2ZE2B

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
428
structure length
416
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 104
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B03
1WNEA 1NHVA 2IM3A 2EC0A 1IKWA 3PW4A 1IKVA 3UR0A 3H5YA 4ECSA 3CJ4A 4TYAA 4MIAA 3LP1B 4TY8A 1SUQB 1N5YA 1SH0A 4DL6A 2IBKA 4ZHRA 4IKAA 3KHRA 2YNHA 2GIQA 2E9RX 5F9LA 4WXOA 4DEZA 1KHVA 3N6LA 2R8IA 3KLHA 2FVCA 2HAIA 4I2QB 4J9OA 4MKAA 3H5UA 2JC0A 2FJVA 3BGRB 5DQIA 2UUWA 5KFGA 1SV5B 3DRSA 3TVKA 4KKOB 2W8LA 2BE2B 2D41A 3BQ0A 3BSCA 2YKNA 2FVSA 3MFIA 4IOBA 4RNFA 3G6XA 3DLKB 1C1CB 1SH2A 1CSJA 3DOLB 3Q8RB 3CVKA 2XWYA 4NLVA 2XGPA 3PR5B 4MH8A 3ICLA 3MECB 1JLQA 1QAIA 3PJXA 4KHRA 3HVTB 4U6PA 3PW0A 5I42B 5F8MA 2BE2A 4F4WA 5DG8A 4ZPAA 1JX4A 4IFVB 2IA6A 5C24A 4J9RA 1RTHB 4RW6A 3DLKA 1C1CA 1JLAB 1TKZB 2ILZA 5F8GA 1FK9A 4TQSA 4F4ZA 1TKXB 3DOKB 5C25A 1UWBB 5CYMB 4PQUB 4Q0BB 5HLFB 4NLGA 3T5JA 5I42A 3DLEB 5HBMB 3EPGA 3OL7A 5KFZA 3C6TA 1S10A 5KFEA 1BQMB 3M9OB 3MEEB 3BSOA 1JLAA 5F8NA 4TQRA 5KFTA 2XCAA 1RT5B 3DOKA 1UWBA 5CYMA 2OPQB 4Q0BA 2IM0A 1HNIA 3T5HA 3DLEA 3T1AA 3JSMA 4NLSA 3MR6A 3QIDA 4NRUA 3M8PA 4ED3A 1MU2B 2W8KA 4TYBA 1HMVA 4KFBB 4XPEA 4H4MB 1RT3B 3MEEA 1S1UB 5K14A 4ECQA 1TP7A 3OSPA 1TQLA 1JXLA 1C0TB 1BQNA 3IRXA 2ATLA 1TV6A 3CJ2A 5KFJA 3FQKA 2JEFA 2OPQA 4Q8EA 4KO0B 3MR2A 4MK7A 2ZE2B 5KT6A 5DGBA 1TKTB 4ZP9A 1LWCA 2IAJA 4I2PB 4KFBA 3KK3B 1RT3A 1QE1A 3LALA 1S9GA 1C0UA 3KLGA 2W9CA 1DLOB 4RW7B 3M8QB 1N6QB 3H4BA 2C2DA 5KT7A 4IRKA 4OL8A 3DRRA 2YKMB 4ZVGA 2FLPA 1J5OB 4FBUA 1W25A 3KK2A 3JYTB 1RT1B 2ZE2A 3KLEB 5JUMA 3NBPB 3VQSA 2QE5A 1S1XB 3PW5A 3RB4A 1HQUA 3E01B 2HNZB 3KK3A 3CWJA 1VRUB 5T14A 4IG0B 2YNFB 1S9EA 3IS9B 3M8QA 5HP1A 5L1LA 4QW8A 2F8EX 2UVWA 2D3ZA 2RDIA 2IJNA 4KBIA 2YKMA 2VG6A 2V0NA 1J5OA 1XR5A 4MK9A 3JYTA 3MEDA 2B6AA 3KLFB 4QWEA 3DLGA 1K1SA 3NBPA 1OS5A 2HNYB 2HNZA 3KLIA 4PUOA 3D28A 4H54A 1JLGB 4WE1A 2XGQA 4G1QA 3BJYA 4O4RA 5DLFA 2YNFA 3QLHB 4IG3A 3H5XA 3MTKA 4NRTA 5DGAA 3MEGA 1RYRA 3LAKA 1S6PA 4YMEA 4JV2A 5HROA 2J6UA 3OHAA 1S9FA 1D1UA 1RTIB 2ZD1B 2RKIA 4YR3A 5CYQB 5FDLB 2JEIA 4NZ0A 4FBTA 3QLHA 1S4FA 1JKHA 4ZVFA 3FFIA 5KG2A 3RBDA 1R0AA 5KT3A 3OL9A 2BR0A 4KAIA 2JEGA 4PWDA 1VRTA 2V4RA 2WB4A 1IKWB 2C28A 1IKVB 2W7PA 2UVRA 3M9MB 3TAMA 4J9QA 3V6JA 1EP4B 3G6YA 3MR5A 4NLUA 1S6QA 1S0OA 4O4GA 4ZHRB 4K4SA 1MMLA 2YNHB 4URGA 3PZPA 3FSIA 1HQEA 2WRMA 1TL1B 2WCXA 3KLHB 4RW4A 1NNDA 1S97A 1S0MA 3I0SA 4IDKA 1EP4A 1JLFA 3QO9A 2FLLA 3M9NB 2IM2A 3BQ2A 1S1VA 4B3OA 3KMSA 3DRSB 3H40A 3T19A 2ILYA 5KG3A 3QZ7A 2BQUA 4EO8A 4Q43A 2AU0A 2YKNB 3Q8QB 3EZUA 1TL1A 4M94A 1C2PA 3PVXA 4U7CA 2OPSA 3KK1A 2JLEA 4J9NA 3QYYA 1JLQB 3HVAA 1XR7A 3V6DA 3D5MA 4TXSA 2W9BA 1N48A 4IRCA 3DI6B 3QGHA 3LP0B 3KJVA 2HNDA 5C24B 3N6NA 1JLBB 4DL5A 1JLEA 4RW6B 2ASDA 5I3UA 4WFYA 2AGOA 1TL3A 5KFQA 5KFNA 3C6UA 4HKQA 4RNMA 1HPZB 3H59A 1FK9B 5KFXA 4ECVA 5KFWA 5C25B 3H2LA 3NMAA 4J9SA 4RZRA 1S1TB 2IC3A 1FKPB 3DI6A 2I5JA 3LP0A 4EYIB 4ICLB 1HYSA 5KG4A 4Q45A 4RUCA 4EBCA 1JLBA 4KV8A 4ECTA 2D7SA 3C6TB 4ECRA 4MFBB 3DYAA 2AX1A 4ZVEA 4YQWA 3GV5B 1HPZA 5DG9A 3KOAA 1T03B 4WFZA 4ID5A 3IGNA 4ZPCA 4YR2A 3SI8A 4ZMMA 3CIZA 2FVPA 1HNIB 4O44A 1S1TA 3JSMB 1FKPA 3ISND 4K4WA 3PW2A 2FVQA 4O3OA 4WYWA 4ICLA 3M8PB 2O5DA 5F9NA 4F50A 1HMVB 4I7FA 4MFBA 1XR6A 3NGDA 2QV6A 5K14B 1IM4A 4MK8A 4EO6A 2VA3A 5KG7A 1T03A 3PHEA 1BQNB 3IRXB 4ZVHA 1TV6B 2DPJA 4K4ZA 4RU9A 4Q8FA 5J2QB 2BRLA 1RDRA 2AGPA 1RA7A 4FS1A 1HNVA 3H5SA 2R2UA 2OH2A 2R8GA 1REVA 1LWCB 2IAJB 1T05A 5KFKA 4KB7A 5EWFA 1QE1B 1LW0B 1C0UB 1RT2B 1S9GB 3KLGB 2I1RA 2WK4A 3FDSA 4QWBA 4QPXA 4Y3CA 2W9CB 5L1JA 4ECYA 4WZMA 3DRRB 5J2QA 3PJWA 5KFRA 4KE5A 5L1IA 4J9LA 2E9ZA 3KK2B 3ISNC 2YNIA 3SFGA 1I6JA 4K50A 1HQUB 3GIIA 2UUTA 2J6TA 1LW0A 1RT2A 3MF5A 4F4YA 1S9EB 2AQ4A 2WONA 5HP1B 3CJ0A 4LQ9A 5DQGA 2OPPB 1LWEA 2VG6B 4IRDA 3DDKA 2C2EA 4GC7A 3MEDB 2B6AB 4MKBA 1DTTA 3DLGB 4WXWA 2R8KA 5KFFA 4G3IA 1IKYA 1LW2A 3KLIB 4PUOB 3BSAA 4WE1B 4URQU 4G1QB 5F8HA 4RW8A 4R8UA 3PR4A 4IG3B 5KFIA 3GIJA 2ASJA 2OPPA 3I5CA 4Q44A 4LSLA 4QW9A 3MEGB 4DL4A 1S6PB 2WOMB 5KFOA 4Y34A 5HROB 5J2PA 4XPCA 3V81B 2V4QA 3T5LA 3H4DA 4RUAA 2RKIB 4O3NA 2R8JA 1HARA 2CJQA 5KG0A 1JKHB 3FFIB 1R0AB 4QWAA 2D3UA 5J2NB 3BSNA 4PWDB 1VRTB 2WOMA 3UDLA 4O3PA 2HMIA 4EYHB 2VG5A 3FRZA 1S0NA 3V81A 2W7OA 3TAMB 4TLRA 5KFYA 2ASLA 5EUHA 3LP2B 4K4TA 1S6QB 3DMJB 4NLOA 2RF2B 4NLXA 4O4GB 3QGIA 3ITHA 3EPIA 4K4XA 3I5AA 2C2RA 2WTFA 4J9PA 5KG6A 3BREA 3SFUA 4JV1A 1HQEB 5J2NA 3HHKA 1LWFA 4K4YA 3DM2A 3OLAA 4O3RA 4XO0A 4RW4B 1RTDB 2FJXA 3I0SB 4IDKB 2HWIA 1JLFB 4ED0A 3QIPB 3QO9B 4ECZA 2BRKA 2HWHA 4YR0A 3LP2A 3DMJA 3Q8SB 2R8HA 2RF2A 1S1VB 3LANA 5C42B 4B3OB 5J2MB 3CDUA 3GV7B 1RAJA 3RB6A 1FKOA 4HYKA 1EETA 4NLPA 4IQXA 2XCPA 5C5JA 1KLMB 5KFMA 4DG1A 2FLNA 2UVUA 4ECUA 1RTDA 2OPSB 4EBEA 3QIPA 3KK1B 1N4LA 4WYLA 5KG1A 4J9KA 1QUVA 3RBEA 5C42A 1D0EA 3V6DB 3GIKA 3GILA 5J2MA 4R5PA 3CO9A 4RNHA 2W9BB 4NLQA 2FJWA 5KFPA 3KJVB 1YVFA 1KLMA 1RT7A 2HNDB 4NCGA 4ED2A 1JLEB 5I3UB 4RNNA 1TL3B 2B43A 1QAJA 4JV0A 3C6UB 2DPIA 2BANA 2GC8A 4R0EA 4ZPDA 3I0RA 2IC3B 