2ZE2B

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 104
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B03
4I7FA 1R0AB 3DOLA 1VRUA 1FKPB 2ZD1B 4DG1A 3KK2B 3MEEB 1TP7A 5KFCA 4ECTA 3KLVA 3FDSA 2J6UA 4ZP8A 5KFWA 4IOBA 5DG9A 3CDWA 1S1VA 1T03A 2XGPA 3JYTB 5KFPA 1S6PA 2OPPA 4F4ZA 3QIPB 1TQLA 2UVVA 1HQEA 1RT1B 3ITHA 4TY8A 3H2LA 4LSLA 3KJVA 1GX5A 3KLGB 1JLQB 3PW7A 3H59A 5CYMA 4K4UA 3KLFA 1S0OA 2HNYB 3PZPA 2FVPA 3C6UB 4H4MB 4PQUA 1SUQB 2V4QA 4H4OA 2AQ4A 4IG0B 2ASJA 3MECA 1IKWB 1S1XA 2ILYA 5DG8A 1S48A 4ZHRB 3C6UA 4H4MA 3M8PA 2V4RA 3FSIA 1T05A 4MKBA 3CO9A 4R8UB 3CVKA 1RT2A 2OPSA 3KK1A 3KLGA 2YKNA 4NLRA 3PR4A 3DM2B 3V4IA 1IKYB 1S6QB 3KLIA 5F8MA 1U09A 4EEYA 5KFXA 4QWAA 4FS1A 4NLOA 1RT7A 4ED0A 5I42B 3RB4A 4TLRA 4K4VA 3M9MB 1LWFB 4KFBB 4DL6A 4RW8B 4RNMA 1JLAA 5C25B 1EETB 4KHMA 3PW4A 1OS5A 1HNIB 2I5JB 4FBTA 4NRUA 2C22A 3KOAA 3I5AA 4O44A 3DI6B 3DLKA 4RZRA 3M8QB 2BQ3A 2VG6A 5JXSA 3DM2A 1C0TB 1ZTTA 2AWZA 3OL7A 4IH5A 4NLUA 3RB3A 4K4ZA 4Y2AA 2HNDB 4IG3A 3HVTA 4ZP6A 4ECQA 3IRXB 4F4XA 4ECWA 5J2MB 3DRPA 2ALZA 4PUOA 1S0NA 1JKHA 2WONB 3V81A 3TAMA 4DL2A 1HNVB 5KFDA 5HROB 2IC3A 1TVRA 2YNFA 4Q45A 4M94A 5EWGA 2ILZA 3DYAB 1IKVB 4KO0B 1N6QA 1S49A 3Q8PB 4K4XA 2IM0A 3ITHB 3BR9A 4ED1A 5KT7A 3CIZA 4ED6A 3T5KA 2VA3A 3DLGA 3I5BA 3M9NB 4FBUA 3DMJB 2HMIA 1T03B 4NYZA 3T5LA 1LWCB 4ZPDA 4NLTA 1IKVA 1S1WA 2IJNA 4F4WA 3HHKA 2C2DA 1TKXA 1TVRB 4I2QA 5L1KA 1QAIA 3SFUA 3DRSB 1FKPA 5HROA 2YKMA 3JSMA 5DQIA 1C1CA 4LSNB 2FJXA 3RB6A 2E9RX 4RUCA 5KFOA 2XGQA 3IG1B 4J9NA 3MEGB 1HQUB 1C1BA 1JLBA 1RT3B 4RUAA 4Q8FA 3CJ2A 3BGRA 5I3UA 2AX0A 5F8GA 3NGDA 1XR6A 2IJFA 2XCPA 1S1UB 4TYBA 3GIIA 3H40A 4O3QA 4Q8EA 4DL7A 4JV0A 2JEGA 5D3GB 4URSA 4NLWA 1W25A 1TKZB 3BJYA 2ZE2B 2I5JA 4WYLA 2QV6A 3CJ5A 3CJ3A 1JIHA 4ZMMA 4IFYB 1IKXA 1DTQB 2BANB 1HMVA 1BQMA 1LWFA 3MR6A 4O4GA 3LP1B 4EYIB 5I42A 4IFVA 4RW9B 1RT3A 3I0RB 3HVAA 1GX6A 5KG2A 1HQUA 2JEJA 2F8EX 1XR7A 5KFIA 4J9RA 5KFFA 1REVA 5CYQB 3V4IB 3KLEA 2YKNB 4PWDA 4DL4A 4K4YA 1QE1B 2IAJA 3NAHA 1JLEA 2OPQB 5KFEA 3M8PB 2W9CA 2B5JA 5L1IA 1HMVB 1JLGA 4IFYA 1S1WB 2O5DA 2FLLA 2HAIA 3FQKA 1RT4A 1S9GA 4KSEB 5DGBA 2FJVA 2FVRA 5D3GA 1YVFA 4IQXA 4U6PA 4LSLB 4MH8A 3KJVB 4RNFA 4TY8B 3BSNA 3QGHA 2YNFB 1K1SA 5KT5A 2GIRA 4ED2A 4G1QA 4WFZA 2WONA 3KK3B 5KFHA 1JKHB 1TL3A 4QWDA 4LSNA 5KG7A 2D3UA 2IA6A 3H5UA 2R8GA 4M95A 1S0MA 5DG7A 3KMQA 4NCGA 3ISND 3MEEA 5KG1A 5KG6A 1TKXB 3HVTB 3UQSA 5K14A 1RTHA 2RKIB 1J5OA 3BSCA 3QO9B 4YP3A 4EBDA 1EP4B 3EPIA 1RTHB 3CJ4A 3N6NA 2ZKUA 3QLHB 3M8QA 4YQWA 4FS2A 3DI6A 3DLKB 2C28A 2WB4A 3DOKB 4XPEA 4WFYA 4EYHB 4HYKA 4I2PA 5J2PB 3LAKA 1TL3B 3KK3A 3Q8SB 1SV5A 5KG3A 4ID5A 2WOMB 4ZVGA 4RNHA 3N6MA 5KT3A 4LQ9A 1NNDA 1KLMA 3V81B 4ZPBA 4Q43A 2W9AA 4XO0A 1S6QA 1K1QA 3V6DB 1DTTB 2B6AA 2BE2A 4B3OA 1TKTA 4Q44A 1T3NA 2D7SA 4KE5A 1MU2A 4F50A 5KFLA 2GIQA 4O4RA 2DPJA 2R8JA 4R8UA 3H4DA 4EO8A 4NZ0A 3DLEA 3QLHA 1LWEA 1ZETA 1FKOA 2IM2A 1S1XB 3NMAA 3RAQA 4WFXA 4H4OB 3FQLA 4RW4B 1RT6B 2HNZA 1TL1B 4ICLB 3KLFB 3OHBA 5CYMB 4GC7A 1JLAB 4U7CA 4RU9A 4K4WA 4PWDB 3QIDA 2WHOA 4Y3CA 2YNHA 3QGIA 5JUMA 3OLBA 3OL9A 1XR5A 4ZP9A 2WTFA 3JYTA 5KFMA 3KHRA 1KHWA 2R2TA 5C24A 4K50A 1S4FA 4J9LA 1N4LA 3GIJA 1RTJA 1RT2B 1MMLA 1TL1A 4ICLA 4ECUA 2HWIA 4URQU 2W7OA 4KKOB 2FVQA 1IKWA 3MECB 2OPRB 1JLGB 2JC0A 1SUQA 4NLQA 4R5PB 5HBMB 1FKOB 1QAJA 2VG5A 5C42B 1JLFB 4RW6A 3DLEB 4RNOA 5DLGA 1C1BB 1JLBB 4X2BA 3MEGA 2IAJB 1QE1A 4ZP7A 3V6HA 1MU2B 3PW2A 1I6JA 1JLQA 1TKTB 3NBPB 2I1RA 3V6DA 4QWCA 4ECXA 2FJWA 1C1CB 4F4YA 4NLPA 2BQRA 2XC9A 3LAMA 5C5JA 4J9PA 4RW7A 1JLCA 3I0RA 2W9BA 2VA2A 2WOMA 4ID5B 1VRTB 3DRRB 4MK9A 5DQHA 3T1AA 5J2QA 4MKAA 3MEDB 4O3RA 1RYSA 1CSJA 1IKXB 2BANA 3ISNC 2E9TA 1NHVA 2QE5A 3OSNA 3V6JA 2J6SA 3TVKA 5F9LA 4Q0BB 2XI3A 3DOLB 3KMSA 3DLGB 5L1LA 3CJ0A 3IS9A 1SH3A 4KBIA 4ED7A 3RBEA 2DPIA 5HLFB 4HKQA 5KG5A 1ZTWA 5EDWA 4ECZA 3PJWA 3NBPA 3EPGA 3E01A 3T5HA 3BGRB 5I3UB 5KFAA 1S97A 3Q8QB 4K4TA 1FK9B 5FDLB 5KFZA 5T14A 2YNGB 3T19A 3Q8RB 4NCGB 2AGOA 2YNIB 2JEIA 1S1TB 5HP1B 1D1UA 2D41A 4O3OA 3BQ1A 5DLFA 3PW0A 4Y34A 3GIMA 2UVUA 4PUOB 1S1TA 3DRPB 5HP1A 2IMWP 4KKOA 2YNIA 1RA6A 4TN2A 2FLNA 2YNGA 3KLHB 2AX1A 4I2QB 3RB0A 2HNDA 2AGQA 1HYSB 4WXOA 3KHHA 5L1JA 4DL3A 4YR3A 5HLFA 2FLPA 1RT5A 1TV6A 2HMIB 4QWEA 1S9EA 4EBEA 2AGPA 4ED8A 5F8IA 3RBDA 2YNHB 4IH6A 4EBCA 4J9QA 4ECVA 4ED3A 1HARA 4KV8B 2BRLA 5J1EB 4KFBA 4Y2CA 3I0SB 2W7PA 4TQSA 3PVXA 2W9BB 5KFGA 1IM4A 4RW7B 3SI8A 2UUTA 1C2PA 5F8HA 4ECRA 5KFJA 4MFBB 1IKYA 5KT6A 5KFYA 1RTDA 2IM3A 4NLYA 4JUZA 3H5YA 3IRXA 3FFIA 2W8LA 1BQNB 4IFVB 1S9FA 4IG3B 1KHVA 3MR2A 1RTIA 3GV7B 1RTDB 4MK8A 4B3OB 2B43A 2FVSA 3BQ2A 4IG0A 4KHRA 2VG6B 1NHUA 2IM1A 4YR0A 4O44B 4K4SA 2E9ZA 3G6YA 3ICLA 2HWHA 4O3PA 5EWEA 1SV5B 2R8KA 5C25A 4WE1B 1RTJB 4RW8A 4H54A 2ATLA 2RF2B 5DQGA 4I2PB 5J2PA 3M9OB 1HQEB 1RT1A 5KFUA 4IRCA 2OPPB 3NAIA 3KHLA 3NL0A 5EUHA 3KLIB 1LW2B 5J2NB 4NLGA 1TV6B 4ZPAA 3CDEA 4NLDA 3UDLA 2CKWA 4QW8A 4GC6A 4ZVEA 2BQUA 1J5OB 4QW9A 2OPSB 3KK1B 3MR3A 2YKMB 3JSMB 3PJXA 1T05B 2JEFA 3UPFA 1QUVA 2BR0A 4YMEA 3CWJA 3GYNA 4IH7A 2R8HA 