2ZE2B

Crystal structure of l100i/k103n mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
molecule keywords Reverse transcriptase/ribonuclease H
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 104
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ze2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ze2B03
1S6QB 3TAMA 2FVPA 3C6UA 4TN2A 3H5UA 3KHLA 2IAJB 1TKZB 2YNFB 4QPXA 1RTJB 1RA7A 2XC9A 3H40A 4K4WA 5C42B 4RW9A 3MECA 1RTIB 1FK9B 4F4XA 4K4UA 5C24B 2CKWA 5KFIA 3UQSA 4F4ZA 3G6XA 1C1CA 3QIDA 4RU9A 3DM2A 4YQWA 3IS9A 3LP0A 4QW8A 3CDWA 5DQHA 5DG8A 1QE1B 3HVWA 2AGOA 3Q8QB 5KG2A 4PUOA 3C6TB 2DPIA 2IJFA 2O5DA 1VRTA 1HQEB 4I2PB 4WXWA 3PZPA 3IGVA 2YKMB 3KLEA 3H5SA 4Q8EA 1LWEA 4TY9A 3HHKA 5KFVA 1IKYB 3LP1A 3KHGA 4ECUA 2EC0A 4GC7A 4WE1B 2JC1A 3E01A 2OPQB 5KFBA 3PVXA 4IG3B 1RT1A 1T03B 1BQMA 1D0EA 5CYQB 2R8IA 1JLGA 4R5PB 4NLPA 1LWFB 3PJXA 4ED7A 1U09A 4IR9A 1YVFA 5DQIA 3OSPA 3FFIA 5I3UB 3QZ8A 4ZHRB 2FLPA 3IGNA 4I2QA 2RDIA 1IKWA 3NBPB 2OPSA 4IH5A 3NKYA 3N6MA 1C2PA 3VQSA 1RT5A 2AX0A 4R8UB 4NLVA 4Y3CA 5EWGA 2W8KA 1FKPA 2UUWA 4TY8A 4Y34A 3M8QA 3D5MA 5C25B 1UWBA 4DL6A 4DL7A 2ZD1A 4H4OB 2FJWA 1W25A 3PR5B 4ID5A 5HLFA 4PWDB 4RUAA 3TAMB 4HYKA 4NCGA 2J6TA 3C6UB 3CDUA 3D28A 3IN5A 3PW4A 1ZTWA 2V0NA 1C0TA 3HKWA 4URSA 1S0OA 3NGDA 3M9NB 1XR5A 3EZUA 3CWJA 4RW9B 3I5BA 1JLFA 3MECB 4KHMA 3KLIA 3GIJA 2XI3A 1TVRA 4M94A 3MEGA 1C1CB 2JEJA 1RT3A 5J2PA 2D7SA 4IRDA 3DM2B 4NLDA 3IS9B 3I5CA 3EPIA 3I0RA 3LP0B 4ECTA 4RW6A 4NLQA 3GIMA 4PUOB 3KJVA 2W9BA 4K50A 1VRTB 4DG1A 1TKXA 2ILYA 4NRTA 3KLEB 5KT6A 4QWBA 1LWEB 5HBMA 3JSMA 4IH7A 4ZP9A 3LP1B 4K4ZA 2BRLA 1S1TA 2V4RA 4URQU 4ED8A 2D41A 3E01B 3KK3A 3DMJA 2XCPA 3MR3A 3H5XA 3MF5A 5C5JA 4O3SA 4ECSA 4DL5A 1RT1B 1BQMB 3KK2A 1HNVA 4NZ0A 2AGQA 2IM0A 1JLGB 3KNAA 5I42A 1NNDA 4ZPBA 5F8JA 2UVVA 3OL9A 1RT7A 1TL1A 5DG9A 4F4YA 4ED1A 3FFIB 3ISND 1RT2A 3KMSA 1J5OA 1RYRA 4I2QB 4O3PA 2W7OA 1IKWB 4B3OA 4KKOA 2OPSB 4U7CA 4TQRA 1K1QA 4MKAA 1RT5B 4ED6A 2ATLA 2IJNA 5F8MA 1FKPB 1S1WA 2FLLA 5KFXA 4TY8B 3ICLA 3M8QB 2JLEA 3CJ3A 1UWBB 2ZD1B 3KLGA 1GX5A 3RAQA 4ID5B 5HLFB 4NRUA 1KLMA 4NCGB 3UPFA 5T14A 5JUMA 5L9XA 2AGPA 4K4SA 4RW7A 1C0TB 3H2LA 4WFXA 4ZP7A 5J2MA 5KFCA 2FJXA 4J9MA 4ECRA 5KFHA 4FS1A 3OL6A 3T5KA 1JLFB 3DYAA 1C0UA 4MIBA 4TYAA 5KFJA 3KLIB 4MK7A 3DLGA 5KFKA 2UVWA 2IMWP 1TVRB 5DQGA 2FVCA 4MFBA 3PJWA 5KT7A 4K4TA 3MEGB 4XPEA 5KG0A 1RT3B 5J2PB 2AU0A 3H59A 3LP2A 2R2UA 3SFGA 3I0RB 4NLWA 1RAJA 2XGQA 4JV0A 4NLGA 1S6PA 4RW6B 3KJVB 2W9BB 4EYHB 4DG1B 4G3IA 3KLVA 3SFUA 1TKXB 4Q43A 2FVQA 3MEEA 3DOKA 1KHVA 1NHUA 3V81A 2IM3A 3UR0A 3OSNA 4LQ3A 3JSMB 5HBMB 3MR2A 2UUTA 2J6SA 1S1TB 1T94A 5F9NA 2ASLA 5DGAA 3KK3B 3DMJB 3BJYA 5KG3A 2HNYA 5KFFA 3MFIA 2HWIA 1LW0A 3KK2B 1XR6A 1HNVB 1QAIA 5D3GA 1CSJA 5I42B 4WZMA 2WONA 4QWEA 4RUCA 1RTDA 3OL8A 1RT7B 1TL1B 3V6DA 1TQLA 1RTHA 4G1QA 3JYTA 4PWDA 3G86A 3Q8PB 1RT2B 3OLBA 3KHRA 1J5OB 1S1XA 4NLYA 4B3OB 4KKOB 1SH2A 3T1AA 3ISNC 2F8EX 4LSLA 5KT3A 1S1WB 2B5JA 5KT5A 2VG7A 4ZP8A 1DTTA 4EYIB 1RT6A 5KFWA 3KLGB 2CJQA 1WNEA 3QIPA 1KLMB 4PQUA 1S49A 2VG6A 1EETA 1S9GA 1REVA 2IC3A 4KV8A 4RW8A 4RW7B 5J2MB 1Z4UA 5CYMA 4J9RA 2QV6A 3DYAB 4LSNA 1C0UB 4MK8A 4JUZA 2E9ZA 1SV5A 3DLGB 1JIHA 2R8HA 1N5YA 3FSIA 1HQUA 4MFBB 5EDWA 4EBEA 4XO0A 5J1EA 3QGGA 4O3QA 3LP2B 3RB0A 4TYBA 4TLRA 1S9EA 1N6QA 5F8LA 1S6PB 5KFQA 3DLKA 3EPGA 1TV6A 2IM2A 4O3OA 2BANA 3MEEB 3DOKB 2FVRA 3V81B 3DLEA 1LWCA 1JLAA 1RT4A 1N4LA 4LQ9A 4K4VA 1EP4A 5KT4A 5KFSA 2VA3A 2HNYB 4IRCA 1LW0B 4ZPCA 5J2NA 1N56A 5D3GB 2FLNA 3PW2A 2WONB 2W8LA 1RTDB 3V6DB 2C2DA 3NL0A 1RTHB 4G1QB 4IG0A 3JYTB 3M9OB 1S1XB 5EWFA 5EUHA 1JX4A 4J9QA 2WOMA 3MEDA 5KFRA 1HMVA 4LSLB 1MU2A 1D1UA 4QWCA 2B5JB 3KOAA 2VG7B 2XCAA 4ZVHA 3GQCA 1DTTB 3RBEA 5KFGA 1RT6B 2RF2A 3KLFA 2ALZA 3QO9A 2BQUA 3QIPB 3LANA 4KFBA 4ED3A 1DTQA 4PQUB 2VG6B 1S0NA 2IC3B 1EETB 1S9GB 4KV8B 4RW8B 5KFDA 3Q8RB 3V4IA 3SI8A 4J9LA 4ZMMA 1BQNA 5CYMB 2WCXA 3CJ2A 4YR0A 4LSNB 1IKXA 1QUVA 2XGPA 1SV5B 5K14A 1NHVA 1N5YB 4JV1A 3CO9A 4MIAA 5F8NA 1HQUB 3QGIA 4EEYA 4IOBA 2WRMA 5J1EB 4X2BA 4FBTA 3V6HA 3IG1A 1S9EB 1N6QB 2ASDA 1S97A 2GIQA 4MKBA 3DLKB 2BQRA 1TV6B 3E51A 4YR2A 2BANB 5DG7A 3DLEB 1LWCB 1JLAB 1RT4B 3GILA 3QZ7A 1QAJA 3RAXA 4YP3A 1S9FA 4KB7A 1HARA 2OPRA 3DRPA 2RDJA 1S1VA 4IFVA 3BR9A 3T5JA 4QW9A 2V9WA 1EP4B 2XI2A 4KBIA 5KG7A 3OHBA 4FBUA 3CIZA 4TXSA 5J2NB 4GC6A 5KFLA 2XWYA 1TL3A 4O44A 2VG5A 1VRUA 5KG1A 4WYLA 4IG0B 3KLHA 4EO6A 2HNZA 2YNIA 4WYWA 4IFYA 4URGA 4K4XA 5KG4A 4IQXA 4J9PA 1T05A 2WOMB 3MEDB 2D3UA 1HMVB 4NLOA 4Y2AA 2BE2A 1MU2B 3BGRA 1R0AA 4NLXA 2BR0A 2JEGA 1JKHA 3KLFB 2RF2B 3BQ2A 3QO9B 2IM1A 3HVAA 4NLSA 3G6VA 4KFBB 1DTQB 4IKAA 4H4MA 3KK1A 1I6JA 3H98A 5KFYA 4EBDA 4Q0BA 4KHRA 3V4IB 2R8GA 1BQNB 2WHOA 4F4WA 3RB4A 2YNGA 3CVKA 4KAIA 3I0SA 1IKXB 3ITHA 1SH3A 4ZPDA 5K14B 3DRRA 1LW2A 5DGBA 2B6AA 1JLCA 1S4FA 2WB4A 3G6YA 1TP7A 3M9MB 3PR4A 2J6UA 4KO0A 3NAIA 5F8GA 4DEZA 5J2QA 3IG1B 1HNIA 3DRSA 2ZKUA 3TVKA 5L1KA 5KFTA 3V6JA 4RNFA 3DDKA 1IKVA 4H54A 4WFZA 4WFYA 3GIKA 2BQ3A 1JLQA 3GV5B 4IR1A 3QYYA 4ED2A 3MTKA 4IDKA 2ILZA 2WTFA 2DPJA 3HVTA 