 2BQRA 3OHBA 1KLMA 2XI3A 2AQ4A 4O3SA 3NBPA 3V81A 2AX0A 5KFZA 5C42A 5L1LA 1I6JA 4XPEA 3CO9A 2HNZB 2WONA 2HNDA 4YR3A 4DL5A 2J6UA 1T03B 4K4TA 2OPQA 4R5PA 1JXLA 4IRDA 5J1EA 5F8IA 1N5YB 2ZD1A 1SV5A 1QUVA 5KFTA 4XPCA 5JUMA 3H5XA 1JLQB 3QIPB 2CJQA 3DRSB 5J2MA 4I7FA 3M9MB 2E9RX 2OPRB 4K4VA 4ED1A 3DLGB 4F4XA 3OL8A 2VA3A 4PUOA 4PWDB 5HP1B 2F8EX 3MEGB 4TY8A 2VG5A 3PW7A 4KO0A 2W7PA 2RF2B 2E9TA 4QWEA 4I2PA 4LSNA 5J2NB 1RT7A 2HAIA 2UVVA 4MK9A 5KFXA 3BSAA 4Q0BA 2V4RA 2QV6A 3GIJA 2FVPA 1LWCB 4NLSA 2YNIB 4M95A 5DLFA 1N56A 1JLFB 1VRUA 4G1QB 5KT3A 1IKVB 1RT1B 2EC0A 4KBIA 1JLBA 4WYLA 4ECZA 5K14B 1TKXB 1S1TB 3DLKB 3FFIB 3I0RB 4ECYA 2V9WA 2BRKA 4IFVB 1S1VB 5DQGA 4O4RA 1RTIA 4TLRA 4TXSA 3LALA 4YR2A 5KG6A 2O5DA 5L1JA 1TKTA 4DG1A 3QIDA 3DOKB 4ZPCA 4ED0A 2VA2A 5KFIA 4MIAA 1S6PB 5EDWA 1C1BA 4J9NA 2YKMA 3T5KA 3GIMA 2R8KA 1S4FA 5F8JA 3SI8A 1LW0B 1NNDA 4IKAA 1S97A 4IH7A 1S48A 2FJXA 4ED6A 2BE2A 2J6SA 1LWEA 3MEDA 1TP7A 1IM4A 1CSJA 4ECUA 3DRPA 1GX6A 3NAIA 4K4SA 3KLVA 5DGAA 1RT2A 3MEEB 3NGDA 4KHMA 5JXSA 2FVRA 2UVRA 1N48A 1C0TA 3Q8SB 4J9QA 1FKOA 1S6QB 5HBMA 3MR3A 1SH2A 4RW6B 3KK2B 2IJFA 3UPFA 3OL9A 1REVB 4ZHRB 4FS1A 2ZE2A 3DMJA 5KFSA 3KK1B 1NHUA 1JLAA 4ECVA 2ALZA 3V6JA 2IBKA 3KLIB 5KFOA 3E51A 5KFAA 1IKXA 4ICLA 4TN2A 3C6TB 5EUHA 5EWGA 2BR0A 4RNFA 3N6LA 3PJXA 4RUCA 1RYSA 1KHVA 1RT6B 4IFYA 4MH8A 1SH0A 5KFLA 2ASJA 4RW8A 4WXWA 2IM3A 2IJNA 1ZTTA 5KFWA 1HNVB 4RNOA 5F8NA 1TL1B 3SFUA 4O4GA 3IN5A 1QAIA 4EBEA 3LP0B 3OHAA 1MU2A 3T5HA 2JEIA 3GIIA 3LP2B 5I3UB 4IG3A 5L1KA 1DLOB 4ID5B 3DLEB 4DEZA 2B43A 1RTHB 3DI6A 3H4DA 2B5JB 3C6UA 4NCGA 2W9BB 1IKYA 4Q45A 1EP4B 3H2LA 4YR0A 3BQ0A 2VG7B 5KT7A 3H5YA 3LP1A 1XR6A 5HROB 4HKQA 3CDEA 3HHKA 4RW7B 4ZPAA 3RAQA 2BQ3A 1Z4UA 4MKBA 4ZP8A 3D5MA 2OPSB 3JYTB 1DTTA 3HVAA 4K4UA 4ZP9A 1J5OB 1N6QB 1D1UA 4FBUA 2YNHA 4H4MA 1QAJA 3E01B 5F9LA 2I5JB 5J2QB 5KFYA 4IG0A 5C5JA 1C1CB 2YKNB 2ILYA 3LAKA 1RT5A 3MECA 1JLGA 2W7OA 4NLTA 1RT3B 4X2BA 4EYIB 1JLCB 4NLWA 1HQUA 5KFBA 1IKWB 3MF5A 2FLLA 1S1WB 3MR6A 2JEFA 1TL3A 4PQUA 2BANB 2AWZA 3DYAB 4EBCA 5KFHA 5KFNA 3PHEA 2C2DA 2YNGA 1RYRA 1LWFB 3IG1A 3MR5A 3G6XA 2UUTA 3H98A 4F4YA 2R8IA 3IS9A 5KFJA 1HQEA 2RDIA 3RAXA 2GC8A 3NKYA 4ZVHA 2AX1A 4IQXA 3BJYA 5CYQA
chains in the Genus database with same CATH superfamily
1U6BA 1YTYA 4ED7A 4NLRA 2BJEA 3H59A 4YB7A 4DPOA 4WYWA 2W9CA 4ES1A 2ZFHA 3EXYA 1XK8A 2XMUA 2HS3A 3A8EA 1P1LA 3GYXB 3GIKA 4L72B 3VQSA 2CNLB 2WONB 4O44A 3Q8QB 3C16A 1E6VA 3UDEA 3SDEA 4YY3J 3UQSA 4PUOB 2R2UA 2CKWA 2MKYA 1WC4A 5HMYA 2NSBA 3TUIC 3CCLS 2CPXA 1SUQA 1JLEA 3QZ8A 5LT5A 3X3UA 1BXNA 4M5LA 5A0YB 1URNA 2MLXA 4C8LA 4DS5A 4NLGA 1BY9A 4ZIVA 3ISNC 2WVEA 1PBUA 2HK3A 3ZTSA 3C14A 3OVSA 2YKMB 4KH0B 1LWEB 4CM0A 1WC6A 2FVQA 3ISND 3MUVP 3BH6B 5DJBA 4NLPA 5CZXA 1EETA 3UVJA 3KLHA 2MKCA 4NI2B 4OHXA 1SPBP 2HS0A 2VZ9A 1FA0A 3MEKA 4B17A 1Q78A 2JRSA 3GB0A 2A18A 1H7XA 2VPZB 1T9VA 1R8AA 4O4GB 3AA8A 4USTA 1X4AA 2FY8A 1N5SA 2C42A 2E1PA 2AJ1A 4DR2J 2FHOB 1C2PA 2Y8YA 3C2PA 5DM7Q 2VUGA 4YS2A 2DIUA 3SYZA 3FNNA 4AL5A 3DLGA 3Q8PB 3MEGA 4QWAA 2ZH4A 2RF2A 2ZNZA 1NK4A 5J2NA 3IG1B 4EEYA 2ZH5A 1HQEB 2WW8A 5CYQB 2DGSA 4I0WA 4CH7A 3RB3A 4I6AA 4GC7A 1P8GA 1DQAA 2ABYA 3MXHP 1HFEL 1S1VA 1UZDA 4QZVB 1P9QC 4CDIA 3DLLQ 1P9YA 4USWA 3SCJE 2JHEA 1YBUA 5F8LA 4O3RA 2X1AA 1WTBA 1FVQA 3OTOJ 1O51A 4WCEQ 4DV2F 5IFMA 4ZHRA 2XS7A 2B7BB 4RWXA 2R7QA 4PG6A 3BO3A 5B0EA 1X4FA 1RT6A 3CDBA 3TUJC 1O8BA 2PC6A 4KGXB 4CTAB 3W2WB 4M5KA 2E7WA 3GV5B 4DWIA 5LOQA 3GLJA 3FEXB 1S1XB 4WK3A 1LV5A 3VGSA 2QA4S 2AMCB 2BM1A 1FFSB 4HYKA 2YY3A 4L3NA 2OH2A 4I4BA 3OR2B 3HLUA 3SXLA 3C46A 2XYHB 3PV8A 5E0OA 2BKOA 1UTAA 2AW0A 1SJFA 4JV2A 2HFVA 2QFIA 3T5LA 4K4ZA 3MPUB 5EX3A 1UPMB 3L7OA 1BE4A 4CRJA 3B4MA 1MMNA 2WVCA 2XI3A 1Y5IB 1FNOA 4XPEA 3CO9A 2HNZB 2WONA 1UWAA 1XTZA 4YR3A 4C8KA 4CLYA 1N5YB 2CJQA 4PUOA 1U0SA 3JTNA 1DRZA 3HJFA 2BVZA 3NY0A 2O66A 4YHHF 5BR8F 4DSJA 1RKJA 1FTRA 2E5JA 3J7Z5 5A0YA 4LR9A 2GW8A 3TYTA 1TKXB 1VCTA 4WKYA 4J9VA 5EDWA 2YKMA 3J81Y 2EXUA 3CCMS 5F8JA 4IKAA 1IR1A 1LWEA 3GFHA 1RHKB 2UVRA 2ROEA 1FRHA 4FYWB 1NCLA 1NEEA 3O44A 2QL5B 4NI2A 1Y5LB 4C3LA 4MH8A 5KFLA 2HURA 1HNVB 4FKXA 4O4GA 3T5HA 1XNRJ 3LP2B 4J37A 3DLEB 3ELHA 3NCQA 1N0UA 1NK7A 2HBQB 3H5YA 3HHKA 2ZOGA 3OFHA 5CD4A 3HVAA 3ZZUA 4P52A 2DGWA 5HVGA 1YITS 3SCIE 1KVIA 4DFMA 5KFBA 2IFXA 5BXIA 3MR6A 3IG1A 2V9KA 2J0XA 1HBOB 2XMMA 1HQEA 2ZH1A 2AX1A 5CYQA 3N6NA 2ILZA 4DL2A 4HHJA 2KXNB 3MD3A 2FJBB 1M5KC 4ZITA 3DGPB 4DV3F 3M8PB 2ZWPA 1KLMB 