4IDKB 2ASDA 2JC1A 2BRKA 5KFRA 3DMJA 1LW2A 2HNYA 5J2NA 2AU0A 3LALA 3LP2B 4YR2A 3PR5B 2UVRA 4XPCA 2VG7B 2XCAA 3SFGA 2BE2B 3DYAA 4KO0A 1N6QB 3G86A 4IKAA 4NLXA 4TXSA 4RNNA 4WE1A 2VG7A 3QIPA 5F8NA 1S6PB 2IC3B 1S9GB 1HNVA 3TAMB 2D3ZA 2FVCA 3MFHA 3MFIA 5EWFA 3QZ8A 1RDRA 5KFVA 3MEDA 3FRZA 3QYYA 4O3NA 3OL8A 3GV5B 4IR1A 4O3SA 1VRTA 3DRRA 5KT2A 1VRUB 1JLCB 4WZMA 3FFIB 4I7FB 4TYAA 3IN5A 4J9MA 1EP4A 5KFNA 1RYRA 3QO9A 1RAJA 3KLEB 2RKIA 5K14B 4ZPCA 1LW0A 3BSAA 3PW5A 2UVWA 2JLEA 4WZQA 1DLOA 1HNIA 4RW9A 3BQ0A 4J9SA 1JLFA 4RW6B 2VG5B 3LP1A 1EETA 4O4GB 3I0SA 5C42A 5HBMA 4R5PA 2RF2A 1BQMB 4KV8A 5L9XA 5DGAA 1N48A 3MF5A 3C6TA 3LP0B 3H98A 4R0EA 3OLAA 3UR0A 1Z4UA 1RT7B 2RDJA 5F8JA 4G1QB 3TQ1A 1S9EB 3CDUA 3BREA 1HPZB 3I5CA 1RT5B 3DDKA 3GILA 1UWBA 4J9KA 1SH0A 3LANA 4KB7A 4TQRA 1S1UA 3RAXA 2EC0A 1HYSA 1RTIB 5C24B 3D5MA 4MIBA 4QPXA 2C2RA 1BQNA 3VQSA 2WK4A 1N5YB 5KG4A 3KLHA 4OL8A 2RDIA 4TY9A 4EO6A 3IG1A 4ZHRA 1RT4B 2XI2A 3H5SA 3G6VA 2R8IA 4ECSA 4NRTA 5KFTA 3C6TB 3LP0A 4URGA 3IGNA 3T5JA 4LQ3A 4MFBA 1T94A 4WYWA 2B5JB 3H4BA 4PQUB 1C0UB 2OPQA 2W9CB 1N56A 1JLEB 2HNZB 3DRSA 4IR9A 1RT6A 5KFSA 1C0UA 4RW4A 1JX4A 4KAIA 5F8LA 1D0EA 1LW0B 5J1EA 4G3IA 1REVB 5CYQA 4MIAA 2J6TA 3KHGA 5KG0A 5KFBA 4WXWA 1LWCA 3IS9B 3D28A 1LWEB 3OL6A 1S10A 3E51A 4ZVFA 3OHAA 2WRMA 1N5YA 2V9WA 4JV2A 3N6LA 4Q0BA 4IRDA 2GC8A 1SH2A 1S1VB 4DEZA 2W8KA 2CJQA 1DTQA 1DTTA 2B6AB 4NLSA 3H5XA 1UWBB 2XWYA 3QZ7A 3EZUA 1HPZA 3MR5A 4DL5A 5J2QB 2WCXA 1KLMB 3QGGA 2ZE2A 4ECYA 2ZD1A 4DG1B 3KK2A 1TKZA 3NKYA 3GIKA 3G6XA 3IGVA 3V6KA 1R0AA 2IBKA 2OH2A 3HVWA 5KFQA 4J9OA 3KNAA 3BSOA 2UUWA 2R2SA 2R2RA 2R2UA 5J2MA 3PHEA 2C2EA 5F9NA 1WNEA 4MK7A 1DLOB 3DOKA 3LP2A 4QWBA 3MTKA 5KFKA 1FK9A 5FDLA 3GQCA 3OSPA 2V0NA 3E01B 4NLVA 2ASLA 4JV1A 1RA7A 4IRKA 1JXLA 5KT4A 4IDKA 4ZVHA 3GV8B 2OPRA 1C0TA 3HKWA
chains in the Genus database with same CATH superfamily
2WZ1A 2HZVA 4DF8A 3PDNA 1FKPB 3EVMA 4GVBB 2BJ9A 3K59A 1TP7A 2JWNA 2GIFA 2FZCB 3FDSA 1EIYB 4ZP8A 3L7PA 5ITHA 3K8VA 1IBKJ 1S5ZA 2Z2YB 2FY8A 4DPUA 3T1HF 4AL5A 1NUEA 1WJ9A 3JYTB 2JSXA 3PYEA 4I0WA 4OJGA 3UN5A 5C2CA 3R97A 5KFPA 2MKJA 3P3DA 4DU7A 1GX5A 1HBNA 3AOCA 4JOUA 4UUXA 4JV5F 2AJ1A 2AD9A 1U26A 1TAQA 1SL0A 3KLFA 5D4NA 2K3IA 1B99A 1S0OA 4B9LA 1XN9A 1PGZA 2EKNA 1WDDA 3R5DA 8AT1B 1JNRB 4H4MB 4EZ6A 1ZOTA 2GQ2A 4NI2B 3MM8A 1U1KA 1N54B 2DKOB 3U02A 2ASJA 1IKWB 1S1XA 4LR9A 4IO9Q 5DG8A 2RSQA 1S48A 4ZHRB 4H4MA 2EWHA 3M8PA 5SZTA 4C2MA 2V4RA 5C2GA 3FMWA 2KFNA 1T05A 1R8CA 2MSSA 4MKBA 3SXLA 3PY8A 2XY5A 3CVKA 2OPSA 1RWNB 1VR6A 4YFUA 1OPIA 5ADZA 3DM2B 3V4IA 1IKYB 4A8YA 1S6QB 2A1BA 5D0HA 5F8MA 1U09A 3U27A 3M6VA 2CJBA 2V67A 2UUBF 4DPOA 4O23A 2XEXA 4K4VA 1YSJA 1LWFB 3WC0A 5HQ8A 4DL6A 2JLGA 4RNMA 6FD1A 3K5NA 1WEYA 3FCWA 1OS5A 1HNIB 3D66A 2C22A 4GVBA 4MYUA 4RZRA 2DR9A 2ZOMA 2BQ3A 1NK8A 2PI4A 4JI6J 2C1EB 2MQNA 4ZKAA 1ZTTA 4M5HA 5LMUJ 2AJ2A 2H5IB 3LW5C 3BO2A 4J37A 4IH5A 2R7SA 4K4ZA 3D1QA 2NPIA 1UAWA 4IG3A 4Y2AA 3HVTA 2KDOA 2UUAF 3EVWA 3IRXB 5ETNA 2CQPA 4LF8F 2CZ9A 3DRPA 3G82B 2ALZA 1U45A 3ETOA 2LEBA 2LQ8A 2WONB 3V81A 3TAMA 1RHMB 4A8SA 3ZZ0A 2OJ3A 1M1GA 3Q83A 3VAHA 4DR1J 1KD1T 2V4JB 2IC3A 2AYMA 1TVRA 2K8GA 4OFZA 5J1PA 2XLJA 1HHTP 2VUGA 3K2YA 2ILZA 1VQYA 1Q8LA 2MLYA 1IKVB 1DQAA 3Q8PB 4K4XA 1BLUA 4ED1A 3ITHB 5F3ZA 4ED6A 1OYEA 3M2VA 5KT7A 1KC8T 3DLGA 3M8ZA 2F8MA 3UVJA 2XMAA 4DX6A 3QJJA 3W8PA 1RWWB 2W2NP 2XZWA 3N0VA 3TOQA 3VAFA 2ERRA 2LXFA 3KNGA 2ZZTA 4C8OA 1T11A 1WC6A 5HROA 2H54B 1CVJA 3AA8A 2JZ5A 1R31A 3IBWA 4LSNB 2FJXA 3MPWA 3GSIA 3M6WA 1XMQJ 2E9RX 1DQ8A 2GVDA 3G2XA 2R7RA 1UKUA 4UW2A 3BPSP 3MEGB 1GXTA 1HQUB 3MM9A 2N7YA 4HDHA 3K57A 4LFCF 4RUAA 3NOCA 1SL1A 4DQQA 3BGRA 5A0YA 2AX0A 1SKUB 5F8GA 2M3DA 4CO4A 1EHWA 3LGHA 4OX6A 4TYBA 4CIOA 4KPYA 1NO8A 3O1LA 4NEYA 2GQQA 3LO3A 5D3GB 3GSDA 4URSA 3VV2B 5LSLA 5JMNA 1VBYA 4NLWA 4P9SA 1W25A 1KONA 2ZE2B 2I5JA 4WYLA 2Q1LA 2QV6A 2HRTA 4FVCA 4TLQA 1X4EA 2HVDA 4QCLA 4IFYB 3C15B 3FK4A 1HMVA 4M5KA 4O4GA 3IA0A 4ZOSA 5HL7Q 4EYIB 1UA0A 3I32A 3HVAA 3I0RB 2G0IA 2PO4A 3OTCA 5KG2A 2KG0A 2JEJA 1FE4A 2OD4A 4DFJA 5KFIA 2GMJA 1NDCA 3HFZB 4DPYA 1Q1KA 4YB6A 2XY7A 3KLEA 2MQPA 3PV8A 1RI7A 3M8YA 4OJ3A 3CD0A 1NKEA 3R5JB 1L3VA 1WOOA 4X66F 2IAJA 3VTIA 3EXYA 1SKWA 1XBWA 2DK2A 3NAHA 4EFAC 4KGVB 2L9NA 3RJMB 3MCMA 2W9CA 3P96A 2GFFA 3DRXA 4FXVA 5IQQA 1R8HA 5L1IA 1VBZA 1H7XA 3ET6A 1R43A 4C8LA 2O5DA 2MHNA 2HAIA 4PCQA 4DOZA 2AMCB 1RT4A 1B4SA 3PFOA 4BBYA 4X4QA 4BLGA 1GTEA 2BV3A 2Z2MA 3PIOQ 2FJVA 2CDQA 4CDIA 4F3MA 4OZ1A 1VQ9S 4IQXA 1CS4A 3WIVA 3KJVB 4MH8A 1VQMS 3C46A 3W60A 5EX0A 3BSNA 1WI8A 1K1SA 3NOGA 4N41A 1QY7A 1F3FA 1H98A 1FVSA 3L95X 3ZXWA 1CG2A 1FF2A 4LF9J 2DXDA 4OYOA 3NGUA 2CQGA 1W26A 4QWDA 2G2ZA 2DO0A 1Q5YA 1Y4ZB 2EFQA 4M95A 5KOWA 2IA6A 3G8QA 1I3OB 3ZZZA 2KFZA 4CH0S 3MEEA 3IR5B 1LFWA 4NXNF 4PPZA 1XK8A 3PACA 4MYTA 3ZZPA 5K14A 4M5DA 3PKYA 4KGXB 2V34A 1B70B 1NZ8A 5DRKA 3OVBA 4EBDA 1EP4B 2VFTA 5A8RA 3DU5A 3I4HX 2AYGA 3DI6A 4KPCA 4RBVA 4XPEA 4WFYA 3POTA 3OTOF 1UWAA 2IRYA 2QJ3A 1L3UA 3AD7C 1TL3B 2DGUA 3SQGB 1VC5A 4AFFA 3KK3A 2HEKA 3NS7B 3GFXA 3Q8SB 