2OPRB 3DRPB 4NLRA 2BRKA 1S1VB 4IFVB 5KT2A 4FS2A 2R8JA 5F8IA 4ECQA 1HPZA 1RA6A 3LAMA 4ZVGA 4ECVA 4F50A 2I5JA 2D3ZA 3GIIA 1TL3B 4O44B 4J9KA 5JXSA 2VG5B 1VRUB 1SH0A 3KLHB 2GIRA 3H5YA 3RBDA 4NYZA 4YR3A 2HNZB 2YNIB 4TQSA 4IFYB 3RB3A 4EBCA 1TKTA 1T05B 2VA2A 4MK9A 2BE2B 3BGRB 1R0AB 3V6KA 4ZVFA 1JKHB 3H4DA 4IRKA 5KG6A 4ECXA 4ICLA 3T5HA 3QGHA 2C2EA 5HROA 1OS5A 3T19A 4RW4A 3GV7B 4H4MB 3KK1B 4Q0BB 3NMAA 3DI6A 2E9RX 4Q8FA 1FKOA 3LALA 2FVSA 4RNMA 5F8HA 2YNGB 2C28A 4QWAA 3I0SB 3ITHB 3BREA 2I1RA 3DRRB 1LW2B 2B6AB 1JLCB 4J9NA 2R8KA 4WXOA 4Q45A 3FQLA 4KE5A 3OLAA 4KO0B 3RB6A 5J2QB 2GC8A 4O3NA 3PW5A 3KMQA 1HNIB 2IA6A 1DLOA 3DRSB 4M95A 1S1UA 1HYSA 3CDEA 4Y2CA 5KFMA 3KHHA 2JEFA 5L1IA 1IKVB 2HNDA 1JLQB 1KHWA 5F9LA 2C22A 5KFZA 4IDKB 1GX6A 3HVTB 3NAHA 4J9SA 3M8PA 4ECWA 2YNHA 1REVB 4QWDA 3Q8SB 3GV8B 4DL2A 3FDSA 1HPZB 2ZE2A 2RKIA 3QLHA 4O4GA 4ED0A 3CJ4A 5HP1A 3IRXA 2AX1A 2I5JB 3N6NA 4J9OA 4IH6A 2JC0A 5L1JA 4O4RA 2JEIA 5L1LA 4K4YA 3OL7A 2W9CA 1IM4A 1ZTTA 3DOLA 1TKTB 2FJVA 3T5LA 2OPPA 2OH2A 4XPCA 1N48A 3H4BA 5KFUA 4KSEB 5FDLA 2YKNA 3MR5A 5KG5A 4MH8A 3LAKA 4ICLB 1S10A 5HROB 1C1BA 1JLBA 4RW4B 4U6PA 4RZRA 2V4QA 3PW7A 1JXLA 4O3RA 4ECYA 3DI6B 5KFEA 4HKQA 5EWEA 1SUQA 3PW0A 1RDRA 4R0EA 1JLEA 1FKOB 4I7FA 1S6QA 2HMIA 5KFAA 4YMEA 2R2RA 2R2SA 1S0MA 2QE5A 2IAJA 1TKZA 2YNFA 1RTJA 5C42A 5DLFA 3MFHA 4DL4A 3CJ5A 1K1SA 3MR6A 1RTIA 1FK9A 2E9TA 3GYNA 5C24A 3BQ1A 3UDLA 1DLOB 4EO8A 3OHAA 1S1UB 1HYSB 4JV2A 1QE1A 3N6LA 3C6TA 2HNDB 1ZETA 4RNNA 2B43A 4OL8A 1T3NA 3CJ0A 1HQEA 4NLTA 4WZQA 4I2PA 2YKMA 3M8PB 2YNHB 4ECZA 1XR7A 1IKYA 3FQKA 2WK4A 3PHEA 4Q44A 4DL3A 2ZE2B 2RKIB 3QLHB 4O4GB 4WE1A 5HP1B 3IRXB 2OPQA 3BSCA 4ZP6A 2W7PA 1MMLA 4IG3A 2IBKA 3TQ1A 1T03A 2UVUA 4NLUA 5CYQA 4RNHA 5DLGA 4R5PA 2W9CB 1LWFA 2HAIA 3DOLB 4ZPAA 4ZVEA 2C2RA 5KFPA 2OPPB 5I3UA 3I5AA 4ZHRA 4RNOA 2HWHA 5FDLB 3NBPA 3BQ0A 2YKNB 2W9AA 3BSAA 4R8UA 2ASJA 3BSNA 1RYSA 2R2TA 3FRZA 1C1BB 1JLBB 1S48A 3BSOA 5C25A 2AQ4A 2UVRA 2HMIB 2AWZA 5KFOA 4H4OA 1SUQB 5KFNA 1JLEB 4I7FB
chains in the Genus database with same CATH superfamily
2DHGA 4TN2A 1RA7A 2ZVSA 1WDDA 4RW9A 3KUHA 1RWKB 1RTIB 1QAXA 2VJUA 2CQ3A 1KKHA 6AT1B 4CLSA 3DM2A 1N8RT 3LP0A 2G13A 3D3BJ 3Q8QB 3TAQA 2ADCA 3T3FA 4I2PB 4IOAQ 2AKWB 2C3OA 1NSQA 1VBYA 1IQTA 1HNXF 2XWXA 4YY3F 2I6WA 4M5NA 1UJ5A 5ETNA 5EWGA 4P10A 1WOPA 2DGTA 1FE4A 4U7UD 1H38A 3EVOA 3PTWA 1MSWD 3CDUA 4LIRA 2HBRB 1RAOA 4PQAA 3HXMA 1VFJA 2KTQA 3BN7A 2Z2LA 1QY7A 1ZM3A 1C1CB 4DPXA 3FEYB 2EG1A 2L48A 3CD0A 4KGKA 4ZP9A 3EWGA 3MM9A 1YITS 5C5JA 1FFGB 1HNVA 5I42A 1FEEA 1J5OA 3MM8B 4F02A 3CJ3A 4F4AA 3RAQA 5T14A 5L9XA 1Q8KA 4G65A 3IO1A 2FJXA 2OMOA 3KFWX 4MK7A 3DLGA 4M5JA 2IMWP 1NXIA 3TEGA 1KWMA 2LXUA 2RRNA 4RW6B 2W9BB 4OFZA 2DGQA 1M0SA 1MWQA 3BPSP 3BV8A 1T94A 2RAQA 2I8EA 1HBUA 2C2ZB 5KFFA 2J8AA 4ID8A 3UI3A 5LL6d 4IYQA 4WZMA 1X4DA 2YKQA 3NGRA 3QSIA 4C8ZA 3RBXA 2F8EX 1YRTA 5KT3A 4K5RA 2VBYA 3HFKA 2CQ4A 4K0KF 2RS2A 2KO1A 1MLAA 4J9RA 3CCVS 1SQEA 2CPDA 2VFRA 1YDLA 3HULA 1TUVA 4OYPA 4TYBA 1N6QA 2V68A 2PDAA 2IYIA 1H7WA 2BJ7A 1LK7A 1GT8A 3ZTPA 1RLDA 4FXWA 4B3MF 1TK5A 2Z56B 1IXKA 2WONB 1RTHB 4NCBA 2DTJA 5EWFA 4HT7A 3P49B 4ILRA 1K73T 1PGZA 2IC3B 1S9GB 5E5NA 3R6LB 3SI8A 4LSZB 4JI4F 3W5YA 1PILA 4XAKA 2NUHA 4HT5A 1WG1A 1LV5A 2V5HG 3EUNA 3RBZA 3FVYA 2ZH8A 3N5FA 4IUFA 3P6YC 3PCOB 1ZM4A 3BR9A 4Y6IA 1RBOB 4KBIA 3TP2A 1Q16B 3LTOA 2MQMA 1TL3A 2HK2A 3AFGA 4LBIA 2F8MA 3H98A 4FPRA 3RR8A 2MKJA 3ITHA 2B6AA 3G9CA 2FZGB 3G6YA 3VAMA 1DY3A 2IA0A 3PRBA 4JI1J 3TRGA 3V6JA 4WFZA 3FMBA 2BQ3A 4ILLA 2F5GA 3GV5B 3QYYA 4OHZA 4IR1A 1WJ9A 2AJ2A 3GIIA 4DN9A 3B4MA 3K5MA 3IR6B 3BR8A 2GX8A 3DGVA 3GB0A 1NJIT 2ZDOA 3DI6A 3LALA 1DQ8A 4DR4F 4A8SA 3U1LA 3T1YF 1F1BB 1S99A 4USTA 3OVBA 3JXOA 2MY7A 4FF1A 3SV4A 3SIPB 4ED0A 3N6NA 2JC0A 1N88A 1UETA 3OL7A 2ZM6J 3DOLA 4DQRA 4OYXA 3Q24A 1L5UA 3ADAC 4DV4F 4DLGA 4ELVA 1CJKA 4RZRA 5EWEA 1NKBA 1AT1B 2HMIA 1HI1A 4I7FA 1VJWA 2GO9A 1S7HA 1GXTA 4B3RJ 3GFZA 1NPPA 2ATCB 4ZVPB 1RTIA 3K5LA 2HNDB 4KYZA 2VFTA 4I2PA 1NB7A 1U1KA 4TNOA 1WHYA 1S48A 3LH2S 5KFOA 4PXBA 5IT9U 4K4WA 1SKWA 3UE2A 4K4UA 2Z4PA 5KFIA 2N82B 1C1CA 3P96A 2CQIA 2RS8A 3ZTRA 4CI0B 4I67A 4WXWA 2CUYA 2MY8A 2PEHA 4A48A 2IY5B 3MM8A 2ACMA 3CC4S 4PABA 2W8KA 1B0PA 3HX9A 3EE3A 3FSYA 3VVTA 4WFNQ 2XZTB 3D28A 3IN5A 5ETOA 4FZVA 2W2QP 5DS7A 1XR5A 1MNEA 3CCMS 2KXNB 1NJZA 1HBMB 3ZZUA 3IS9B 2GS8A 3I5CA 3EZOA 3KG0A 4RW6A 2W9BA 5E3PA 2XMUA 5KT6A 1FHTA 2RT3A 4C6AA 3SCIE 4O3SA 2J0XA 3OVSA 2V6AA 5D4LA 1YJTA 4LR9A 9ATCB 4U7CA 1K1QA 1U1MA 4HEA9 3AXKA 5MLCV 5IV3A 2CJKA 4OI1A 4ERDA 1SJ4P 1GNKA 5KFJA 5KFKA 1L3VA 2MZTA 5DQGA 4OYZA 4JV0A 1S76D 1FVSA 3SFUA 4Q43A 3UR0A 2LYVA 2AZ1A 2UUTA 4MKYA 1UPPA 5KG3A 1YJRA 1QAIA 2CYYA 3LWMA 2FGCA 2WONA 2XO7A 1RTHA 1RT2B 2BJ1A 2CFXA 2EC2A 1FX2A 2YWKA 2EFVA 2M7SA 4EYIB 1FKAF 2IC3A 1S9GA 2MPUA 2MEWA 4MK8A 3ZZ0A 1BLUA 5D4PA 3A8IA 1D8ZA 1VQSA 1KP6A 4OYIA 2FHOB 2DVIA 3VALA 4F2SA 2G0IA 2RJZA 5K5MA 5EN1A 1N56A 3KG4A 3PW2A 3BKUA 3NXZA 3M9OB 2HQIA 4WK3A 2HBZB 1JX4A 2HFNA 2Q3PA 1DTTB 1TL7B 3QIPB 3W1YC 3Q8RB 4KV8B 4J9LA 3CJ2A 4LSNB 1BE4A 3I82A 1SV5B 