3NBPB 4IOBA 4QOTA 1DZ5A 1NZAA 2B3TB 1KS2A 2JNJA 3BF4A 2I0XA 4I7FB 2ACMA 4M5HA 3TQEA 4M94A 2LA4A 2JEGA 4UY85 4CTAA 2GQQA 4IR1A 3W2WA 1U1OA 5IT9U 5KAKA 2W9AA 5IWAF 3OTDA 4PWWA 2BJ1A 1S1XA 3PEJA 4EO8A 1TL7B 5HJXA 3S01A 3AXMA 1VMBA 4JYAJ 1N4LA 4MIBA 2N4DA 1UFLA 5KG1A 3OR2A 4JI7J 2V8PA 3TJ8A 2YKQA 3POTB 2CZ9A 4Y2IA 3PX6A 1X9WA 1PSDA 1VQ6S 1Z2LA 3BPSP 4QW8A 5DG8A 2MGZB 3FJ2A 4FF3A 2CNOB 1OPZA 4DR4J 2V2ZA 1RLCL 1FE0A 2HNZA 2FVCA 2YKPA 4AT1B 2IRYA 1N5YA 2FJEB 3T6JA 1ZM9A 3ILLA 4NCBA 2KJVA 2XMAA 1IQTA 2AYEA 4W4MA 2XNQA 4OX7A 1IBMJ 1FI4A 2D3O1 3CCUS 2C28A 1XEZA 3D66A 4LRBA 2VQEJ 4ZCMA 4LR8A 1EQ0A 1U02A 4ZLPA 4KC5A 2LDIA 1TKXA 2DR9A 4IRCA 2R7XA 1SKSA 1YHQS 4PEOA 2V8GA 5KFRA 1G2EA 3QGHA 5D3GB 1R8BA 4LMZA 4NYZA 5HLFB 1WWHA 2CJKA 1BQNB 1WJ9A 2OELA 2MJNA 2UXCJ 4RBTA 1HPZB 3JSRA 1FRMA 5MAOA 4WFNQ 3HF5A 4DR2F 4NX9A 4IH6A 3KNAA 1HNVA 2EWHA 5CABA 5EN1A 3LP2A 3GG1A 4M1KA 3DLEA 1VYAA 5FD1A 5GADI 1WNEA 1WI8A 2XGPA 2EFVA 2MLYA 4ZP7A 1WF1A 2QFJA 4L3KA 1K8AT 1FEEA 3EGZA 4OZ0A 1B99A 2V68A 2F7VA 1KHWA 1RTDB 3KUEA 3UCUP 4K8RA 3KLGB 4KHPJ 1HBOA 2CQPA 3W61A 5CCLA 3FSIA 4BLGA 2DRBA 3UDLA 2Q66A 2UV8A 2QSWA 3OTOF 3M6XA 4ANDA 1NO8A 3EPGA 3TI0A 3A4TA 1U1MA 3BR8A 1K44A 4F26A 3WX8A 3DGPA 2OIHA 4J9LA 3M8PA 1ZTWA 1QM9A 3UN3A 1KLMA 1ZM3A 2RUGA 2V69A 3LGMA 3NBPA 3TEGA 3N4WA 3UD3P 3O2IA 3R8YA 2V8VA 4I7FA 1F2HA 1HWIA 4Y00A 4Z7CA 4K5SA 2AZ3A 5D4PA 1EQMA 4YEAA 1SQGA 3ILJA 4R25A 3PFEA 2MKSA 4DI6A 4N5SA 3N0VA 1X4HA 4ECZA 2ZM6F 4FYYB 1RCXB 1BGXT 3NWGA 4FPIA 4C9DA 3QIDA 1TL7A 4C8YA 1N8RT 4J9NA 4OYAA 3EGVA 4ED6A 1WEYA 2GIFA 3W7BA 4DV0J 3Q8SB 3MR3A 3OL9A 2UUAJ 2BJ8A 1G3OA 3D0GE 5EWGA 1GMVA 3POTA 4NYOA 3K8WA 3VCDA 5IZHA 5IOLA 4EBEA 2H1YA 1RTHB 2MGZA 4IO9Q 1RHJB 4OYWA 2BJ9A 5AXKA 3SQGB 3JYTB 3SBMA 4DPWA 4ZP9A 4FBUA 2N3OA 4U95A 2I5JB 4LF8J 1JLCB 2E5HA 1NRKA 1KR4A 5KFHA 5KFNA 3RU0A 3MR5A 3JS9A 4JI1J 3W5ZA 4OZNA 1XC9A 3T1YF 3PJWA 1XWLA 1HHTP 5B0AA 1DTQB 5T41A 2NQPA 1XR5A 3FBFA 2A1BA 2R7TA 5E3PA 4C6AA 2WVFA 5LMUJ 2D74B 2YWEA 2B9EA 4HVZA 4DPUA 2ZJQQ 3CJ2A 3D1OA 3QO9B 2ZOMA 5D3GA 1QSSA 5HLFA 1BQNA 5GAEI 3M6WA 4R5PB 3PYDA 4JI2J 5J2MB 3NOGA 1HPZA 2HHHJ 4TY8B 4P7TA 4XDCA 1MMDA 3N9UC 5C2CA 3QWPA 2QLBB 1OMSA 3GPAA 4KAIA 2W2OP 5KFQA 2EFQA 1WHWA 4ED8A 3M8ZA 4KSEB 3NNCA 3BDEA 1SC1B 4TNOA 3KOAA 1RTDA 2BJDA 3DRPB 1D0EA 1FDBA 2DNYA 3KLGA 2L08A 5A8RB 3SCKE 3FC9A 2RIJA 4K7QA 5ETOA 3G6VA 2VASA 2U1AA 3EPIA 1LEOA 3G4SS 2LQ9A 4M5DB 1D3WA 2CG8A 3VVTA 3OJUA 3P96A 4OX6A 1R8CA 3KHHA 1LK5A 2NPFA 1PAUB 2DXEA 3LP1B 1Q16B 4LT6A 3QGGA 4K0KF 3G87A 4DF8A 4O3PA 4HTIA 1KVKA 3JB9k 3JAMY 1RUSA 4J9OA 1RXOB 1ZAVA 3GJRB 3D28A 3THVA 2J7WA 1TVRB 3OLBA 3TJAA 4F0HA 3QWUA 3NS6A 2V5HG 3BV8A 1RK8A 5KFKA 2E44A 2R7VA 2DNPA 3MCOA 1S0MA 2IYGA 4Q2MA 3I31A 2HVIA 4ETXA 3KJFB 1UVLA 3D54A 3EGNA 4JI6J 3I87A 4JI7F 3FSYA 1VQOS 1O0PA 4P2SA 2XWXA 1QD1A 1LXNA 2LQBA 1M5OC 4C0BA 2FLOA 1LW2B 3T3FA 1J2VA 2EKNA 4DR4F 4V19X 2F5GA 2R3VA 3QAEA 4WZQA 1RTHA 1CS4B 1RBOB 5LJ5Y 3GR1A 1W26A 3SQGA 4J9KA 3JYTA 5DQIA 1IBMF 4HEA9 4RJVA 5T7LB 2I5JA 4DL3A 1JLCA 2EC2A 2V0NA 5IC4B 1RWVB 1L3UA 4K4WA 1S4EA 4USUA 4HH0A 1WG1A 4DQRA 2MHNA 3CCQS 4Z7YA 1NHVA 4ITSA 2DGTA 3AQOA 2BYCA 1DTQA 3DRRB 3OL7A 5I42B 1U8SA 3MPVA 1RAEB 2AEFA 1VBZA 3GILA 4KTQA 1HW9A 3QO9A 2UXCF 2AQ4A 2CJBA 2ERRA 4R5PA 3EVMA 2KTQA 2G9OA 4G1PA 3QIPB 2YWHA 5J2MA 3P49B 2OPRB 4K4VA 4X4TA 4TY8A 5HQ8A 5KOXA 1ICEB 3R5AA 2J8AA 3T6BA 5HN0A 2CPZA 4WKRA 3R7NB 3JSYA 3EVWA 4BS2A 2CJYB 4NLSA 5DLFA 1IBLJ 4CI0B 5KT3A 3RTVA 2BRKA 4E2FB 4X66J 2HHUA 2DH8A 4KIAA 1FERA 2E29A 3AH6A 2E5LJ 2DYAA 2GVZB 2UZAA 3AHPA 4KHPF 1H73A 3RRHA 5DETA 2IY5B 1S97A 2APOA 4A8FA 1XQIA 4ECUA 3DRPA 1GX6A 2CNNB 4EU0A 5A8RA 2KI2A 5KFSA 4B9TA 2IBKA 1JQGA 3PM9A 5EUHA 1RU1A 2R7OA 4QU6A 4V19J 4RW8A 4M5DA 4EUVA 5F8NA 3LWLA 3SFUA 2VHGA 3IN5A 1QAIA 2A2CA 2AD9A 4FKYA 2QLJB 5AJ3F 3LP1A 5B0FA 2QL9B 1YDLA 4LFAF 2LEAA 2KG1A 4NLWA 2H4WB 3OXFA 2FLLA 1WG4A 4BWJA 1BQXA 3AJ2A 2H48B 1LWFB 2XY5A 1SJ1A 4EGLA 3G6XA 5HQMA 5IQQA 1R0BG 2RDIA 4CLSA 5F3ZA 2ZH8A 3VQTA 2NUHA 1UP1A 2AGPA 3IFEA 2CAJA 3PCOB 2LQJA 4IR9A 4DV0F 4I2QB 4OI0A 4GO5X 4AXIA 2QA4G 2UUAF 4DV5J 1B4SA 1RCOB 2XG8A 2P9EA 1YRXA 1XJWB 4NE9C 2OPQB 1UAWA 4P74A 1NB2A 2AEJA 1LW2A 2Y0SD 2JFKA 3ISZA 4LSNB 1H2UX 5EX0A 1UCNA 2H9ZA 8ATCB 3CCVS 4HI1A 2RS8A 3CVKA 1B0VA 2ALYB 1NZ8A 2FLPA 4USMA 1CS4A 4LF8F 2IMOA 2QE5A 3QAUA 4UTGA 2DNNA 5T7LA 2BKPA 3HFKA 1AFJA 2LU2A 3TO8A 1IN0A 3ETOA 3PEHA 2PD1A 1WI6A 5LMUF 4URQU 2M88A 2ATLA 1JLAB 