2NREA 4DN0A 2R7XA 3BKFA 1X0FA 4ENOA 1IBCB 2W9AA 2ADBA 1JJ4A 1CJVB 1DTTB 1VISA 2DGXA 1MW7A 3CCVS 4M5GA 2V8PA 3HD1A 4F50A 2UUAJ 1NDPA 4R8UA 4DJBA 3DRYA 4CRJA 3GP9A 2DR6A 3WHIA 2XO6A 2KM8C 3QLHA 3UN3A 4A8KA 1Q81T 2AJ0A 1Y3JA 1ZETA 3R2CJ 2RU3A 1Q16B 3DHWC 4J5OA 4PEOA 2CQ3A 1F60B 3NMAA 2CQCA 3R3TA 1PILA 2XS5A 3GLJA 4DR1F 2HHHF 1IR1A 2KB2A 2ZH9A 2HNZA 2OEMA 3KUEA 4YEAA 4OYIA 5E5NA 5LL6d 3W2VB 3PKMA 1N33J 5CYMB 2KG1A 1NK9A 1QVFR 2XTJP 3K8WA 2HFNA 3T9NA 3I31A 2YNHA 3QGIA 3LGMA 1XNRJ 1JJHA 3OLBA 2J9DE 1XR5A 3PJ9A 1HFEL 4ES3A 3CMAS 1TELA 2W2MP 2C3PA 2MKCA 4MTPA 2Z2LA 1O51A 1REGX 1UJ5A 3NY0A 2Z58B 4B3RJ 2XZDB 5CABA 3KJNB 2QL7B 2A6OA 1RT2B 1T9UA 1WC3A 4JV5J 1TL1A 5GAEU 1VCTA 5EGYA 2HWIA 1NDKA 4UF4A 4UTGA 2DNGA 3TUJC 1ROFA 3AQOA 1U1PA 4KKOB 2FVQA 1XMQF 1QUPA 1F6TA 1UVKA 4Y2MA 2GJ2A 1SIZA 2DEJA 4DV1J 2HPUA 4R5PB 3O8WA 4C0OC 1NK6A 5C42B 1X5TA 3GMGA 2RQCA 3DLEB 1EAYC 3HD2A 4ZA1A 2ZH3A 1C1BB 4X2BA 5DDQC 1N5TA 1TUWA 4ZP7A 3K0JA 1I6JA 1WUUA 3BEGB 2ZJRQ 4A8WA 4B9VA 1D8ZA 3H90A 5F41A 2DY1A 4WIQA 4CTAA 5DZ6A 3EX7B 3R2DJ 2P6TA 2G13A 3J81U 2M88A 1S6OA 3LAMA 3TZXA 1NB7A 4RW7A 4OHYA 1NKBA 4CWBA 5DQHA 4MK9A 4OLOA 2HFUA 4YOEA 5J2QA 4PQAA 1DQ9A 1KKHA 4RO0A 2F3JA 5CCLA 1CSJA 1IKXB 2BANA 1WHWA 2G0JA 2W7AA 2WB1D 2R7QA 3GFHA 3L9ZA 2BEFA 2CPFA 5RUBA 3J81Y 2E9TA 4W90B 3UWTA 2OP5A 5F9LA 2F40A 4N56A 1KTVA 2XI3A 2UXDF 3KMSA 5L1LA 4KBIA 5HN0A 2HQFA 2DISA 2YKQA 4ZIVA 3H2UB 4HKQA 4F8RA 4LSZB 1A6LA 2Y0SD 3HX9A 3E01A 2XMVA 3PJWA 2G1DA 4M1KA 3EPGA 2VH7A 2E1PA 2V2QA 1FK9B 3BYRA 3T19A 3Q8RB 2AGOA 1MROB 2YNIB 2KN4A 2W2OP 1YJRA 3ZFVA 4CLLA 4TU7A 3IC1A 2MKIA 1S57A 2KRRA 1WOSA 4Z37A 5IQ6A 4NASA 2K3KA 4NPOA 1SQEA 2YNIA 3TYTA 1RA6A 5EX3A 5I4MA 3KLHB 2XZTB 3R27A 2HQCA 3SV4A 3RB0A 2HNDA 4OYAA 1HYSB 4YN3B 2FJBB 5KAKA 2KL8A 2GGPB 3LTOA 5CHCB 4YR3A 2UUCJ 2J8AA 2LYVA 1PCAA 4HTIA 5IC4B 2J0QD 1N0UA 2V63A 3C66A 2J7UA 1S9EA 3VAJA 4EBEA 1ELOA 1RKJA 2CJKA 2LVWA 3ZTOA 2HW3A 1X60A 1VQ8S 4X4VA 1LEOA 3A8KA 3BB5A 4WFAQ 1M5HA 4B9SA 5F8IA 2ZJPQ 4ANCA 1SL2A 1PC5A 5DJBA 3WDOA 1OQ3A 1HWLA 4Y2CA 4NCBA 3AOBA 1NJWA 4PXEA 3PVXA 3JSRA 4FYXB 1NJIT 4RW7B 5B0AA 1U6BA 5HQLA 4C98A 4TU9A 3R5AA 4ZPTR 4DLEA 1V9OA 3W9HA 2HFZA 1HHSA 3CDAA 1RTDA 3H5YA 1Y5IB 1GMUA 3S7RA 3LPEA 3ONQA 2HQIA 3K58A 3FFIA 2IYGA 3KG1A 3FGVA 1FKAF 4IFVB 2J9EA 4UOGA 1E6VA 3QFHA 4ID8A 2DHHA 4USWA 1SBRA 4Z2XA 5L46A 1YGYA 4DR3F 1GXUA 3T1YF 1RWMB 3MM5A 4KHRA 1RADB 2VQFJ 2IM1A 4YR0A 5IZHA 4XTTA 1U1LA 2MTLA 3HXMA 4USIA 3ICLA 3B78A 2HWHA 3FVYA 2HK3A 3IAS9 5HO4A 2DTJA 4KYZA 2IFXA 3X1LB 2VBYA 1NLKL 4H54A 3DGPA 4MMOA 2MQOA 2ALYB 2AYBA 1HQEB 2W01A 3NL0A 2OPPB 1FTRA 1OMSA 1M5KC 3HHLC 3KLIB 5J2NB 4OYZA 4NLGA 4GKKF 3DCAA 4K2XA 1RAAB 1YJ7A 2MQLA 2NXEA 2YWKA 1LXNA 2CKWA 2C2KB 2GJIA 3T6BA 2RDDA 1MWQA 3KK1B 3FEYB 3PHTA 3MR3A 3VAIA 5DO2A 1GH8A 1JWWA 3JSMB 1RHKB 2AEJA 1X4FA 2FJEB 2JEFA 1FDBA 2HGNA 4I64A 4DX7A 4QIFA 3A3NB 4LF7F 1SC1B 2CQ4A 4HH1A 4YMEA 4BC9A 4QIWD 3FZBA 4I6WA 2BVZA 4LF4F 2JC1A 2BRKA 1IN0A 2NXCA 1MLAA 1B7YB 2W4DA 4OZ2A 2HNYA 5LJ3Y 5GADU 3OTBA 7AT1B 2C2ZB 2D9PA 4ZVOB 1R3NA 1WG5A 3PR5B 2UVRA 2DB1A 2HHSA 1CQNA 3GG0A 3R5CA 4CLKA 4F26A 1TK0A 3QAEA 1N5SA 5D77A 2VC1A 2JNJA 4C0HA 3EDRB 5B0BA 3TARA 2ADCA 1S9GB 1HNVA 1JNZB 1UPMB 5HMZA 2D3ZA 1JXVA 1R6YA 5EWFA 2Y9HA 3BF4A 4QZVB 3SQOP 4D3GA 2J9DA 4DR7J 1S0VA 1Q8BA 3BBFA 3POTB 3QYYA 2RVJA 2IPOB 3DRRA 3CJRA 5KT2A 3M6XA 1NBEB 1DRZA 2PI5A 1KVJA 5H9FJ 1U1MA 3NRBA 3MMCB 4DPTA 1EP4A 1HR0F 5KFNA 1YJNS 5B0EA 5K14B 2AZ3A 4M5DB 4USUA 2XG8A 2MQ8A 3VCDA 1VMBA 5G4DA 3OFGA 1YBAA 4RWXA 3FZ2A 4J9SA 2BE7D 4RW9A 1JLFA 2HFOA 4YR2A 5BYSA 5E3QA 2HFSA 2GHWA 2RF2A 3M7VA 1ZZNA 3ILOA 3MF5A 4U67Q 1PAEX 3G8SA 3PX6A 3IWNC 3CJSA 3H98A 3SCLE 1GTHA 3SSQA 5FD1A 1RT7B 4U7UD 2IY5B 5F8JA 3MM6B 1KEKA 2QEXS 3CEDA 4DV5J 4C97A 3CDUA 2W4PA 3LOUA 4UY8T 3AJ1A 4DV3J 2HBRB 3GILA 4RWWA 1Y5LB 3TJ8A 5A6PA 3RAXA 2VC0A 1B0PA 4QYZJ 4MIBA 1RTIB 3BKTA 3CCJS 4QPXA 2C2RA 1BQNA 2WK4A 3U1MA 2L41A 2K2PA 3D9BA 3KG0A 5D8HB 2RB7A 1RABB 4X84A 1RT4B 4CO3A 3CCTA 4TNOA 4EO6A 5BXIA 4KTQA 2Y8WA 1WHXA 3C6TB 2O66A 2Y3YA 4HHJA 4B9UA 4URGA 3T5JA 3I82A 1YBTA 1T94A 3MMAA 3WZ0A 2EFOA 3NLCA 1UEVA 1WTFA 2W9CB 3C3LA 1RXOB 5KFSA 4KAIA 5J1EA 2J0WA 1SI9A 3LGNA 1MNEA 4NCAA 1UVJA 1YJTA 2W4CA 4DDFA 2PEBA 1VQ7S 2DYAA 2H9ZA 3D28A 3LUYA 1LWEB 2QC3A 2J7WA 5E3PA 2AHOB 2WRMA 5HMYA 3G6ES 1YI2S 2E66A 2W8KA 1YWXA 4V19J 3CW2C 2XWYA 3GCXP 2HIQA 5B08A 3EZUA 3MR5A 2BM0A 4HLBA 3QGGA 1KLMB 1N33F 2ZE2A 3UCUP 3NKYA 5LM7E 3GIKA 2DITA 2HBZB 4ZPVR 4NXMF 3N28A 3DLJA 2ZUGA 1UVMA 3BSOA 1HBUA 5ETSA 2M5YA 3K5LA 5A0YB 3TJAA 5F9NA 1TZ0A 2K1RA 4MK7A 4QWBA 3CO0P 1UETA 2QZ8A 4GO5X 3UR3C 1UFLA 4RX6A 4X4UA 4WP3A 2UUBJ 4L73A 3JTOA 5IV3A 2HHUA 4V1Ak 2XS2A 1ZM2A 4IRKA 1JXLA 1OQ6A 4IDKA 1RBAA 2E7WA 2HGLA 3VAMA 2R42A 2CDRB 1RE1B 2XB2D 4DR4F 1UW4A 2NSCA 3B54A 1Q8KA 3OTDA 2W25A 2CFXA 3W64A 4LF5F 1HBOA 1VBKA 2P9GA 3D0IE 1BWVA 4DHVA 3OXFA 4QPTA 2J6UA 2KZZA 4J7CA 4J90A 3D0HE 3HZGA 5DG9A 4FPRA 4QBUA 2YKPA 4JI0J 2NXNA 3JB9k 4KR0B 4WIIA 3JAMY 3KXDA 3NXZA 2DGTA 4RUBA 5D0GA 2P5VA 