4MIAA 5L46A 5J1EB 2H5JB 2P6TA 3VAKA 4N5SA 5IT0A 4UZBA 4ZLPA 3UNYA 1T9TA 1BD6A 2VPZB 3C14B 1B99A 2XWYA 2J7WA 3Q86A 3M8YA 2MDAA 3CO0P 3PFEA 4DSIA 2E7XA 2AW0A 4OLPA 4A8KA 1DTQB 3QT6A 1VC0A 2WHOA 3ISZA 2HRYA 2CPYA 3CJKB 1ZPWX 5L9NA 3TVKA 1RU1A 3CTRA 3DDKA 1DZ5A 2ILZA 2DPJA 3Q0AA 2KVQE 1RISA 1U2RA 1WC5A 1VDHA 2F4VJ 4AUKA 1VRUB 3IRWP 1M1GA 1RJJA 3CJSA 5KG6A 3QGHA 2XNRA 3GYGA 2C28A 1VHFA 1U1QA 3KDNA 1NH7A 2KJWA 1JLCB 2UUBF 2W25A 3FQLA 2RD5C 1RAAB 5LXYA 2U2FA 3PW5A 2K7KA 4B3MJ 2JEFA 4USVA 4DU8A 2V2VA 4NYOA 2HNDA 3DN9A 2XY5A 1HW9A 3BH7B 1WI8A 1OY8A 5GVQA 1Z1ZA 2JEIA 3UDCA 4Q7AA 4A8XA 3LGMA 2MKSA 3M2UB 3DLHA 5KG5A 4N47A 2KB2A 7FDRA 4HKQA 1ZM2A 3DCAA 4OZ2A 1VI7A 1X0PA 2MLYA 3NP5A 2B7CB 2GA7A 2CQBA 2H5EA 4XTTA 4D3GA 1XERA 3J81j 2FYXA 4DL3A 1X7VA 3BSCA 1U6ZA 1CLFA 2IRYA 2QT7A 3L7OA 5EGYA 1PO6A 1NDLA 5GADI 5GAHI 4RX6A 2HRTA 4RPFA 4QIEA 1N33F 1APSA 1X5OA 1SUQB 5KFNA 1SJFA 3VQTA 4CM0A 2BKOA 2FHJD 2B4UA 3TX0A 2DR8A 1HBMA 3KKFA 4YQWA 4DSEA 3IS9A 2AEFA 3DFEA 2ZJPQ 4C8YA 3CJTA 1FXLA 4TY9A 2QMUB 2OPQB 3PVXA 5LXRA 4AE5A 4DR4J 2IVFB 2VKZG 4X4PA 5DQIA 1XQIA 4DR2F 2FLPA 3N6MA 3VQSA 4CLPA 4R8UB 4NLVA 4DUYJ 3TA0A 4CDIA 1PCAA 7AT1B 4NX9A 2OJ3A 2LVWA 1S4EA 3I96A 4LFCF 4NEYA 2GZOA 2FLOA 3GJRB 1Y7PA 1J5EF 4W4MA 4NLDA 1FRKA 3NOCA 5F3ZA 1S7IA 4NA1A 3OW2R 4PUOB 1AUDA 2ZH2A 2ILYA 4KY3A 5IWAF 2QLFB 2DRBA 1WG4A 1PJ7A 5HVFA 1CG2A 2RB7A 1RT2A 2LDIA 3R5BA 4DPTA 1RYRA 3QRRA 2HHVA 5L8RC 5LT5A 2CVEA 3ICLA 2RHQB 3BYPA 2FZKB 2D9OA 1X4GA 3GU0A 2AGPA 4JI7J 1U1LA 1YRUA 3B6BA 1GMUA 4ZPTR 3K57A 2VV5A 3D68A 4P7TA 1RKIA 1VOMA 2VH7A 2DNZA 1T11A 2R9LA 1B4SA 4JP8A 3R5JB 5FLXU 5D4NA 2CNOB 2EVZA 2DH9A 1PYTA 2BJEA 2HGMA 2ASLA 4DQPA 2ZC4A 3MFIA 1Q5VA 1DARA 1EJ7L 1Q8IA 3Q8PB 3NCQA 4P2MA 4Z2XA 4DS4A 2DR5A 1FRLA 1Y00A 4LRFA 4YUDA 1DTTA 1TL7A 3RGIA 5B08A 3QNWB 3QIPA 4KV8A 2JVRA 4LSNA 1YBUA 1SV5A 2G9OA 2VZ9A 5J1EA 4O3QA 5D0GA 4GO7X 2NUUG 2RQMA 2YTCA 2J9DA 5JVGQ 2HNYB 5M2UA 3C14A 3HO1A 4LF8F 1TFWA 1L3TA 2LMIA 2KKHA 4A4JA 3SXLA 1DTQA 4RW8B 4PEOA 1UVIA 2YY3A 5CYMB 1X9SA 2X3DA 4JV1A 4F8RA 3CJKA 1R8CA 4FBTA 1SJ3P 4CLTA 5GAEU 1ZH5A 4B9MA 1M90T 1EQMA 1QAJA 4L73A 4YP3A 1HARA 1HWIA 5GMKa 5KG7A 1HWKA 3UNGC 1RHJB 2DHSA 1YBAA 2UUCF 2VDIA 1VRUA 2XMAA 2DY9A 4AL6A 3FMWA 3CJRA 2C1EB 2BR0A 2ZZTA 3ZNUA 3EDQB 2Y1IA 4DV0F 2GFFA 4IKAA 4P73A 1VQNS 1V5IB 3LOUA 1JLCA 2BDPA 3AB4B 3H25A 4ED5A 4DPOA 2HZVA 1QVFR 3TZWA 1NPRA 4IFVB 3PY8A 3Q8UA 2D3ZA 3PDNA 4DZDA 3M2UA 2BE2B 3IM8A 3R7SB 3L4BC 1N36F 4Q5VA 3KK1B 3EYZA 3I87A 4DUTA 3PHTA 2VOOA 3PV8A 2I1RA 4Q45A 2A2CA 2CZVC 4KO0B 1OY9A 4HHHA 4X66F 1DQAA 3GR1A 5L1IA 5F9LA 3MXHP 2KH9A 1REVB 4QWDA 1YJUA 3FDSA 4DX8H 4V1Ak 4PAAA 3WC2A 1IM4A 1URNA 3U02A 4YB6A 2JH3A 4U8VA 1HHSA 5ITHA 1EX8A 2DIVA 3CJQA 4PG5A 4USWA 3PW0A 1SUQA 2R2RA 2BM0A 2Z57B 2MZJA 4OLOA 1N0UA 2MKKA 3CJ5A 1U1NA 1R6VA 2Q6CA 3BQ1A 3UDLA 1Z2LA 3UN5A 1RLCL 1WSVA 3W2VB 4U9RA 3CD7A 3KTQA 1CC7A 1VC5A 3EVMA 3CJ8A 2ZE2B 4BC7A 4DV7F 2EFGA 2OPQA 2W7PA 4X4RA 1DRZA 4GKJF 1SC6A 2MQNA 4DUZF 4ZVEA 4HH0A 2R7WA 1I3OB 2YKPA 4D3HA 5FDLB 3D66A 4R8UA 2DXDA 1C1BB 3FRZA 3IA0A 3U1MA 4YB1P 3H5UA 4DX6A 3H40A 1GFWB 2R42A 4F4XA 1QTNB 3NS5A 1TZ0A 4PUOA 5A8RB 4B3TF 3HJFA 2H65B 3KHGA 2JC1A 2AEMA 4M5LA 1IBLF 1T7PA 2XMWA 5LM7E 4IR9A 2UUBJ 3PO5A 4DF8A 3ZNJ1 3D5MA 3JQKA 1YG0A 2AHOB 3A4TA 2J6TA 3M9NB 2D69A 1BC6A 1OYEA 1ROFA 2ZH1A 1PBAA 4B9TA 1VRTB 5E3RA 2HQFA 2D41A 1UFWA 4DFJA 3J7Z5 2JX2A 1OYDA 1KVIA 1FKPB 2HBYB 2FLLA 1NHKL 4ZJOA 2VONA 2ZD1B 2HIQA 4ID5B 4F26A 1IWAA 5KFCA 4Y2MA 4FS1A 1D8YA 4ZLLA 3T5KA 2A10A 1WC4A 2GJFA 4UOCA 4AD6A 3QRPA 4C8OA 1RP5A 1WKJA 3H59A 2R2UA 3SFGA 1U02A 1QAYA 4FKXA 2NSBA 3KUGA 3D0GE 1S1TB 1CJTB 2E5GA 2HNYA 3ET6B 3KXDA 2C22A 4G3IA 1O51A 3I31A 1KQSR 1X5PA 4RW8A 5CYMA 3OJSA 2E44A 3AQPA 1Y3KA 3G96A 3NOGA 1N34J 5K8PA 3Q22A 2R4FA 4TLRA 2ZOFA 3UN2A 4OJ3A 5CZVA 1NJXA 4LQ9A 3QJJA 1SJRA 4DX5A 2DJWA 3QQCD 2MKIA 5D3GB 1FO1A 3FUYA 4PYAA 2HSEB 2EXUA 2KFNA 1U6FA 2BE7D 2DB1A 2LU1A 2M8DB 3H7HB 2HKEA 3RBEA 2BQUA 4O0IA 5HANA 1UP1A 4PQUB 4NYPA 1HA1A 1YX2A 3T6BA 5IWAJ 4IOBA 2HFSA 1M5VC 2W01A 2QSWA 1GMWD 3NNHA 2DRDA 1AROP 2BV3A 3R27A 2MLXA 4IFVA 3BS9A 3OBIA 2J0QD 2QTWA 2NZ4A 1GH8A 2BE2A 1VQ9S 3BQ2A 2RF2B 3HVAA 1VQ4S 3KK1A 4EBDA 3W3SA 3V4IB 3VZIA 1LOUA 1IKXB 3Q23A 2FIUA 4KPYA 1HLWA 3VGUA 4I69A 4KO0A 4YOEA 1AW0A 2ZKUA 4LT6A 2DGUA 2KRRA 3GIKA 5D78A 1RXOB 4DSJA 2BOAA 3S1TA 2FHKA 3MAHA 2KT2A 3PYEA 3V6KA 4AQYF 3W9IA 1U6BA 3MEKA 1SPBP 3FZ2A 1NKEA 1X4AA 4P2FA 1D9DA 4GKKF 2M0GB 4C9DA 2LU2A 3OLAA 2DT9A 3ONQA 1JMTA 3CDEA 1U8WA 3W2VA 1JLQB 1UJ6A 1YGYA 3HSDA 2R7SA 4WFBQ 3U7JA 2MMYA 1HPZB 2ZE2A 2AX1A 1RWXB 2GO8A 1MMNA 3RW6A 4NASA 1S5ZA 2FJVA 4JI2F 1S59A 4UOGA 5FDLA 2PO4A 3QT7A 4ICLB 4EZ6A 1C1BA 4JV5F 3MPUB 2UU9J 5D8HB 3MFHA 4DL4A 1XK8A 1TUGB 3GYNA 5AJ3F 1NDKA 3HHLD 5A8RA 3AJ2A 2CPJA 1FD8A 1UVJA 2GV1A 3IRXB 5LSOA 1MMLA 3TQ1A 4NOHA 4WP8A 2HAIA 1S12A 1PYSB 1MW7A 5KFPA 2OPPB 2HQCA 5DZ6A 2DNHA 2C3UA 3ZC4A 1SC4B 5M2RA 1KR4A 3BSOA 2BXJA 2FVPA 2UZAA 2EEYA 1FWLA 1RTJB 4EK2A 5D0HA 2RUSA 5BR8F 3H8YA 3E2EA 1XMOF 2HFOA 1AXQA 5KG2A 4LBHA 1GK8A 