4PXBA 2IJRA 5FLXU 4ES3A 1VK3A 1UJ6A 2KZMA 3DRRA 5I42A 2Q1LA 2Z2LA 3US5A 2K7KA 4KE5A 1TUVA 4RR5A 1ZOTA 5ETTA 4NCGB 3C6UB 1KTVA 1S99A 2I6WA 3GFZA 2HHHF 3VGUA 2C1EB 3G82B 3QIPA 5ETKA 2OPRA 2DHAA 1WSRA 2J9DE 2UVWA 3I9V9 3EX7B 3GQCA 1V3RA 4AFFA 2MTLA 9RUBA 1KLNA 5FJ4A 2JSXA 1N5TA 2C2OB 3DRYA 1FKPB 2XZDB 3ZNJ1 5JMNA 1VGYA 2FJDB 3FMWA 3EZUA 3BGUA 5U47A 3Q22A 2GVZA 4USVA 2CPEA 5KG5A 1FRIA 2C3YA 3OTEA 2HGLA 3PRBA 3V6DB 3QYYA 4DZDA 3BDPA 4IYQA 1HBMB 1CC7A 2DR5A 3I4PA 4OI4A 5BYQA 3OVBA 2DITA 3O1LA 4OZLA 2A2DA 5KTQA 2EK6A 4TU7A 3ET6B 3H8YA 4QYZK 4XK8C 3CDAA 1C0UB 5IM0B 2DPIA 3K17A 4NLOA 2QRRA 1SVDA 2AIRB 3FDSA 2HVHA 2VFRA 4OI2A 1YBAA 2EPIA 2DGXA 4OL8A 2VQFJ 2O1PA 2HMIB 2AKWB 3R5CA 2HPUA 2EEYA 4FXWA 1LWFA 3R5GA 1YZ7A 3THTA 4A8KA 3PYFA 3N6MA 3T19A 3W62A 1NH7A 3W65A 2MQ8A 4JI6F 1OIAA 4ZVFA 1FFWB 2LCWA 1HQUB 4I2QA 1TELA 2DNGA 5DDRC 1NPRA 5L9XA 2FHJD 4PYDA 5CXTA 4ER8A 4C11B 4S0MA 2VJVA 1NK8A 3T41A 3CMAS 1Y5NB 2BUNA 2OPQA 2RU3A 4WFAQ 4X4NA 1MLAA 2OD4A 2KT3A 5HI7A 1N32J 4F4XA 2Y9HA 1TK5A 4O23A 3NMRA 4CCHA 4LSNA 3WC2A 1Q86T 1ULRA 2V4RA 2MY7A 1SB6A 1APSA 1LWCB 1RABB 4M95A 3UNGC 5LXRA 1JLFB 2MYFA 1VBYA 5LL6d 1SJQA 4O4RA 4TLRA 2HBZB 4ELUA 4C97A 5L1JA 2EW9A 3SSRA 3KUHA 1RB0A 3FBCA 1WKLA 4ERDA 1S5ZA 2W7AA 2KN4A 4B9NA 4B02A 3HX9A 3IBCB 4I1TA 4A8YA 1WORA 3LTOA 2VODA 1F3FA 1JLAA 2KFYA 4NXMJ 2EVZA 4TN2A 2VC1A 4UOFA 2V63A 3R2DJ 1CG2A 3EYZA 3W64A 4NCGA 3C6UA 4UUWA 1EP4B 1VBKA 1LNQA 1M90T 5H1SV 5IV4A 3HSZA 3IAM9 4K4UA 2YH0A 3HSDA 1CEZA 3G82A 2NYIA 3OJSA 4QBUA 5B0GA 2DGVA 2BANB 2C2KB 3X1LB 4DUYJ 4B9LA 3RAXA 2PO4A 2RSQA 2E5LF 3BJYA 4QR1A 3J7YU 3CCSS 3U02A 4F2RA 1FKPA 1U47A 3PO5A 1HWLA 2GQ2A 1UETA 3CDWA 3K8VA 4PXEA 4QIEA 2BJ7A 3V6DA 4LQ3A 3UO0A 4OHWA 1HBMA 1VQYA 4ZIWA 2C2RA 2ZD1B 2RAQA 5CCMA 3ENVA 4NEYA 4YQWA 4DQIA 3ET6A 3MM6B 1NDLA 1X5SA 4JBCA 1C0UA 3D6HB 2DNKA 1HHSA 3VVUA 1I94F 2BV3A 4PABA 3I55S 2FHJA 1ZBTA 2FGCA 4P2XA 1FTCA 3GU0A 1R31A 5AE2A 4ZLJA 1FRJA 2D9OA 1UKUA 2G2YA 2D7SA 2HMIA 2RMLA 5GAHU 1LQ9A 4DFJA 2IM1A 4F4KA 4Y65A 3M2VB 1CPZA 3PW4A 4C4WA 3CIZA 3OFGA 4DV5F 4IO1A 3W60A 1ZA2B 4DL6A 1P1TA 1U1QA 2OFHX 4C11A 2BE9B 3KYLA 4J7CA 4OZ2A 3MR7A 4K5RA 2ZITA 3CEDA 3H5SA 1ROFA 4WWSA 1OJ4A 1TMJA 1W2IA 2GHWA 2YNGB 2EFNA 2HBRB 4PR6A 5D15A 1LWCA 2LEPA 1JLFA 1NSPA 4DZ6A 1Q8KA 4UZBA 2B4VA 4EWTA 2Y1LB 2BRLA 4NZ0A 3ZTPA 3I0SB 3K5MA 1FD8A 4LF6J 1OSCA 1T95A 3QMQA 3KJVB 1QDUB 1RT4B 3RBDA 9ATCB 2IC3B 1RE1B 1GXUA 1FJ7A 5KFDA 4KJIA 3G8QA 5AXLA 1KOHA 4B3MJ 3C8YA 1UEVA 1EP4A 4B9UA 2LXUA 3JSMB 1WSVA 1U6ZA 2LQ5A 1VS3A 5EWEA 4O3QA 4MKAA 3BGOP 3EMTA 2BANA 2N4CA 2DISA 1PILA 2RHSB 2Q43A 4FN5A 2Y1JA 1BWVA 1QVFR 2MZQA 1IM6A 1NPKA 3R7SB 4Z2XA 3CCJS 3M2RB 1PJ7A 5KFMA 2ZKTA 3RR8A 3VTIA 2Y1RI 3KK3B 3HVTA 1NLKL 2KZZA 4PG5A 1D8ZA 3QRPA 3IWXA 4O0IA 2V6AA 2AZ1A 1JXLA 2ZD1A 3U1NA 3GP9A 3MM6A 1YX2A 1OO0B 1TUGB 2L3MA 2HHVA 1NB7A 2HAIA 5E7OB 3MMJA 2H4YB 2EG1A 5AE3A 1T9WA 2DK2A 1S12A 1LWXA 2V9WA 4IFVB 3R6GB 2UUBJ 4DHVA 5B0BA 1S6PB 2OSQA 1QJHA 1IUJA 1CSJA 3A12A 2R4FA 4A8WA 3QT7A 3EXCX 1QSLA 3I96A 3M2VA 2QC3A 4N77A 4ED5A 3RBZA 1TK0A 2BEFA 2W1BA 3LQVA 4TLQA 3VAJA 2B43A 1K0VA 3SEOA 4DV4F 3VGVA 4DX5A 1GH8A 4C0HA 5E3CA 3MUTP 3MF5A 2M4MA 3CC7S 3U27A 2YNGA 3ZTOA 1Q8BA 2KU7A 4ZS6A 2XQCA 3JXOA 3MFIA 1ZAXA 1F0XA 3I9ZA 3MM9B 3BGRB 5A2QU 2R2SA 2PEHA 1PJ6A 4OI6A 3MR2A 2G0JA 3I0SA 3N79A 3P8BB 4WF9Q 1M1HA 4F50A 3BSCA 1EAYC 4ZKAA 3CD7A 4ECWA 3FK4A 2ZC4A 5LSRA 3KJVA 1KRPA 1IWGA 4FBTA 2GZOA 1RT4A 5KFVA 3AOCA 2E1RA 2IC3A 2VBXA 2UP1A 2IYIA 2XS5A 3H4BA 2BW7A 3FEYB 3JSMA 2DXDA 4F3OA 4DUYF 4HR2A 2ZJPQ 5D6GA 1XBWA 1WD6A 2GAHC 1OQ6A 5HATA 2MKIA 2OEJA 1T7PA 2CVEA 3Q8VA 1FKOB 1WTFA 2JEJA 2ZUGA 4KPYA 1VISA 1U1KA 2F4FA 3M9OB 2AGOA 1VQPS 4MKYA 3M2RA 2HFUA 2AYMA 2DGUA 1B0TA 2COLA 1RA6A 4IG3B 2LFVA 3KK3A 1WOPA 5HMZA 2DNZA 2NREA 3G86A 2WTFA 2YNHB 1R43A 3WIVA 1NSKL 2HQIA 1ZPVA 1S76D 3IR6B 3M05A 2F4VF 1QUPA 4WK1A 1XMQJ 1RHMB 1NJZA 3NEKA 4IFVA 4DPTA 2KFNA 2B4OA 1S6PA 4GVLA 4U6PA 4N56A 4CLTA 2CPYA 4TVAB 2YQ3A 2J7UA 3M8SA 5CYMB 2NXNA 3DM2B 2IDEA 2DCLA 1TV6B 2WSFC 4M63A 2CPJA 2RRNA 4KYZA 3UN2A 1W7WA 4X84A 3RG6A 1QTNB 2RKIB 1JJ4A 4M5NA 4UQTA 1UJ5A 2AEMA 4D3GA 4JP8A 2W2MP 2XZWA 5KT6A 1NJWA 1GTHA 3PW2A 1RWNB 3WQPA 4OYBA 3MURP 1HNIB 2CUYA 5DG9A 1FK9B 3G2XA 3ENWA 1NK0A 3CDUA 1XERA 2FJAB 5KT4A 2QLFB 4OZ3A 1R0CB 3C15B 2HQ3A 2F8HA 1RSCA 3H25A 1KD1T 5ETSA 3MM9A 3BGRA 4LF6F 2J5AA 4ZLNA 1VQNS 4IOCQ 5KFEA 3MUMP 2N3LA 4A8XA 2NXCA 4Q8FA 4RO0A 5DDPC 3QPIA 