1ZTTA 3HKWA 2I5JB 2ALZA 1ZETA 4KHMA 1HYSB 4KV8B 3V6HA 4RNOA 3UQSA 3DYAB 3QGGA 3V4IB 3CJ5A 4DL3A 2IJFA 2FVRA 4ED7A 3OL6A 4ID5B 1ZTWA 2AX0A 4TN2A 1KHWA 1RT6B 4O44B 2XC9A 3KHGA 3NL0A 4GC6A 3KHLA 2R2RA 3G6VA 4K4UA 4ZPBA 3GV8B 4I7FB 5EDWA 3LP1A 1SUQA 3V4IA 4O3SA 5F8IA 3T5KA 5KFCA 4DL2A 4LSNB 1RT6A 3MFHA 3KHHA 4FS2A 1HNVB 3OSNA 2B5JB 4I2QA 1REVB 5L9XA 4ECWA 1T05B 2E9TA 1Z4UA 1T3NA 3BGRA 1SV5A 4KKOA 2IMWP 1RYSA 4LSNA 3GYNA 4IH7A 3OLBA 4O3QA 2YNIB 5L1KA 2B5JA 4DL7A 3DOLA 4Y2AA 3MECA 4KSEB 3MR3A 5EWEA 2ZKUA 3HVTA 2WONB 4NLTA 5DG7A 4IFYB 4ED8A 3FQLA 4IFVA 1LWEB 3CDWA 2BQ3A 1JIHA 1RTHA 1DTTB 1T94A 4NLYA 1TKZA 3I5BA 3KNAA 1IKYB 1LW2B 3GQCA 4X2BA 1TKXA 3IG1B 2OPRB 3N6MA 4RW8B 1C1BB 4PQUA 4R8UB 5HLFA 3CDEA 4IFYA 1IKXB 4M95A 1RT4B 4LSLB 5HBMA 4ZP6A 4NLRA 4F4XA 4EBDA 4EEYA 2J6SA 5J2PB 5KT2A 1BQMA 3NAHA 2C22A 3NKYA 3OL8A 5F8LA 1RT5A 3IG1A 2OPRA 2V9WA 4H4OB 4IR9A 1C1BA 2VG7B 2YNGB 4WZQA 1IKXA 2XI3A 1RT4A 2RDJA 4IH5A 3RB3A 5J1EB 1MU2A 1S48A 2XI2A 2HMIB 2VG5B 3RB0A 1N56A 4H4MA 1S1UA 4K4VA 4ECXA 1C0TA 1SH3A 3NAIA 5D3GB 4H4OA 3IN5A 3ITHB 5EWGA 3BQ1A 5DQHA 2UVVA 2VG7A 4KO0A 4NLDA 3RAXA 5KG5A 2YNGA 1U09A 5KFLA 4QWCA 1TVRB 2W9AA 2AGQA 5KFSA 1TKTA 1LWFB 3DM2B 5J1EA 4RW9B 3G86A 3DRPB 4I2PA 3E51A 3RAQA 1RTJB 1DLOA 1JLCB 4RW7A 1N6QA 5D3GA 4ED6A 3LAMA 3PW7A 2CKWA 5KFBA 2R2SA 3H98A 5KT5A 4IH6A 1FKOB 1K1QA 1EETB 4YP3A 1TVRA 1RT1A 4WFXA 3KLEA 1NHUA 4ZP8A 5KFVA 4DG1B 4RW9A 1S1XA 3DRPA 3E01A 4LQ3A 4JUZA 1VRUA 4ED1A 4URSA 4IG0A 1GX5A 1RTJA 5KFHA 1JLCA 3IS9A 5JXSA 2JEJA 4R5PB 2VA2A 3KMQA 1GX6A 1RA6A 2GIRA 3KLFA 1RT7B 4NCGB 2HNYA 5DLGA 4IR1A 3OHBA 1DTQB 3IGVA 2JC1A 4MIBA 1JLGA 5F8JA 2BANB 1S49A 1S1WB 4Y2CA 3QZ8A 3TQ1A 4J9MA 3I0RB 2AWZA 5KFUA 2WHOA 3BR9A 5KFAA 3CJ3A 4NLWA 4TY9A 4ZP7A 3Q8PB 5KT4A 3KLVA 5KFDA 2IM1A 1RTIA 3HVWA 4TY8B 4QWDA 3V6KA 2ZD1A 1N5YB 1DTQA 5CYQA 5FDLA 2BQRA 3GIMA 1S1WA 4NYZA 3UPFA 2R2TA
chains in the Genus database with same CATH superfamily
3PW4A 4ZLPA 4ALZA 4U7UK 2G4BA 1KLNA 5A8RA 2Z2MA 4OI6A 4ELUA 1AFIA 1RWNB 1OQ3A 1UL3A 4X66F 4DR3J 3UDCA 2QA2A 5KFGA 1SV5B 3MTJA 3HPOA 5IM0B 4PEOA 5ETPA 1RHJB 2VZ9A 2V8VA 1NSAA 2MQPA 4X62F 3ISZA 1NDLA 1VK3A 3FMBA 2ZH5A 3MUTP 1KFDA 3W5XA 5HMYA 3MM7B 5CCLA 1CQMA 2I38A 3GLJA 3CC2S 3M9OB 3WIUA 1RT5B 2M52A 1M90T 4DUYJ 2DKOB 1NB2A 3H8YA 5THWA 1H2TZ 2X51A 4DSFA 1TQLA 4FF2A 2HGNA 4X4RA 1OYDA 3LALA 3PO5A 1IJFB 2JL9A 2BA9A 4ZLJA 3M1VA 4MKYA 1X5OA 3BN7A 1S9EA 2Q43A 1S12A 2UVWA 2B9YA 1KONA 2IFXA 4QWEA 3NBPA 2HNYB 3CDAA 2UP1A 3QLHB 3LGNA 2DVIA 1QVFR 4A47A 2R7VA 2JNJA 2QYCA 3MAAA 5LL6d 2LA6A 2QL5B 3QFWA 3DGPA 2EXUA 1HW8A 1S4FA 1R0AA 3S7RA 2DBBA 1HI1A 1TL1B 4DHVA 2MKHA 3EGZA 2XMUA 3T19A 2ILYA 4PXCA 4EO8A 4DLEA 4Y00A 2ZH2A 3Q8QB 2R7WA 3PX4A 1Q78A 2KT5A 3O1LA 3HVAA 3D5MA 3LA0A 1JLBB 2E1MC 5KFQA 3C6UA 2UXDJ 3M6XA 2AX1A 2GVZA 3AOCA 1GTEA 4USJC 3CIZA 1VC5A 4ICLA 2HLTA 4F50A 4I1TA 2VA3A 4RBUA 5A6WA 1R8HA 1TV6B 2B4OA 4PPZA 4Q8FA 3VHQA 1Q1KA 2YQ0A 2X1FA 5H9EK 2R8GA 4U95A 4QPXA 1VJWA 4QCLA 4J9LA 2DITA 1I6JA 1VR6A 4DV2J 3SYZA 3H0PA 4Y65A 2AQ4A 2DH9A 1DRZA 3DDKA 2C2EA 3W8GA 2WSCC 1ZAWA 1TMMA 5KFOA 3V81B 3T5LA 4NPOA 1NXIA 2W2OP 1S77D 3FCVA 4QWAA 1HWUA 3AQOA 3FRZA 3HSZA 1WC1A 2PA3A 3PYFA 1WC5A 1HQEB 4AQYJ 3VWSA 1SBRA 4M5IA 3LP2A 1S1VB 4WCEQ 1EETA 5A8KB 1OYEA 3GIKA 4JI5J 2VBZA 1RT7A 1GFWB 4NCGA 1NPPA 1NH8A 2OI2A 5A2QY 5KOXA 4PG7A 3J80U 2IC3B 1H0HB 2E1RA 1HYSB 3SQGA 1RP5A 1PYOB 3OL6A 2A3JA 2YWEA 3UN3A 3RRKA 4DX6A 4ITSA 4Q7AA 3T5KA 2MQLA 4LF9J 4FP9A 4FS2A 2QL7B 4LJMA 1KEKA 2VFRA 1TR0A 4NXNF 4F2SA 2B9WA 4ZIVA 1BGXT 3FZ2A 1RLDA 2CUYA 3OFFA 4WK1A 3AJ2A 5B0AA 1S4EA 4JB8B 2CRLA 3RZAA 3LW5C 3DCAA 3C16B 1JIHA 2YTCA 1TKXA 2VC1A 3JSRA 3TZXA 3CDEA 1S76D 2DNOA 3KG0A 3H2VE 4I6WA 3U7JA 1QY7A 3R7SB 1B70B 3HHDA 3IR6B 4H4KC 3F73A 1X4FA 1JK9B 2CWKA 1OPIA 3K17A 3IM9A 4K4VA 1C0TA 3CD0A 3ITHB 2UVVA 1YJ7A 1HBMA 1RJJA 3UN5A 3RAQA 1N6QA 5DZ6A 1ZA1B 2R2SA 5KT5A 1K1QA 3OUYA 2VQEJ 5G4DA 1F6TA 4RKUC 2UXCJ 1NK6A 1TUWA 2VA2A 1VBXA 3I0RB 2WHOA 3BR9A 4C0OC 2W2PP 5L38A 2QN6B 4HTJA 4DZDA 3HVWA 5FDLA 2FC9A 3UPFA 4UTGA 3CJ4A 2HS0A 4DEZA 3CJQA 4XDDA 2AP6A 4FNHA 4RNFA 2HFZA 1VDHA 4CTAA 3PR5B 2VHGA 1VQ9S 3ENVA 5DG8A 1XEZA 3OV7A 1FD8A 2ZH1A 2CAJA 2J7WA 2DRDA 2L08A 4NLGA 3T5JA 3GMGA 4TQRA 5KFTA 2XCAA 3W7BA 5A8WB 3MR6A 5HANA 3EYZA 2XMVA 1B64A 5KFJA 2OPQA 3FSXA 5KT6A 3EJMA 4DF4A 1LWCA 1PIEA 2PFDA 4FF4A 1QUPA 4FBUA 3JYTB 2ZE2A 4GVBB 3E01B 3KK3A 1DARA 1VRUB 4DR3F 4PG8A 2D3ZA 3QAUA 3RR8A 3DLGA 3D28A 2XS2A 1RYRA 1CJUB 1WF2A 1S9FA 2WVFA 3PV8A 2UUAJ 4NZ0A 4FBTA 6FDRA 3ELHA 2VOOA 4YB1P 4RWWA 1YJNS 2WRMA 2XMMA 3FCWA 3FRYA 4B9NA 3KLHB 3QWPA 3R9LA 2CQPA 1Q53A 2AU0A 1O0PA 4WF9Q 3QYYA 3OVSA 2MLZA 5GAEI 3LP0B 2ASDA 1JLEA 1IR0A 4A8SA 1FK9B 2KFZA 3OXFA 3NMAA 2KO1A 4J7CA 4RZRA 3BR8A 3H2UB 2O67A 4HHUA 2XWXA 4KGZB 4ZPCA 1WG5A 3M8PB 4O0IA 1XR6A 2MQNA 1HWJA 3DHWC 3MM5B 3CSKA 2LCWA 4WJBA 4CO5A 4FS1A 1HNVA 3ZTRA 2HS3A 1PJ6A 2NPFA 2ZDPA 2CPZA 5DRKA 2HFSA 1D9DA 1WC4A 2WVDA 3JSYA 4NI2B 1QSSA 4IRDA 1GNKA 3N9UC 1WSVA 3UFCX 4JI2J 5CHCB 4ILMA 1IKYA 1VJQA 3I5CA 2OD4A 