1VRTA 3UN3A 2XLIA 3PZPA 2HVHA 1RACB 1VQLS 1TU0B 4QOTA 2R7RA 1LWFB 4OJ1A 1UA0A 1BHNA 2BKPA 4LF4F 1OY6A 4CH1A 3CCES 2AX0A 1FKPA 5IFMA 4DL6A 3HZEA 1NSPA 5C2GA 2ZD1A 1XN9A 4ID5A 1ZTWA 3HKWA 4URSA 3THVA 1S0OA 3SQOP 3VV2B 4MMOA 3M6UA 1F5BA 4NPOA 4P74A 1RBLA 1HBOB 2E66A 3Q2SC 1IUJA 1VBKA 3BEGB 3WX8A 1S1TA 4URQU 1CJTA 3FSXA 4DPUA 1TELA 3ZTSA 1RWVB 1IBMJ 3BO2A 1BQMB 4NZ0A 1JLGB 3ET6A 4WPAA 2DR9A 1L3SA 3OTOF 1F3VA 2R7UA 2ATLA 3MMCB 4JI3J 3J80Y 1NK9A 2FJBB 1I1GA 1VBXA 1GQEA 2IBOA 3HMJG 5B0EA 3O3LA 4PG4A 4DV7J 3I0RB 1RAJA 2B9EA 2EK1A 3G8QA 4QBUA 4DUZJ 4DR6J 3CCTA 1NHUA 1O8BA 1FJGF 1UJ4A 2LA6A 2J6SA 5GAGI 4Y2KA 4H4KA 2HURA 5D3GA 4G6VB 3OLBA 3KHRA 3K8VA 1QJHA 2FPHX 1PG5B 1LFWA 4X4OA 3IR5B 2CQHA 5KT5A 2X1BA 3QSYB 4PQUA 3I6PA 2J5AA 5EHHA 2F8HA 4MFBB 5EDWA 4XO0A 1NDCA 3QGGA 5A8KB 4OX9F 3EPGA 4MAKA 3I56S 1U2FA 4DSLA 3BKTA 3OV7A 2VODA 1VQMS 5KTQA 1UVLA 2V8VA 3CEDA 1ZAVA 3PEJA 2WVEA 3PYFA 4KR0B 4DQQA 2PD1A 5EUHA 2LQ5A 1PSDA 1GAOA 2ALZA 2NS1B 1RT6B 2RF2A 1FX4A 2POKA 3HM9A 1SVDA 3PYDA 3LGNA 5KFDA 3V4IA 4OYAA 1IKXA 2HVIA 1NHVA 2F4FA 3K58A 2Y3YA 1YJNS 4CZCA 5D15A 2HHQA 1CULB 2X1FA 1TV6B 2BANB 3HVRA 1U0SA 3EDRB 2WB1D 1KOHA 3N0VA 4FBUA 4PR6A 4IG0B 2HG4A 4NXMF 3PEHA 2FGOA 2W1BA 1T3OA 4DMZA 1XIQA 4W90B 2FDNA 2RE1A 4ELUA 4ANCA 1R0CB 3KUEA 1TP7A 2FQQB 1XMQF 2DR7A 2XHCA 3NAIA 2IJRA 5D6GA 1HI8A 1JLQA 1RUSA 5HATA 5KT2A 4FS2A 3DRYA 5F8IA 1RSCA 1HPZA 4ZVGA 3LUYA 5JXSA 1YJ7A 3MURP 1VQ5S 1CJUB 4YHHF 1UAWA 1RHMB 5K8MA 2VA2A 5CYJA 4QR2A 1V9OA 4ICLA 4OX7A 4WU2A 4H4MB 5ETVA 1HD1A 1XNQF 2AJ0A 4RNMA 3MGJA 4DI6A 1QLNA 2VOPA 2IA6A 3HK2A 3IBFB 3CMES 2VBWA 4M95A 2AT1B 2MYFA 1KHWA 2NSCA 4USJC 3IP0A 2RQ4A 3D1OA 1RGVA 3HF5A 3RU0A 1AZSB 3C66A 4QIWD 3MD1A 4QU6A 3IRXA 3TUJC 3F56A 4LMZA 4WK1A 4DR5J 1ZTTA 2OPPA 2ZFHA 4I4BA 2UXDF 1N32J 2CQ2A 4RW4B 1K44A 2K3IA 2B4OA 3S7RA 2IFXA 5HQ8A 3HI9A 1RTJA 3HD1A 2WZ1A 4OV1A 2HIYA 2GJIA 5B0DA 1IBCB 4EO8A 1S1UB 3MOJB 3QT5A 4NCAA 3N6LA 3NGSA 3R6GB 2R7QA 2DXFA 1XR7A 4DOZA 2V2ZA 1LWFA 4RR5A 3US5A 3BQ0A 3L09A 1F9EB 2DXEA 3G82B 3EXYA 4A8YA 3KHLA 1VISA 2IAJB 3S8SA 3QGPA 2YKAA 2XYPB 1QSLA 1HBOA 3LPEA 5DG8A 2AGOA 2VASA 2KT3A 4ES3A 3IGVA 2EI5A 4DX7A 4L3KA 1V5VA 3FJ2A 1UWAA 1RAHB 1BQMA 1NJWA 1JLGA 3BF4A 4GKKJ 3O5TB 1VHIA 3NBPB 3D0IE 3MMCA 4CLFA 4HDHA 2NCKL 2XQCA 4JYAF 1ZS6A 4LR8A 1TMMA 3I0RA 3BKFA 2I2YA 4P7VA 4CO1A 3MAAB 4OX8A 1FTCA 2PFDA 3AA9A 1RT1B 1FDDA 2KJVA 2JWNA 1IKWB 2GMJA 2RUGA 3FEZA 4JI6F 3Q2TC 5BYSA 1IM6A 5HLFB 3HHDA 1JWWA 4ECRA 2QA4G 4MFBA 5KT7A 5A8KA 2CXEA 5IS2A 1BY9A 3KJVB 1JNRB 1Y9OA 1RWUA 4NZ6A 1HWJA 1O5JA 3MR2A 1MMDA 5DGAA 1YJ9S 4KQZA 4JOUA 1R31A 3UCGA 2W4DA 3G86A 4OZ3A 1NM2A 5BR8J 2Y8YA 3M8RA 3MUMP 1RT6A 3UFCX 1XMOJ 3ENWA 3G2XA 5HVGA 3FCVA 2E9ZA 3IAS9 4KH0B 3BO3A 1CULA 2BACA 1CC8A 2EFNA 3BM7A 1TV6A 2BANA 4A8QA 1KVKA 3GCWP 5AE2A 1U48A 4USUA 1VQYA 5DETA 4BC9A 2V63A 2PE8A 5E0OA 4IG0A 1EKSA 4F3QA 5FD1A 1Q79A 5LSLA 1AB8A 5IM0B 1JNZB 2XCAA 4ZVHA 3DGPB 5GMEA 2MKCA 2PFFB 2XO6A 4DXLA 2ZWPA 2XGPA 4O23A 4EEYA 2ASDA 4HI2A 2R7XA 3E51A 3GG1A 2C2KB 3QZ7A 1OJ4A 4ZA1A 3TJ8A 1T0TV 4BLGA 2DEIA 3MAQA 2CPXA 1WKKA 3PKMA 3M8ZA 1CJUA 4USKA 4EO6A 4URGA 1ZAXA 2G4BA 5F3TA 4K4ZA 1NLKL 1WACA 3DRXA 5DDPC 2XLKA 4H4MA 1I6JA 2Y8WA 4WU3A 1LEOA 4DV1F 1Y5LB 2WB4A 5HMXA 3M9MB 5ETTA 5F8GA 2FZCB 4C98A 3MMJA 3R7BB 5KFTA 2P9CA 4LUBA 2MKYA 1C4AA 1AZSA 2CQDA 1G7CB 2DH8A 4NYZA 2OELA 3Q89A 4EBCA 4G1PA 3MCSA 3NWRA 1OS5A 4RW4A 3H2VE 4Q0BB 2MXYA 4M5IA 3I0SB 4NXNF 2BBEA 2GC8A 3ZZTA 1S1UA 3WIUA 1M5SA 3ULHA 4F0KA 4IDKB 3QT8A 4DN0A 1YLXA 3QWPA 1Y0HA 4O4RA 5L1LA 2CQPA 4XPCA 3LW5C 1S10A 4ZITA 4GVLA 2V4QA 3G82A 2QGFB 2IAJA 2HHWA 4L75A 1WC6A 4USIA 3OHAA 4JV2A 1X9WA 1WSRA 4F3OA 2YBVA 1WC0A 4Q44A 1R8AA 3GFHA 2MHEA 2FC9A 4C97A 1AUSL 1T9VA 4FKYA 2V2KA 3NBPA 4W98A 1XMQJ 2HHPA 3D1QA 2HS3A 2GAGC 1SIZA 1I94J 1TKDA 3CB4A 4OI3A 3QJPA 4B17A 1V3ZA 4FXDA 4WF9Q 2V8HA 3RG6A 2OO4A 5A8WB 3PX4A 4EU0A 3MAAA 3R5DA 2W2OP 3CGIA 2XZWA 1RT1A 3E8OA 1WC1A 3NS7B 4C3LA 3QZ8A 3IGNA 2RDIA 2VBZA 1IKWA 2CIMA 4Y34A 5DRKA 5HLFA 3TAMB 2C3YA 1M5HA 2CVIA 3I5BA 3NRBA 5DDQC 4I1TA 3JSBA 2W4PA 3N79A 1HL6A 4ECTA 1PC4A 3KJVA 3L9ZA 4K50A 3CC7S 3M30B 2E1AA 4U67Q 5F0WA 2C2NA 4ED8A 3KJFB 2EWHA 2A6MA 4MT1A 2LEBA 1SL0A 4RLEA 3KMSA 2ZH6A 1SQGA 2AEJA 1JQGA 2RQKA 2VFVA 5AE1A 4NCGB 1N5TA 2BX6A 3P3DA 5HMWA 2JJ4D 2NXEA 1PBUA 4E0DA 4ZKAA 4EZ9A 3PJWA 1FXRA 2UV8A 2AZ3A 3ZTQA 1KEKA 3DDIA 1KHVA 4M1KA 1K0TA 1REGX 4M5GA 2Z2MA 2GCFA 3HSGA 1VQKS 1E6VB 4JI8F 5E3QA 4ZVSB 2ZHBA 3NY0A 3FCWA 2BABA 5IM0A 1QVGR 3DGPA 4OYOA 3KNGA 4QU7A 3HSJA 2RU9A 3DYAB 1RHRB 2ZKTA 1Q8LA 2OD4A 1SKSA 1LNQA 1K9MT 3NS6A 1ACMB 1Q0NA 3PFOA 2RMLA 3QWUA 2G2ZA 2AMCB 5F0UA 3PXGa 1KN6A 2Y1RI 2E1PA 3EJMA 4IOCQ 1UW4A 1CBKA 5DDOC 4WJBA 2LFVA 3PIPQ 4JI0J 3DLBA 2ZNZA 2J0WA 1AFJA 4X4UA 4AFFA 2MTLA 2E5LJ 5E33A 1U24A 3UCZP 1TUWA 3NNCA 3RRKA 1N5YB 3M05A 2RSQA 2QL9B 2WW8A 6FDRA 4QCLA 1ZA2B 2KU7A 3BB5A 1FNXH 1BQXA 3DU6A 5JVHQ 1NPKA 1MN9A 5ETKA 2EKNA 5KOWA 4PWWA 4KB7A 1EP4B 2GNKA 1FRJA 4K4XA 1RKJA 4FNHA 2XMMA 1UZDA 4I64A 2IM1A 4NLSA 2F7VA 3MI7X 4Q0BA 2E1MC 6FD1A 4KC5A 4K59A 