2KT2A 2XMVA 4LFBJ 2XHCA 4K4TA 4I69A 1Y0HA 3QQCD 1TL5A 1WDDA 1KQGB 4OJ3A 4B3MF 1S59A 2UVVA 4DF4A 3TA1A 1L3TA 3B6BA 2LP4A 3RRKA 1GMWD 4RBVA 4RUHA 2FIUA 3FFIB 3RZAA 2AF6A 1F9EB 2O5DA 1UVIA 2ZC3A 2LVWA 2Z0GA 5ETVA 4OJ1A 1FRKA 3OFFA 1NKEA 3ZNUA 3PIOQ 4QQBA 3NGDA 5JXSA 1G1XA 1GXTA 1FKOA 2C3UA 2J0QD 1Y4ZB 3KK1B 1FHTA 1H3DA 5MLCV 1HNXJ 4Y6IA 4ILRA 1KC8T 1HWJA 3ZTRA 4WXWA 2CDRB 2D9PA 2E7XA 5IT0A 1Q53A 1FFGB 4IG3A 5L1KA 4OV1A 3HSJA 3H4DA 1BUXA 4CO2A 3K5NA 4F3QA 2OPSB 3W5XA 1J5OB 2YNHA 1Y3JA 3E01B 5F9LA 2YKNB 1CJUA 2DTJA 4NLTA 2P8IA 4YDXA 2L41A 4MKVA 4NYPA 4LF9J 4LRFA 1IWAA 3NKYA 4CZCA 2V2VA 5H9EK 2Q6BA 1UVNA 2UXBJ 3L9ZA 4JI0J 4F4WA 2B6AB 1NMEB 4X4OA 1Q81T 4BCAA 5KG3A 3J7YI 4P72A 4OYXA 4X62J 4LBHA 1T9UA 3H40A 1JX4A 4J90A 1YG0A 1IR2A 3V81B 3HVWA 5C42B 5HVHA 3FBEA 3DKDA 2GJ2A 3NGSA 3KG1A 4ILLA 2VG5B 5CYMA 3UD4P 3DM2A 2HHXA 4I2PB 3KDOA 1TV6A 4K50A 5CYJA 4TU9A 2HZAA 3GTYX 1SKRA 3KMSA 7FD1A 2RKIA 3T1HF 2RRAA 5KG0A 4M5JA 2BM0A 3TVZA 3QGPA 2WHOA 4H4KC 3W8PA 2D41A 2IM0A 3B82A 3PX4A 1C1BB 4AE5A 3R5JB 3W9IA 4ZK7M 2ZJRQ 1HNIA 1FK9A 2F65A 1GFWB 4U9RA 1CJKB 2IHR1 5GAHI 3VWSA 1RJJA 4YHHJ 3NRBA 1GMWA 3C15A 3VAKA 1IKXB 2WBMA 5IS2A 2QN6B 1PGZA 2WBRA 3BM7A 2M7SA 1U49A 1HL6A 1T9XA 3DN9A 3DI6B 3M8WA 1GNKA 2P6TA 1G6BA 5K8PA 1V6HA 2YPYA 4Y3CA 2VFSA 1P27B 3D6MB 2BBEA 3W5YA 3W9JA 4D3HA 2KVQE 2B9WA 2RVJA 1YGYA 3K89A 1X7VA 4CLPA 1N34J 2HWIA 1T94A 2MKHA 1RHQB 3M8RA 2WZ1A 4QR0A 3FFIA 2YQ1A 5KFUA 1XMOJ 3EM1A 4LUBA 1YJNS 4JI5J 1H6KX 3V4IB 4NLVA 3W2VB 4LRDA 4DCJB 2GJIA 5KG7A 3J7ZT 3OFEA 2XI2A 1VDHA 4JV5J 4NA2A 4P73A 3P5BP 2RD5C 3KK1A 3IO1A 1Q5VA 1X0FA 4CLKA 4B9SA 4RNMA 3M9NB 4QIGA 1HMVB 2J8SA 4B9VA 5KT5A 4F0MA 1JMTA 4P9SA 4QWDA 1U8WA 4L76A 2VBYA 2BABA 2OPSA 4NLQA 2C3PA 4TQSA 1J5OA 2C3OA 3BREA 2VJUA 1UWBB 3E01A 2QIFA 1X4EA 2YKNA 1FWPA 1SBRA 1XMQF 4CT8A 1NJYA 4K59A 2I1RA 1SL0A 1URRA 4F0KA 2H5EA 3LANA 2K8GA 2V2KA 3GE9A 2PSZA 1X4BA 4FVMA 2CVIA 2B6AA 2C2MB 2VKRA 4ZJOA 2PIIA 1OS5A 1KBRA 1X9SA 2DHSA 4WP3A 4H4KA 1WKJA 2HG4A 3ULHA 5DS7A 4ZPVR 3V81A 5C42A 3T9NA 4DL5A 2J9CA 1H74A 2WAQD 4LF4J 4XPCA 3CCWA 2QGFB 4N7TA 4FNIA 2VG5A 3QSYB 2W7PA 4I2PA 4C8OA 6FDRA 4E98A 2FVPA 3VZHA 2ZUAA 3BN4A 2KH9A 2CQ4A 3DLKB 4ECYA 4AXJA 2L9DA 3SSSA 3N28A 1C1BA 3GIMA 4IH7A 4UY8T 4C98A 2HQFA 1ZA1B 3NAIA 3PRVA 1NU4A 1CJKA 1YBTA 1S6QB 2EK1A 1NDKA 4U67Q 1G7CB 1IKXA 3N6LA 2E66A 4ZVPB 2IM3A 5KFWA 4E0DA 3AJDA 4LFBF 4RWWA 3GIIA 2DHXA 2MQNA 4ID5B 5J1NA 3GCWP 2CQIA 3DI6A 2VG7B 3CDEA 3RAQA 4RW7B 2J7KA 4LR7A 4H4MA 3CCZA 3AOBA 3WC0A 4CWBA 4CO3A 1C4AA 2MLZA 2YWFA 2VV5A 2IDLA 2C2DA 1YJTA 3AFGA 2G2ZA 3MM5B 3ENAA 3TUZC 2EFPA 4ELVA 1OYDA 3Q83A 3TZYA 5GMDA 1LKZA 4H54A 2HW3A 4OHVA 1J5EJ 2R2TA 4RW9B 2KFZA 3V4IA 3W2VA 2FB0A 1HNXF 3EE3A 3K0JA 1R6VA 4DPYA 3GWCA 2GVDB 4DR1F 1YJUA 4W98A 2YX4A 2B9YA 4KO0B 1IXKA 3PIPQ 2F9DA 4CLFA 2OEMA 1HMVA 3CB4A 3Q2TC 3G9CA 2DGOA 4WPAA 3NG8A 3SIPB 4E8UA 4DV6J 4ECTA 1RAFB 4LF9F 3RUBL 1UWBA 3CT9A 1K1QA 2WK4A 2ZVSA 3MOJB 2UXBF 3FCVA 5ADZA 5K8MA 2WOMB 4DSKA 4JI0F 2Z8QA 2C2EA 2XNRA 3BSNA 5H9FJ 4DR7J 3D6FB 4KY3A 3CC4S 3BEGB 1F6TA 1QTMA 4X62F 3O8WA 3MCNA 1VQSA 2ZM6J 4OYOA 2DY9A 1GK8A 1YZ6A 3LAMA 3IMQJ 4KB7A 1H72C 2QT7A 1RTZA 5L1IA 1Z1ZA 1SIWB 3MECB 1AYEA 3UE2A 2C2NA 2RE1A 3L95X 3NCRA 2N7CA 2ZWOA 2VBWA 2KXHA 3R5BA 3IS9B 2FLNA 5KFGA 3D0IE 4LVNP 3GYGA 4WIQA 1UJ4A 3DLKA 4H4OB 1UL3A 4TYAA 2ZH7A 4QW9A 2QYCA 3HHDA 3BR9A 3KG0A 1DBDA 4PCQA 1MROB 4G65A 4P75A 2RQ4A 4XIUA 4F4AA 4HTJA 4CH1A 3HHEA 2PFFB 2XYGB 3BQ1A 4NA1A 3MCMA 1S6QA 1EKSA 1Y9OA 2E1MC 4PG7A 2RQCA 2FUG9 3E8OA 2CJ9A 3OSNA 3RW7A 5K20B 1GAOA 3T1YJ 4ZA1A 2RB7A 4LF5F 4MT1A 1VRTB 4HH1A 3BO4A 2L9NA 3TZZA 2VICA 4ID5A 3SFGA 5FDLB 4I64A 1QSYA 2YH1A 5M2PA 2VG7A 1TKZB 4RW7A 5E3QA 1T02A 4DUZJ 2UXDF 4C8NA 2ZH6A 1N34F 3DDIA 2MEWA 1R7IA 3F44A 2EBEA 3HT3A 2YNFB 2JJ4D 4A4JA 3KLFB 3MM5A 2VFUA 4HDHA 4KQZA 1XMOF 4JI5F 3ITHB 4TY9A 4DSFA 1YIJS 2KYXA 2B7CB 3NOCA 3HO1A 4RW9A 1KTQA 1EX8A 1PYSB 2MZ1A 1U45A 2HRYA 3H7HB 4JV5F 2DNLA 2H51B 3OHBA 4W90B 2DT9A 1MG7A 3NGUA 3DCAA 4PPDA 2I8EA 5L9NA 5HVFA 2J6UA 1T03B 2KM8B 2GVDA 4Y2MA 5F3TA 3H5XA 4ANEA 5IC6B 3OL8A 4KO0A 2WVDA 2HFNA 2JX2A 4Z37A 4OZ1A 3IA0A 2YNIB 2H54B 2XB2D 5KOWA 2RS2A 1S1TB 4YR2A 2HVEA 4K0KJ 1QY7A 3AA9A 5AXNA 3T5KA 2X7IA 4XAKA 2KM8C 2VDIA 2OGUA 4FXDA 4UW2A 4K4SA 1FWLA 2FVRA 1N48A 3EWGA 2HRTA 4UF4A 4A8OA 4LF7F 2ALZA 3GSIA 2JL9A 5KFAA 2B8QA 7FDRA 4OFZA 5JJBA 5DM6Q 1AA1B 3LOUA 2GO8A 4PRFA 4DEZA 3ZO7A 4LF4F 2W9BB 1YQHA 1Q0NA 4Q45A 