1SQFA 2VQEF 2UVVA 2XS7A 5IWAJ 1RT1B 3ITHA 4B17A 3CCUS 1RCOB 4ZLLA 2ZHOA 2F9JA 2J0SD 1WWHA 3KLGB 1CC8A 1MSWD 1CJUB 3EICA 3HJVA 3NP5A 2HNYB 5FIIA 1QTMA 4ES1A 2FVPA 1ZA1B 2MLXA 5I3QA 2QA1A 3FEZA 4H4OA 4XAKA 4IG0B 2VBXA 4FYYB 4DUTA 4YB1P 3G82A 4B9MA 4K2JA 4DV7F 1F1BB 4LF1A 2CPYA 1VFJA 1R7IA 1G6BA 3CO9A 4ALZA 4QR0A 3KK1A 2BM1A 2HIYA 2FHJA 3CJ8A 3DKDA 4NLRA 1S72S 4LF6J 1RAFB 2E1RA 1XQIA 1LWXA 4HDGA 4ZITA 3KLIA 2B4VA 3EVOA 3VVTA 4EUVA 4EEYA 4Z7CA 1RT7A 3P5TL 2HHVA 4AQYJ 3HHLD 4TLRA 2LQBA 2IYIA 4KFBB 2V9KA 3L7UA 3NGSA 5MAOA 4DV6F 2JVRA 2BJ3A 3B6BA 1RB0A 4LUBA 3PW4A 3QPIA 3QWPA 2V5HG 1SJ3P 5IT9U 4W92B 3DLKA 1F9EB 3M8QB 1HR0J 1B3TA 4FF3A 1KQKA 3DM2A 1C0TB 1VHFA 1M5PC 1HL6A 2WVBA 3ZC4A 2DY9A 2I0XA 5IT9Y 5B7WA 3CCQS 4NLUA 3RB3A 1Y00A 2RS8A 4RJVA 1GNKA 3J80Y 2PEHA 4DF4A 2KRBA 2YKOA 3TUZC 4F4XA 1UPPA 1XIQA 5J2MB 3F56A 5CAAA 4PUOA 1RHUB 2J8SA 2IMOA 2BJ1A 1SPBP 2Z0GA 1VIXA 4QR2A 4DL2A 1FHTA 1SKRA 1HNVB 3H42A 4DV0F 4F4KA 2VL1A 4C7QA 2DNKA 5IT4A 2HAFA 4HR2A 4XIUA 4Q45A 4ATNA 2DNLA 1KR4A 1S49A 2IM0A 2PFDA 4LIWA 3FBBA 4FBUA 4WU2A 3PO5A 4DI6A 4NYZA 1P27B 3AODA 8ATCB 1LWCB 1QAXA 1FT8A 4ZPDA 4A48A 5GAGI 3S6EA 3EGVA 1Q82T 1S1WA 2IJNA 4Y28C 4F4WA 3SV3A 3J7YU 3HJFA 2C2DA 2DT9A 2B8PA 4N8OA 2EK6A 4F67A 2CADA 4NEZA 1MWYA 4PG8A 4IUFA 4QU7A 2ZZMA 3SFUA 1FKPA 2M9KA 4EK2A 3JSMA 3ELHA 3MD1A 2R7TA 1AXQA 1C1CA 2OUGA 2XMWA 3RB6A 4X64J 2MGZA 4I69A 3ZTRA 2UXCJ 4ED4A 5LT5A 2XGQA 4J9NA 3A3OB 3CTRA 3P8BB 5IFMA 2ZHAA 3MM7B 4YHHF 2RAQA 3O6QA 3TW0A 1FDAA 4JI3J 1S12A 4L74A 2QRRA 2EI5A 2OIHA 1AT1B 3SDEB 5A8KB 2OEJA 3DLBA 3CULA 4FF4A 1TKZB 2Q3PA 1KVKA 2MYFA 4ZCMA 4P52A 2MJNA 3N5BA 3MOZA 4EU0A 2MKSA 2ZH8A 1DBDA 2BXJA 1NPKA 1IKXA 2BANB 2U2FA 3FMBA 1Q8IA 3P45B 3M2UA 3PRDA 4PG6A 3QSYB 1E6VB 2MEWA 2CWXA 3MR6A 4LFAF 5I42A 4MIWA 4IFVA 1RT3A 3EZ5A 2QX0A 4JI5J 4TKTA 1GXLA 1QAYA 6FDRA 4J9RA 2DNZA 2YKNB 4PWDA 4U95A 2MKKA 2ACYA 2MZJA 4OLPA 1N5QA 2LU1A 2IRUA 3ILLA 4P7TA 2OPQB 2FHMA 3GIRA 1HNXF 2MLZA 1NSPA 3G87A 1PYSB 3M2UB 3NG8A 1RAIB 4L72B 2ZVIA 1LV5A 4ERDA 5H9FK 1M0SA 5EHHA 3FQKA 2VQEJ 1RISA 1UW9A 2DO4A 3VR1A 1HNZJ 4WFBQ 5ETLA 4P2SA 1YVFA 2DJWA 2GGPA 2AJ4A 1RHJB 1IWAA 4LSLB 2FHKA 2G9OA 2VPXB 4JI4J 4TY8B 5D78A 4RUHA 3QGHA 2YNFB 5KT5A 2GIRA 4ED2A 2RE1A 1WKJA 1QSYA 2EFNA 4WFZA 1N32F 1NU4A 2CRLA 5ETVA 5KFHA 1JKHB 1WEXA 1RZMA 3H5UA 4DR2J 1N36J 2P6SA 3KMQA 2PC6A 2PE8A 4F25A 5KOXA 1W2BR 3IMQJ 5KG1A 5ETTA 4QYZK 2NCKL 3UQSA 4PG4A 2XNQA 3HHLA 1NK0A 2KJWA 1B64A 5ETMA 1RTHA 2QSFA 2B7CB 2B8QA 4ETXA 1EQ0A 3TX8A 4FF2A 1RTHB 3CJ4A 5HANA 3N6NA 3HHLB 3QLHB 3KJFB 4EI2A 4YQWA 2WB4A 5HQMA 4NZ7A 3DOKB 3TUPA 2EVZA 2F9DA 2KKHA 2LCWA 2KYZA 3HFKA 3TZYA 3B4DA 3LAKA 3BO3A 4KHPF 2MB0B 4NA3A 2B3TB 1U6ZA 2L48A 2XWXA 3BGUA 4FKXA 1SV5A 3Q89A 4OQJA 2OFHX 1BUXA 5KG3A 5HVHA 2QG9B 2FY1A 1H3DA 1GAOA 2CPXA 3CMQA 2FQQB 3GE9A 1QTNB 4BHQA 4XO0A 1K1QA 1VDHA 4C3KA 5DDOC 2LMIA 3D6MB 4G1IA 5K5MA 5L39A 4K50A 2D74B 1KFSA 1WKLA 3MTJA 4O4RA 2GHPA 2KJVA 3NGTA 2UV8G 4UQTA 3PO4A 3DLEA 3HKZD 3KNAA 2CQDA 3BM7A 1VQ5S 2Z2ZA 2DR7A 1AFIA 4P6QA 1IXKA 4CLWA 2HHQA 3RAQA 2CPEA 1HKAA 4WFXA 1O6XA 1UL3A 1U1RA 1NJXA 1O5JA 4B9TA 4DV0J 1PKUA 3ISZA 4RW4B 2IJRA 3AD8C 4C11A 4GVLA 1TL1B 3J7YI 1YRUA 4DSIA 2HHWA 1NK4A 3GYGA 4K8RA 2PT0A 1RAEB 2V94A 5M2RA 4PWDB 2VB6A 4U7CA 1TFWA 4Y3CA 1FD8A 3QATA 2JJ4D 5JUMA 3OPKA 2MZTA 5GAGU 2WTFA 3NNHA 3GJQB 3KHRA 3SZ2A 2QLXA 2DH9A 4MT1A 4TU8A 2QFJA 4B3MF 3GIJA 2KVIA 1FDDA 1XNQJ 2CPZA 2LKZA 2RJZA 4HHUA 4P2FA 4U8YA 2KHCA 2VFVA 5HMXA 4ECUA 5E33A 2LXUA 3MMJA 3UW1A 1HBMA 4CH7A 1YTYA 3HI9A 3BZQA 1BGXT 4X64F 2YH1A 3SDEA 5A8KA 3D54A 4P2MA 2OPRB 4HHHA 3K5MA 4HT7A 2Y1LB 4CO2A 1QAJA 3HSGA 3NWGA 2VG5A 1F5AA 2CQIA 2XMTA 1VK3A 2Y1JA 1NMEB 1XNRF 3U7JA 2IAJB 3V6HA 2ZJQQ 2RRBA 1RKIA 5HSPA 2GX8A 2PSZA 4X65F 3D1HA 2F1FA 2OEKA 3ZTPA 2MGZB 1FNOA 3BGLA 1C1CB 2ZM6J 4F4YA 2BQRA 2ZOGA 2M52A 3HHNB 2OGUA 2ZBPA 5C5JA 2MSTA 1G3OA 3I0RA 2VF3A 4DQIA 1R0BG 3NCRA 2XULA 2LDYA 5L8RC 4F4AA 1TAUA 4O3RA 2V6AA 3QQCD 1PSDA 3SCJE 1RYSA 2PN6A 2M2BA 4DZ6A 3K5PA 1WDTA 3Q22A 2N7CA 4AL6A 2J6SA 5HI7A 4Q0BB 1T3OA 2E5HA 4B3SJ 2M8DB 3BO4A 3IS9A 4QQBA 2ZH2A 5HLFB 1SJRA 3NGKA 3VGUA 3N79A 3NBPA 3PRBA 3BGRB 5KFAA 2DXFA 3D6FB 2OFGX 4FZVA 4OYPA 2YNGB 4NYOA 4QYRA 4ED5A 1BHNA 2GW8A 7FDRA 2RQ4A 5M2UA 2JEIA 5HP1B 3OFHA 4O3OA 4LF9F 2QYCA 5JVGQ 2VKRA 2Y1RI 4I68A 2G2YA 2BX6A 4NZ6A 4OZ3A 4PUOB 3GIMA 1LOUA 3BN4A 1UTAA 3RTVA 1HNWF 2VODA 2FLNA 3M4XA 4LR8A 5AXMA 4FXDA 2CWKA 5CZVA 1CJKA 1W2IA 3KKFA 2VU5A 3KHHA 2DH7A 5L1JA 1CS4B 2KT3A 4RKUC 3KDOA 4DS5A 2O1PA 2ROPA 1D9AA 2ZWOA 3CCMS 2LU2A 2FLPA 4C4WA 1TV6A 1MMNA 4QWEA 1RWPB 3UVJB 2XGPA 4H4KC 3FKBA 3AFGA 4ZVTB 2M4MA 1U0HB 1VBXA 2EBEA 4EBCA 1YK9A 3OUYA 1N32J 4ED3A 1HARA 2BRLA 3PRVA 5J1EB 4KFBA 4LRAA 3RRKA 4E2FB 3QNWB 4UOHA 2MKHA 4B9NA 3P49B 2QSWA 1IM4A 1F9FA 4OHXA 1BQXA 2OI2A 2UUTA 2V2KA 5KFGA 4ECRA 3CD5A 2FTRA 1U25A 3PNIA 4J91A 2CYYA 3QGPA 4P73A 2X3DA 1Z1ZA 2ZNZA 2IM3A 2RHQB 3IRXA 5U47A 4OHZA 4ANDA 1HIYA 2W8LA 1BQNB 2E29A 1UFKA 1FRIA 4IG3B 1S9FA 1RTIA 1WF1A 2G4BA 3T6JA 4B3RF 2KI2A 4FYDA 