2XEXA 5HROB 1X60A 2GIFA 3LH2S 2PDAA 1KVJA 2CG4A 2E5LJ 1NK8A 2V68A 2W7OA 3AFGA 3QGIA 1ZBTA 3BREA 3HULA 1LWFA 2CJAA 5CXTA 1RTDB 1NK7A 4FPRA 2NUHA 8AT1B 3R1LA 3DMJA 1SC3B 4DG1A 5JVHQ 2UVUA 2MZTA 4ECUA 4YB6A 2GJIA 5C42A 4NEZA 3V6DB 3LTOA 1YVFA 1KLMA 3K0JA 3MPWA 4DV2F 1U2RA 2BJ8A 4UZBA 1T9XA 4G1PA 3W66A 3NNCA 2GMJA 2F3JA 2UV8A 1ZETA 1D9FA 2DISA 3KG4A 3V6HA 3IAS9 3G2XA 1XWLA 1KSPA 5FLXY 3NCPA 3KHLA 1SPBP 4WP8A 3W64A 4PABA 2H65B 4DL2A 2X1BA 2CYYA 4FKYA 4AL6A 1REVB 1SKSA 4EZ9A 3OLBA 3RYLA 3MECA 1R6VA 3SCIE 5HVFA 3SIPB 4QR0A 4AXIA 2HFUA 3I5BA 2DGUA 1IKXB 5IC4B 3Q83A 5BXIA 5F8LA 5H9EJ 2W01A 2DH8A 2P9GA 4IH5A 1VLYA 5F3TA 4CI0B 4H4MA 3P4UB 3B82A 2KRRA 4OJ3A 1SH3A 4EZ6A 1LFPA 2PA8D 1SL2A 2O3DA 5GMEA 3DRPB 4OJGA 2ZOMA 2QGFB 2B4PA 4RW7A 2DNYA 2CKWA 1AUDA 5LMNJ 4RW9A 4TLQA 3OXGA 2E7VA 2OEKA 1WEYA 2J76E 2D74B 3CULA 2AIRB 3QATA 4PXDA 1SKWA 4RR5A 4RBVA 4ZP7A 4DS4A 1SJRA 5K5MA 2DGTA 3UR0A 4YEAA 3V4MA 3FBCA 4MIAA 3ILIA 4FYYB 4B3SJ 1S6OA 3BH7B 4UUXA 2ZVSA 3D7SB 2W25A 3TJ8A 3ZZZA 2FVSA 3MFIA 3C15B 1HQ2A 3PW0A 5B09A 3GFXA 2PEBA 1TKZB 5C25A 1Q4RA 5HLFB 1OWXA 1U25A 4OIXA 2HVEA 2YWFA 3AH6A 1L3UA 3BSOA 5H9FJ 4NZ6A 1VC6A 4F3OA 4IOAQ 3T5HA 1SQFA 4NRUA 3PFEA 4ED3A 2ZJQQ 3K58A 1U8WA 1WJ9A 1S1UB 4MK7A 3K7RA 1TKTB 3R7NB 8RUCA 1HBOA 5D0HA 2LQJA 3OQ2A 1S9GA 2DTJA 2A2DA 1FEHA 4ZVGA 1W25A 4Q5VA 1B0TA 2RDIA 2YKMA 1J5OA 2VFSA 4ZS6A 2B7CB 5EGYA 4HR2A 2RU9A 4HI2A 2HNZA 2VV5A 3BBBA 3U1LA 1S6PA 5GADI 2C2NA 3CT9A 2I6WA 3VGUA 1HW9A 3VVTA 4GVLA 3V2UC 2V4RA 1IKWB 2LU1A 2AYBA 3TAMA 1RBOB 3BM7A 4RW4A 3OJUA 1VQKS 2IM2A 1WD6A 2J9DE 2OTLS 2RAQA 4PXBA 1HI0P 4OYBA 2MKSA 1CQNA 3M2UA 4JV5J 4JYAJ 5KFWA 3MMBB 3EGWB 4PYDA 3PNIA 3RRHA 4WFZA 2ZBRA 2NXUA 4DQIA 4RUHA 3PW2A 1WTFA 2V63A 3CO0P 1HMVB 3NGDA 1IM4A 4EO6A 2YWGA 2UUAF 5J2QB 4WTOB 5LJ5Y 2IAJB 3ET6B 2E5HA 3BO3A 1C0UB 1FJEB 2XZWA 4DQPA 2XHWA 2R7TA 1HWKA 2YNIA 3MM9A 3SFGA 2PI5A 4C11A 3BPSP 1UEVA 2B6AB 2PMZD 4X4QA 1AXQA 4G1QB 4RW8A 3PR4A 3FEZA 5C2CA 2LEAA 1FWKA 3TUPA 5J2PA 1VQOS 1Y00A 4U8VA 2BBEA 3LWLA 1F2GA 2GQQA 2COLA 3GG1A 4A48A 1HNZJ 3ZFVA 2ADBA 2VPZB 1X4EA 1XNRF 4B3TF 1H74A 1J5EF 1UPPA 3RGIA 2HQ3A 1W2BR 2NYHA 4ED0A 1NK5A 3HFZB 4PPDA 4ECZA 4IQXA 1GXUA 2P9EA 2MHNA 4DFMA 4LUBA 1YTYA 4GO7X 2HNDB 6AT1B 4V1Ak 2KJWA 4P2SA 3DLBA 4OI3A 1QSLA 1NJIT 3L7UA 3HHLA 3ZZYA 4NEYA 4C6AA 3D6MB 2VFVA 1BWEA 2JX2A 1RT6A 1U1NA 4QYZJ 2B5JB 1F5AA 4ECWA 2ZEJA 3QNWB 4PYAA 3AD7C 1VQSA 4AT1B 1EIYB 2PE8A 2ADCA 2F63A 3IBFB 2F4FA 1VI7A 3HX9A 2DXDA 3MHYA 4ZP6A 4EEYA 4M5MA 4KC5A 3OL8A 2KHDA 5AT1B 2FTRA 2RRBA 4F26A 3D6FB 4H4OA 2GFFA 4KO0A 3GTYX 3E8OA 3KJFB 2FUG9 2H5IB 5D77A 1U1MA 1TL7B 5M2PA 2RHSB 2KM8B 4ED1A 2YKQA 2KN4A 5HJXA 4LRFA 1RA6A 2Y1LB 3OHBA 3MGJA 1S1WB 3R5JB 5KFAA 3A4TA 3AQPA 2RQCA 2QTWA 1N5YB 3TW0A 2FJEB 1UEKA 2MSSA 2LA4A 1R89A 1YQHA 2KU7A 1GT8A 2CG8A 2GVDA 4X64J 1L3VA 2UUWA 3DRSA 1MG7A 3S8SA 3DOLB 1I51B 2XGPA 1WOPA 1JLQA 4U6PA 1N0UA 2BE2A 5C24A 1UJ6A 2QMUB 1FXRA 1M5KC 2BJ7A 4DQRA 1VGYA 1RAAB 1HNIA 1NMEB 1NDPA 4TYBA 3LO3A 3MEEA 4FKXA 1QE1A 1WKKA 3KLGA 4UQGA 1RADB 5KT7A 3RB4A 3CWJA 2BV3A 5T14A 1Y3KA 2V0NA 2DNRA 2Y8YA 1OS5A 4GKKF 3C14A 2YNFA 3VAGA 2CQBA 1U1QA 2GNKA 4YMEA 5CYQB 1M5HA 2JHEA 2MY8A 1EARA 2RJZA 1FFWB 2UVRA 4CO3A 3MR5A 4NA1A 2V69A 2WCXA 1FCAA 3QO9A 4USUA 2HS4A 3TEGA 2J8AA 1VC0A 5L9NA 1N48A 2ZC3A 3N6NA 3TJ9A 2HQDA 2CQ4A 1D8ZA 1HPZB 1SC1B 3H59A 3K2YA 1HWLA 3Q0AA 1ZAXA 1X4DA 3MM6B 1S1TB 3DI6A 3RBXA 5T7LA 4Q45A 3CF5Q 4KV8A 1HBNA 1SJ3P 3SI8A 4USMA 5HJYA 3DXSX 1UEUA 3O44A 3GFZA 2OKQA 4KYZA 1GH8A 4NA3A 4C48A 3R97A 3KWMA 3X3UA 3M6WA 3K8VA 2HVZA 4F4YA 3B78A 4WBFA 3TARA 2L9DA 3HM9A 2VG6B 3DFEA 1RWPB 3HSDA 4DCPB 4N56A 4BCAA 2KT3A 3UN2A 3I55S 2H1YA 1XNQF 3IM8A 1Q81T 1RGVA 1G2EA 4ENOA 3CIMA 2OJ3A 5EN1A 2HRUA 1GMVA 3FFIB 1N33J 2CWXA 4EYHB 3I4PA 1RHRB 2CZVC 3KG1A 4DR4F 4O4GB 2KVIA 2FY1A 4BC9A 1OPZA 2DNKA 2V2QA 2F7VA 1JLFB 1NSQA 4M1KA 4C8ZA 3N0VA 4B3OB 4DQQA 1Y7PA 4F4KA 1RHUB 5C5JA 5I3PA 2OPSB 3RBEA 3CO9A 1TFYA 4HHHA 4M5GA 4J5OA 3TP2A 2KM8C 5AJ3F 3L3CA 1DJ0A 4L73A 3NGSA 2W2QP 1CC8A 2I5JB 3A1YG 3M2RA 1IBLF 1KHWA 3A8KA 3NL0A 2L48A 2R7UA 4JI0F 4I4BA 1KFSA 4I7FB 4K5RA 2QMXA 1RABB 3KHHA 2Q6CA 3FC9A 3D3CJ 1RTZA 1T3NA 2LDYA 2DRBA 4Y2AA 5EWEA 3E3XA 4ED8A 4BWJA 1RTHA 2M4MA 3KNAA 4PQUA 3L95X 1QDUB 4IFYA 1KTQA 1AFJA 5HBMA 3G82A 1T8EA 1F2HA 2V9WA 2YNGB 1F3VA 4ZVRB 3GIRA 1LOUA 4JI8J 3RB0A 2YPYA 4QBUA 2LU2A 2BEFA 4DV0F 2M8HA 2RB7A 4DCOB 3PKMA 3BF4A 4DN0A 1GMWD 1DHMA 4DUZF 2HHTA 4DSIA 4QQBA 4I6AA 3QSIA 3CCZA 3PKYA 1UMJA 3C66A 2JC1A 1FE0A 1S49A 1VQLS 4DV1F 1MWYA 2AWZA 2ZVIA 1KOHA 1S6UA 1RTIA 4QWDA 2Q1LA 2BQRA 5IV3A 4P6QA 4NYZA 2VBYA 4HTIA 1ZA2B 1CJTB 4DPTA 4Z37A 4LRDA 2FGCA 1FRHA 1CJVA 4IKAA 3PIOQ 2C2OB 4B3RF 2RHQB 1K0TA 1X31C 3PEHA 3THTA 1CC7A 2HHVA 3PY8A 3FCHA 5BR8F 3M2VA 1HNXF 1WKLA 4KH1B 1QAIA 5I42B 1EJ7L 1C1CA 2A10A 2ILZA 1RU1A 3FVYA 5ETMA 4TQSA 4F4ZA 1KDNA 4P10A 1KQKA 4LFBJ 1CULB 2A1BA 1I94J 3D67A 1BXNA 2AJ2A 4CYUB 3IRXA 3P6YC 2JEFA 4DV5J 1FD2A 4XK8C 3NCQA 1JJ2R 4KFBA 4U7UD 3H4BA 4A8QA 4OL8A 3Q2TC 1FNXH 1S79A 4YS2A 4RX6A 