4YR0A 3TZXA 6AT1B 3LWMA 1UFKA 4J9UE 1D1UA 3TW0A 3LA0A 4ATNA 1C1CB 1Q4RA 3MECA 1LXJA 4DFKA 3P45B 1JJHA 2JEFA 1R3NA 3DYAB 2VPXB 3GJTB 4F02A 1NK5A 3IS9A 2XY7A 2XHWA 1B7YB 2Y1IA 2HK2A 4A48A 3M1VB 2JLEA 4CM2A 3PKYA 3MI7X 2OTJS 3HFVA 3EJMA 2RILA 4H4OA 4RNHA 1WHYA 1I1GA 2M5YA 1KQKA 2IVMA 2CRLA 2BA9A 3K5PA 5D0RA 1MROA 1N33J 1RWUA 1U2RA 3ZZTA 5J1EB 4ECXA 1SV5B 2XSFA 2GIQA 2X1GA 4WP8A 4HDGA 2QZ8A 3OQ2A 1GT8A 2D3UA 2R8GA 1MMLA 4ZVEA 3ILIA 4LF1A 5D77A 1KKHA 1VRTA 3RYLA 4NOHA 3H0PA 3A8KA 4LREA 3AT1B 3S8SA 5FDLA 3BBBA 4QWCA 4NLXA 1TKZA 3ICLA 1Q7LB 1CJVB 1SQFA 4DG1B 2HAFA 3NMAA 2NPIA 3IBWA 1RISA 1PCAA 2F1FA 4QU7A 2YNFA 3NS7B 1RU2A 3JTOA 4UT4A 3B78A 4ZVOB 2PGCA 3KLFA 2ZBCA 3WHIA 1SC6A 3ITHA 1S6OA 5K8NA 1J5EF 4LFCJ 3DMJB 2WW4A 4B3RJ 5SZTA 3WX4A 1XMBA 1WHXA 3W9HA 4K4YA 4NXNJ 3LF0A 1KN6A 3TUPA 1HI8A 2OFGX 2OMOA 4U8VA 4U7UD 1X5PA 1UPPA 1Y00A 1UVJA 2DH7A 3BYPA 4QYRA 3HXMA 1UEUA 1U1PA 3CJKB 1T03A 3D1HA 2A10A 1RADB 1RWXB 1K73T 3DC2A 1T8EA 4EFAC 4HACB 4DV6F 4DL4A 1CBKA 3R1HA 3QJJA 4NLDA 4KGZB 5KFFA 2K06A 4CO1A 4QWBA 3AD7C 3CJTA 2YNIA 3ILOA 4K2XA 5LSOA 1HI0P 1S1TA 4AL7A 5AJ3J 1PC5A 3PVXA 4LFAJ 4DR7F 3IGNA 2XY6A 4WU2A 1HQ2A 3MMCB 2IBOA 3QJLA 3GZ7A 1DFDA 3HVRA 2J9EA 3JSBA 4XTTA 3U7JA 3QATA 1U1LA 1TQLA 4DX7A 4KKOB 2PA8D 1U25A 3BO2A 1DAXA 2RDJA 3HKZD 2XEXA 4NLUA 3PO4A 3L7PA 4O3NA 1DURA 4OYZA 3OL6A 2JH3A 2W4DA 2W9BA 1X4DA 5HSPA 2FVSA 3VV2B 3BBFA 3MMBB 1AFIA 2ZVIA 2VIHA 1FJEB 1F9HA 4ZOSA 1C1CA 1X4CA 4DL7A 3EZOA 4RU9A 3DYAA 3K7RA 2ASDA 1K0TA 5A76A 4Q8EA 1CC8A 2CDQA 5DGBA 4EYHB 2XGQA 4URGA 4J9MA 5F9NA 2LU1A 1N54B 3M1VA 2KO1A 5JVHQ 1PBAA 2UVUA 2DR8A 5KG4A 1S72S 1AROP 3DDKA 2DPJA 4G6VB 3ZC4A 2XM3A 2ADBA 3BKFA 4FF1A 3I4HX 4JOUA 4O3SA 4ED4A 2YKOA 2OKQA 1E6YB 3DNCA 5J1EA 1SV5A 2HHWA 5E41A 3DRSB 5HP1B 3BYRA 1TKDA 2ZH2A 5HQLA 1FJGJ 4X4RA 2KXFA 4DUZF 3RBXA 2Z30B 5GAGU 1IKVB 1F60B 5K14B 1SJ3P 4L73A 3UDVA 3LALA 1CJVA 4DG1A 2MHEA 5KFIA 3FCHA 5GADU 1D09B 2P2CB 1T3OA 3BGLA 3C3LA 4MYTA 1M5VC 2FHMA 3DMJA 4AD6A 3KLIB 4JI3F 3KXDA 3K59A 2XMTA 5B08A 2CQGA 1VLOA 3PJXA 3AQPA 4F04B 2X1FA 1WKKA 4HI2A 4GO7X 4DR6F 2CQDA 5KT7A 2ZHBA 3OTBA 3TZWA 3K58A 1V5IB 1RLDA 3CJKA 2DIVA 3CE8A 5KFYA 3U1MA 3LAKA 3J81U 4QIFA 2VONA 3IR7B 4HACA 3TAQA 1U24A 1N88A 2HGMA 2FZKB 5EGYA 2AJFE 2UUTA 3A3PB 4F25A 4NMXA 3H20A 4IQXA 3QT8A 5IT9Y 2VOPA 4CIOA 1SJ4P 3GFXA 1RP5A 2JEIA 4ECQA 3I32A 4DLGA 2MMYA 1LK7A 3MMCA 2WRMA 3M6VA 2XLJA 1NXIA 1BD6A 3OUYB 4B3SF 2FTRA 4KGVB 3FSXA 4QIWD 3BPDA 3QZ7A 3HT0A 3BH7B 4Y0FA 3BSOA 4X4UA 4KKOA 2IM2A 1S77D 3Q2SC 1OPIA 4OMFG 4R0EA 1OY8A 3GFYA 2W01A 3QT6A 3BKTA 3VF0B 3NL0A 3BBCA 1YK9A 1IVZA 3MMBA 4OYMA 3PR5B 1FX4A 5D0HA 5M2UA 3IM8A 2BE2B 2M52A 3K5OA 4RZRA 3P4UB 1A6LA 3FUYA 3KHRA 4F2SA 4MJKA 1N33F 3DHWC 5HAOA 4IFYB 4OLPA 3SV4A 1B3TA 2JLFA 2ZZTA 1R8HA 3DHXA 4C7QA 2J9DA 3CJ5A 1SI9A 3DLHA 3UNYA 1HKAA 1VLYA 1GQEA 3CGIA 1E6YA 2GAGC 4C8MA 3PZPA 5D8HB 4K2JA 3F73A 3DRSA 3IRWP 5HP1A 2O01C 1CVJA 2XCPA 2ASLA 2AJ4A 1PAEX 2NZCA 2E7VA 5GAEU 3FZBA 4ZCIA 2V94A 3D3CJ 2FJVA 1IKVA 1MWZA 3PR4A 5K14A 4NRTA 2B51A 1H2TZ 2CPHA 4Y28C 1M1GA 2CA9A 2D1CA 2BOPA 3VZIA 4DCPB 2CQ2A 4F4ZA 3TX0A 2XLIA 3HKWA 4LFCF 4B3RF 2OHDA 1L3KA 4L6V3 3RRGA 2GV1A 1T3NA 4MYUA 2D69A 2NLWA 3W66A 4NXNF 3VAHA 3KLIA 2V67A 3UR3C 2DH9A 2W2NP 1LOUA 3J80Y 1H7WA 4DV7J 2HWHA 4GKKJ 2XULA 2YWGA 1FRXA 4QCLA 3KG4A 1TU0B 4LSLB 2IA6A 5B0CA 3WZ0A 2B4PA 3L3CA 1CQMA 1KEKA 2HHQA 3KTQA 1I94J 1WC5A 1NM2A 1J27A 2FQQB 2RHQB 2DD8S 2R42A 4X64J 1AT1B 4LBIA 3H2VE 1TVRA 4ZPBA 1T11A 3LO3A 1HLWA 1Q1KA 3G8TA 1I6JA 3OUYA 4DU8A 4IRDA 1WACA 5D0GA 2RUSA 4DQQA 5CQGA 2HFOA 3FCWA 3N01A 5JUMA 2E9RX 3M9MB 3DU5A 3PW7A 2ZZNA 3GG0A 2E9TA 3LH2S 1RHRB 3BZQA 3R27A 1ZZNA 2DR6A 2H3EB 3TP2A 4X4QA 4KBIA 4OYPA 3I0RB 3RW6A 5DQGA 4TXSA 3ZZRA 3I82A 1QLNA 3SI8A 1IR0A 2BE2A 4N76A 1IM4A 4CYUB 3MEEB 4KHMA 3PACA 2RT3A 2QSFA 3UDCA 4RW6B 1Q82T 4CO4A 2NZ4A 4RNFA 1G4CA 4IFYA 2QEXS 3GR0A 1ITPA 4PXCA 2J76E 4W92B 2F9JA 4WJBA 4I68A 1FJGF 3KHLA 1S0NA 2QA2A 1RT3B 3PG9A 2X3DA 2NYHA 1NUEA 2U2FA 4V1Ak 5F0WA 4C48A 3H98A 2R8IA 4C3KA 4CNZA 3VAGA 4JB8B 2GC8A 2L48A 4ZVHA 1HNWF 4NCAA 3D6TB 3CNQP 5C2GA 2MZSA 3GV8B 3SCLE 3MWBA 3VGTA 3F56A 3CPWR 3MDFA 2MKKA 4RW4B 1HNZJ 1NSQA 1U48A 4DV1J 5T14A 3HK2A 4DLEA 3KMQA 1EZZB 2N7YA 4J9SA 2KYZA 3MTKA 4ZVUB 2QL7B 3MFHA 1SIZA 4UQGA 2HSEB 3UR0A 4WZMA 1I5OB 1AUDA 2KKHA 4I67A 4QPXA 3MCSA 1M0SA 1K1SA 2V8HA 4F7VA 3AXKA 3ZZOA 1JLBB 3HSGA 4ZP6A 5E5NA 1VQMS 4LSLA 4NRUA 1S7IA 3HJVA 1A7GE 3TRGA 