4MK8A 4NMLA 4B3OB 1FO1A 2G2OA 2FLOA 2LP4A 2Z30B 3JSBA 3O5TB 4IG0A 3GPAA 2N3LA 4BWMA 1KDNA 1VQ4S 2P9CA 2L9WA 2UU9F 3P6YC 4DQPA 2OAUA 4F02A 1URRA 2OSRA 4O3PA 3L3CA 4DV1F 3EYZA 1Y10A 2R8KA 1CJUA 1V5IB 3RRGA 4DR6F 4WE1B 4HH0A 1NJYA 3IFEA 2RF2B 4LIRA 5DQGA 2CQ0A 4I2PB 5J2PA 1U0HA 3HHEA 1RT1A 4G6VB 3M9OB 4DV4F 4IRCA 2W1BA 3NAIA 2DHXA 5EUHA 3FNNA 1UFWA 1WKKA 1TV6B 3QRPA 3UDLA 2YWWA 1RK8A 4NLDA 4LREA 1L3TA 1KN6A 2LQ9A 4ZVEA 1J5OB 4DL0C 2OPSB 4QW9A 5HK4A 3HK2A 1J5EF 2V8GA 1T05B 3US5A 2R9LA 4A8MP 5DS7A 2LEPA 2X3GA 1UZHA 5GMDA 2UXBF 3LH2S 2HBYB 2R8HA 1FNXH 3QRQA 4IDKB 3CJQA 4N77A 1CEZA 3OFFA 3KWMA 2BOAA 1S6UA 2AEFA 1AUSL 3FSXA 5KFRA 2UXDJ 4DFKA 2MY7A 1Q86T 3LALA 4DXLA 1NHKL 4EWTA 2XCAA 3SFGA 5HATA 4I6YA 4DL7A 4CCHA 2RS2A 4WE1A 2DH8A 1PJ6A 2HLTA 4ZDNA 1PAUB 2VHGA 2VONA 4YUDA 2IC3B 4PXBA 1DHMA 2CZVC 2FJAB 2EW9A 1HNXJ 5AT1B 3TAMB 2FVCA 1FCAA 1IR0A 2WW8A 1VQKS 1U2CA 4CLUA 3H4DA 5LMNJ 3GV5B 4O3SA 2M7SA 3OL8A 3ETMA 2RNEA 3QT5A 1XWLA 4TYAA 3UNYA 2HS0A 3H8YA 2ZH6A 2NQPA 1G1XA 2ROEA 1H73A 2V50A 3DDNA 1E6YB 3TNVA 5B0CA 2ZFHA 3W5YA 2RKIA 1T02A 1VHIA 3FJ2A 4WTOB 5K20B 4ZPCA 3BSAA 3PW5A 4DMZA 2UVWA 1EX8A 4C8NA 2W2QP 3VGSA 3K5OA 1X4DA 4DS4A 1HNIA 2CNKB 4J9PA 4OI4A 2VASA 2VG5B 3LP1A 3N6LA 3OTEA 5L9XA 1Q7YT 3MMAB 1BQMB 2ATCB 1NXIA 3TA1A 1PG5B 2EG1A 1RUSA 3C6TA 1YJUA 2FPHX 1IVZA 3B4MA 1VGYA 3FBFA 3UR0A 1IBLJ 2CQHA 3MPVA 3OXLA 3QAUA 2Z57B 1Q95G 3TQ1A 4CYUB 4DFMA 2F65A 4K59A 2QMXA 1P8GA 1X4HA 2PMWA 2E5LF 3HHDA 3RR7A 2I38A 4A8XA 1S1UA 3BV8A 2EC0A 4JYAJ 5CYJA 1CJKB 1JQGA 4X62J 3BH6B 2DGQA 1OJ4A 2SXLA 4DSKA 5KG4A 3Q2TC 2AYEA 5GAHI 1CC7A 1WC0A 4TY9A 3IG1A 4ZHRA 3UCGA 3G6VA 1RP5A 4DUZF 4ECSA 5H9EJ 1HA1A 1GFWB 4F2SA 1URNA 1YZ6A 1NH8A 3CPWR 2GVZA 3IGNA 1HW9A 4LQ3A 1FXLA 2B5JB 1OYDA 3HSZA 3W1YC 3HVRA 4R25A 3EUNA 2VQFF 3DRSA 1C0UA 4RW4A 1D0EA 1P6TA 1R27B 3N9UC 1VIOA 2X1AA 3HSDA 4ER8A 2HQGA 2F5GA 1REVB 5CYQA 4UZCA 2OTLS 4JI1J 5KG0A 5KFBA 3MMCA 2D3O1 3IS9B 3THPA 1VQPS 3N5FA 1S10A 3D3BJ 3E51A 4ZVFA 3OHAA 3CC4S 4E0DA 4Q0BA 2DNQA 3NS6A 1SH2A 1H2VZ 1QDUB 2CJQA 2LFVA 1DTQA 3H5XA 4UOFA 2G1HA 4Q2LA 1SIWB 5DM6Q 4JI7F 3OJSA 2IDLA 3UDEA 2WBMA 3MR7A 2DNNA 5T7LB 4WZQA 3R6GB 3G6XA 2GZOA 2HFVA 2HZAA 2GQCA 5DM7Q 2OH2A 2BABA 1HNWJ 4MAKA 2QLWA 2RIJA 1ZM4A 1PBUA 4DPWA 4N7TA 4LF7J 3CD6S 2AJQA 4P10A 3MDFA 1X9SA 2XBPA 1OY9A 2QLBB 1V6HA 2JFKA 3DOKA 2C3YA 2JOQA 3MTKA 3CSKA 1FK9A 5KFKA 3GQCA 4NWBA 3CC7S 4GKKJ 1FWLA 2FJDB 3W5ZA 1KTQA 3E01B 3GONA 2LEAA 3HF5A 4NLVA 4OX7A 1RA7A 4ES2A 5IS2A 5B0GA 1X4AA 3LWLA 4OYXA 3GV8B 2OPRA 2CQ1A 3KUHA 4CLSA 4X65J 3FEXB 2PD1A 4I7FA 1R0AB 1FEEA 2BJDA 4DG1A 1ZS6A 5KFCA 5ETQA 4ECTA 3OV7A 1HD1A 1BD6A 3DC2A 3F73A 3RUBL 2RILA 5A8WB 1XMBA 3CDWA 1S1VA 4FPIA 4LR7A 2JHEA 3L7OA 2KO1A 4X4SA 2DHAA 4F4ZA 4ZVPB 2OPPA 1PIEA 4B3SF 1HQEA 4TY8A 2AW0A 4LSLA 2YQ1A 2UV8A 3R7NB 2RD5C 1P9QC 4HT5A 1Q7LB 4Q7AA 3UDCA 1L3SA 1J5EJ 2YTCA 3PW7A 4K4UA 4ILMA 1G4CA 2EXUA 2KU7A 2CIMA 1MMDA 2DGSA 4PQUA 3C6UB 3W66A 2CG4A 1FTCA 2WSFC 3OXGA 3MM5B 2ILYA 2RU9A 2IIHA 4USJC 3C6UA 2GMHA 3TANA 2A6MA 5CA5A 4LRCA 2Q6CA 2XMUA 5HVFA 3M2RA 3I9ZA 1RT2A 2C42A 5THWA 2E7VA 3CE8A 5H1SV 2H51B 3I56S 5LMNF 1U2RA 1DZ5A 2YKNA 2E5GA 2HG4A 1KFDA 3A8EA 4F0HA 1YLXA 3TEGA 3MXHP 2K7KA 1B7FA 2ZH1A 3AD9C 3W7BA 5KFXA 4QWAA 3RB4A 4ED0A 5I42B 2VPZB 3EDQB 5DZ7A 4KH0B 3M9MB 5HJYA 1K8AT 1T9WA 5GMKa 1YHQS 2ABYA 5K9FA 1KLNA 1FRLA 4FBTA 3KOAA 3I5AA 4O44A 1VLOA 4U96A 1TL5A 2VG6A 1WEZA 3PXGa 5D0EA 1HI0P 3UFCX 2CNNB 4ZJLA 5JVHQ 1ZAXA 2B51A 3ZZRA 4YY3J 3OL7A 4AD6A 3TI0A 1OY6A 2V4QA 2HNDB 2BJ7A 1ACMB 3DU6A 1RBOB 2QT7A 2D3OR 4BDPA 3DLLQ 5D4OA 3J81j 1T8EA 1T9VA 3OT9A 5AXKA 5T41A 2Q6BA 3S8SA 1S0NA 1JKHA 2R7UA 4PAAA 3AT1B 3SBMA 2XMKA 3V4MA 3GCWP 3JS9A 4O0NA 1FD2A 4DV7J 1IJEB 2YNFA 2HKEA 3ENQA 3IBCB 4WCEQ 1UA1A 4M94A 5EWGA 1NDLA 3D1OA 1EZZB 3DYAB 4KO0B 1WSVA 5DDPC 2VA3A 3BBBA 2HHPA 3CIZA 3TA0A 4DSJA 1AFJA 3M9NB 1H38A 3I55S 4IYQA 1GMWA 4GKJJ 2HMIA 1T03B 1YG0A 1N0VC 1YDLA 3CT9A 2YWFA 1FDNA 1AA1B 1IR2A 4NLTA 2H1YA 3N01A 4P75A 4KT0C 5IV4A 4LFBJ 3HHKA 1H0HB 2W24A 1RGVA 3IM8A 4ZJQA 1FJGF 2XHWA 1JJCB 5F0WA 3DRSB 1N34J 3RBZA 1U4BA 2YKMA 1NSKL 4I56A 1B0VA 4DX8H 4GRSA 2EFPA 5DQIA 4YB7A 2CJYB 4PYAA 4CLFA 1LNQA 4RUCA 4DV4J 1U1QA 5KFOA 4X4OA 4PG5A 3IG1B 3S01A 1QD1A 2FZKB 2VPWB 1C1BA 2XY6A 3UD3P 1RT3B 1WHYA 5I3UA 1XR6A 1IQTA 2IJFA 5B09A 1S1UB 2CJAA 4YDXA 2XCPA 4O3QA 4JI1F 4Q8EA 2HQDA 3A12A 2FZGB 4WKRA 3F41A 1NH7A 1H2UX 2GS8A 2H65B 4ZN3A 3MCOA 5ETKA 4Y2KA 4FF1A 3ET6B 4LBHA 1HI1A 1FFSB 3EE3A 5E0OA 3PX0A 1BQMA 1Y3KA 2DCUB 2GAGC 3LP1B 3MM7A 4P71A 4DLGA 3KUGA 4HI1A 2BKOA 2F8EX 3AXKA 1T0TV 4Y00A 2R7WA 3DXBA 4ITSA 3U1LA 4BS2A 2V8DA 3WX4A 5KFFA 4JI2J 1UVIA 3W63A 1S76D 4WKYA 3M30B 1E6YA 3UD4P 2MPUA 3G9CA 1WI6A 1ZPWX 1QE1B 5F0UA 3SCIE 4K4YA 3FSYA 1JLEA 1EKSA 2XSJB 4CLZA 2HZCA 2P8IA 2L08A 3CMES 2HVIA 1CPZA 3W3SA 3OQ2A 4DV6J 4DSLA 1HMVB 1JLGA 4DV2J 3QJLA 4IFYA 1S1WB 1F3VA 3BH7B 1S99A 2ZBCA 1M90T 1ZM3A 2H3EB 4DPXA 4KSEB 5CCMA 4WFNQ 1KVIA 1GMVA 3R8YA 3LQVA 5D3GA 1ITPA 3MHYA 1VQLS 3PEJA 4RNFA 4XDDA 3WBZA 3FCHA 4ZIWA 