3TAPA 3CVKA 3I0SA 2F1FA 4OZNA 3HJVA 3DLLQ 4DEZA 4NWBA 2E5IA 2OFHX 2G1HA 4IDKA 2VQFF 3DRPB 3VHQA 4WTOB 1IBKF 2GHPA 4WTYA 3TZXA 4O44B 1N52B 1E6YB 3UDVA 5B0CA 4TQSA 1LFPA 3RB3A 2UP1A 5LJ3Y 4ZLJA 3VGSA 3QRQA 4C2MA 4F67A 3NMAA 1FWKA 3P5BP 3MPVA 5F8HA 3OTEA 3SSSA 4B3SF 1FE0A 1HNIB 5CAAA 2BJ9A 3NAHA 5H9FJ 2O1PA 4ECWA 4WKYA 3LF0A 1XJWB 2MJNA 3TEHB 1WELA 2CWKA 1K0VA 1BWVA 2OH2A 1EZZB 3H4BA 4I0WA 3MR5A 1UPMB 5HROB 1FT8A 4U6PA 5LMUF 3PW7A 1RDRA 1S0MA 4LF7J 4PKDB 4EUVA 3MR6A 3UCUP 2FY1A 2GQCA 2UXBF 1PC5A 4KH1B 1U0HB 4PPDA 3D6MB 2DGSA 3BGUA 1EQ0A 5A8WA 3SCLE 4ECZA 2R3VA 3NNAA 4DJBA 4F7VA 4LFAF 2HHHF 2W9CB 1EKRA 4ZPAA 2C2RA 3UD5A 4F04B 4RNOA 2KDOA 3RRGA 4OHWA 2AQ4A 5IQ6A 1PIEA 3U27A 3R2DJ 4F4YA 3TAMA 5B0BA 4F36A 1MROB 4C0BA 1T8EA 5C24B 4F4ZA 2FB0A 2OAUA 5DQHA 3HVWA 2VKRA 3C6TB 2XS7A 2DBBA 2YKMB 3H5SA 3M30A 5DDRC 5HO4A 2EC0A 3OTBA 2C2OB 4IG3B 1D0EA 4R5PB 4NLPA 3GE9A 4ED4A 1U09A 4NXNJ 3G6ES 1VQPS 2YQ3A 1F6TA 3N9UC 2QLWA 3PR5B 1YKWA 4HYKA 4NCGA 1UVNA 3CWJA 3AAWB 2K3KA 3ZZPA 3DNCA 3GIJA 2OMLA 3TANA 3EGWB 5IT9Y 5LSRA 3OFFA 4NLQA 3VTIA 2MQ8A 3KLEB 2LCWA 3LGHA 1FRMA 3M32B 1VS3A 2Z2YB 1NKCA 1E6VA 3KNAA 4OV6A 2G0CA 1RAEB 4ED1A 3MDFA 3QFWA 4F4KA 2H54B 5KFXA 1O6XA 2HVZA 2DNYA 3OT9A 5JUMA 1NSKL 1WORA 4FN5A 1YZ7A 3DYAA 5KG0A 2XULA 5J2PB 3HCXA 4NLGA 1FJCA 3EZ5A 2IM3A 5HBMB 3NLCA 1UW9A 3FZBA 2BJ3A 2QO3A 1SJQA 1X4FA 1OSCA 1QUPA 4C11B 5HJYA 1VQOS 2B8PA 1S1WB 4YDDB 1EARA 2MSSA 3MMAB 4OMFG 5JJBA 3OFGA 5A6WA 1WNEA 1Y4ZB 4RW7B 4DV5J 1Z4UA 4ZPVR 3A3OB 3D6FB 1N5YA 2XYHB 2DITA 4EBEA 2DEJA 3I4HX 2GHVC 3J80U 2RVJA 2LXIA 1NK7A 1R27B 3DOKB 5D4OA 3V81B 1B7YB 4B9SA 1OPZA 3NGTA 1N5SA 1EP4A 4EWTA 1U4BA 2HQDA 1FCAA 4ZPCA 4LFBJ 1KS2A 4FYVB 4B9UA 1S1XB 1L3KA 4LSLB 2FD2A 3OTCA 2R7OA 5KFGA 4OZ0A 4RBVA 4ED3A 3JB9k 2ZZMA 4ZMMA 2WCXA 1QUVA 2B7BB 3CCWA 2WRMA 4X2BA 1A6LA 2EKYA 3V6HA 3PYGA 2G2OA 2XMVA 2Y1LB 3DLKB 1T9WA 2LQBA 2VD3A 1FESA 3IAM9 1JLAB 3POTB 4ZJQA 3DRPA 2RDJA 2AJFE 3ELHA 4O44A 2KL8A 1E6YA 4IQXA 5ETRA 1MU2B 2R7VA 3CT9A 2LA4A 4HVZA 2W2MP 2B8QA 1SH3A 5DGBA 5IT4A 2HRUA 2EK6A 3OPKA 2K1RB 1HNIA 2L9WA 2ZH4A 1HKAA 1FJ7A 2VFSA 3VF0B 1R3NA 3TZZA 1N54B 4P71A 3HPOA 4ECQA 2W2NP 2D74B 3HHNB 4P9SA 2N7CA 2GIRA 4N41A 4IFYB 1HNZJ 1VC6A 3CCJS 2B56A 1FRHA 4FVMA 5HROA 4BDPA 1KBRA 1L3UA 2RU3A 1HHTP 3RR7A 1IWGA 2K06A 4X62F 3DRSB 3KHHA 1U0HA 1F9FA 2ZH7A 1HI0P 1HW8A 1DQ9A 1ZA1B 5IC4B 4J9SA 3G71S 1XNRJ 4TVAB 3Q8SB 1NBEB 3TR5A 4K5SA 2Q66A 2I5JB 2W9CA 1KSPA 8RUCA 3ZZOA 1HNWJ 2PN6A 1T95A 2V8GA 3CXCR 2F65A 4XIUA 4HACB 1RTZA 3FBFA 4P2SA 3FBBA 2LP4A 2XMKA 1MROA 2QA4S 2KG0A 4ZCKA 4KJIA 5C24A 3ZZRA 1FF2A 2C2MB 1KQGB 4C3MA 2VC1A 3C6TA 1ZETA 3CW2C 1KNZA 2YKMA 1XC9A 3VAJA 1HD0A 3FQKA 2H1YA 2UV8G 2BZ2A 4IG3A 4R5PA 1J2VA 3AT1B 1KQKA 1GMVA 2FHJA 4X65J 3BBBA 2V67A 5E3CA 4QPXA 3M2VB 3OFEA 4HHUA 4RU9A 1QE1B 5HQMA 2BW7A 1YQHA 3K89A 2DPIA 2WSEC 3KLEA 3UWTA 4ILMA 1RADB 1ZAWA 4QYZJ 3M32A 2XY7A 5KAKA 2AYBA 4FVCA 2QA1A 3WQPA 1HNXJ 4YY3J 4QYRA 4CLKA 2JVOA 2KZMA 4WCEQ 2CQ0A 3F0NA 4ES2A 3VWSA 5J2PA 3OXFA 3DKDA 4PG6A 2NPIA 1UFKA 5HBMA 4E2FB 5LMUJ 4DL5A 5CCMA 2AGQA 2CQGA 5F8JA 3BDPA 4RKUC 3OL9A 4XK8C 3AJDA 4I2QB 3GLJA 4FF4A 3AB2B 4C11A 2ROEA 4ED6A 1FXDA 1S1WA 3MMAA 4ANEA 2DGOA 3UPFA 4RW7A 4LJMA 4RUBA 2CWXA 2YWFA 4OYBA 3M8WA 1GXUA 4TYAA 4UQGA 2UVWA 1TVRB 2NYIA 2SXLA 2QYCA 2WVCA 4CO5A 3WX4A 2BEFA 3DOKA 3V81A 3OSNA 2L3MA 2DNMA 2D3O1 1TFYA 4A46A 2IHR1 2HWIA 2DCLA 2IVMA 1S1XA 1SH2A 1HWLA 2GIFA 1M1HA 5CH7B 1KONA 4LSLA 2Q43A 3R1HA 1FWPA 3K5NA 2D3OR 4JUZA 2BW2A 3NMRA 4K0KJ 3FSIA 3W9HA 3DC2A 2I9SA 3TQEA 3DLJA 2RIJA 4A8OA 3DLKA 1H6KX 4J37A 3AH6A 4N56A 1JLAA 3POTA 4AL5A 1IVZA 4M63A 1HFEL 4G1QB 2KYXA 3N4WA 3MUVP 2X7IA 1B70B 1MU2A 3GJTB 3GQCA 3FC9A 4ZCIA 1FFSB 5IXUA 1IR0A 3DOMB 3BPDA 3SBMA 2LXFA 4JI4J 1X4CA 1JXEA 3Q8YA 2K1RA 2GIQA 3CF5Q 5HL7Q 2PMWA 1G1XA 2FTRA 1DURA 1XEZA 4I6AA 2HQ3A 2ZNYA 1IR2A 1VRQC 4IFYA 5KG4A 1W7WA 1M5KC 2JEGA 5THWA 5LOQA 2AV5A 3LWLA 3HKZD 1ZBTA 4CNZA 2QYGA 3C19A 4OZ1A 3JQMA 3TUZC 4S0MA 4KAIA 2OP5A 1JK9B 4ALZA 5CCLA 2UXCF 3DRSA 5L1KA 4AXIA 2CAJA 2WTFA 3MMBB 1MWZA 2HEKA 2R8JA 2I5JA 2BE9B 1SH0A 1K8AT 3KLHB 5GMDA 1T05B 1EHWA 3BGRB 5ETSA 4QR0A 2E1RA 4IO1A 4PG7A 3OR1B 4HACA 2QFJA 1NK8A 3AXMA 2E9RX 1DAXA 3G87A 2VQEF 2YNGB 2Z8QA 3HHEA 2QEXS 3T1YJ 3J81Y 4ANDA 5I3PA 2VC0A 2YWWA 4DR7F 1NZAA 2MQQA 5HMZA 3MCOA 3R5AA 3WDOA 3D67A 2ZM6F 2AJQA 1NK5A 1VLOA 1WEZA 3T5LA 2K2PA 4QQBA 2OEJA 4OX6A 5C2CA 2Q1LA 4B3RF 4OZJA 4DV4J 4M5KA 3OVAA 1H3DA 3M2VA 4UTGA 3OQ2A 2E9TA 3DU5A 2HVEA 2NXCA 2ZH9A 1QE1A 2MLZA 5HN0A 3LPYA 2FC8A 2M8HA 1P9QC 4YDXA 1P1LA 3OUYB 4RNHA 2G0JA 2JFKA 2ERRA 2KM8C 3N28A 2YKNB 4NEZA 2UVRA 2AWZA 3PRVA 3KG1A 4CLLA 4LVNP 3HHLB 2OTLS 3H0PA 4MKVA 4X64F 2EG2A 3CDWA 4LRBA 1I51B 3IXQA 1TK8A 3B78A 2IJFA 5CHCB 1ZZFA 2HQGA 3GJSB 3NGKA 1DFDA 2JRSA 2XZDB 2AD9A 4FNIA 5BJRA 2YH0A 4KHPF 1UEUA 3BGLA 1KVJA 2PA3A 3OSPA 3BBFA 4I2QA 3SEOA 3VZHA 1C2PA 4X62J 1WF0A 2L9NA 3M1VB 2VJVA 1WHXA 2KN4A 1TVRA 1Q7LB 2D7SA 3J7YU 1LKZA 2QX0A 2RH3A 3JAMY 2RILA 3LP1B 4CM2A 1Q82T 3E01B 2ZVIA 4ECSA 4LF1A 1GTHA 1NNDA 2F3JA 1NDPA 