1FNXH 4B08A 2R7UA 4R0JA 2ZHOA 1SL2A 2FGOA 2JWNA 4XO0A 3V5RA 1RBAA 3Q89A 4DMZA 3ETMA 2DRDA 2DNMA 1DJ0A 2ACYA 3Q24A 1YRUA 3CMES 2HKEA 4MK8A 1PJ5A 1RWMB 4FDFA 4EO6A 2H5JB 4URSA 3KJNB 1BLUA 3VR1A 5BYRA 4ED2A 1XR7A 3HZGA 2VD3A 2EFOA 4IG0B 4AQYJ 2ZBQA 1JLGB 1ZETA 2RDDA 4ENOA 1TL3B 4MTPA 1NJIT 4ZPWR 1P6TA 4CH0S 2G0CA 4GKJF 3RBEA 3Q8YA 3G6YA 1X31C 2FYXA 4DOZA 3DFEA 2M8HA 3AOAA 3DU6A 5HO4A 3I0RA 3A3OB 4DV4J 2GQCA 2MQMA 2FC8A 5J1PA 4DX8H 3PDNA 3TA2A 1EARA 4CYUA 3MEEA 1SH3A 1UA0A 4RW6A 4DU7A 3JAMU 1SC4B 4YB6A 4L74A 1RACB 4YOEA 1PKUA 1S9FA 4YP3A 1T05B 2IPOB 4UOCA 3OPKA 1U7LA 4Q44A 4OLOA 3EUNA 2AYBA 2QTWA 3V4MA 4ALZA 1HIYA 1ZM4A 3CW2C 3R9LA 1NKBA 5GMKa 4Q43A 2DO0A 1Z2ZA 1NKCA 2X1BA 3L09A 1S7HA 3JQJA 1RT3A 3CJ3A 2QLWA 5AE1A 2WCXA 1T9TA 1FJCA 2HNYB 3HP6A 4YB1P 1YJ9S 4WFYA 1FESA 1NDPA 2DY1A 2G2OA 3P5TL 4YY3F 2B4UA 4OI3A 4TYBA 2W25A 4PKDB 2JFDA 5B09A 3WBZA 1FDAA 3AODA 3FZ2A 4ILMA 2Z56B 4RW4A 2MZRA 4X4VA 4N8NA 4X65J 1RAAB 2HS4A 1QUVA 5IT4A 1N0VC 1AUSL 1JLQB 4DV7F 2XMKA 2ZDOA 1DHMA 3PRDA 1EIYB 3HULA 1FX2A 4GKKF 1PO6A 1GEHA 2LKZA 4Q5VA 2PMZD 4OJHA 2QV6A 4A47A 1M5PC 1GTEA 2LDYA 1YI2S 1JLBA 1QVGR 5KG6A 2OJ3A 5GAGI 2GNKA 3KJQB 5IM0A 3DOKB 1F2GA 4ED0A 2W4CA 1S4FA 1NK6A 1M5HA 2J0SD 3FBBA 3HFZB 1SJRA 1BWEA 4X64F 3MMAB 1JNRB 2ZBPA 4J9QA 2CJAA 2ZNYA 2F4VJ 1A0OB 2RQMA 4ECVA 1D9DA 1B7FA 2VC0A 2P9GA 2AYGA 3C6TB 1VJWA 4RUCA 2FPHX 3DGVA 3G6ES 2I9SA 3UD5A 2F3JA 3D68A 5K5MA 5IQ6A 2DNQA 2B5JB 5LMNJ 2MSSA 3FKBA 4HKQA 4LVOP 7AT1B 2MKJA 4U7UK 4FYVB 1QAJA 5C5JA 4IG0A 1JLGA 2W7OA 4DSEA 4DN9A 3UCZP 4DCOB 1HQUA 1F5AA 3QBCA 3J80U 1TL3A 2W2PP 4FNHA 4DS4A 3C66A 2DEJA 4ZMMA 2Q6CA 2F40A 2AT1B 2GHPA 3M6UA 4IUFA 5G4DA 3DLJA 3NGKA 1S9GB 1JKHB 2XO7A 4UUXA 2V2QA 3TA0A 4C3MA 1OSDA 4J9PA 2Y8WA 1V3SA 1DY3A 4NA3A 1K9MT 3M7VA 3W8GA 1PC4A 2HRUA 1I3OB 3PXGa 4IH5A 2OD6A 3QFHA 5FLXY 3A3NB 1T05A 1YRTA 2M9KA 2EI5A 2RRBA 3Q0AA 5A6WA 1KFDA 2QMUB 1ZS6A 2BW2A 4PYAA 2XS2A 2HWTA 3H5UA 3QGIA 3DRXA 2HNYA 3J7AN 5HBMB 1VR6A 1VQ8S 4WFBQ 4HT5A 1HNZF 1S79A 4DV1F 2DNRA 2HZVA 4ZVRB 1IKYB 4F3MA 4BHQA 4P2MA 2NCKL 1U2FA 2WVBA 2HFSA 1JLQA 4I6WA 3P3DA 2BACA 4PQUB 2CWXA 1O6XA 2KDOA 3B4DA 3KDNA 4DJBA 2FHKA 4Y34A 1VK8A 2EG2A 3OLAA 1B64A 1S1UB 1QAXA 3LGHA 2CXEA 1XNRF 3DOKA 2K3KA 4WE1B 4DN0A 1RQ0A 2XO6A 4TQRA 3JQMA 3DDNA 2HFZA 4B3OB 3MMAA 4P7VA 3THPA 5D78A 2LYVA 3QJPA 1W2BR 4KV8B 3A8IA 5F8GA 3BN7A 3V6HA 1RZMA 4RPFA 1B0PA 3C6TA 4X4PA 2J6TA 2K7JA 2QLXA 3C19A 3R7BB 4QR2A 5IXUA 2W8KA 4DSIA 3IRXB 4AQYF 3GIRA 2B5JA 4LF2A 1AB8A 5F0UA 1SQEA 1X0PA 4IDKB 2C22A 2NR0A 3OXLA 1DARA 3EICA 3ZZPA 3ZTQA 2CPFA 4RW8B 3FRYA 4WXOA 5KFCA 3CWJA 2N82B 4DFPA 2BZ2A 2IRXA 4LJMA 2ZBIA 1KFSA 2FJWA 1YLXA 1JJCB 1R0AB 2OLWA 1S9EB 4KFBB 2MZTA 3T1HJ 3CJQA 2Z4PA 1JB0C 1TL4A 1HYSB 3H90A 2D3OR 2HLTA 1VJQA 1W25A 2LMIA 1S9GA 1AW0A 3BQ2A 3VHQA 3PHTA 1JKHA 3FMBA 2AX0A 2GCFA 4ZJLA 2OEKA 4F67A 3CTRA 2OAUA 3PY8A 3GONA 1KONA 1LFPA 4JYAF 2DVIA 1VRQC 2B0GA 2F8EX 2G13A 2ZH3A 1R6YA 4PPZA 1WDTA 1KP6A 1N56A 3B54A 2LA6A 5ETRA 4G1QB 2AJ0A 2BJ3A 2L9WA 1GMUA 2H65B 1A9NB 1FRLA 2CQ0A 2P9CA 4ZN3A 2LECA 5E2QA 2FJXA 3Q23A 5HMXA 5GVQA 5HBMA 2IJFA 1REVB 4HT7A 2HQGA 5KFOA 1NBEB 3E51A 3KNGA 3QT5A 2YX7A 1SH0A 4X65F 4RNOA 3KUGA 1TL1B 2BXJA 2VQEF 3LP0B 4A46A 5I3UB 1DLOB 1VI7A 1MW7A 1IKYA 1ZYQA 3GMGA 1XR6A 3FVYA 1S6UA 1R27B 2R7RA 3O3LA 4EYIB 2R9LA 3AB4B 4DQPA 3PFOA 4QYZJ 3ZFVA 2DHHA 2PDAA 3AD9C 4PQUA 4OV6A 3MM8B 4U96A 4P2FA 2DB1A 2P6SA 1VHIA 3PKMA 3R97A 1RWPB 1SL1A 3RB6A 3CUNA 3DXSX 5E33A 3EZ5A 2CADA 2QJ3A 3IGVA 3RB4A 2IAJB 3GJQB 1S1UA 4C2MA 4WE1A 4ZVGA 5DLGA 4MAKA 4HHHA 4O3OA 3WDOA 1VQ9S 3Q8UA 1X4GA 4B3OA 4GC6A 4ES2A 4PWUA 3VALA 3L7UA 2MQOA 1PG5B 2XWYA 4KV8A 3MPWA 1DQ9A 1OYEA 1NSAA 1FVSA 4HHUA 4DL0C 1SC3B 3TVKA 2KG0A 5LMNF 1U26A 4BC7A 5ETQA 3IRXA 3CXCR 3AD8C 1RWKB 1WG5A 2M0GB 5I3QA 4ZLLA 1RTIB 3D1QA 4IDKA 4OX9J 4FP9A 4J91A 4WFZA 4PXDA 1ZPWX 5DQHA 3MEDB 3CJSA 1NAQA 4CO0A 2CQBA 1H38A 1R0AA 2Z2ZA 1S9EA 4KFBA 3LPEA 4YMEA 4ICLB 3CO0P 3SV3A 2CZVC 5IV3A 4O0NA 1HYSA 2GMHA 2FC9A 4CLWA 1RI7A 1PYTA 3F0NA 1N5VA 4AUKA 3IWNC 2YTCA 2KRRA 3E2EA 4ELTA 2ZEJA 1BC6A 4M5GA 1Q8IA 4KPCA 1EKRA 3D0HE 3S1TA 2V50A 4UOHA 1PIEA 2HIYA 1T9YA 4KHRA 4A8SA 4G1QA 5AT1B 3UWTA 5GMEA 1FT8A 2ZBRA 2GMJA 1JK9B 2JLGA 2JDJA 5KFPA 4FZVA 8AT1B 1OY9A 2XMJA 2GX8A 3PX0A 1UEKA 2X3GA 5DG7A 2GFFA 2YWWA 2Z57B 1IJEB 1H0HB 3M4XA 4WTOB 5KT2A 1WC1A 2PMWA 1O5JA 2HQDA 2MY8A 3A1YG 1REVA 3T1AA 4ZPTR 1BHNA 1S49A 1SKWA 1RKIA 3FRZA 2LEBA 3I5CA 