4X62F 4G1QA 4C9DA 1J2VA 2BUNA 2R7OA 4FYWB 3KK3B 1S59A 1TL3A 3SQGA 4LSNA 3ZTSA 5KG7A 3IRWP 1M5VC 2F63A 2HWTA 1S0MA 5DG7A 2EG2A 3VGTA 2KYXA 5LSOA 3VF0B 3ISND 2VOOA 1FESA 2FHOB 1HWIA 4PABA 3X3UA 1PYOB 2YXLA 2LA6A 4R0JA 1J5OA 3BSCA 1EKRA 4ILRA 3QO9B 2D1CA 3UN2A 3AQPA 5DDRC 5D15A 3M8SA 5E3CA 3CJKA 2ZKUA 3M8QA 2DNRA 4FS2A 3DLKB 2C28A 1SCJB 3FRYA 3ENWA 4F04B 3D6TB 2V2ZA 4I2PA 5J2PB 3OJUA 3THVA 2VICA 2HS4A 2KVQE 4J9VA 4YDDB 4KIAA 1FX2A 4ID5A 1P9YA 4ZVGA 3Q0AA 2GO8A 4RNHA 3N6MA 4LQ9A 1NNDA 1KLMA 3V81B 4ZPBA 4Q43A 4UY85 1U47A 3R5GA 5AE2A 1X31C 1VJWA 3V6DB 2BE2A 1V3RA 4B3OA 1TKTA 1RU1A 3KJQB 4CNYA 1R0CB 4KE5A 1MU2A 4MKYA 5KFLA 2GIQA 2DPJA 2WVDA 4OHVA 4YY3F 2O67A 3QT6A 4NZ0A 1TKDA 1FXDA 2XMJA 1LWEA 3JSYA 2VJUA 1TU0B 2NLWA 2W2PP 3VGVA 4H4OB 2MKYA 3KFWX 4CT9A 4OI2A 4FYVB 4CH1A 2LECA 3WC2A 5EN1A 1FJCA 3PYGA 1Q53A 1T9YA 2PDAA 4ICLB 2D69A 3EGNA 2ZBIA 3OHBA 3W62A 3DOMB 4GC7A 4PXCA 3TVZA 1F9HA 3THTA 3V5RA 3IR7B 3OUYB 3O3LA 2YX7A 4DV3F 1APSA 3TQEA 4JI5F 2HRYA 1Y7PA 2MMYA 1FERA 3IWLA 1KHWA 3FBEA 2R2TA 1SC3B 4OHWA 4DN9A 1VLYA 5CQGA 1SJFA 2J5AA 2X1GA 2DR5A 4OI0A 1RTJA 1S7IA 2KTQA 4J9UE 2HHHJ 3GTYX 4M5IA 4ETZA 1U1OA 5L9NA 2MQMA 1RWUA 2MDAA 2FC9A 4P74A 3MM6A 2W7OA 3D67A 4N47A 4QR1A 2IBOA 3CB4A 4KH1B 2YH0A 4NMXA 1IKWA 4HTJA 4AT1B 2GAHC 2JC0A 5E41A 1YIJS 3BKUA 3MM8B 2LDIA 1FKOB 3A3PB 1JLFB 4PRFA 4IOAQ 4WF9Q 2RHSB 3MEGA 3J7Z5 1WF0A 2A0FB 3PW2A 4U8VA 1GQEA 2I1RA 3NBPB 1VQSA 4B3TJ 3ZTQA 4QWCA 3G71S 3WQPA 1Y5NB 2F4VJ 1WC5A 4NLPA 5AXNA 1WNEA 4DUYF 2F7VA 1TMJA 4KGMA 4EGLA 3G96A 3EXCX 4CLYA 2WOMA 2W9BA 3DRRB 1X0PA 2VA2A 1FJGJ 1IJFB 2DXEA 3QT7A 1FEHA 2B4PA 3MPDA 1NHVA 1OSDA 1RSCA 2QE5A 2ZHBA 1V3ZA 3GZ7A 3RR8A 3D68A 5HMWA 3TVKA 3M8RA 5KTQA 1P1LA 2AP6A 4ZLPA 1XEZA 3OVSA 4I67A 3DLGB 2JDJA 3CJ0A 1SH3A 3TJ9A 5M2PA 2OMOA 3DGVA 4JB8B 2ZC3A 3I96A 4AL7A 3RBEA 4JI4F 3H0PA 1ZTWA 5EDWA 4LMZA 3T5HA 2PMHA 2WVCA 1U24A 2OO4A 2MXYA 1S97A 3ZO7A 4K4TA 3W2WB 3BBCA 5T14A 4ED7A 1I5OB 4NCGB 2JRSA 1NK7A 4PYDA 1WF2A 2QMWA 3MUVP 1S1TB 2DBBA 2ROGA 3M32B 1SB6A 2QLJB 2DCLA 3PW0A 3ENAA 2UVUA 1S1TA 3DRPB 2DGVA 2GNKA 4OZNA 4C8ZA 1HBMB 2COLA 4TN2A 1TFYA 4TVAB 3TX0A 4Y65A 4I2QB 4I4BA 1Q78A 4USHA 2CPJA 2CVIA 3OW2R 4CNZA 4DL3A 3IXQA 1FA0A 1N52B 1U1NA 3QSIA 1YRXA 2HRUA 2V8HA 4JI2F 1S4EA 3R5BA 4OZJA 3H20A 2XLIA 4DR5F 1VI7A 1I94J 2X1FA 4E98A 2VJVA 4ED8A 3RBDA 4IH6A 3DGPB 3MURP 1VK8A 5LOQA 2DNHA 1H6KX 2J9CA 2DNMA 1OY8A 2CZ4A 2X7IA 3MZIA 4HACA 1IUJA 1LXJA 2VPYB 2MY8A 3AJDA 3I4PA 1FXRA 3Q2SC 2W9BB 1UVLA 3F0NA 4C11B 5F8HA 4PPDA 4KGKA 2ZZNA 3QJPA 5KFJA 4MFBB 1KSPA 2QFIA 1IKYA 5KT6A 1QSSA 2F8HA 3Q8UA 4CM0A 1BC6A 5KFYA 4ZCLA 3ZZOA 1T9TA 4NLYA 3ZZYA 4A8QA 2HVHA 4PKDB 4Y6IA 3VVUA 2NUHA 4B3MJ 1AB8A 1KHVA 1UJ4A 1PC4A 3GV7B 1TL7B 4RBUA 1RTDB 5E3AA 3C2PA 5GADI 2B43A 2HLUA 3OD2A 3QRRA 1OIAA 1CJTA 1NHUA 3DN9A 3CCWA 4NI2A 5JJBA 3DFEA 3D7SB 2AJFE 3VALA 4K4SA 3MI7X 3ADAC 1LKZA 1UCNA 3I9V9 5EWEA 1SV5B 1FFWB 2RRNA 1YQHA 4V19X 5C25A 1LFPA 4OYWA 1FRJA 4W4MA 1RTJB 4RW8A 2ZEJA 3WX8A 4C48A 2ATLA 4A4JA 1JB0C 2V68A 3T41A 3HPOA 3MWBA 4G1PA 3KHLA 3IM9A 2VFSA 5BYQA 4C8MA 5SUHA 3AA9A 3BDPA 2NYHA 5IT0A 1TK5A 1XMOJ 3CD7A 4C8KA 1X5SA 3FUYA 1Q0NA 2PA3A 4L3KA 1JXEA 4FP9A 5A2QY 1GEHA 2UZAA 2IA0A 3UPFA 1QUVA 2NZ4A 3W61A 2BR0A 3CWJA 4IH7A 1CQMA 2APOA 4K5SA 3T1HJ 1K44A 3EM1A 1SVDA 4G65A 4Q2MA 2KFYA 1NZAA 2FGCA 1BMQB 1MROA 3DMJA 2FYXA 5J2NA 2NSBA 2XYHB 4ZS6A 3CCRS 2OD6A 1R8BA 2KM8B 1ICEB 4WK3A 4XPCA 3J7AN 2VG7B 3ULHA 5DETA 2BE2B 1HD0A 1N6QB 1ZAWA 4NLXA 3HZEA 4IKAA 4WP8A 4BCAA 4RNNA 2E5JA 3CNQP 2AIRB 2BJ8A 2CPIA 3EJMA 3QIPA 4Y0FA 1S6PB 1ULRA 3C16A 4XDCA 1FE0A 1PBAA 3M05A 1UJ6A 4QJVA 1F2HA 2NXUA 3CXCR 2MHEA 2DHSA 3OR2A 3QWUA 3DLHA 2FDNA 3VHQA 1RDRA 4FVMA 3BPDA 5KFVA 2UXBJ 3FRZA 4IR1A 3ILIA 4O0IA 1VRUB 1NSAA 3JTNA 3FFIB 4WZMA 3IN5A 1QJHA 3MAQA 2CNLB 3UDVA 4CM2A 3QO9A 3LA0A 4LBIA 1RAJA 2ZH5A 4QU6A 2XLKA 1XTZA 2JLEA 2ZITA 3OR1B 1KOHA 2I8EA 4A8OA 4F3OA 1DLOA 3AAWB 4CLPA 2BE9B 3BQ0A 2R7VA 5C42A 1EETA 3FBCA 2KXHA 2NPFA 4R5PA 1F5CA 3RAMA 4WBFA 4F0KA 2QA4S 4CO5A 5DGAA 3MMBB 1N48A 1X7VA 2E1CA 3LP0B 2CPHA 3SYZA 1UEKA 3D4JA 2VD3A 3A1YG 4G1QB 3MPUB 2RDJA 2M8HA 2YQ0A 4JI6F 1D9DA 5FLXU 1S9EB 1I1GA 3BYPA 1U8WA 2MZQA 1HPZB 2DEIA 3BREA 1M1KT 4J9KA 1UWBA 4RPFA 4KB7A 3ZNUA 1VRQC 2ZBRA 4TQRA 2XO7A 2XMMA 4WU3A 4B3TF 1HYSA 3VQSA 1V5VA 1N5YB 3W65A 3KLHA 1HWKA 4H4KA 2R8IA 3H5SA 3VZIA 4NRTA 3B82A 1A0OB 4OZ5A 1A9NB 1XERA 4WYWA 3O2IA 1GK8A 2JH3A 3H4BA 1QVGR 2C3OA 2B7BB 2JL9A 1N56A 2N4DA 1JLEB 1AROP 2HNZB 2IRXA 2XSJA 3VWSA 2ZOFA 3W2VA 2ZDPA 4OV1A 3W9IA 4IR9A 1VQ6S 2HK2A 1LW0B 2WBRA 1X9MA 3M30A 5E2QA 3S1TA 1FJ7A 5HJXA 2X51A 4LRDA 4MIAA 3KHGA 2Y1IA 1PJ7A 4WXWA 1LWCA 2LLZA 3OL6A 4DR5J 1I94F 2V9WA 3J80U 1WC1A 4JV2A 2RH3A 1N5YA 1XJWB 4HEA9 3TZWA 3F44A 4IRDA 3QMQA 4OYMA 3NNAA 3HCXA 1U8SA 1O0PA 3IWXA 1DTTA 4NLSA 1SQGA 3ZZTA 1KRPA 1UWBB 2ZH4A 1R8PA 1L3KA 1HPZA 1UVNA 2VKZG 5J2QB 3KDNA 2QMUB 2QA4G 2ZD1A 3KK2A 1ZZFA 3OFEA 2PGCA 2PMZD 1SKSA 3DHXA 3IGVA 4WP9A 2IBKA 4OX9J 4K0KJ 3HVWA 4M8LA 4QIEA 5KFQA 4NXNJ 3J7A1 2VBWA 3MMBA 