3HP6A 2AYGA 2W4CA 1NUEA 2ZUGA 1RT5B 2IJNA 2HLTA 4HTJA 3M8QB 2JLEA 4NRUA 3IWNC 3R7NB 5D0EA 4WFXA 2CPIA 4J9MA 3OL6A 2JZ5A 3AOAA 5D77A 4FP9A 2BUNA 4J7CA 1URRA 2RRBA 1N5QA 5IC6B 1TKXB 1UA1A 2HGNA 3FBCA 2IDLA 1VGYA 2OHDA 3EGZA 3SYZA 2Y0SD 3TVYA 5GAEI 3KOAA 4G1QA 2DIUA 3ILOA 4NLYA 4B3OB 3HT0A 3ISNC 4YB7A 3IMQJ 2OEMA 5KFWA 3R3TA 1RHUB 1VIOA 3DOMA 3NCPA 1NJYA 2MZQA 5F8LA 1S6PB 5KFQA 4KGZB 1N4LA 3QATA 4RUHA 4DPWA 4K4VA 2YH1A 5K20B 2FLNA 3V6DB 4CNYA 3W65A 5CZXA 3EGVA 3OFHA 3WC0A 1GMWA 1UCNA 3L7UA 4WIIA 2KFYA 4C8MA 4C0HA 1S97A 4CRJA 2PT0A 3EVWA 5DG7A 3ZO7A 3MMBA 3RAXA 4OJHA 1SXLA 2HPUA 2DNQA 1X4EA 2V9WA 2D1CA 4NZ7A 4TXSA 3PM9A 5H9FK 3QFHA 2N4CA 1NSAA 3KLHA 4DDFA 3EX7B 2A2DA 4CYUB 2N3OA 2BA9A 1T05A 2WOMB 3ILLA 3BGRA 4DHVA 3D54A 2J8SA 3KLFB 1PKUA 3OR1A 4MJKA 2RNEA 2DR6A 5K8OA 2B3TB 2XSFA 2YNGA 1S6OA 5HQLA 2CPEA 1FVQA 4FYXB 2DNGA 3M6XA 1WUUA 2NPFA 2J6UA 5D0RA 3UDEA 1TMJA 4I6WA 4PXDA 3PG9A 1U2CA 3GMGA 4EFAC 3T1HF 2F4VF 5HAOA 4ES1A 3FBEA 4ZOSA 2HHXA 3GIRA 4CH0S 2B0GA 3C16B 4HTIA 2YNIB 5F41A 5HMYA 4DR1F 1JKHB 1CJVB 4ECXA 3T5HA 4ENOA 4QWAA 3NG8A 4RBTA 1NEEA 3DRRB 4W92B 4UZCA 4X4TA 4UT4A 4O3NA 3KMQA 1RBAA 4R0JA 5E7OB 1H2TZ 5A0YB 1KDNA 4KRWA 4FF2A 2P5VA 3SSRA 5KFZA 2YX1A 3RZAA 3GV8B 3THTA 1VQ6S 2FJAB 4J9OA 2LEAA 2OSQA 3OUYA 2ZBIA 3JSYA 4C8LA 3VCDA 2YKNA 4MYUA 1KOOA 1P27B 2DK2A 2CJAA 3TARA 1TAUA 2M88A 1VBZA 1S79A 2MQPA 2JOQA 5DLFA 3HHLA 1D9AA 1V3RA 1P1TA 5K8NA 3MM6B 1HYSB 1F2HA 4Y00A 2K8GA 3SV3A 1RWNB 4DCPB 1T3NA 3D3CJ 3G8SA 2YNHB 2KI2A 3PHEA 1PAUB 3K59A 2AIRB 2JFDA 2M3DA 2UVUA 3X1LB 3OR2B 3O6QA 3C46A 3I5AA 1U26A 3RW7A 4PRFA 1JLBB 2UXCJ 1UTAA 2H51B 2WSCC 3M1VA 4NA3A 1N33J 2CJYB 1TKZB 1UFLA 2M2BA 4HR2A 3GSIA 1FK9B 2H4WB 1SBRA 3PNIA 4QW8A 2KG1A 4UOFA 2O5DA 1EIYB 4JI5F 4E98A 4Q8EA 1IKYB 3LP1A 2VB6A 3GCXP 1OQ6A 3E01A 2OLWA 5CYQB 2D9PA 2VQEJ 1YVFA 4DQIA 4DUYF 2DHXA 1OMSA 1RT5A 3W2WB 4DR2J 3M8QA 4DL7A 4H4OB 1PYOB 4PWDB 3NGUA 1VCTA 2V8PA 4RUAA 2V0NA 4DR7J 1A7GE 4KHMA 4LFCJ 4M94A 3SMZA 3PX0A 1J5EJ 1S57A 3WBZA 4KPCA 4DQSA 1TKXA 4ZPWR 1KTVA 4ZVQB 2DNNA 2CG8A 3P8BB 3ZFVA 4ITSA 4OZ5A 2IM0A 2OI2A 1JJ2R 1NU4A 4B3OA 3VAGA 2EFOA 5F8MA 4JI7F 1RWPB 2ZWOA 2J9EA 1RAFB 4K4SA 3VAFA 3RRHA 2DHHA 2N3LA 2GMHA 3DHWC 3MEGB 1RT3B 1U45A 1S6PA 3OTDA 2CA9A 4LF5F 2FVQA 5FIIA 3JSMB 3FKBA 2J0SD 3R5CA 1RB0A 3BJYA 2QJ3A 2MQOA 3V6DA 1TQLA 4CO2A 2WAQD 4KKOB 5CABA 1NAQA 4X64J 4C4WA 3BN4A 4BCAA 1REVA 2ZHAA 3ZZYA 2QV6A 1C0UB 1JIHA 1FI4A 5J1NA 1T02A 2AF6A 4UQTA 3B4DA 3VGVA 3SZ2A 3UR3C 4KHPJ 4AYBD 4CQ1A 2MZ1A 4FYYB 2CADA 2FY8A 2CDRB 1RQ0A 4F0HA 1QSYA 1YBTA 2C2DA 1VK3A 3JYTB 4CYUA 1ICEB 4J9QA 2WOMA 5KFRA 4PZVA 4LF8J 3C15B 2LLZA 4UOHA 2VPXB 1H73A 3QBCA 3KLFA 4DV3F 3LANA 1FRXA 1A0OB 1S0NA 3HSZA 3S6EA 1QTMA 1T9YA 2CZ9A 3ZXWA 4Z37A 2BQRA 2HS0A 2ZDPA 1LWCB 3M4XA 2X1AA 2MZRA 2O01C 2O3DA 2HLUA 2XI2A 2KHDA 4WYLA 2XEXA 2LKZA 3C16A 2YNIA 3H20A 2UUCJ 3HT3A 2CPFA 1HMVB 4Y2AA 5CQGA 4QR1A 3MCNA 4Z7YA 2ZBQA 1JKHA 1CJVA 1X5TA 3G6VA 1U7LA 5J1PA 3ZTOA 4ETZA 2Y1JA 2DGWA 2XYGB 4DV0J 4QIGA 2V34A 4OIXA 3CULA 3DRRA 5FJ4A 1X31C 4K8RA 2G2YA 2WBRA 1Y11A 2HHSA 5K9FA 5A0YA 3C8YA 2AYMA 2HVDA 4TLQA 9RUBA 4J9KA 2ZZNA 2VF3A 5AXLA 2Q6BA 1RAIB 2UUAF 2C2EA 3T19A 4OYMA 1N36J 1R6YA 4UUWA 3AD9C 1NMEB 3QMQA 3ETMA 2QLXA 3MM6A 1HYSA 4X66J 1ULRA 3MM7B 3MHYA 2YNHA 2PEBA 4YEAA 4XDCA 3CJ4A 3JSRA 4QYZK 3OR2A 4XDDA 4QIVA 2YXLA 2JLFA 3QAEA 2R7TA 4YB5A 1JLBA 1JXLA 2IVYA 2B4PA 4DV6F 1Y10A 1TKZA 1K1SA 1FK9A 1U1RA 1X4HA 3EXCX 1KC8T 3CC2S 1P8GA 4P75A 2VDHA 3I9ZA 1T9UA 4NLTA 4N7TA 1XWLA 1IKYA 2KRBA 2IBKA 5CYQA 1K47A 4JB8B 4GKJJ 1WTBA 3W61A 1WEYA 3W2WA 1Q5YA 4H4OA 3PKYA 4PWDA 3TUIC 4PG8A 2XC9A 4I56A 3T1HJ 2E1CA 5L38A 1P6TA 2YPZA 4L76A 2DYAA 3FK4A 2V50A 4DR1J 5B09A 5AXNA 4ECUA 4B3TJ 1V3SA 2BM1A 5H9EJ 4ZLNA 3A3NB 1X8DA 4LF9F 1VK8A 2IPOB 2ADBA 1IBLJ 2OTJS 4Q2MA 3SQGB 4L72B 1D9FA 1OIAA 3MUTP 4DSFA 4WIQA 1PJ6A 2F9DA 4B9NA 3NGDA 1NZ8A 2XI3A 2CJXB 3MEGA 3K5OA 1RT3A 1YIJS 1MG7A 2YKOA 2P6SA 3X3UA 3EM1A 5GADU 5GAHU 3SCJE 4EI2A 3JSMA 4LIWA 2V4RA 1M5OC 3F41A 1N5VA 4OI4A 2F63A 4ZK7M 4N8NA 3TW0A 4KKOA 2DNRA 2N7YA 1F3FA 1HR0F 4R25A 1NB2A 3IBWA 4ZP7A 3KWMA 1C0UA 1RHKB 2A6OA 4XPEA 2AU0A 4CLZA 1F60B 3ILJA 4LQ3A 2Q79A 4DFMA 3S01A 2YX7A 2RHSB 1KFSA 1SC3B 3HLUA 2ZH3A 3GJQB 3J7AN 3KK2B 1CSJA 4RUCA 1TL1B 3JYTA 1Y5NB 3AD7C 5HSPA 3C15A 4ZIWA 4Y0FA 3G4SS 2KXHA 3QJLA 1W2BR 1S49A 1HHQA 2ZBCA 1NRKA 1N34F 4JI5J 2K7JA 2BVZA 2CRLA 5T7LB 4X4VA 1Q86T 2Y9HA 2QLBB 3K2YA 4E8UA 2IM2A 3MEEB 1LWCA 2BKNA 3J7A1 2HS4A 5KT4A 2W24A 4IRCA 2XG8A 3BZQA 4A8WA 1QM9A 1R8BA 2J9CA 1HMVA 2ZITA 4QPTA 4YN3B 1EETB 1B3TA 3UW1A 2IRUA 4LF6F 1FA0A 3PIOQ 4UW2A 2V69A 4PPZA 4TKTA 2HBQB 4DCOB 2YWHA 3L7PA 1RT4B 1SIWB 2ZOMA 3IFEA 3CIZA 2BJDA 2MSTA 5KFLA 2YQ0A 4PXCA 4DPYA 4KIAA 4LRDA 1SB6A 1U8SA 4N77A 3VAHA 1VQ7S 4ZCMA 8ATCB 3QO9B 4KFBB 3CCZA 3BBCA 2DO0A 5KFYA 4LF5J 5A2QY 1P9YA 3PR4A 2XM3A 3DHXA 3IG1B 3BYRA 4K7QA 4H54A 1WWHA 3MM7A 3MTKA 4HI1A 4USMA 4NLRA 2BRKA 2W2PP 1FDBA 2HFVA 1RA6A 3LAMA 2VG5B 2M9KA 3N01A 3H90A 2QN6B 2IRXA 3TZYA 2CG4A 4FDFA 4ZVFA 4IRKA 1XBWA 1RCOB 2VHGA 3A12A 