2XMAA 3G8QA 4P2FA 4X64F 4ZVQB 3V5RA 3CC4S 1FVQA 3KLIA 4WE1A 3PO4A 2EK1A 1PC5A 3OR2A 1H72C 1YX2A 3QGPA 3MCNA 2QL9B 2JFKA 1WI8A 2EWHA 3A3OB 1SJFA 1PJ7A 3A8IA 1YDLA 1O51A 4ATNA 2M9KA 4JP8A 2YH1A 2AEMA 1NO8A 2MPUA 2V94A 2X7IA 5A8RB 2XY5A 3BV8A 4YHHJ 1S97A 2BOPA 3BO4A 2NREA 5LJ3Y 2H5JB 2XS5A 4QR2A 4OQJA 4LF1A 5D0GA 3VAFA 2R3VA 2OUGA 2YXLA 3RW6A 4ZVEA 1T03B 3IGNA 3R6LB 2E1CA 2LXFA 4K4WA 2ZUGA 2HWTA 1SC4B 4MK8A 2CJKA 2AGPA 3DRYA 2YQ3A 5A2QU 2IA0A 2E66A 4C3MA 2WK4A 4K2XA 5AXKA 1J27A 4DR7J 3MF5A 1S9EB 4LQ9A 4EK2A 2HQCA 1MROB 3KXDA 1TAQA 2PMWA 2OPPA 2XLKA 2WOMB 2NSBA 4XPCA 1WF1A 1SCJB 4ZVTB 4PG5A 4K8RA 2I0XA 4F04B 3DGPB 1R0AB 2GO8A 2QYGA 2HMIA 1P8GA 4DSKA 1REGX 3I5AA 3QJJA 1PAUB 3OLAA 2IMOA 5IV4A 2OEJA 2G2ZA 2FJBB 1U6ZA 1U49A 2E7XA 1NKCA 4CH0S 2DNNA 4DUTA 2YWKA 4W90B 3HI9A 1WHYA 4K5SA 2AJQA 3D2WA 2HW3A 4JV0A 2DPIA 3C6UB 2BUNA 4ERDA 4R0EA 1D09B 4DSJA 3HHNB 2BJ9A 1R7IA 2ZH6A 3L7PA 5IXUA 3K5PA 3CJ5A 3GZ7A 2HK3A 4WP3A 2AEFA 2KDOA 1T9WA 3GV8B 4CP5A 4EU0A 2XSJA 2RS2A 2AF6A 2FIUA 3D1QA 2GJFA 4LRCA 2QLFB 3US5A 4FYDA 4I0WA 1WKJA 4B08A 4LF7F 2OD6A 2LFVA 4M5DB 3FZBA 2ZKUA 3HVTA 5LSRA 4OYMA 2BQ3A 1F9FA 4DN9A 3R5CA 3GWCA 4EGLA 3NS6A 1TUGB 3VGSA 3ENQA 3ZZRA 1FO1A 2IDLA 1RHKB 2VG7B 4KH0B 3QRQA 2EPIA 2CPIA 5CAAA 3HZEA 5AE2A 5KG5A 5KFLA 5J1EA 1URRA 4LSZB 1Q79A 2BJEA 1RTJB 1NSKL 4X4VA 1N32J 2RRAA 2CJBA 3H98A 4L6V3 3I6PA 1EETB 1FRJA 3UDEA 4URSA 3MZIA 1TL4A 1Z2ZA 3WIVA 1FNOA 1QTMA 1RT7B 2JDJA 4NCGB 1A9NB 1IBMF 1U02A 2Y0SD 2HZCA 1H3DA 1FEEA 2CJYB 4NLWA 4TY9A 3SQGB 4G1IA 4TY8B 3TVZA 1DTQA 3SBMA 1XERA 2ZBIA 4RWXA 2BOAA 1EKRA 5RUBA 1WORA 1BQXA 4ZHRA 3P3DA 1KHVA 5D8HB 5K8NA 5IS2A 2ZHOA 4HH0A 4A8YA 4ZN1A 2FJVA 1HLWA 1QAYA 3HK2A 5HVHA 1ZS6A 3DOMB 1VK8A 3G6XA 2MQQA 3Q8RB 4ZKAA 4KHRA 1JX4A 2RUGA 3AT1B 1X4GA 5IM0A 4UOCA 2DNMA 1TKXB 4P71A 1YZ6A 2POKA 1UFKA 3OL7A 1DY3A 1S10A 4OX9J 3GFHA 3Q89A 3MM7A 3ZNUA 3HT0A 4AE5A 4E0DA 1N5TA 5IQQA 4H4KA 1TP7A 1C0TB 3JB9k 2C1EB 2J9DA 1NJXA 3UNYA 3L9ZA 3KUHA 1FFSB 3M8QB 1N6QB 2Z2LA 2FLPA 4U9RA 3OUYB 3W5YA 5B0DA 1Q16B 1K9MT 2IBOA 1G6BA 5HP1A 4QW8A 4DV3J 1TTHB 4DL0C 1UZDA 1PYSB 1TL5A 4N47A 4IYQA 5DGAA 3A3NB 3NLCA 3G4SS 2RT3A 5FJ4A 4P2XA 3GJSB 4P74A 1PC4A 2DNZA 5FDLB 4F3MA 3QLHA 2BR0A 1EX8A 2WBRA 5IWAF 2K7JA 2DCLA 1RISA 1XMQF 1S6QA 3TZWA 1PJ5A 1WTBA 3M8SA 1I94F 1R0CB 1WUUA 5ETOA 1IBKJ 4LF4J 3KMSA 1KQSR 5B0FA 1TL1A 2WAQD 2OFGX 2V2ZA 4WIIA 1E6VA 3P5BP 4JI7J 1T3OA 4WFYA 2MKKA 4HKQA 4ECVA 2BX6A 2KJVA 4EBCA 1JLBA 2DEJA 3DYAA 4ZA1A 1VHIA 1OQ6A 4ZCIA 3MM8A 2FVQA 3QSYB 2E5JA 4NMLA 1SQEA 2HYIB 2QV6A 2UXBF 2IY5B 5KG7A 2RSQA 4RU9A 1JMTA 2XHCA 1RA7A 3I9V9 2DHAA 2I9SA 1LWCB 1T05A 1DQ8A 4QWBA 3FDSA 1VQMS 3FMWA 1S57A 3AXMA 2E9ZA 2ZNYA 3BH6B 3TA1A 3GIIA 2ZM6F 2NYIA 4WFBQ 3WX4A 2FY8A 5E2QA 3DLGB 1B0PA 3BSAA 1PCAA 3HSJA 5AE3A 3GIJA 3QWUA 3SSQA 1UVLA 2KT2A 4ER8A 2HFVA 1KOOA 1S0NA 3V81A 2XYPB 4CH7A 2NXEA 4GMKA 5E3QA 2BRKA 3LANA 5J2MB 1FKOA 4HYKA 2FJDB 4CRJA 5KFMA 4DPXA 4ZCMA 2H9ZA 4F67A 4EBEA 1FJGF 2GGPA 3QT8A 1WHVA 2I2YA 3W60A 1JLEB 4ID8A 3W63A 4EMDA 1N54B 3UQSA 1TELA 4LF5F 4BBYA 1SKRA 1ZTWA 1G7CB 2K1RA 3NXZA 1WC3A 3RTVA 1KNZA 2A18A 3KDOA 1HNVB 2VQFJ 2ZUAA 4I68A 2CDQA 3Q24A 3MMAA 1Z4UA 1YZ7A 3BGRA 1DFDA 4KKOA 5D15A 1KRPA 3O6QA 2HFOA 4YY3F 1SL1A 2VH7A 2GQ2A 4ELVA 2U2FA 2ABYA 1IKYB 4EUVA 2ZKTA 5HMWA 3C16A 2QFJA 3G8TA 1T11A 4OLPA 1YJUA 3IWLA 2R4FA 3DDIA 2OFHX 4DLGA 3RB3A 3A8EA 1MU2A 2WVEA 2XMKA 1HR0J 4W92B 2J5AA 1LWFB 2EW9A 1YLXA 4B9TA 4I2PA 2ZOFA 4V19X 4X4SA 2HG4A 3X1LB 4E98A 4NCAA 4ZP8A 2CZ4A 4DG1B 1S1XA 2LEBA 5IC6B 1N5QA 1JNRB 2HFNA 3AY0A 4ZK7M 3D1HA 3MEKA 1V9OA 3AD8C 5JJBA 3FEYB 4Y2CA 1UW9A 1CLFA 2MJUA 3OW2R 3T6JA 2DGSA 3Q8PB 3CCWA 1MW7A 1VQ7S 1EZZB 2ZBQA 4M63A 3K5NA 1NHVA 2QFIA 2FB0A 1VQPS 2EG2A 4NYOA 4ZLLA 3LGMA 2JOQA 2OIHA 1NBEB 5DQIA 4Z2XA 3MPYA 1NLKL 5CZXA 1U48A 2XWYA 4PWWA 3CUNA 3MECB 2IYGA 3SCLE 4DR5J 2IA6A 4RW6A 4JI1F 1JLAB 1NPRA 4HDGA 2NLWA 1Y5IB 2IVFB 5DDOC 3DLEB 2MYFA 5LSOA 1RWKB 4AXJA 5LSLA 4NCBA 1M1GA 1DZ5A 3UNGC 3D1OA 4NLSA 3TYTA 2H4WB 1CEZA 4H4MB 4AUKA 3SMZA 4FVCA 3MR2A 4OHYA 2C3OA 5E33A 4RW7B 3TR5A 4DU7A 3KK2A 4KHPJ 3NNHA 3J80Y 4CM2A 5DETA 5L1LA 1JQGA 4MK9A 3JYTA 1XBWA 3W5ZA 2R42A 4NE9C 3BJYA 4ANDA 2PT0A 3JAMY 1N36J 4K2JA 4FN5A 2ROEA 2XSFA 5IFMA 1VQ5S 2RD5C 1CJUA 2YVSA 4DV6J 2XMTA 4OZ5A 2VKZG 1GMUA 1X0PA 2DO4A 3P5TL 2JJ4D 2PC6A 3MMCA 3LF0A 5D4LA 3OTOJ 2ATCB 1R31A 4IO1A 1XTZA 3PVXA 4U7CA 4DV4F 2F4VF 4TXSA 2MDAA 3J7A1 4X65F 5I3UA 1TL3A 2XG8A 4CNZA 1YIJS 5C25B 3H2LA 1U0SA 3LP0A 1S7IA 2ACMA 3KOAA 3BKUA 3BYRA 2O5DA 2J9CA 4JI6F 3TUIC 4FDFA 1MWZA 2C3PA 1UA1A 2DPJA 2RH3A 2FHKA 2MZ1A 1JXVA 1AZSA 1ZM9A 4KB7A 1LW0B 1S9GB 3MM5A 4M5HA 3D0IE 4DX7A 2R7SA 5KFRA 1PO6A 5JVGQ 3VAKA 3RW7A 3UD5A 1FTRA 4ELTA 3K5OA 1RLCL 3KJQB 2VJUA 1LWXA 4ETXA 4Q44A 1S6PB 3NOGA 3ZXWA 3H42A 3AD9C 1NB7A 3UDLA 4B17A 3TAMB 5HQ8A 5B0CA 5KG6A 3CTRA 3OPKA 3NRBA 4X84A 3M7VA 5D4PA 4XO0A 4RW4B 1NRKA 2Q66A 3Q8SB 2W2NP 4CLSA 3KYLA 1NJYA 1VQ6S 2QT7A 2A6MA 1RTDA 5CZVA 1T02A 1YRXA 4WYLA 5A76A 2J0WA 2C2MB 1U24A 3M2UB 1FRIA 3GJTB 3G6ES 2B4UA 3EGNA 