2VFUA 4CTAB 3RW6A 4CLTA 2UUWA 4LF2A 2R2SA 2R2RA 2R2UA 4RBTA 5J2MA 5A76A 3TZZA 1SC4B 2YPYA 1YJWS 2C2EA 1DLOB 5AJ3F 3LP2A 4JI0F 4C3LA 4DZDA 5FDLA 4ZLNA 3J7ZT 3H25A 3OSPA 1N8RT 4WTYA 2V0NA 3CCZA 5LXYA 4JV1A 4C0BA 3HLUA 4L76A 3OTOJ 1C0TA 5B0DA 2H4WB 3RRHA 1X8DA 1VC6A 2F4VF 3K17A 3DOLA 2YX4A 2NS1B 1VRUA 4JI7J 2ZD1B 3KK2B 3MEEB 1O8BA 1BE4A 2AF6A 4AUKA 5IXUA 3PTWA 3JAMU 2L3MA 5D6GA 2XM3A 3KLVA 3HT3A 3CCSS 2HBQB 5KFWA 4DSFA 1H72C 3GYXB 4IOBA 3UCZP 2ZDOA 4NXMJ 3R9LA 1T03A 3AH6A 2PFFB 1C4CA 2HS3A 1S6PA 2J76E 2UU9J 3QIPB 1TQLA 1T95A 2A2CA 2AT1B 4OI6A 4F0MA 4MKVA 3G8TA 1NJZA 3H2LA 3KJVA 4JBCA 1QSLA 4NE9C 1JLQB 3LPYA 4CI0B 3G4SS 4ZVQB 2KT5A 1U02A 5CYMA 2RT3A 3H59A 2DRAA 1CULA 3C14A 4ZLJA 2DIVA 3PZPA 1SUQB 2BW2A 3TA2A 3W5XA 4DCJB 3W9JA 2V8VA 2IVMA 3MECA 1KOOA 3I87A 1TUGB 4JI8F 1K73T 1K47A 4C8YA 3MCSA 3DDIA 4OIXA 3FSIA 1F2GA 3RU0A 3UD5A 4ZK7M 5IWAF 4R8UB 2BYCA 2CQ2A 4ZPWR 4AYBD 4I6AA 5F3TA 3I6PA 3KLGA 4ZJOA 4ZCIA 3PR4A 4X66J 1RWOB 2A18A 2CNOB 3HT0A 2Z56B 2NYIA 2Q43A 3GR0A 3OBIA 1AUDA 2VV5A 4LF6F 3AB4B 4FS1A 4NLOA 2HHXA 3GJTB 2E1MC 3RGIA 3OVAA 2VIHA 1XC9A 4RW8B 1AZSA 2HVEA 2B4OA 1JLAA 2QIFA 5C25B 1GT8A 5IM0B 1EETB 2H4YB 4KHMA 1IBMF 1DFDA 4ELVA 2I5JB 1HBOB 4NRUA 3DI6B 2DHGA 2JFDA 5JXSA 5A8RB 2E5LJ 2HVZA 2ZM6F 2AWZA 5K8OA 4OV6A 3M6UA 2ZKTA 2EEYA 2DGWA 4ZP6A 1BXNA 1X5OA 2YQ3A 4ECQA 5HAOA 1RLDA 3BGOP 3MM9B 2A2DA 3QT8A 2K1RB 4B08A 4I1TA 4ECWA 2LXIA 2GVDB 1HBUB 3D0GE 4N8NA 4LVNP 2RUGA 2DGOA 2BKPA 1RWKB 3C8YA 5KFDA 5HROB 3U1NA 3C16B 3L09A 4IQMA 4W98A 1K0VA 1N6QA 2LQ5A 2B0GA 1J27A 3C19A 2JX2A 3RBXA 3BR9A 1YJ9S 1T7PA 1DURA 2MJUA 3T5KA 3I5BA 2EK1A 4OI1A 3HFVA 3T3FA 3DMJB 4UOCA 1TMMA 5J1NA 1U7LA 3UE2A 2DIUA 3T5LA 1RU2A 3ZZUA 1DJ0A 2GCFA 3E8OA 2V69A 3HDSA 3HULA 1IKVA 1OSCA 2GJFA 1A7GE 1TKXA 2M0GB 1TVRB 4I2QA 5L1KA 1QAIA 4D3HA 1U48A 2BDPA 2WSCC 2DNYA 4DR2F 1N36F 3EGZA 1MWZA 2XNRA 2KT2A 2EPIA 3M1VA 4PWUA 1ZBTA 1Y9OA 2VDIA 2HGMA 4OX8A 3HMJG 2H5JB 1N5VA 1IQZA 4K5RA 2KZMA 1JLBA 4PG7A 4Q8FA 3CJ2A 3GJRB 4BWJA 6AT1B 2AV5A 3NGDA 1AW0A 3GIIA 3H40A 4UUWA 3C15A 4JV0A 3MCNA 2JEGA 1H2TZ 3GFYA 4UT4A 3SMZA 4DCOB 4A47A 4FKYA 5T7LA 3BJYA 1N88A 3FC9A 3CJ5A 4X4NA 2G0CA 1WHVA 3CJ3A 1JIHA 4ZMMA 1MN7A 2QN6B 1NCLA 1DTQB 4NX9A 2I9SA 4F2RA 1LWFA 2QLFB 1TL7A 4CZCA 4N76A 2V2VA 4RW9B 4FDFA 1D3WA 1GX6A 1R8AA 3IO1A 1HQUA 4IO1A 1KP6A 1XR7A 1REVA 5CYQB 3V4IB 1LK7A 3MEKA 3JQMA 3H2VE 3NS5A 4USTA 4RLEA 2CA9A 1S79A 4YB5A 4DQRA 3CDBA 4EMDA 4DL4A 2XQCA 4DUZJ 5ETRA 5CXTA 2X1BA 2CVEA 5KFEA 3M8PB 2IDEA 2B5JA 2CXEA 3QBCA 3HM9A 2HHTA 3VZHA 3R1HA 2FLLA 3P4UB 1ZPVA 1RWXB 4WJBA 2O3DA 4IOCQ 3PG9A 1S9GA 3VAGA 2OSQA 1EQMA 2WVEA 5DGBA 2FVRA 1IWGA 2Y8YA 2ZUAA 2YX1A 1DARA 1HBNB 4U6PA 4LRBA 4FNIA 4AE5A 3MGJA 4HI2A 5LSRA 1R6VA 2IHR1 3A8JA 4LJMA 3L4BC 2V4JA 3JTPA 1KNZA 2GV1A 2CPDA 4UQGA 2WONA 3A13A 5IOLA 2UP1A 1TK8A 2HYIB 4DBQA 2VFRA 2XYPB 3EZOA 3M1VB 2D3UA 3DOMA 3GFZA 3MAHA 3HP6A 1RBLA 3MUMP 2R8GA 4NCGA 1TUVA 5LJ5Y 9ATCB 1SXLA 3W2WA 5KG6A 3JQJA 1TKXB 3HVTB 2BKNA 4HL9A 4WPAA 2EC2A 2WSEC 2RKIB 2BW7A 2R4FA 4CT8A 4YP3A 2QO3A 3EPIA 2GO9A 4M5LA 5E3RA 3PEHA 3K89A 1WG4A 2BJEA 1Y0HA 2QA2A 2AZ1A 4RU2A 5CH7B 1YRTA 4EYHB 2KXFA 4HYKA 2P2CB 3EWGA 3D6HB 3LWMA 3TAPA 3EMTA 1NK5A 2J0XA 5D4PA 1N34F 1QLNA 3RG6A 4M5NA 5A6WA 4C3MA 4DV2F 2WOMB 5KT3A 3SSRA 4DFPA 3DXSX 4FNHA 3TP2A 1BY9A 4K0KF 1HNZF 1S6QA 2VBZA 3GG1A 2B6AA 2FGOA 1T3NA 1FRKA 2XHCA 4Q44A 1NPPA 2D7SA 3GWCA 2D9OA 1HHQA 2BZ2A 2P9EA 2R8JA 3AOAA 4EO8A 4WWSA 5AJ3J 4Z7YA 2N3OA 1FKOA 1WACA 2IM2A 2POKA 4CQ1A 1W7WA 2EFGA 1S1XB 1FJEB 1X5PA 3NMRA 1ZA2B 5BJRA 5D0RA 2B9EA 1XNQF 2Z4PA 3PX4A 3FQLA 3O44A 4USMA 2YWEA 2JVOA 4OX9F 3VAKA 1RT6B 1TR0A 3R6LB 4ILLA 1KQGB 3KLFB 3M8WA 4F36A 1TTHB 1IBMJ 1JLAB 5IM0A 4RU9A 4K4WA 1LQ9A 3QIDA 5CD4H 3CC2S 2WHOA 3AY0A 1YBUA 4DSEA 3OL9A 1FWPA 1JMTA 4ZP9A 3JYTA 3BN7A 5KFMA 2DD8S 5CD4A 4DR3J 1OPZA 5C24A 4CO0A 1FWKA 1WTBA 1FVQA 1PYTA 4KY3A 1S4FA 4J9LA 1RJJA 1N4LA 2N4CA 1H74A 4E8UA 1D8YA 2WAQD 3KG4A 1DY3A 3PIPQ 3CCES 3T1YJ 2I2YA 3SSSA 1CBKA 1MMLA 4ICLA 3IP0A 2ZVSA 1KBRA 4URQU 1CLFA 1VQNS 1U49A 1BWEA 3AJ2A 3Q8YA 3ILJA 5GVQA 2OTJS 2E5IA 3CUNA 3MECB 1Q5VA 1JLGB 4NL5A 4LFAJ 1SUQA 4NLQA 5HBMB 1EARA 4RW6A 1IBKF 4RNOA 3AXMA 5DLGA 1JLBB 1CULB 2PIIA 3C14B 4KGZB 2H48B 3NEKA 1QE1A 3IAM9 1YJVA 1MU2B 5ETPA 4DCPB 3KTQA 2A10A 1JLQA 1TKTB 3PM9A 4Q5VA 3V6DA 4ECXA 4OYBA 2FJWA 1UZDA 2ZC4A 1UMJA 3R7SB 2UUCF 4DR4J 2XC9A 2QTWA 1HLWA 2L9DA 1U2FA 1JLCA 2YVSA 3MPYA 4YS2A 4X4TA 4ID5B 1VRTB 4UZBA 3T1AA 4KHPJ 4MKAA 3MEDB 1HQ2A 1YX2A 3RYLA 4JI8J 3Q24A 3TO8A 1PO6A 3ISNC 1NAQA 3OSNA 3V6JA 5D4LA 4S0MA 4P2XA 2DR8A 4DR7F 2U1AA 4OMFG 2K7JA 2AKWB 4MJKA 4LF4J 3DOLB 5K8MA 3R1LA 4EZ9A 3LF0A 1ZH5A 1FFGB 3CGIA 2C3MA 1NEEA 3BGFA 3PFEA 3CJKB 1VQOS 2DPIA 2IVFB 5KG5A 2QYGA 4GKJF 4ZVRB 4ECZA 4X4RA 5I3UB 1RCXB 3R7BB 3Q8QB 1RWVB 5FDLB 5KFZA 4L3NA 2C2MB 2B4UA 2RMLA 3W8GA 4DUYJ 2YWGA 1Q79A 1D1UA 2D41A 2C3UA 2Y0BB 3BQ1A 5DLFA 2OMLA 3TAQA 4Y34A 1ZYQA 1L5UA 3QFWA 3PCOB 5HP1A 2FC8A 2CG8A 2PA8D 4KKOA 3JXOA 2KXNB 3CF5Q 2IMWP 2YNGA 1G7CB 2AX1A 1SC6A 1YZ7A 2CUYA 