4AQYJ 3CD6S 4P2XA 4M5DB 1SL2A 3CIMA 3KDOA 5J2QB 1OSDA 3O44A 5ADZA 5KFMA 5B0FA 3UVJB 2QMWA 1SI9A 4DL2A 4J90A 3UD4P 3UO0A 3R1LA 4DV3J 1X0FA 4NMXA 1FNOA 2LEPA 3C2PA 2KT5A 1TKTB 2ABYA 3W9JA 4KSEB 5KFUA 3WZ0A 5A6PA 3IR7B 2UU9F 4JI2J 4LBPA 2GQ2A 4ECYA 5KFEA 3PRDA 2NQPA 1PJ5A 1Q78A 2HW3A 4JV5J 2I0XA 1DLOB 2J9DE 1Y3JA 5AJ3J 2GW8A 4O4GB 4WKRA 3OXGA 4LREA 3J81U 5IOLA 1RHQB 2MQLA 5LMNF 5DLGA 3EGNA 4X4NA 3SQGA 2YQ1A 2ZEJA 3MZIA 2GMLA 2PI4A 1JLEB 1S6QB 2LDYA 5C42B 3SCKE 3JQJA 1TL4A 3QIDA 4QIFA 2WSFC 5A76A 2UUAJ 5KFVA 4GC7A 2E7WA 5KFBA 2X1GA 3V2UC 4M8LA 2R8IA 2AJ1A 3GFXA 3PJXA 3GTYX 1RZMA 2OGUA 3DXBA 4LF4J 2UUWA 4BS2A 1W25A 3N5BA 3EZUA 3AODA 3MECB 5IZHA 5AT1B 1KFDA 3R8YA 4PWUA 2LECA 5JMNA 2PC6A 3EPIA 5B0GA 3GIMA 3TA2A 2BYCA 2GVDB 4LVOP 3B82A 2BOPA 4NRTA 4QWBA 1IBMF 1LWEB 2BRLA 3PO4A 4X4QA 3MR3A 3MF5A 2NXNA 4WBFA 1R8PA 4DV6J 3KK2A 2XBPA 4ZPBA 1TL1A 3THPA 3FFIB 2VL1A 1RCXB 4FXVA 4JI3F 3OTOJ 4TY8B 2XHWA 3CCSS 3E3XA 3A8JA 5KFHA 1FFWB 1BMQB 1JLFB 3JTNA 2FVCA 5T7LA 2EFQA 1LQ9A 4DR6F 3BDEA 1H7XA 2FJEB 1B0VA 4DG1B 4RU2A 1IR1A 3MEEA 2QL5B 4CCHA 3KK3B 5E3AA 1YJVA 1FJGJ 3SDEB 2HK3A 3P4UB 2GJ2A 3JAMU 5HVHA 1Z2ZA 5SUHA 4WFAQ 4ZP8A 4C3KA 5E2QA 3P45B 3KLGB 1WKLA 2CJQA 3TJ9A 3JS9A 1EETA 4ZVUB 3CNQP 3D1HA 2R8HA 3RB0A 1Q95G 1BXNA 3OJUA 1VQ8S 2FJDB 4LF9J 3ENAA 1RT4A 4OX9J 1WDTA 4NE9C 4Y65A 4DSKA 1RTDB 1X60A 2L9DA 4QZVB 3TX8A 1D1UA 2ZOGA 3QO9A 4CWBA 1VLYA 2OKQA 4KFBA 2V4JB 3K7RA 1U47A 4BWMA 1X9MA 3IG1A 4K2JA 5DZ7A 2WVDA 4ZCLA 1TL5A 3AA8A 4CT9A 3OXLA 1HR0J 2VG5A 2GHWA 3MEDB 2D3UA 3TOQA 2IIHA 2XSJB 1FD2A 4NXMJ 2KYZA 2CDQA 3MWBA 1N0VC 2M52A 1ZYQA 4M5DA 1DJ0A 3BGOP 5G4DA 1S72S 5J2QA 2ZBRA 5HI7A 4RNFA 5DO2A 3AY0A 1YK9A 4ED2A 3UVJA 2MJUA 1NK6A 3GSDA 1WTFA 5H1SV 4ECVA 3RJMB 1LWXA 1JXVA 3MM5B 4YR3A 2HNZB 1VIXA 1TKTA 4Z7CA 4YHHJ 4OI6A 3K5PA 4Q8FA 4PXEA 4F2RA 5BYQA 1OO0B 3M6WA 1XNQJ 1LW2B 3LQVA 4NL5A 2C42A 5DJBA 3W60A 1DLOA 3ENVA 4Y2CA 4ZS6A 3W64A 3HVTB 4I6YA 5BYRA 5SZTA 4O4GA 4DR5F 2E5HA 2QL7B 2LQJA 3MPYA 1AYEA 2LQ9A 4WP9A 1N32F 1EAYC 5HJXA 4FF3A 1N48A 1B7FA 4CIOA 4LF6J 1M1KT 3LAKA 3TO8A 4DWIA 4R0EA 2UXDJ 1JLEA 1S6QA 4YMEA 2A18A 1B64A 4X4SA 5C42A 4NMLA 5MAOA 3BH6B 2FUG9 3AJ1A 2PGCA 3U1NA 2DY1A 2PA8D 4G1IA 3CJ0A 3TI0A 4RJVA 4AT1B 4C7QA 3QLHB 3KJNB 2OUGA 1YHQS 2X51A 3K8WA 1H0HB 4DU7A 4CO4A 1TK0A 2H48B 2J7UA 1WOOA 4DLEA 2ASJA 1O0PA 1RYSA 3D2WA 2HHTA 4DF4A 2DCUB 2YNFB 3D0HE 2CPZA 4JBCA 3MECA 3L3CA 2JDJA 1GEHA 1FDAA 2J76E 5CXTA 2GVDA 2OEKA 2B4VA 4TU7A 1LWEA 4WE1B 3L95X 2CPHA 1T03B 7FD1A 3V4MA 4U7UK 3JTOA 3T9NA 3FFIA 4ZHRB 1FNMA 3KJQB 3W8PA 3NKYA 4Y3CA 4NI2B 4TY8A 5C25B 1WG5A 3MPDA 3RUBL 5ETQA 1JLFA 1ZM9A 4DV2F 1RAGB 4JYAJ 2JEJA 4BHQA 4OI2A 4IRDA 1Q8BA 5I3QA 4GVBB 4DG1A 2W7AA 3CUNA 3NWGA 4OQJA 3H5XA 3KK3A 2XCPA 3SDEA 2ZBPA 5B0AA 2UVVA 3F44A 3R2CJ 3H2UB 2QZ8A 4GRSA 4O3PA 2OPSB 1RE1B 2DNPA 2JNJA 1UWBB 3KLGA 2DGVA 4JI6J 2KM8B 4MIBA 2HAFA 3CPWR 3DDNA 1YRXA 5LMNJ 5IV4A 1TAQA 2QC3A 3KLVA 4GO5X 4K2XA 1WEXA 3SSQA 3DMJB 2PI5A 1IJEB 2QFIA 4QWEA 1RTDA 1RT7B 5EX0A 2X3GA 1BGXT 3T1AA 3W62A 2AJ4A 3MTJA 2V9KA 2COLA 2V4JA 1WF2A 2P9GA 1AA1B 3O2IA 4ZVRB 2CJ9A 3LP2B 1R89A 1G3OA 4O3OA 5U47A 1R43A 3PX6A 1NK0A 4BWJA 3GYXB 3I32A 5KFSA 4ZN3A 1LW0B 3ENQA 2W8LA 4C48A 3NL0A 5CD4A 1RU2A 4ZVOB 4HH1A 3MEDA 1JB0C 3CMAS 2KVIA 2XSJA 2VG7B 3MR7A 2P2CB 4Y2IA 2AYEA 3P5TL 5GAGU 1HQUB 2QA2A 2BMBA 2PMZD 1S9EB 4MKBA 2NR0A 3DLEB 3R5GA 1J27A 2QRRA 4FYDA 3T5JA 5M2PA 4GC6A 4PYDA 1ZPVA 2A1BA 1AFIA 3MM5A 4HHJA 1VR6A 2CQCA 2HNZA 2OSRA 1B0TA 4NLOA 1F5AA 1G2EA 4KHRA 2R8GA 1BQNB 3RB4A 4CH7A 3DXSX 4DL0C 1LW2A 3HD2A 2ROPA 4DV1J 3A8KA 4LR7A 2DNLA 2P9EA 3HVTA 2OPRB 1S1VB 3C3LA 1D3WA 4F50A 4B08A 2ZHOA 2N4DA 1QD1A 4A8MP 2L08A 3VVUA 1R0AB 1U1PA 1X4BA 4B9LA 1RI7A 1G6BA 4LRCA 4B02A 5LJ5Y 4KGMA 3MD3A 2WVFA 4KE5A 5CD4H 3RB6A 4YS2A 4DBQA 4OHVA 1IKVB 2IDEA 2VU5A 1RK8A 2L41A 1SJ1A 3FGVA 4KGVB 4FPIA 2Z2ZA 8AT1B 4Q2LA 3QLHA 3A3PB 1DHMA 1UEKA 4IH6A 2Z30B 1ZZNA 4CP5A 4K4YA 3GP9A 3LO3A 2M4MA 1CVJA 2DO4A 5H9EK 3TUPA 2ASYA 2VUGA 4O3RA 3NEKA 4MIWA 1WD6A 2YNFA 2DNOA 3A13A 1OPIA 4OJGA 4O0NA 3AOCA 3EICA 3I9V9 1Q53A 4F3MA 3AD8C 4ZIVA 1SCJB 4OL8A 2MB0B 3RAMA 4RL1A 3CDAA 1DBDA 3QPIA 3CDBA 4WE1A 1RWOB 5HP1B 4CLWA 1WI6A 1T03A 4NLUA 3TWZA 2PIIA 2XS2A 4ZHRA 1SQFA 2WBMA 3M2RB 4J9UE 1I94F 4WWSA 4NI2A 3BSNA 5C25A 3MPWA 3VR1A 1R7IA 1UVKA 2ZC3A 3FEXB 4GVBA 3VGTA 3W7BA 3HHLC 1FJEB 2HFUA 2XNQA 3HHKA 3D6HB 4ZJLA 2OD6A 2VIHA 1OQ3A 3LA0A 4F25A 2CZ4A 3T41A 1TR0A 1F2GA 1HBNB 2HHUA 2NXUA 3Q8VA 2OPSA 2G1DA 1RWMB 1F0XA 1UWBA 3D9BA 3C6UB 3A8EA 1OWXA 2A3JA 2VICA 4UY85 2Z58B 4J9VA 2QIFA 3F73A 4DR3F 4M5HA 2APOA 4IH7A 2V2QA 3DMJA 1SC1B 1RT7A 5DG9A 2W7OA 4TQRA 1UMJA 1XMBA 4N76A 4C8NA 2O66A 4X84A 4RWXA 4C0OC 1C0TB 2NXJA 2ZH5A 3KLIB 3NCRA 1GTEA 3LP2A 2CNLB 4NLWA 2V8DA 2XGQA 1SKUB 4EYHB 3CCUS 2YWGA 4U96A 4DS5A 3MCMA 3J7ZT 1XR6A 1LW0A 1D09B 3R97A 2IMOA 2E5JA 3TNVA 5B7WA 4JI8J 3AOBA 4OHXA 2VG7A 3HFVA 1XTZA 4CLYA 1NH8A 1KLMB 1A9NB 3FRYA 5J2MB 3CMQA 4CT8A 3D6TB 1FTRA 1HQUA 1UVMA 4GMKA 1KLNA 4LF2A 5KOXA 1S9EA 3T6JA 4A8FA 4A47A 1NK4A 2FVRA 3DLEA 2NLWA 