3V4IB 4DL3A 3CCTA 5K20B 3NP5A 2KVQE 1SUQA 3THVA 2H4YB 3MFHA 4CLPA 2RQ4A 4FYXB 4CLZA 2RUSA 3T1HJ 4C97A 3VAHA 2JSXA 1QTNB 4DV7F 2HSEB 3KUGA 2YNIB 3MM9B 4NLTA 1FKAF 2QSWA 1X9WA 1U8SA 3I87A 2VB6A 4C2MA 2FHJD 3IG1B 4C8MA 2SXLA 4RW8B 1JJ4A 3CE8A 1FTCA 1P9YA 1Y0HA 2J6SA 5J2PB 3N28A 2VUGA 3QAEA 4Z7YA 1IKXA 2RDJA 1M1KT 3M8ZA 2MZQA 3CCJS 4ECXA 3IN5A 3BQ1A 3VGTA 1NK0A 3B54A 3PX0A 2HBRB 3CB4A 3VTIA 2QSFA 3KLEA 1VQ8S 3CDBA 3DRPA 5LXYA 3K89A 3ENWA 3Q23A 5DLGA 4DPUA 1SL0A 1QSYA 4XTTA 1T0TV 5CYJA 4LBIA 3MPUB 3HHLB 1QVGR 1L3TA 3C46A 3W1YC 3T1YF 4USTA 4B3MF 3H5YA 4ECSA 3IP0A 1ZPWX 3K5MA 2EFQA 1JB0C 2YNHA 4B9UA 1U0HA 4NXMF 5HK4A 3QT5A 2W8LA 2UV8G 1CSJA 5ETKA 4MH8A 3SV3A 5CA5A 1V6HA 4ZVOB 4ZPAA 2NS1B 3C15A 2V8HA 2MJNA 2XO7A 4OX8A 3SEOA 4E8UA 4LF6J 3EVMA 1Q5VA 3TJAA 1X7VA 2G0JA 3TZYA 2IM0A 4WP9A 1FJCA 2CQHA 5K14A 4KO0B 3CJSA 2BACA 2A6OA 2W9CA 1ZM4A 3HF5A 4DWIA 1RWVB 2OMLA 2YH0A 3PW5A 1HQUA 4DR6F 5GMDA 3AJDA 2HHPA 3VV2B 3KTQA 3MEDA 1WDTA 3R5DA 4PUOA 1H6KX 3W65A 4IG3A 1YHQS 4NRTA 1HWIA 4LF2A 2PSZA 5HMZA 3MOZA 3J7YI 1U1OA 2UU9F 4OX6A 4RU2A 4QIGA 2JEIA 1PSDA 4ZVFA 3OL9A 2H5EA 4KAIA 4PWDA 2VPWB 1KC8T 4TU8A 1N52B 4URGA 3PZPA 2KZZA 5D4OA 4BHQA 2CQ2A 2GVDB 3KJNB 3NCRA 3DRSB 5BJRA 4DBQA 1NAQA 2CPJA 1JLQB 3CCVS 3ILJA 4GKJJ 1ZPVA 5C24B 3A8JA 4KIAA 5KFNA 3Q8UA 2YPZA 2YKPA 1A7GE 2NSCA 2OSQA 4ECTA 1UJ4A 2HURA 5SUHA 3EUNA 1HNIB 2C3YA 5H9FK 1Y3JA 1YI2S 1XMOF 5F9NA 5DS7A 2RRNA 3PHEA 3NWRA 3D6TB 3WQPA 2AJ0A 3DGVA 1QE1B 3GP9A 3KLGB 4FXDA 4ECYA 5J2QA 3ET6A 2DNGA 3CJ0A 3OTOF 3G87A 1LWEA 1B7YB 4UT4A 5KFFA 1LW2A 3C14B 4NOHA 2AYEA 3AB2B 2UUBJ 2ASJA 4MYTA 3H7HB 2YKAA 1IN0A 4DR2J 2R8JA 3K5LA 4DR1J 2JFDA 1L3SA 1DURA 2EFNA 2D1CA 4FYVB 1VQYA 2ASLA 3R8YA 2XM3A 4NLOA 2WTFA 4C7QA 3W61A 3CCRS 3HHKA 4J91A 3DM2A 1F1BB 3QO9B 3SV4A 4K0KF 3EXCX 4NLPA 4WKRA 5G0RA 1J2VA 2FLNA 4L74A 5IT4A 5KG1A 1FDAA 2M7SA 2X3GA 1O5JA 1V3SA 4OZ2A 2D69A 1OO0B 4LF8J 5T7LB 4FXVA 4KV8B 1KKHA 1HBNB 1HHSA 4ED5A 2FVRA 1HD1A 4Y2KA 3B4DA 2C3UA 1VRQC 5EDWA 4LFAJ 2V2VA 1Y5LB 3UCGA 5FIIA 5JMNA 2BW2A 3GYNA 1E6YA 2B5JA 4KSEB 1WG4A 4CCHA 1HHQA 3ZNJ1 4NLYA 1I3OB 5HO4A 4XAKA 3ZTPA 1FRLA 1SI9A 4I69A 3OT9A 1EAYC 4DFPA 4O23A 4LR7A 5ETVA 2NR0A 3BB5A 5D3GB 4CH1A 4NLDA 4ZVSB 3VR1A 3HP6A 4N5SA 2OAUA 1PKUA 4IG0A 1GX5A 1HIYA 2MKYA 1RBLA 4A4JA 4C0BA 3PYGA 4MIBA 1JLGA 1F5CA 4M5NA 2HZAA 3M2RB 5KT4A 2J9EA 5F0WA 1S1WA 1FX2A 4DUYF 2IM3A 2HIQA 3MI7X 1N5YA 2BXJA 1N34J 1RCOB 3D54A 4DOZA 1P1LA 2GW8A 4CLKA 1M1HA 2YX1A 4LREA 2JC0A 4QYZK 4KQZA 1X5SA 3BQ0A 3CVKA 1TZ0A 5HQMA 2NUUG 1WEXA 4LBHA 2Y1IA 3NGKA 1RTHB 1KP6A 3ZC4A 4U96A 2DHSA 3B4MA 3FKBA 2BE7D 3DOKB 4PQUB 2MEWA 1IJEB 1IQZA 2DR9A 5HBMB 1CJKA 4NA2A 3RAMA 2MKIA 1OY8A 3G82B 1MMNA 1BHNA 2NPIA 1BQNA 4X4PA 3BEGB 2KYXA 5E3CA 2HHQA 1VOMA 3LPEA 2NZ4A 4DX5A 4X62J 4RL1A 2DGOA 3ZZPA 2HQFA 4A8WA 1CVJA 1KQGB 3O8WA 4A8FA 3H5XA 2UXDF 1GMWA 1WEZA 4JV2A 1NEEA 1RTIB 2XNQA 2ZZMA 2QLXA 4CLUA 2J7UA 2V9KA 2AT1B 1VRTA 3MD1A 2LDIA 4N76A 1FDBA 2CPYA 4ZPVR 1CJVB 2YX7A 3GCWP 1MMLA 4KGXB 3I0SA 4IDKA 2L3MA 2F1FA 4R25A 2MMYA 2YY3A 3DLHA 3J81Y 3IO1A 2KFNA 3CNQP 3M2VB 5A0YB 1XR7A 2W9BA 3JTPA 3BBCA 2DR7A 4DL5A 2KRBA 1YJ9S 4FF3A 1WSRA 1UKUA 1OY9A 4EYIB 1MSWD 4RUCA 1RUSA 3PM9A 2ZNZA 1DQAA 1PAEX 1HPZA 4HEA9 2OP5A 4DU8A 2UZAA 4YR2A 3UD3P 3N5FA 4B9VA 1S1TA 1TU0B 5E3RA 2G9OA 3PXGa 1JJHA 3IRXB 4K4ZA 4C0HA 2WBMA 3GPAA 4AQYF 3HD2A 2V4JA 1MLAA 1FHTA 4WK3A 1FESA 2DNQA 3ZZ0A 4MAKA 3P96A 5GMKa 3R7BB 2EBEA 2P5VA 4JI5F 3Q22A 3ETOA 1DTTA 2R8KA 3OD2A 3KLIB 4WE1B 3DKDA 1FX4A 3OR2B 1VFJA 1NK4A 2Y1JA 2BVZA 1YRTA 3H20A 1B3TA 3FBFA 4I67A 2ZHBA 2D3UA 3BSNA 2C3MA 2G1HA 2CQ0A 3TANA 2CPXA 2IIHA 4YB7A 2CNOB 2K2PA 4JV1A 4LF9F 2F8MA 4WWSA 4K7QA 2KZMA 1L5UA 2FJXA 2VASA 1H73A 3HJFA 2HWHA 2WSFC 1UPMB 4KY3A 3OJSA 4PXEA 1H98A 3C19A 3GILA 3D3BJ 1CS4A 5I3QA 4RNNA 2LXUA 4ZPDA 1UTAA 2DRAA 4NZ7A 3FNNA 4TVAB 3DLLQ 3QGGA 4TN2A 4CT9A 4ZIWA 2XC9A 3KHGA 1B0VA 3LP1A 5MLCV 5KFCA 1K44A 1YRUA 4OYXA 2F8HA 4I2QA 4FXWA 1S72S 1SKUB 4IUFA 2HHSA 1T9VA 2VQEF 5L1KA 5GAHI 1WHWA 2L9WA 1XMBA 2UXCF 1F9EB 1HNWJ 3R2CJ 2LYVA 2D3OR 1Q7LB 3BZQA 5HMXA 2VFTA 2OPRB 2AJ1A 1C1BB 1UZHA 1RT4B 2OMOA 3VAMA 3EM1A 3NKYA 5IOLA 2FZGB 1Z1ZA 4U8YA 2DR5A 4L72B 1S48A 2HMIB 1TK5A 5LMUJ 5EWGA 3RAXA 2YNGA 1U09A 5CABA 4QWCA 5KFSA 4I6YA 4NXNJ 1AW0A 1FRKA 3OTDA 3S01A 1YITS 3PW7A 4IH6A 4YP3A 4WFXA 4ED4A 4ILLA 4UZCA 4CO2A 4LR9A 2VBWA 3KMQA 4A8OA 2KKHA 3SCKE 1U45A 3G8SA 3HMJG 5DJBA 4V19J 2OHDA 5KFUA 4Q2MA 1UVJA 1K73T 3IWXA 3CJ3A 3PRBA 4F7VA 4DPYA 4BS2A 2AKWB 3VVUA 3L7OA 2ZDOA 3BS9A 2FGOA 2QJ3A 2XSJB 3GCXP 3EMTA 3EVWA 1JWWA 1GEHA 3CJ8A 3BN4A 2KTQA 4RO0A 3HJVA 2Z58B 3HO1A 3ZTQA 1V3RA 3HVTB 5F8MA 4QZVB 3ADAC 4OMFG 3PYDA 3Q86A 3JS9A 3B8HA 3MOJB 4ZPTR 5I42A 3M8WA 4YN3B 2IPOB 2JVRA 3C6TA 4Y2IA 2LQ5A 4NL5A 4QYRA 4ZN3A 3VQTA 5KTQA 3GR0A 1VMBA 2MKJA 2APOA 2B8QA 1GK8A 2AZ1A 4ZP9A 1P6TA 3C3LA 2M8DB 1W2IA 3IA0A 1UCNA 2C2DA 5DM7Q 1KN6A 3VQSA 2QE5A 4Y28C 1X8DA 2DK2A 4KBIA 2IJNA 4OHWA 2LP4A 1NDKA 4H54A 2XGQA 3CCQS 3TQEA 3MEGA 1GQEA 3VGVA 3OFEA 1EB0A 1D1UA 3VAIA 2G1DA 2XMJA 4FNIA 