5IC6B 3SCKE 1F5BA 1S7HA 2AGQA 4WXOA 5I3PA 5HLFA 1RT5A 1Z2ZA 2CJXB 2HMIB 5BR8J 4A8FA 1QM9A 1P1TA 2BBEA 2HQ3A 1RHRB 2AGPA 1SJ1A 2WW4A 1IM6A 2CAJA 2YNHB 4J9QA 1KWMA 2RUSA 2YBVA 1AZSB 4BC7A 1WSRA 4KV8B 4QOTA 4ECVA 1LK5A 3HO1A 3I0SB 2W7PA 4TQSA 3IR6B 4DV5F 2VZ9A 3MAAA 3SI8A 4ELTA 1C2PA 5FLXY 4M5JA 2FD2A 2BA9A 3NCPA 3TVYA 4RL1A 3GU0A 2QGFB 1WD6A 1GMWD 3WIUA 3MUTP 4N5SA 4KJIA 3E2EA 2FUG9 1DAXA 1EJ7L 4JUZA 9RUBA 4X4PA 1K9MT 4PXDA 3DNCA 1X4CA 3CCLS 3MR2A 2IVYA 2DRBA 5B0FA 1Z2LA 1U0SA 1UP1A 1EB0A 2FVSA 3NGRA 1CJVA 1NB2A 4QIVA 4PR6A 3BQ2A 2VG6B 1FRMA 4FXWA 4M5MA 2E44A 2Z8QA 3D2WA 1RAOA 4O44B 3E3XA 2LQJA 3IBFB 1KQFB 3A4TA 1S77D 3MAAB 4QIGA 3G6YA 2ZBQA 3AHPA 2E9ZA 1SJ4P 4FN5A 4GO7X 1D9FA 5AXLA 3PYFA 3Q8VA 4KRWA 4WK1A 5C7PA 2B9YA 2EBGA 3N4WA 4L75A 4LFBF 5KFUA 4OJHA 5FJ4A 3OR1A 1HI8A 4ANEA 1LW2B 2J7KA 2XSFA 3PYDA 4C6AA 1C4AA 2I6WA 2HURA 4ZPAA 3CDEA 1FRHA 3P5BP 4ELUA 2MZSA 4QW8A 4GC6A 3SIPB 2NZCA 2FB0A 2XYGB 3TRGA 1RAGB 2BQUA 3SEOA 2M70A 4F7VA 5HVGA 5K8NA 3M2RB 2YKMB 1FNMA 5G0RA 2EFVA 3PJXA 4OI3A 3JQKA 4B02A 7FD1A 2E7XA 1I51B 2CJ9A 1R89A 2CQBA 2O01C 2RQMA 5G0RB 1VC0A 4LF5J 4DX5A 3NNCA 2BMBA 2EKYA 3GYNA 4AXIA 2ASDA 1X4GA 4U9RA 1NSQA 2OHDA 5A2QU 1RACB 1WORA 2B9WA 3ENVA 2OKQA 1M1HA 2ZNYA 1LW2A 4NYPA 2B9XA 2NR0A 3TUIC 4KQZA 3LP2B 2R3VA 2AU0A 5ETOA 4A46A 3UO0A 1KQSR 1F0XA 4OJ1A 3DYAA 4KO0A 2BACA 2KHDA 2NXJA 2ZWPA 2H5EA 1Q4RA 3G86A 2VG7A 1VYAA 4TXSA 1YITS 1XMOF 5F8NA 4KC5A 3BS9A 3GR1A 3Q23A 4LF8J 2DRDA 4Y2IA 4JP8A 4LBPA 4OZ0A 3V2UC 5K8PA 3MFHA 3MFIA 1M5SA 1FRXA 2FIUA 1ZM9A 3QZ8A 4ZN1A 2B56A 2JLFA 4M63A 3MEDA 4O3NA 1AYEA 1MG7A 1VRTA 2MQQA 1JLCB 2FHJD 3MD3A 3UNGC 4I7FB 4CO1A 4J9MA 1WELA 4HVZA 2MZ1A 3ZNJ1 5LMUF 1V3SA 1OO0B 2HSEB 1RYRA 3KLEB 3FCVA 4GMKA 1LW0A 1FX4A 4NA2A 4RR5A 2GHVC 3RZAA 4AQYF 3TR5A 1HWUA 2QL5B 1T9XA 4RW6B 3GJSB 1ZAVA 1RAHB 4O4GB 3I0SA 4LT6A 5HBMA 4PZVA 4F3QA 2RRAA 4KV8A 2VDHA 2YPZA 3NWRA 1X4BA 1HW8A 3RW7A 4R0EA 3OLAA 1SJQA 1Z4UA 2Q79A 3A8IA 3AB2B 4CP5A 4DR6J 2YY3A 2LA4A 4ZVSB 2N82B 5GMEA 2K06A 2GMLA 4ZCKA 1K0TA 4XK8C 1CJTB 1RT5B 3BDEA 3DDKA 3I5CA 3TEHB 1SH0A 3LANA 1VOMA 3B8HA 2YKAA 2C2OB 2ZH7A 5H9EK 4LRFA 2AQ4A 1U6FA 1M5OC 5C24B 3D5MA 4JYAF 3Q86A 1YKWA 1RHQB 4OL8A 2DVIA 2RDIA 2ACMA 4ZVUB 3VQTA 2XI2A 4LVOP 2QL9B 4DQSA 2E1AA 1VS3A 5KFTA 3TWZA 3LP0A 4P72A 5CZXA 1RQ0A 4MFBA 1WG1A 2DNOA 1X9WA 1IBLF 4PQUB 1KS2A 2C2NA 1C0UB 2OPQA 2F4FA 4USVA 1B0TA 1RLCL 2OELA 3D3CJ 2ASYA 3NCQA 5BYRA 2A3JA 1RT6A 4L6V3 2KH9A 1JX4A 4USKA 5F8LA 1NM2A 1H7WA 1WC4A 1FI4A 4HACB 2GVZB 4NOHA 3CJTA 5AE3A 4G3IA 2J6TA 2RQKA 3KYLA 3GB0A 4LFCJ 3CIMA 2OLWA 3MOJB 2GA7A 4OZLA 1MN9A 1NRKA 2MZRA 1OWXA 2GC8A 5BR8F 1S1VB 3M2VB 4P7VA 4AXJA 4DEZA 2VOPA 5A8WA 2B6AB 1NPRA 3UI3A 1TL4A 2YWHA 3OR2B 5LXRA 3QZ7A 4DL5A 4PWWA 2WCXA 4NA1A 2AEMA 4CYUA 4ECYA 4DG1B 1JJ2R 1D09B 1TKZA 1RTZA 3V6KA 2Q66A 5AE1A 1R0AA 8RUCA 2NUUG 2WVFA 3EGWB 1Y11A 2BOPA 4J9OA 2UXCF 5GAEI 3M32A 5GAHU 1G2EA 1UEUA 1VJQA 2DNPA 1JK9B 3PHEA 3HSJA 3T9ZA 5L38A 1WOPA 3K7RA 3H7HB 4JI3F 4DWIA 2ASLA 1PJ5A 4U7UK 5KT4A 4ZVHA 4K7QA 5MLCV 4YHHJ 1HWJA 3BR8A 5E7OB 1NKCA 4DU8A 3HKWA
chains in the Genus database with same CATH topology
4DF8A 3PDNA 1FKPB 3K59A 1TP7A 2JWNA 3FDSA 4ZP8A 3L7PA 5ITHA 3K8VA 3T1HF 4AL5A 2JSXA 3JYTB 4I0WA 4OJGA 5KFPA 2XGPA 2MKJA 3P3DA 1GX5A 1HBNA 4JOUA 4UUXA 4JV5F 2AJ1A 2AD9A 1U26A 1TAQA 1SL0A 3KLFA 5D4NA 2K3IA 1S0OA 4B9LA 1XN9A 1PGZA 3R5DA 4F2SA 4EZ6A 1JNRB 4H4MB 1ZOTA 2GQ2A 1U1KA 3MM8A 1N54B 3U02A 2ASJA 1IKWB 1S1XA 4IO9Q 5DG8A 2RSQA 1S48A 4ZHRB 4H4MA 2EWHA 3M8PA 5SZTA 4C2MA 2V4RA 2KFNA 3FMWA 1T05A 1R8CA 2MSSA 4MKBA 3SXLA 3PY8A 2XY5A 3CVKA 2OPSA 4YFUA 1OPIA 5ADZA 3DM2B 3V4IA 1IKYB 4A8YA 1S6QB 2A1BA 5F8MA 1U09A 3U27A 3M6VA 2CJBA 2UUBF 4DPOA 4O23A 2XEXA 4K4VA 1YSJA 1LWFB 3WC0A 5HQ8A 4DL6A 2JLGA 4RNMA 6FD1A 3K5NA 1WEYA 1OS5A 1HNIB 2C22A 4MYUA 4RZRA 2DR9A 2ZOMA 2BQ3A 1NK8A 2PI4A 4ZKAA 2MQNA 1ZTTA 3LW5C 3BO2A 4J37A 4IH5A 2R7SA 4K4ZA 3D1QA 2NPIA 1UAWA 4IG3A 4Y2AA 3HVTA 2KDOA 2UUAF 3IRXB 2CQPA 4LF8F 3DRPA 2ALZA 1U45A 3ETOA 2LEBA 2WONB 3V81A 3TAMA 4A8SA 3ZZ0A 2OJ3A 3VAHA 1KD1T 2V4JB 2IC3A 2AYMA 1TVRA 2K8GA 4OFZA 5J1PA 2XLJA 1HHTP 2VUGA 3K2YA 2ILZA 1VQYA 1Q8LA 3Q8PB 1IKVB 1DQAA 4K4XA 1BLUA 4ED1A 3ITHB 5F3ZA 4ED6A 5KT7A 3M2VA 1KC8T 3DLGA 2F8MA 3QJJA 2XZWA 3N0VA 3TOQA 3VAFA 2LXFA 3KNGA 4C8OA 5HROA 1CVJA 3AA8A 2JZ5A 1R31A 3IBWA 4LSNB 2FJXA 3MPWA 2E9RX 3M6WA 1DQ8A 2R7RA 1UKUA 4UW2A 3MM9A 3MEGB 1GXTA 1HQUB 4HDHA 2N7YA 3K57A 4LFCF 4RUAA 1SL1A 4DQQA 3BGRA 5A0YA 2AX0A 5F8GA 2M3DA 4CO4A 4OX6A 4TYBA 4CIOA 4KPYA 1NO8A 3O1LA 2GQQA 3LO3A 5D3GB 3GSDA 4URSA 5LSLA 1VBYA 4NLWA 1W25A 1KONA 2ZE2B 2I5JA 4WYLA 2Q1LA 2QV6A 4FVCA 4TLQA 1X4EA 4QCLA 4IFYB 1HMVA 4O4GA 3IA0A 4ZOSA 5HL7Q 4EYIB 1UA0A 3I32A 3HVAA 3I0RB 2PO4A 3OTCA 5KG2A 2KG0A 2JEJA 1FE4A 2OD4A 4DFJA 5KFIA 2GMJA 1Q1KA 4YB6A 2XY7A 3KLEA 2MQPA 3PV8A 1RI7A 4OJ3A 1L3VA 3CD0A 1NKEA 4X66F 2IAJA 3VTIA 3EXYA 1SKWA 1XBWA 2DK2A 3NAHA 4EFAC 2L9NA 2W9CA 3P96A 2GFFA 3DRXA 4FXVA 5IQQA 1R8HA 5L1IA 1VBZA 1H7XA 1R43A 4C8LA 2O5DA 2MHNA 2HAIA<