4RBUA 2XTJP 2EBGA 4JI0F 2VA3A 2U1AA 2PMHA 2E7VA 2CJBA 2E5LF 1YTYA 2JSXA 2OFGX 2B51A 3HFZB 4QWCA 2B5JB 4DV2J 4P6QA 2VG6B 1TTHB 4OZLA 2PSZA 1NO8A 3K17A 1BQNA 1S77D 4YR0A 2MZSA 2HGLA 4DCJB 2NREA 4HDGA 5F8NA 3QGIA 1H98A 2C3PA 3MOZA 2VPYB 1H72C 1T9XA 2DD8S 4YR2A 4B9VA 1BWEA 1S9FA 2VBXA 2OPRA 1S1VA 4L6V3 4UF4A 3OHBA 5J2NB 1WF1A 4MYTA 1CQMA 4TU8A 4UUXA 3EMTA 4WYWA 1KTQA 5ETLA 4J9PA 4NLXA 1R0AA 5E41A 4EGLA 2RRAA 5HK4A 1KQFB 3GPAA 3BGFA 4CLUA 4ZPDA 5K14B 3D7SB 3CSKA 1YSJA 4OYWA 3UD3P 2B9XA 1IKVA 1Q4RA 2EPIA 2MGZB 1NCLA 3O1LA 2VQFJ 1YZ6A 1WC3A 2AP6A 1JJHA 1IBKJ 4KTQA 2WW4A 3H5YA 4CO0A 3B54A 1YJWS 2I38A 2EW9A 4ETXA 3GV7B 1F9HA 2IYGA 2YX4A 5DM6Q 4YFUA 2FVSA 3CD5A 2R8KA 2GVZB 3CCLS 2B9WA 3T9ZA 3CCRS 2EFPA 1CS4B 4B3SJ 1R8HA 5A2QU 1X5SA 2DH7A 1ELOA 1CEZA 2QLJB 2ROGA 5CA5A 5HP1A 4I68A 4F0MA 5AXKA 2KXFA 1G4CA 3M2RA 4ER8A 4P52A 2KHCA 4N8OA 1FKOB 4LF7F 3A1YG 3IM9A 1U49A 2XB2D 1IN0A 3I4PA 1PAEX 1QDUB 1C4CA 5G0RB 3Q83A 2B43A 2UXBJ 1FRIA 2JL9A 3M8PB 4CTAB 2RKIB 2VFUA 1QSSA 4LFAJ 2HHHJ 2ALYB 1HBNA 2RDDA 2W9AA 2JLGA 2R2TA 1HWUA 4DZ6A 1VJQA 3AHPA 3C6UA 4RO0A 1VYAA 3ILIA 2J7KA 1WHVA 2CKWA 3UQSA 3G6XA 2QMXA 4KGXB 3CE8A 1HQEB 2HYIB 1UL3A 3JTPA 3GWCA 2HWTA 2Z0GA 4ED7A 2F9JA 3IWXA 5I3UB 1CQNA 1JJCB 3FCHA 4IH5A 2GGPB 3GG0A 4WP3A 2CNNB 4V19X 1M5PC 4ZDNA 2FJWA 5C7PA 5FLXY 3PW4A 1C0TA 1JJ4A 4RW9B 3D4JA 3KLIA 3GONA 2CNKB 3DM2B 4H4KC 4AXJA 5EX3A 3LP0B 2NYHA 3M6VA 1Q81T 4L74A 3GR0A 3AQOA 2ZJQQ 1GXLA 1UEVA 1IQZA 2KFZA 4ATNA 2V94A 1LXJA 3TA1A 4L3NA 3OD2A 3RTVA 1ZOTA 3TYTA 2OIHA 3ISND 4MKAA 3G8TA 5T41A 3BO4A 2H5IB 1GX5A 1KLMA 1R0BG 1S6UA 1U25A 4MTPA 3H2LA 2ZJRQ 5J2MA 3WIVA 3B8HA 1Y5IB 4TU9A 4K4TA 4IQMA 2C3MA 2GQQA 2DNKA 5ETPA 5AE3A 5BXIA 5F9NA 2XLJA 4CO3A 3MM9B 2DRAA 2DHAA 4JI1F 1HNVB 5I42B 3OL8A 1KD1T 1J5OB 2HZCA 3ETOA 3GFYA 4J5OA 3VAIA 2B5JA 4DV5F 3TVZA 4C8KA 3WHIA 2VG6A 4LRAA 2XMJA 2BJ8A 3RYLA 3GZ7A 2LQ8A 4ELTA 1RABB 3IWLA 3DLGB 5I4MA 2YWEA 4FYWB 4OI0A 2EBEA 3V5RA 2DISA 3IC1A 2HZAA 1V6HA 4DFKA 1U1OA 4NA2A 5RUBA 2M5YA 1MWYA 4P72A 1YI2S 4LFBF 1KRPA 1HBUB 4ZN1A 1LXNA 5J2NA 3HZGA 5ETMA 3QAUA 3CCQS 1CPZA 4Y28C 2GAHC 3W5ZA 4V19J 2P8IA 1S0VA 1MN7A 4DR3J 5K14A 1F5CA 3CO9A 2E29A 2A0FB 1N6QB 3M8SA 5DM7Q 3ZZZA 4HLBA 2H9ZA 3GILA 1WOSA 2QG9B 2MGZA 1Q7YT 4QW9A 4ZVTB 3TJAA 5KG1A 3W5XA 2RQCA 2WVBA 3W8GA 1UZHA 3PJ9A 4F4WA 4BBYA 2XY6A 2ZUAA 2DGXA 1S4FA 2GVZA 3R9LA 1ITPA 3IBCB 1CS4A 1SL1A 4KT0C 4J91A 1HQ2A 4WFYA 4EMDA 4AL7A 1EB0A 1W2IA 2M70A 3PACA 2Y0BB 1IJFB 1HNZF 1TL3B 2MHNA 3RBDA 2YVSA 4MK9A 2QSFA 1SKRA 1LK5A 4DFPA 3H4DA 1H74A 3W66A 1UKUA 1FKOA 3ITHB 3BREA 2B6AB 4J9NA 1RWWB 4WXOA 4USHA 1I5OB 1XNRF 3O8WA 5G0RA 1GX6A 3M7VA 1HIYA 3M8PA 4CTAA 1FEHA 2RKIA 1Q1KA 3HDSA 5L1JA 1HNWF 1VMBA 1BUXA 2DKOB 2KZZA 2XS5A 1W26A 4MH8A 2FHMA 2NZCA 4HL9A 2XMTA 3K0JA 3DI6B 2CQ1A 5KFAA 1H2VZ 2R2SA 2O67A 2H3EB 2QE5A 2JHEA 2MKHA 2HFZA 4PCQA 4U8YA 2ACYA 4OHYA 3W63A 5IQQA 3I55S 2F40A 2YPYA 3KYLA 4IO9Q 4RNNA 1HQEA 4UY8T 4WZQA 3FNNA 2VPWB 1FERA 2WK4A 5L39A 5AXMA 3H42A 4ZP6A 4RWWA 4U95A 1FDNA 4QJVA 3DOLB 3J7YI 5I3UA 2HWHA 2H4YB 3BSAA 2GGPA 4M5MA 4X65F 1WHWA 1CJKB 2B9YA 1YWXA 1H2UX 2HMIB 4I7FB
chains in the Genus database with same CATH topology
1S6QB 2FVPA 2UZAA 2DHGA 4TN2A 2LDYA 5E3CA 4QPXA 3M2VB 1RTJB 1RA7A 3OFEA 2ZVSA 5C42B 4RW9A 5BR8F 3SCKE 1RTIB 1QAXA 2CQ3A 3H8YA 1TL4A 3E2EA 3QIDA 4RU9A 3DM2A 1N8RT 1XMOF 2HFOA 3LP0A 2G13A 4QIFA 1QE1B 3Q8QB 1AXQA 2WSFC 1YQHA 5KG2A 2DPIA 3TAQA 1VRTA 2ADCA 3T3FA 4I2PB 2XLIA 3PZPA 2WSEC 3KLEA 3UWTA 2HVHA 4ILMA 5KFVA 4IOAQ 1ZAWA 4QYZJ 4GC7A 2E7WA 1VQLS 3M32A 2XY7A 4QOTA 5KFBA 5KAKA 2AYBA 2X1GA 3V2UC 4M8LA 2C3OA 1VBYA 2R8IA 1IQTA 2R7RA 2AJ1A 1LWFB 2QA1A 3GFXA 4FVCA 3PJXA 2XWXA 4OJ1A 1UA0A 1HNXF 4LF4F 4YY3F 4CH1A 3CCES 1UJ5A 2AX0A 3DXBA 5EWGA 1FKPA 2UUWA 4BS2A 4QYRA 2JVOA 5IFMA 2DGTA 3HZEA 1FE4A 4DL6A 1H38A 2KZMA 4WCEQ 2ZD1A 1W25A 1XN9A 4ID5A 1MSWD 3CDUA 4LIRA 1ZTWA 3HKWA 4URSA 3THVA 2CQ0A 1S0OA 3N5BA 3EZUA 4MMOA 4PQAA 3M6UA 3HXMA 1F5BA 1VFJA 3MECB 3BN7A 2KTQA 5IZHA 1KFDA 2Z2LA 4PWUA 4NPOA 1QY7A 3VWSA 1ZM3A 1C1CB 4ES2A 2LECA 5J2PA 1HBOB 3FEYB 3OXFA 2PC6A 3EPIA 5B0GA 2EG1A 2L48A 3GIMA 4PG6A 3TA2A 2E66A 3Q2SC 2BYCA 4LVOP 3B82A 2BOPA 2NPIA 3CD0A 1IUJA 4KGKA 4NRTA 4QWBA 1IBMF 1LWEB 5HBMA 3BEGB 4ZP9A 2BRLA 1S1TA 4URQU 3PO4A 3FSXA 4X4QA 3MR3A 3MF5A 3MM9A 5C5JA 1YITS 1R8PA 4DL5A 5CCMA 3BO2A 1BQMB 3KK2A 1HNVA 2CQGA 2XBPA 4NZ0A 1JLGB 2AGQA 5I42A 4ZPBA 2DR9A 5F8JA 1L3SA 3OTOF 3BDPA 4RKUC 3OL9A 1TL1A 3THPA 1FEEA 4XK8C 3FFIB 1J5OA 2VL1A 4I2QB 3MM8B 4FXVA 3AB2B 4C11A 4JI3F 2FHJA 4FF4A 4F02A 2R7UA 2ROEA 4ED6A 1FXDA 2ATLA 1S1WA 4TY8B 3MMAA 3MMCB 3CJ3A 2XHWA 3CCSS 3E3XA 2DGOA 3RAQA 3J80Y 1NK9A 3UPFA 2FJBB 5T14A 5L9XA 4RW7A 4LJMA 3IO1A 2FJXA 5KFHA 2OMOA 1I1GA 2YWFA 1VBXA 1JLFB 1GQEA 1GXUA 4TYAA 3KFWX 4UQGA 4MK7A 3DLGA 2IBOA 2UVWA 3JTNA 2IMWP 1TVRB 3HMJG 2FVCA 5B0EA 5T7LA 2EFQA 3O3LA 4PG4A 1LQ9A 2NYIA 3I0RB 2SXLA 1RAJA 2LXUA 2QYCA 4DR6F 2RRNA 4RW6B 4CO5A 3BDEA 2W9BB 2EK1A 1H7XA 2FJEB 3G8QA 1B0VA 4DG1B 4OFZA 4QBUA 2DGQA 1M0SA 4RU2A 3WX4A 3CCTA 3MEEA 3DOKA 1NHUA 3V81A