4E2FB 2JEGA 2HVHA 2AYGA 3PRDA 4NLUA 2Y3YA 4KTQA 2EK6A 4ZHRB 4K4SA 4LT6A 3MCSA 3M9NB 4DDFA 3M30A 2ROGA 5IZHA 3EZUA 4OYIA 5SZTA 4DFJA 3S6EA 4CLYA 3KJVA 2VIHA 4JI2F 3MAHA 3UW1A 1SJQA 5D78A 2D7SA 2MB0B 3ZO7A 3GV5B 2HGMA 2MXYA 3S1TA 2E5LF 5IT9Y 2R7XA 2GCFA 1T03A 2XBPA 2N82B 2N4DA 1RBAA 4WZMA 4HACB 1FWLA 2PN6A 3UVJB 1UVNA 5HP1B 4OI2A 2ERRA 1XJWB 1TMJA 1H7XA 2J8SA 3CPWR 5U47A 4QW9A 1MROA 3TA2A 1FVSA 1YBTA 5J2NB 5D6GA 2WOMA 3TRGA 1S6QB 2RF2B 2C2RA 4K4YA 1U1KA 2MTLA 5FD1A 4YR0A 3U27A 4J90A 1E6VB 1N4LA 4X4TA 2Q6BA 4R5PA 4Y0FA 1ZM2A 4NLQA 2FJWA 2CZ9A 1R8CA 2BANA 2BJDA 3MPVA 4LIRA 4ES1A 1ZZNA 2G2YA 3DYAB 3R5GA 3MM8B 2ZC4A 2D9OA 4A46A 2XY6A 3UDVA 3IR5B 2MQOA 3AA9A 9ATCB 3HCXA 1T05B 5E41A 2HVIA 1ULRA 3N79A 3HSGA 3R27A 3H25A 3GSDA 4WFNQ 5LMNF 4DL7A 3IC1A 1PBUA 4IFVA 2HQIA 1HHTP 4M5DA 4DPWA 4N77A 1S7HA 1F60B 2PI4A 4PZVA 4NLRA 4LVOP 1BQMA 3NAHA 3CJKA 4L75A 4ZVUB 3RU0A 2J0SD 3BO2A 1Z2LA 4UOGA 2XNRA 3C8YA 3SSRA 2XI2A 4LVNP 2VDIA 1RKIA 4CLLA 5CD4A 2VG7A 2DHHA 1TVRB 4B3SF 1KWMA 4DZ6A 1ZYQA 1JLCB 2PMHA 1FT8A 1FKOB 2CJ9A 1RT1A 1NHUA 2DIVA 5KOWA 2KFYA 2AV5A 1RTJA 2IRXA 2GGPB 2V50A 1RAIB 3W2WB 3QPIA 1XK8A 1LK7A 2CA9A 2Z2YB 2RS8A 5D0RA 3SDEA 3TQ1A 4J9MA 2A2CA 3J81j 1HNWF 3T6BA 4NX9A 1QD1A 3V6KA 1YWXA 2ZD1A 2GO9A 1SXLA 2R2TA 3GYXB 2K1RB 3NWGA 3BGLA 1Q95G 1HKAA 4C8OA 2DD8S 1WI6A 4TY8A 3GR1A 5J1NA 4IQMA 2IVMA 1UVIA 1GTHA 3FBBA 1YJRA 5GVQA 2DNPA 2FVCA 3MMAB 4J9OA 2CPEA 3FEXB 3JAMU 1B7FA 3BGRB 3TVKA 1A0OB 4KKOB 5LMUF 1S5ZA 2YKNA 4HHJA 5DZ7A 3DLKB 1NCLA 4XDCA 2Z8QA 3ICLA 2IJRA 3DOMA 2RMLA 2HGLA 1RWMB 5F8GA 5LM7E 1UWBB 5CYMB 4Q0BB 4G6VB 4MT1A 4UOHA 3BBFA 5KFZA 2BMBA 2M3DA 3DNCA 4ZJOA 2HQGA 3JSMA 3Q2SC 1MU2B 4XPEA 1RT3B 3OTBA 2HVDA 2HHUA 1HD0A 4Q8EA 3QBCA 1BC6A 4I2PB 4KJIA 2AMCB 4PQAA 1V3ZA 1F3FA 4B9SA 4IRKA 1LV5A 1X5PA 1S1XB 1VBYA 1RQ0A 3M8QA 4ZITA 2MZRA 4JV5F 3CD7A 5DDQC 4O4RA 5DLFA 4JYAF 1IQTA 3J7YU 2DXEA 2DH7A 2RKIA 4WIQA 3LGHA 1JKHA 3PACA 2GHVC 1U1PA 1EP4B 3JTNA 3MCOA 4Y2MA 3CJRA 2V6AA 1A6LA 3NY0A 5ETNA 3QT7A 3G96A 1X0FA 4ZOSA 2DEIA 1N5SA 3H40A 4MIWA 1K8AT 4Q43A 2GJ2A 3KK1A 2JLEA 4J9NA 1PILA 1ZH5A 4F0KA 4F0HA 4RW6B 2ZITA 4RNMA 2PEHA 5D0EA 3Q8YA 3K59A 3RRGA 4A8KA 8ATCB 1P9QC 4L76A 1FKPB 2HHHJ 1W7WA 4D3HA 4ECRA 4MFBB 2XLJA 1X5TA 4ID5A 2FLOA 3BYPA 1YSJA 3QJPA 4ZMMA 4O44A 4WYWA 3GSIA 4JBCA 3ENAA 4JI3J 4FZVA 1HNZF 4ZVHA 1TAUA 2BZ2A 3IFEA 5KFKA 2E44A 1RT2B 4PKDB 2AJ4A 3OXLA 2GAGC 3POTB 3KK2B 2HBZB 3WC2A 1OSCA 4G3IA 4P9SA 2CQ3A 1UETA 2G13A 4Y34A 1RB0A 1HBUA 1HARA 5HSPA 2VG5A 1ITPA 2ZH4A 2IHR1 1Q0NA 4QIWD 4QIVA 3ILLA 3SCJE 3QIPB 4EWTA 3MMCB 2FC8A 4OYWA 3NGUA 2BJ1A 3ETMA 1N88A 2VOPA 2E5IA 5J2MA 2C2ZB 4Y6IA 5I3UB 1TL3B 2B43A 1QAJA 1IM6A 1C4CA 1AA1B 1Q8IA 3FSYA 1CG2A 3HVRA 3ILOA 2AX0A 3W2VA 4ZCKA 1FE4A 4GC6A 4K4UA 3G6VA 3W3SA 5EX3A 3OR1A 3BKTA 5L46A 1VBZA 2Y9HA 5F8IA 2M0GB 2Z2ZA 1R3NA 1XNRJ 4LSNB 3O5TB 4B3TJ 4QU7A 4OYAA 2BKPA 1J5EJ 2CNLB 1FFGB 4DX8H 1AZSB 2B3TB 5E7OB 1ELOA 4K59A 6FD1A 4OZNA 3FUYA 4IH7A 3OTEA 4NYPA 2G0IA 2GHWA 1P27B 3PRVA 1NPKA 3VZIA 3MURP 3OVAA 1XIQA 2K3KA 3TUJC 2C22A 3DN9A 2H54B 4KPCA 3HFKA 1M5VC 3MXHP 1U6BA 2W9AA 4C3LA 2V34A 1FA0A 1DLOA 1NDCA 4J37A 3IS9A 2XTJP 3WZ0A 4CT8A 2XLIA 4OHXA 3MAQA 3MR7A 3KLFA 3PHTA 4UY8T 3U1MA 1FWPA 3PDNA 2Z4PA 5HATA 5K8MA 3KLVA 3ZZUA 3QMQA 3AHPA 1IKVA 1DAXA 2DCUB 1SUQB 4DL6A 1JXEA 3KHRA 5L39A 2E9RX 1F0XA 5F9LA 2VU5A 4MJKA 1VHFA 1T7PA 1FXLA 3CMAS 4MMOA 1Q82T 2FDNA 4IOBA 4DFKA 1FERA 5MAOA 4PG4A 4AL5A 3DRXA 1AYEA 2CDRB 2OEMA 5DM6Q 4F3QA 1P1TA 5B08A 1JLAA 2ZOGA 1YK9A 2QRRA 3I9ZA 3DLEA 3QIDA 5IQ6A 1FRMA 2VODA 1ACMB 4ECQA 4USVA 3NS5A 2V67A 2FHJA 2K06A 1AUSL 3M1VB 2BDPA 3CC7S 3DRRA 3KLEB 3NBPB 2MGZA 5B0BA 2YWHA 3CCLS 4OZ3A 1UVMA 1ROFA 1EHWA 2F8EX 3FK4A 1DQ9A 1DBDA 3MAAB 1H7WA 1K1SA 1HI8A 3GJQB 3DC2A 2VPYB 3MTKA 1FXDA 4YR3A 2P9CA 4ILRA 4KGMA 3IXQA 2MY7A 4J9QA 3G6YA 4UQTA 4W4MA 1X4HA 2YNHB 2FZKB 3SQOP 3PX6A 4JI4J 1U0HB 2W1BA 1XC9A 4QPTA 4DMZA 3H90A 2BQUA 2OGUA 2OSRA 3MCMA 2Y0BB 1WACA 1TFWA 2FHMA 1IVZA 1FRXA 3EE3A 4GKKJ 2M70A 5KFXA 2GVZB 3ULHA 4PR6A 3KUEA 4ICLB 2KL8A 4DPOA 2DNLA 2RE1A 1ZOTA 2HRTA 1N33F 5K14B 3HKZD 3KFWX 4NASA 1RWWB 5H1SV 2W9CB 4Y3CA 1FI4A 1YJTA 5BYQA 1HQUB 1UFLA 3AJ1A 1LW0A 3UR3C 1EKSA 2WONA 1RAGB 1RHQB 3MEDB 3WHIA 4QJVA 2DHGA 2QLWA 3OFHA 4PUOB 3RR7A 5F8HA 4URQU 4R8UA 4IG3B 4LSLA 3KNGA 2V4QA 4O3NA 3HHEA 1BMQB 4DCJB 2HK2A 2ZBPA 4PWDB 1VQNS 4O3PA 2HHHF 3BPDA 5EUHA 3LP2B 4J9PA 1O6XA 3SFUA 1LKZA 4B9MA 3C2PA 5HL7Q 4DQSA 1RAOA 3M32A 3D0GE 1MWQA 1FNMA 2P6TA 4JI3F 1NH7A 3GV7B 1MN9A 1N0VC 4FF1A 4CNYA 1S59A 1U6FA 1QUVA 2E5GA 1D0EA 2X1GA 2CADA 3SZ2A 2OTJS 1IBCB 4DF8A 4LFCJ 3IWNC 3OFGA 2E1AA 1XNQJ 4NMXA 1RACB 2DIUA 3R1HA 4HT5A 4C3KA 4JI8F 3GU0A 1UA0A 1YG0A 3V4IA 4DR4J 1Y9OA 1Q8LA 3NG8A 2I8EA 1SV5A 4C4WA 1B4SA 5LT5A 5GAHU 3MR3A 1H2VZ 3FGVA 4J9VA 2YBVA 1LWEB 1RWXB 3EXYA 1U1RA 5AJ3J 4WPAA 1LW2B 3GQCA 4X2BA 4Z7CA 4M95A 2KI2A 3E2EA 2AD9A 5HQLA 1IBLJ 1RT5A 3IG1A 1G4CA 2J7KA 2XI3A 1X4BA 4JI0J 2GX8A 3UCUP 1HBMB 4M5LA 2BW7A 1U7LA 3NAIA 4C9DA 5ETRA 3J7ZT 5DQHA 2AGQA 4CIOA 3DM2B 4IO9Q 