4JI1F 3PJ9A 1KQSR 3NAHA 5M2RA 3UN5A 1TL1A 5C25B 2E9ZA 3RJMB 4M5IA 3LP0A 4BDPA 5I3UA 4RLEA 1DLOA 2GJFA 1QE1B 5ETLA 3IP0A 2VFTA 2OSRA 3TJ9A 4DR5J 4BBYA 4DR1J 4IRKA 2K3IA 1UZHA 3MM8A 5HJYA 1WOSA 2MQLA 3CJ8A 4JI2F 5J2PB 3QLHB 1RDRA 2KL8A 4XDDA 3TOQA 4DUTA 1CJTB 1KSPA 2NS1B 1D9FA 2IAJA 2FZGB 3JTPA 4USJC 4MK7A 2V34A 1WELA 3TARA 3T9ZA 4NL5A 2W24A 1UVKA 2DKOB 4PZVA 1YKWA 3WIUA 1F9FA 2SXLA 3TX8A 1NDCA 4X4SA 1YWXA 1L3SA 2VA3A 1ZH5A 1YSJA 2VPWB 2PT0A 3S7RA 2HEKA 4QWEA 1U1RA 5KFXA 4EMDA 3NNAA 4UZCA 1M1KT 2B8PA 2LQ8A 4OJGA 4Q2LA 2Z2YB 2DO4A 5BJRA 2IVYA 5F41A 5LJ3Y 1RTIA 1XN9A 5B0DA 1R8PA 5K9FA 4OX8A 2A3JA 4YFUA 1KNZA 3SSQA 1MN7A 1LW0B 1NNDA 1S48A 3MEDA 4GMKA 2YKAA 3KLVA 2EBGA 4RBUA 3CULA 1KOOA 2E5GA 1NHKL 1ELOA 1EHWA 3R5DA 3LUYA 4EI2A 4F8RA 4ICLA 2BR0A 1RYSA 1RAGB 3TAPA 5A2QY 2ASJA 3O6QA 3G8SA 3D2WA 3EDRB 4OHZA 2OO4A 4LRAA 1XNQJ 3SMZA 5L46A 4MKBA 3D5MA 4M5MA 3ADAC 1N6QB 5J2QB 3MAHA 1NH8A 2HVZA 4I56A 3HHLB 4DX6A 1S1WB 1ZZFA 3G96A 5L8RC 4LF5J 3LGNA 5KFJA 2FDNA 5ETPA 2VKZG 2G4BA 3QRQA 4N47A 3NGRA 3HMJG 1UVMA 4WU3A 1TAUA 2J0WA 1RBLA 3DOLB 1RWOB 5ETNA 2UXDJ 1HBUB 4FVCA 2G1HA 4M8LA 1RHUB 5ITHA 4ECRA 1UW9A 3HHLC 5B7WA 3FEZA 2UU9J 5CZVA 3HHNB 4B3TJ 4OZJA 4WFXA 2Z58B 3HHLD 1X5TA 2CPIA 5F8HA 2PA3A 2ROGA 2YVSA 1RT7B 1FCAA 5C25A 2CJXB 1CQNA 3M30B 1UW4A 4LQ9A 1F1BB 3BGFA 1HBNB 1QE1A 2A6MA 4J5OA 3TEHB 3I6PA 3AAWB 3MAAB 2OTLS 2VOOA 3PYGA 5CD4H 2XC9A 1OY6A 4ETZA 4CNYA 4PG8A 1N36J 2R2RA 3HI9A 1RT2B 1FKAF 4GVBB 2IMWP 5J2PA 4BWMA 3QLHA 2QMWA 3E3XA 3CJRA 1CJTA 3PW0A 3SZ2A 4FYDA 2WB1D 4RUAA 2WSCC 4FPRA 3R6LB 2GHVC 1IBLF 4NZ7A 3ZZZA 2KHDA 1TK8A 4X66F 2M70A 3KHGA 1DTTB 3OD2A 2O67A 3K57A 1ACMB 4K4XA 4LF7J 4NPOA 1NK9A 1FNMA 4I6YA 1FDNA 1UFWA 4LRCA 4EZ6A 2CPDA 1WF0A 3CJ4A 3RB0A 3KKFA 1YJWS 3HVTB 4OX9F 4JI4J 1VQLS 4CT9A 2LLZA 3M8QB 5DZ6A 1WUUA 1VC5A 3CSKA 2PE8A 1V9OA 4EBDA 1Q8LA 1LW0A 4C0OC 2CIMA 3IM9A 1RGVA 1B70B 2VPYB 5C24B 4Q7AA 3D9BA 4Y2KA 3MM7B 2MSTA 2CG4A 2AGQA 3G71S 1RTJB 1HR0J 2Q79A 2PI5A 4P6QA 4U7CA 4U8YA 3D7SB 3OT9A 4WP9A 2AU0A 2UUWA 4UOGA 3HD2A 4ZVSB 2AJQA 3NNHA 1V3ZA 2ZDPA 1YJRA 1N6QA 1YVFA 5J2QA 1TR0A 1VHFA 2DCUB 3HHLA 2OMLA 3MD1A 2VG6B 2JC1A 1S1WA 2MB0B 4AYBD 1U1NA 3FQKA 5CHCB 4NLYA 5F8MA 3TQ1A 1WEXA 2AHOB 3KLEB 2CFXA 1FE4A 3D3BJ 1FEHA 3K2YA 1VQ7S 1Y11A 2B9XA 2JC0A 4YDDB 2POKA 3TAMB 2Y3YA 3I5BA 1TFWA 4JI8J 4ANCA 3DOLA 3N5FA 3GV7B 1HBUA 2ATCB 4NMLA 4USKA 4KRWA 2KHCA 2Y0BB 5DDOC 4MMOA 5L1LA 3PYEA 5LSLA 3VAIA 2DNHA 5A8WB 2HLUA 3DOMB 4PWDB 2MQPA 5G0RB 4YUDA 4YB5A 1RT7A 2F8MA 5CH7B 2CQHA 3GIJA 3M30A 3OXGA 4LBPA 1HWKA 4USHA 3BS9A 1JNZB 4DR5F 2ZZMA 1HBNA 3GCXP 1AXQA 2F63A 2UUCJ 3KWMA 4ZCKA 3MAAA 3OV7A 1TAQA 4TU8A 4ZPCA 8RUCA 3ZZ0A 2R8KA 5LM7E 2CQ1A 1ZAWA 4N41A 5DGAA 1RT2A 4P71A 2G0IA 4GVBA 3KK2B 2QO3A 1C4CA 3UPFA 4FS1A 2OI2A 1L5UA 2EKYA 3V2UC 4EZ9A 2DJWA 3OHAA 2NUUG 4IOAQ 3QNWB 3BQ0A 2EFGA 2DXFA 2BQ3A 1HI1A 1DTTA 3BB5A 3DLBA 2E1AA 2M3DA 2ILYA 4X2BA 2O3DA 2VH7A 1KDNA 3CD5A 2QMXA 3W1YC 2XYPB 2AWZA 3PHEA 1HD0A 1X60A 5DDQC 1X5OA 4HL9A 1BQMB 3M8QA 1Q7YT 1Q79A 3OBIA 3M2UB 2HVDA 2CQ3A 1FXDA 2ZKUA 5EHHA 1HW8A 5THWA 5JVGQ 4CP5A 1FD2A 2VQFF 2VF3A 2GMLA 1VOMA 5C24A 1SKUB 3IAS9 5ETMA 3OR1B 2V4JB 3MM7A 3FGVA 4P10A 3GJSB 1RTJA 1XNQF 3V6KA 2VB6A 2M2BA 1MSWD 1WC0A 4ECSA 4RL1A 3HM9A 4Q0BB 2DR7A 2OUGA 5LXYA 3F41A 2P5VA 1RAOA 3IBFB 5DZ7A 2IIHA 2ZHAA 2K1RB 1TKTB 2DEIA 1L3VA 2VG6A 1WEZA 2E5IA 3HDSA 1C0TB 1H2VZ 3NXZA 3ONQA 1VQ4S 3KLEA 1N32F 1S57A 4ID8A 4CQ1A 2QX0A 2XCAA 3TAMA 4KGMA 2KJWA 5HK4A 2XTJP 2CQCA 3CCTA 2AV5A 1T0TV 2BOAA 4RKUC 4NEZA 2UU9F 1MU2B 2GGPB 4B3TF 2W8LA 2KB2A 3CMQA 3TR5A 1IBCB 2GIRA 1RT5B 2ZOFA 1WF2A 5A8WA 3MPDA 2GO9A 3DOMA 4PWDA 4OHYA 4RU2A 4DR3J 4JI3J 5G0RA 3IR5B 5A6PA 2GS8A 1TMMA 1EB0A 2YXLA 1UMJA 4NXMF 2MQQA 4DR6J 1N36F 4OYIA 2OPPB 2KRBA 2HYIB 2W2QP 2UV8G 3K5LA 3CD6S 3PNIA 1WOOA 4MFBB 4R8UB 1GX5A 1NPPA 2R7WA 2PMHA 1F5CA 4PG4A 2Z2MA 3KK2A 1WHVA 3A8JA 3KFWX 4Y2CA 5H9EJ 2IVFB 1UA1A 3O5TB 2IA0A 3OSPA 1D8YA 1LFWA 2R7SA 3IC1A 5EWFA 2DBBA 2RQKA 2WOMA 5L38A 1I51B 2I2YA 2YQ0A 1KQFB 3TNVA 3CC2S 4FS2A 4G3IA 1PYOB 1Q95G 4B3SJ 1FF2A 2AP6A 3ZZYA 1MN9A 3S6EA 4JI4F 4NZ6A 4F36A 1FXRA 4OIXA 3TVYA 1N5QA 3J7A1 1DQ8A 2HQCA 1U2CA 1BQMA 4WIIA 4DBQA 2V4QA 5K8OA 1V5VA 4ZVQB 3M2UA 1CJUB 1U6FA 2BE7D 4CLZA 5I3PA 4LSZB 2BQRA 1HR0F 1M5SA 2V8DA 4L75A 2XSJB 3OR1A 2V4JA 5E3RA 1HA1A 4ED1A 1VQ5S 3NP5A 2CYYA 2RH3A 4PAAA 2YBVA 5H9FK 3BSAA 1JWWA 4Q0BA 2JVOA 1Y7PA 3H42A 2K2PA 2KVIA 1RT1B 4WYLA 2YX1A 3UI3A 