2G0CA 2EG1A 3LAMA 2C2KB 5KFBA 3HXMA 1UW4A 5G0RB 4C8YA 3BDPA 2W24A 3HFVA 2JEJA 4HLBA 3W9IA 2HNYA 4PCQA 3QZ8A 1LFWA 3D0HE 1JNZB 3HD1A 2JWNA 4LFBF 1VCTA 2KH9A 1SIZA 2VD3A 2LXIA 2EC0A 1ICEB 3M8YA 4ES2A 4LRAA 3U02A 2IBKA 4OLOA 4DV0J 2GIQA 3GJRB 4DV5F 1H2UX 5T41A 4CTAB 1VBKA 4MKAA 3U1NA 2JRSA 2GQCA 2FYXA 1E6YB 2DJWA 4CO1A 4DUZJ 1SH2A 3NS7B 4P2MA 2QG9B 3K57A 2CQIA 3NGRA 4DV1J 1VQ4S 2PD1A 1M5OC 2MLYA 1FF2A 4X4OA 5KFEA 3TNVA 5F8NA 1WC0A 1M0SA 1NHKL 1RCXB 3J81U 2BABA 2RNEA 2OPQB 3MMJA 1OJ4A 1PG5B 3N5BA 4OZLA 1TV6A 2V8PA 4B3RJ 2ZE2B 4LR8A 5GAGU 2Z0GA 4HL9A 3KDNA 2K3IA 3KK3B 4YHHF 5FLXU 5AXLA 4AL7A 2AEJA 2ZZTA 3CCSS 3TA0A 5BR8J 1PBAA 1HNXJ 1NZ8A 4IG0B 3HLUA 2R7OA 1BY9A 1IXKA 2J0XA 3DLJA 4R0JA 1JLGB 2O01C 1SVDA 3ZZOA 3F0NA 5HN0A 2RILA 4F02A 3I32A 1RHMB 2ZH8A 3WBZA 3RBDA 5KT3A 3QT6A 2W7PA 2UUCJ 1UWAA 3TX8A 4OYOA 4FYWB 1HQEA 3O2IA 2JH3A 2LLZA 1S0MA 2MQMA 3GONA 2J0QD 3W62A 3A3PB 1SJ1A 1S1VA 5KG3A 2P8IA 5A8KA 4M94A 1YJVA 2MKCA 2OLWA 4DR7F 4AFFA 1RWOB 2KXHA 4IRCA 1EQMA 3DHXA 4UW2A 2WSEC 3O3LA 1NZAA 4F8RA 2R7RA 1I5OB 2IC3A 3TVYA 4M5KA 1HYSA 2F9DA 1CJKB 4P7TA 4UF4A 1TUVA 3ISND 1UP1A 4ZJLA 1BQNB 2BRLA 1R0BG 2R2UA 3H5SA 1V5IB 1YKWA 2B9XA 4BWMA 3EDQB 4OHZA 3PJWA 3ISNC 4JI4F 3VAJA 3RBZA 4N8NA 2ZJRQ 1RE1B 3GFYA 3RUBL 2IYIA 5KFIA 4M8LA 4KT0C 4DL4A 1R27B 3H4DA 4RUAA 1LK5A 1VRTB 3BDEA 5AXMA 4N7TA 1PGZA 3DMJB 4K4XA 1BLUA 3ITHA 1NUEA 2DGWA 2BE9B 1L3KA 4LIWA 3I0SB 4IDKB 5C42B 1RAJA 3RB6A 2RU3A 1KLMB 1O8BA 5C2GA 4DSEA 4PRFA 2W9BB 1YBUA 4MYUA 3RJMB 3I0RA 3SXLA 1OIAA 2DO0A 4OI4A 4WU2A 2IJFA 3UD4P 4L3KA 1UJ5A 4ZPBA 3M6VA 2KYZA 1UFWA 2DHXA 4P52A 1U4BA 2VL1A 2CVEA 2V4JB 2VPXB 3MPDA 3VZHA 1N32F 2IMWP 1RYSA 3CD6S 2ZBCA 2GMLA 1R43A 2LECA 3FQLA 4ZCLA 3CEDA 3Q8VA 2GA7A 1DTTB 5E3AA 2Q3PA 4EBDA 4F36A 4DXLA 4W98A 4IR9A 2LQBA 4LFCF 4ANCA 4WZQA 5A8WA 2QA4G 3UO0A 4L3NA 4OZ1A 4YDDB 2KHCA 3W8PA 3BGFA 1IWAA 3GG0A 2QA4S 1WOSA 4UY85 1D9AA 4OZ0A 4CDIA 4RW9B 3G86A 2DT9A 4U67Q 5D3GA 4ED6A 3UWTA 4LF7J 4GVBA 3E01A 4BDPA 3M8RA 1VRUA 5DDRC 5JXSA 1S0VA 1F9HA 2RVJA 1CS4B 2D9PA 2W4PA 4KRWA 4OFZA 4ZVPB 1U26A 1BWVA 3EVOA 4RLEA 3R6GB 3IMQJ 2OO4A 4B02A 3CGIA 4OX9F 2CNNB 2HAFA 5B7WA 3K8WA 2MHEA 1WNEA 4RPFA 1Y4ZB 3LP1B 1LXNA 2IVYA 2YQ1A 2ZH9A 4WXOA 3KLHA 4I2QB 3EX7B 3CD5A 3H5UA 3JSBA 2N7CA 3DU5A 2D41A 5LXRA 3JXOA 2MSTA 5CCMA 2CQDA 3NGTA 4C8KA 3PJXA 4DV3F 1KVIA 3JQMA 2FHOB 4J9RA 1IBMJ 1FK9A 1JJCB 3ZTSA 2NXCA 2V8DA 2QLJB 2XO6A 1Q8KA 2RDDA 3LWMA 5K9FA 3M05A 1OSDA 3DOKA 3I82A 2PO4A 1I1GA 3M8PA 3A12A 1HBOB 2L9NA 5EX0A 1JXLA 2PGCA 3TZZA 3CJ2A 3FQKA 2AJFE 4F2RA 4J9UE 2EFVA 2DR8A 1IBKF 1R8PA 2QIFA 4ZDNA 1KD1T 2CNKB 4LF4F 2YKMB 2DR6A 1J5OB 2H51B 2V8GA 1NU4A 1BD6A 2HNZB 5IT9U 3AODA 2N4CA 4NI2A 4JI7F 1IWGA 1XR5A 2LQ8A 5I4MA 2XY7A 4CM0A 4WKYA 2ZJPQ 5HAOA 4USHA 5HROA 3M6UA 1U1LA 5F3ZA 4O0NA 1SIWB 7FDRA 2XQCA 1W26A 2HIYA 1U47A 4LMZA 4YFUA 1N5VA 3JQKA 4YDXA 3P8BB 1FDNA 1RI7A 2JLFA 2F40A 3DDNA 4C98A 1RAEB 2PFFB 2GHPA 3V6DA 4C8NA 2AGOA 2WVCA 3SSSA 5A0YA 3AAWB 4HDHA 3C6TB 5L8RC 3TWZA 2XYHB 2GV1A 5IWAJ 4O3OA 2B51A 1K0VA 1XMQJ 3PTWA 2BKNA 4AYBD 1RXOB 2B56A 3JQJA 2V5HG 1REVA 3GYGA 5EWFA 4C11B 2I1RA 2UUCF 1WHXA 1KQFB 4KE5A 1GAOA 2J6TA 1IR1A 1VIXA 3GB0A 3IR7B 3I96A 1YGYA 2Y8WA 5F41A 3IBWA 1HFEL 3MEGB 3LUYA 2N3OA 4ETZA 4GRSA 5F0UA 2N7YA 1OY6A 5ITHA 3PIPQ 4TU7A 5M2RA 1WELA 2ZWPA 2UXBJ 5KFYA 3TX0A 5DDPC 2K8GA 2FZCB 2BJ3A 3UI3A 2VQFF 2R8HA 5AXNA 1MNEA 3M30B 3CDUA 3A13A 1NKBA 5HVGA 2LEPA 3AOBA 4A8MP 3D66A 3WDOA 2ZM6J 4P75A 3EDRB 3KJVB 4CWBA 2KG1A 1AT1B 1Q8BA 3R2DJ 2HZVA 1WG1A 4WTYA 2E7WA 5GAEU 4CLFA 4WU3A 2ALZA 1KBRA 2JVOA 4KGKA 2MLXA 4ED7A 2H48B 1OMSA 1RT6B 2HRYA 3CCUS 2F65A 4OI0A 3W9HA 4OV1A 3J7AN 1Q86T 1HR0F 5ETLA 5BYRA 2AHOB 2WW4A 4P72A 2E9TA 2HLUA 2AW0A 1WDDA 1KR4A 2MQ8A 2EKNA 2LVWA 2RQKA 1U2CA 1FJGJ 3F41A 2FPHX 4NWBA 2Z57B 2QLBB 4CQ1A 1T94A 3J7Z5 1TKZA 5HLFA 2QX0A 2VONA 2P6SA 4LF5J 3FJ2A 2OPRA 4H4OB 1C1BA 1RT4A 1S1UA 1TK0A 2CXEA 4TU9A 1TKTA 2XB2D 2HKEA 3ZZTA 4BC7A 1HA1A 2CPDA 5ETQA 2QO3A 4YY3J 1SJ4P 5CH7B 2CQ1A 4JUZA 4DR5F 4R5PB 1NJWA 4DI6A 3OBIA 1RU2A 1GXTA 4A8XA 2BANB 2C42A 2WZ1A 3OTCA 1AROP 2WVBA 2BM0A 1APSA 3THPA 4BLGA 2NXJA 2N3LA 5A6PA 3PYEA 1LNQA 3GIMA 2B9EA 4OJHA 1IKWA 4TYAA 3F56A 3HT3A 2H3EB 1TKDA 5E5NA 2Q79A 3WC0A 1X4CA 2BE2B 2P2CB 1T95A 4KHPF 4NLVA 3I31A 1KTVA 4IFVB 2JZ5A 9RUBA 3R5AA 3MMBA 2ROPA 1V5VA 2D3O1 1N36F 1LQ9A 1BQMB 3CJKB 3MEEB 4USKA 1QLNA 1AB8A 3AB4B 1YJWS 3L09A 1HMVA 2VBXA 4DV6F 1QAXA 3HZGA 1H38A 4N8OA 3G9CA 5IT0A 2F5GA 2U1AA 2B0GA 3MD3A 2IAJA 4F0MA 1C0UA 2AZ3A 2EFPA 4OZJA 1RT1B 5JUMA 2XZTB 1X9MA 2YNFB 2B6AA 4JI1J 5HI7A 4G1QA 3SDEB 2BKOA 3IRWP 3LAKA 4XIUA 3TAPA 2J6UA 3OHAA 2B8PA 4UUWA 2ZD1B 3N4WA 1X9SA 5KG2A 2EC2A 4UOFA 3M9MB 4FVMA 4OYPA 1S0OA 1S99A 4CO0A 3TO8A 2CVIA 2FLLA 2EFGA 3QFHA 4P7VA 4TNOA 1ZM3A 1GXLA 2YKNB 3HHLD 3MUVP 3JTOA 2B4VA 5K8PA 3DI6B 1TK8A 2HNDA 1MN7A 1N8RT 5DO2A 4J9SA 2NZCA 2XMWA 5KG4A 3HHLC 4CLTA 1RAFB 4P73A 1EQ0A 4TKTA 2Z30B 4ES3A 1Y10A 4OJ1A 3JSMB 3T3FA 1F5BA 3NNAA 1SB6A 5CQGA 1MMDA 2Y1RI 3AA8A 2ZZNA 2YX4A 3BQ2A 5L1JA 1M5SA 2AYMA 3UE2A 5L1IA 2CPFA 2X1AA 3PFOA 3IBCB 4CO4A 4DV4J 4K50A 2F4VJ 1XN9A 4OX7A 4HACA 4X4UA 3F44A 4X65J 3D68A 1WOOA 3UVJA 3TAQA 4PAAA 1LEOA 4KGVB 2RKIB 1JKHB 2VICA 5GADU 4JI6J 2BM1A 2K7KA 2QZ8A 4TLRA 2GAHC 3EPIA 1T9TA 2GS8A 4AD6A 3GE9A 5J2NA 4KPYA 4O3RA 2FD2A 4RUBA 3T1HF 4RJVA 2RF2A 2Z56B 2XCPA 1URNA 1TL7A 2WB1D 3LPYA 4USWA 2CQGA 3KK1B 2HPUA 2NCKL 4M5JA 3T41A 3I56S 4RNHA 2A0FB 3EZOA 1RZMA 2GC8A 3VCDA 2MZSA 3B6BA 3OVBA 1Y11A 1BE4A 1U2FA 4HI1A 4ID5B 2ZH7A 1NM2A 2CQCA 4O44B 1RWUA 1QJHA 2W7AA 1X4AA 4Q2LA 1FDDA 1RAHB 4O3SA 2M5YA 1Q5YA 4F25A 4C8LA 1IUJA 1G1XA 4WFAQ 4KR0B 3DOLA 2QEXS 7AT1B 5DG7A 4IFYB 2EKYA 2RQMA 1QM9A 3BKFA 2ZFHA 1Q7YT 3N6MA 4GO5X 1XQIA 3CJTA 5KT2A 1HBUB 1G3OA 1WWHA 3IAM9 4QOTA 3CCMS 4X66J 2VG5B 5ADZA 4EFAC 2QC3A 2EEYA 2VKRA 2EBGA 3MWBA 3G71S 5ETTA 4G65A 4DV7J 2DB1A 1UAWA 1TVRA 5KFVA 2O1PA 2KXNB 7FD1A 2CPHA 5KFHA 1JLCA 4YB5A 1SC6A 2DY1A 2IRUA 4HT7A 4IR1A 5F8JA 2PIIA 3ZTOA 3W2WA 3HDSA 3LQVA 5B0EA 4LF6F 2IM1A 5KAKA 1KS2A 5CYQA 2WW8A 3CCES 2IDEA 3W2VB 1CPZA 1HL6A 2CFXA 2B7BB 3OR1B 4ZLNA 1SH0A 2YKOA 3CXCR 3N6LA 2R8IA 2XULA 2HAIA 2VFUA 3L4BC 1T9YA 2XS7A 3TEHB 3NOCA 2ZH3A 4B9LA 2JLGA 4OI1A 2IRYA 4DS5A 3BSCA 3WX8A 3N01A 1C1CB 4CLWA 4F4WA 4DJBA 3DLKA 4QR1A 3I4HX 1YBAA 3MM6A 2HEKA 3EPGA 2HBQB 4HH1A 3T1YJ 1UWBA 5CYMA 4Q0BA 2ALYB 4N41A 3T1AA 2DGQA 4B3MJ 4IOCQ 2W8KA 3CW2C 1R6YA 4KFBB 3EWGA 3OSPA 2M2BA 2ATLA 4OHVA 2KB2A 3W9JA 2VC0A 3MDFA 5DGBA 4QU6A 3PJ9A 4QIFA 5C7PA 4RBTA 3QRPA 4NXMJ 1RT3A 4USIA 1NKEA 1DLOB 3NEKA 3AXKA 2X3DA 1PYTA 4D3GA 2CIMA 5J1PA 1VIOA 3IS9B 2DNHA 3P49B 5E0OA 2VG6A 2YWWA 4GKJF 3KLFB 4ANEA 4LRBA 1R8AA 2XZDB 5BYSA 2L41A 3BGOP 4OYZA 4ZPWR 3FFIA 1BUXA 2WB4A 2C28A 1IKVB 3V6JA 2BYCA 4O4GA 3VALA 3PCOB 3TOQA 3FSIA 1NNDA 1EP4A 1JLFA 1RK8A 1NSPA 2W2MP 4B3OA 3BGUA 4I64A 3QZ7A 4CZCA 1C2PA 4DR6J 2OPSA 5D4NA 1NJZA 2ACYA 3QGHA 2E1PA 1RSCA 5M2UA 4X4NA 3CMES 4EI2A 2UUBF 4PWUA 2I5JA 3EICA 3EZ5A 2UU9J 4YQWA 5DG9A 4DR2F 2EFOA 4DR1F 2FVPA 2HHWA 1FKPA 2EI5A 2G2OA 5B0GA 4I7FA 4MFBA 3KKFA 4YUDA 4DSLA 2XYGB 1IR2A 1RDRA 1KVKA 1C4AA 2OH2A 1D3WA 1RKJA 1FJ7A 3DRRB 5K8OA 4QIEA 4YOEA 2MGZB 2UUTA 1RT2A 2GZOA 2V2KA 5DQGA 2W4DA 4MKVA 2OPPB 3POTA 4GC7A 4MKBA 4WXWA 2RIJA 3RG6A 5CD4H 4LF8F 2HBYB 1M5PC 2M88A 2CJQA 5KG0A 1D8YA 1XMOJ 3AOAA 1ZAVA 4S0MA 4K4TA 4LFAF 5E3PA 4NLXA 1CBKA 2W4CA 4JOUA 1VS3A 2ASYA 1B99A 2HWIA 2R7QA 1ZZFA 2GMHA 3UCZP 3DXBA 3LOUA 1LXJA 3ONQA 3VF0B 3D6HB 3QIPA 4J9KA 3D9BA 2O66A 2VDHA 3FBEA 2DGXA 5KFPA 1R8BA 4ED2A 2QA1A 3PG9A 3QQCD 3R3TA 1SQGA 4FPIA 3EGVA 1ZTTA 3HKWA 3T9ZA 4KHMA 1WF0A 4RNOA 3P45B 3NMRA 2OELA 3PEJA 3T9NA 1CJTA 2R2RA 2KXFA 2R9LA 5AE1A 2NQPA 2LQ9A 2VF3A 2DXFA 3QRRA 3OSNA 3DU6A 5L9XA 2NXNA 1T9UA 2CJXB 1VLOA 3R5BA 4LSNA 4K0KJ 1VYAA 2FJAB 2ZWOA 4O3QA 3M4XA 4MTPA 2ZHAA 4LBPA 2DY9A 2DYAA 1WC6A 2WONB 2HHXA 4I56A 3CDWA 2F9JA 5EHHA 4R8UB 5LOQA 4LSLB 4HVZA 4F4XA 3D4JA 3MUMP 4F4AA 2KG0A 1CULA 1NK9A 4ZJQA 4PG6A 2MZJA 5J1EB 4OV6A 5GAGI 1VISA 1N56A 1K47A 4CYUA 2VJVA 1N34F 3QJLA 3E51A 3M32B 2LKZA 1UVKA 2E29A 4LQ3A 3CMQA 1GX6A 2GIRA 5ETSA 2FQQB 3TUZC 1DTQB 2LMIA 3IGVA 3TI0A 2EVZA 5KFDA 1Y5NB 2QMWA 2DGVA
chains in the Genus database with same CATH topology
4HTIA 2VD3A 2IM3A 2LXIA 2EC0A 3PW4A 2HIQA 3MI7X 4ZLPA 4Z37A 2FGCA 1N5YA 1FRHA 4ES2A 2BXJA 3U02A 4ALZA 4U7UK 2IBKA 2G4BA 4OLOA 4IKAA 3PIOQ 1KLNA 2GIQA 3D54A 5A8RA 2Z2MA 4OI6A 4DV5F 4DOZA 4B3RF 1H2UX 5T41A 4ELUA 1AFIA 1OQ3A 1P1LA 2GW8A 1UL3A 2YX1A 4MKAA 4CTAB 4X66F 2JC0A 3UDCA 1K0TA 2QA2A 3U1NA 3PEHA 4KQZA 3THTA 2JRSA 5KFGA 1CC7A 1SV5B 3MTJA 1X5SA 3HPOA 3BQ0A 5IM0B 2GQCA 2VZ9A 2HHVA 2V8VA 3PY8A 1E6YB 2DJWA 4CO1A 2MQPA 4X62F 1SH2A 3FCHA 3ISZA 3CVKA 3M2VA 5BR8F 1TZ0A 1HNXF 1VK3A 3FMBA 1QAIA 2NUUG 1WEXA 5I42B 2ZH5A 3MUTP 2Y1IA 1KFDA 3NGKA 1RTHB 3K57A 2CQIA 3ZC4A 1C1CA 2A10A 2DHSA 2ILZA 5HMYA 3FVYA 3MM7B 3B4MA 5CCLA 4TQSA 4F4ZA 1VQ4S 3DOKB 2PD1A 4PQUB 2XNRA 1IJEB 1M5OC 1IQZA 2DR9A 5HBMB 1FF2A 4X4OA 1CQMA 2I38A 3CC2S 4NA2A 5KFEA 1KQKA 3TNVA 3M9OB 3RAMA 5F8NA 2MKIA 1M0SA 1RT5B 2M52A 1M90T 2BABA 1MMNA 2A1BA 2RNEA 2OPQB 3H8YA 3MMJA 5THWA 1H2TZ 2NPIA 2X51A 4DSFA 1TQLA 3N5BA 1BQNA 3IRXA 4OZLA 1TV6A 3P6YC 2JEFA 4FF2A 2HGNA 4X4RA 4X4PA 3BEGB 1FD2A 2KYXA 2ZE2B 4XK8C 3NCQA 5GAGU 5E3CA 2Z0GA 1JJ2R 4HL9A 4KFBA 2K3IA 3KK3B 4YHHF 2HHQA 3LALA 5AXLA 4AL7A 3H4BA 1VOMA 3CCSS 4A8QA 4OL8A 3Q2TC 3PO5A 1IJFB 2JL9A 2NZ4A 1FNXH 2BA9A 1S79A 3TA0A 4RX6A 2DGOA 3M1VA 4MKYA 4IG0B 1X5OA 3BN7A 3G8QA 1S9EA 2Q43A 3ZZPA 4X64F 2UVWA 3HLUA 2B9YA 2R7OA 1KONA 2IFXA 1BY9A 3V5RA 4A8WA 4QWEA 3NBPA 2HNYB 1CVJA 3CC4S 1IXKA 1KQGB 2J0XA 1FVQA 3O8WA 3KLIA 3DLJA 3CDAA 4R0JA 1JLGB 4WE1A 3PO4A 2EK1A 2UP1A 4A8FA 2O01C 3QLHB 1PC5A 3H5XA 3LGNA 3OR2A 3ZZOA 2UXDF 2DVIA 1QVFR 5HN0A 4A47A 3QGPA 2R7VA 1WEZA 4JV2A 2QYCA 2RILA 1NEEA 5LL6d 4F02A 1RTIB 2LA6A 2JFKA 2XNQA 3I32A 2ZZMA 2ZH8A 1WI8A 2QLXA 2EWHA 1HW8A 1S4FA 3DGPA 3WBZA 3RBDA 1R0AA 5KT3A 2J7UA 2V9KA 1SJFA 1VRTA 3S7RA 2W7PA 3MD1A 1O51A 2LDIA 2DBBA 4ATNA 1FDBA 2CPYA 4ZPVR 4N76A 2M9KA 2YX7A 2YH1A 3TX8A 1MMLA 1HI1A 1NO8A 2MPUA 2V94A 5A8RB 1HQEA 3O2IA