3AJ1A 4NASA 3SQOP 2MJUA 1IBKJ 3A13A 2IRUA 1HHQA 4N8OA 2LXFA 2K1RA 1TKTA 3UW1A 1QAYA 1FO1A 5D4LA 4ZDNA 1Q5YA 4MIAA 4MIWA 2JZ5A 2J6SA 3B8HA 1C0TA 2XMWA 3D67A 4JI8F 1X9MA 3TANA 4DXLA 2H5IB 2W4PA 3U1LA 1NHUA 3V6JA 1VFJA 2MXYA 3EGWB 1ZTTA 2CWKA 1F3VA 5DRKA 1MU2A 2GGPA 4CLLA 1OQ3A 4KR0B 2CNKB 1H98A 3D4JA 4OI1A 2A6OA 2PI4A 5HROB 4ZPAA 4FF2A 1Z4UA 4ZP8A 2ADCA 4KGKA 3HPOA 5A8KB 3HZEA 3CF5Q 1AZSB 1RT5A 3QSIA 2RNEA 1IKWB 2NXEA 3MOZA 3MTJA 4QPTA 2PEBA 2QG9B 1RYRA 1CULB 3I56S 3MAQA 2UUCF 2BKNA 4FYXB 2E1CA 4HLBA 1TFYA 4LIWA 2ROPA 2MPUA 2HIQA 4CLUA 2OPPA 2XZTB 4DDFA 4FXVA 2YPZA 2YWKA 1MWYA 3UFCX 1R89A 1EJ7L 3QRRA 4MFBA 2DHGA 2LXIA 4R8UA 4A8MP 1FXLA 2HNDB 3R3TA 5BYSA 3H2UB 3R1LA 1JJ2R 4JV0A 1KVJA 2XBPA 1TZ0A 1RAJA 3M32B 1U09A 1MNEA 1IJFB 4RX6A 3ENQA 1U0HB 3FQLA 4WTYA 4B9MA 2OP5A 1S0OA 4ED3A 2A0FB 1VRUB 3P6YC 1OWXA 1D9AA 3RGIA 1RWWB 2NXJA 1TUWA 1TTHB 3NWRA 5HMWA 2BDPA 1RA7A 3MHYA 4USIA 3PTWA 4IQMA 2ZE2B 4QIVA 2HBYB 3I5AA 2I38A 2JVRA 2RJZA 4DV2J 2DRAA 1GXLA 4ZPDA 2D3ZA 3ZXWA 5HL7Q 3MGJA 1S10A 2VL1A 5AXMA 5RUBA 2UUBF 3J81j 3RR7A 3T5JA 2XSJA 2BMBA 3AB2B 1VBXA 5E3AA 5KG2A 1ZM2A 2DGQA 1HARA 4PQAA 4J9RA 3UCGA 2HHTA 1CLFA 2X51A 4JUZA 4OQJA 2ZH9A 3GYNA 2PN6A 3AY0A 3R2CJ 2DNOA 1RT1A 3NCPA 2CZ4A 2W9CB 3OTCA 1VC0A 1VIXA 3CJ0A 4YN3B 4JV1A 4KH1B 1HWUA 3CCRS 2PFDA 3NS5A 1FDDA 2JOQA 4O44B 4G1IA 3C16B 1E6VB 5SUHA 4RNNA 5D4OA 3SDEB 3MPYA 1HNWJ 3HCXA 6FD1A 4DQSA 2R8HA 5L39A 2VBZA 2QYGA 4KT0C 2MDAA 4TKTA 4NWBA 1SUQB 2FY1A 1X8DA 1JLEB 3RAMA 5HROA 4DR3F 4ZVTB 3QFWA 5BR8J 3GSDA 5A8KA 1AZSA 4Y2AA 3TWZA 3VAMA 3C14B 2WB4A 1IKWA 3N5BA 2C2ZB 2FD2A 1N52B 2VFVA 1CULA 1YJ7A 3NGTA 3CD0A 3OVAA 4QJVA 1XIQA 2AJ2A 1JIHA 5CAAA 1EETB 3JQKA 2MZJA 3BKUA 3UVJB 3KLHB 3LW5C 5HANA 3VAFA 1REGX 3Q8RB 2RU9A 3CCES 4H4MB 2FZCB 1Y3KA 3MZIA 4ZJQA 5I4MA 1HD1A 3IXQA 5DO2A 4A8QA 1MWQA 1RAIB 5D4NA 5CA5A 1SCJB 2HHSA 2BQUA 1K47A 3PW5A 4WBFA 5D0EA 4GRSA 4EK2A 3EDQB 5KFZA 4RUBA 2NXUA 2HNDA 5F8IA 5KFTA 3DLGB 2HGNA 1VC6A 3MEGB 3NLCA 3M8YA 3M32A 1KWMA 2RF2B 4LIRA 2WSEC 5J2NB 4OZ5A 1U0HA 4MK9A 2VU5A 2G1DA 5C7PA 1VQKS 1SXLA 4AL6A 1VRUA 4DPXA 1NJXA 2EC0A 2KT5A 1IQZA 4DSLA 2BX6A 3W3SA 1S1VB 2NSCA 3DXBA 3IWLA 2ASYA 3L4BC 1F5BA 4ZCLA 1S0VA 4CO5A 2VA2A 2B56A 2XLKA 2M8DB 1TP7A 4BC9A 2HHPA 3LPYA 4ZN1A 3HD1A 1SH2A 4ZHRB 4GKJJ 4DV3J 2ZE2A 3EVOA 3CIMA 1JXVA 1KHVA 1RT6B 1WC3A 3Q86A 1VIOA 2IJNA 2VDHA 1Y10A 1YJVA 1U4BA 2C3MA 2GA7A 3H2LA 3OW2R 2QA1A 2R8JA 4C8ZA 1JXEA 4FF4A 1FWKA 2HZCA 2Q3PA 3W63A 5FIIA 5IWAJ 1BMQB 4EBCA 1RAHB 4F4YA 1IBKF
chains in the Genus database with same CATH topology
4QR1A 3J7YU 1SL1A 3M1VB 3CCSS 1YTYA 4ED7A 1U6BA 2JLEA 4NLRA 3PKYA 3RB6A 2BJEA 3DXSX 3MI7X 3U02A 3CUNA 4F2RA 1FKPA 1U47A 5E33A 3H59A 2OTJS 3PO5A 2RILA 4H4OA 4RNHA 4YB7A 4WYWA 1WHYA 4DPOA 4ES1A 1I1GA 3IGVA 2IAJB 2W9CA 2ZFHA 3RB4A 3EXYA 1S1UA 1HWLA 2M5YA 1KQKA 1XK8A 2IVMA 2XMUA 4C2MA 2GQ2A 1UETA 2CRLA 3CDWA 3K8VA 2BA9A 4WE1A 2HS3A 4PXEA 3K5PA 4ZVGA 3A8EA 5DLGA 4MAKA 4O3OA 3WDOA 4QIEA 1MROA 1VQ9S 3V6DA 1RWUA 4LQ3A 1P1LA 3GYXB 4OHWA 1HBMA 1VQYA 3GIKA 4L72B 1X4GA 4B3OA 4GC6A 4ES2A 4PWUA 3VQSA 1U2RA 2WONB 2C2RA 4O44A 3ZZTA 3Q8QB 3VALA 2MQOA 1E6VA 5J1EB 4ECXA 2ZD1B 1SV5B 2XWYA 2XSFA 4KV8A 3ENVA 3MPWA 3SDEA 5CCMA 1DQ9A 2GIQA 2X1GA 4HDGA 3UQSA 4YQWA 4DQIA 3MM6B 2QZ8A 3OQ2A 1FVSA 4PUOB 1GT8A 4DL0C 3TVKA 2D3UA 2R8GA 2R2UA 1X5SA 2CKWA 4JBCA 1U26A 2KG0A 5LMNF 1C0UA 1MMLA 2DNKA 1HHSA 1I94F 5HMYA 4ZVEA 2BV3A 2NSBA 5D77A 3TUIC 1VRTA 4BC7A 3RYLA 4NOHA 3I55S 2FHJA 3CCLS 1ZBTA 2CPXA 2FGCA 3IRXA 1SUQA 3S8SA 3CXCR 5FDLA 1JLEA 3QZ8A 1FTCA 5LT5A 3X3UA 1URNA 5A0YB 1WG5A 4QWCA 2M0GB 5I3QA 4C8LA 4NLXA 1TKZA 4DS5A 1R31A 3ICLA 1Q7LB 5AE2A 1RTIB 4NLGA 1FRJA 2D9OA 3D1QA 1BY9A 4IDKA 1UKUA 4DG1B 4FP9A 3ISNC 2D7SA 4WFZA 3OVSA 2YKMB 2HMIA 2RMLA 1ZPWX 4PXDA 5DQHA 5GAHU 3NMAA 2NPIA 3IBWA 1RISA 1LWEB 3MEDB 1LQ9A 2F1FA 4QU7A 2YNFA 1NAQA 4DFJA 2FVQA 2IM1A 3JTOA 4F4KA 4CO0A 3ISND 3B78A 2PGCA 3MUVP 3KLFA 2ZBCA 1SC6A 4Y65A 5DJBA 3M2VB 2CQBA 3ITHA 1S6OA 5K8NA 1J5EF 1CPZA 4NLPA 5CZXA 1EETA 1H38A 1R0AA 3DMJB 1S9EA 4KFBA 3KLHA 2MKCA 3PW4A 4C4WA 5SZTA 3WX4A 3CIZA 3OFGA 1XMBA 4OHXA 4YMEA 4ICLB 2HS0A 2VZ9A 1FA0A 2CZVC 4IO1A 4DV5F 3MEKA 3SV3A 1WHXA 4B17A 1HYSA 1Q78A 2JRSA 3GB0A 2A18A 4K4YA 1H7XA 2GMHA 4DL6A 2VPZB 3LF0A 1P1TA 2FC9A 1KN6A 1R8AA 4O4GB 3AA8A 1HI8A 1X4AA 1U1QA 2OFGX 2OMOA 1RI7A 2OFHX 4C11A 1N5VA 4AUKA 1N5SA 3IWNC 2C42A 2YTCA 1X5PA 2KRRA 2AJ1A 3KYLA 1Y00A 1UVJA 2DH7A 4QYRA 2FHOB