2ZEMA

Crystal structure of the human glutaminyl cyclase mutant d248q at 2.18 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLQLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zemA00
3NFZA 2PJAA 2AFSA 4ONWA 3IIBA 4IAVA 4FUUA 2EK8A 2OOTA 4DYOA 1Q7LA 5CPAA 3FJUA 4MXUA 4P4BA 2IMOA 2AFMA 1R3NA 1XJOA 1YLOA 2RB7A 1Y0RA 1CP6A 1GYTA 3ISZA 5JGFA 2PJ9A 3PBBA 2IJZA 2AFXA 3FF3A 3KASA 4MMOA 1TF9A 3CDXA 1Z8LA 4H2KA 5D8NA 3MN8A 5K8OA 2ZEEA 3PB4X 3K9TA 2CTCA 2PVWA 3BI0A 4NGQA 2CF4A 2GU2A 5HVGA 3PB6X 1HDUA 2XEFA 2PRQA 4MCSA 2DEAA 4UF4A 3KL9A 5HVHA 2C6PA 3H8GA 4MCQA 3B35A 2AFWA 2WYRA 1CBXA 2PIZA 2CTBA 3S9MA 2PJBA 2PJ5A 3TC8A 3HUVA 2PJ1A 4OIDA 3S9LA 2PJ7A 4PXCA 1ELMP 1XRYA 1FT7A 1VIXA 4P4IA 4ZX8A 3IC1A 2F7VA 4NGSA 3D7DA 4F8ZA 1XFOA 4NJQA 1YSJA 3BXMA 5K8PA 4IHMA 3PB9X 4OC0A 1BLLE 5HXDA 1LANA 1TKJA 3ISXA 3FMCA 2VL1A 1EE3P 3DGVA 4W9YA 2WZNA 1CPSA 3S9NA 4R7MA 3B7IA 3VH9A 1YW4A 1KWMA 4P44A 1QMUA 2BOAA 4OC5A 5K8NA 4A94A 4OIWA 1PCAA 4RUHA 1CX8A 2HC9A 3FX6A 4OC1A 4P4JA 3GUXA 2ZELA 3WC7A 2O53A 1AMPA 3KHXA 3KQZA 2ZEMA 3SJEA 4NGMA 4JYWA 3LWUA 2J9AA 2IQ6A 3N5FA 1VGYA 5CBMA 3V38A 3WT4A 2JBJA 4NGNA 3PEIA 3BHXA 7CPAA 4OC2A 1QQ9A 1CPXA 3SI2A 1ARLA 2Q4ZA 6CPAA 1LFWA 5D29A 1R43A 5THWA 3WABA 5DS0A 5I4MA 1CG2A 4P4DA 5LRJA 4K3NA 4MRIA 2C6GA 5LRGA 4X2TA 1BAVA 3FECA 3B3VA 3BI1A 2PCUA 4DJLA 2PJ4A 1ZG9A 3JRUA 2QVPA 4P45A 3KHZA 3V7ZA 3B3WA 1TXRA 3PFEA 4OC3A 1PYTB 3SJGA 4NJRA 2PJ0A 5LYFA 3D67A 2RFHA 2V77A 3RAMA 4EFDA 1XMBA 3PB8X 2V8GA 1H8LA 2QYVA 3B3CA 3FH4A 4OKOA 3HLPA 3GLJA 2C6CA 4ZYQA 4DUKA 3NH5A 1F2OA 1CP7A 5HVFA 2PJCA 4TWEA 1ZLIA 1IY7A 2XEIA 1Y0YA 4MHPA 5K8MA 5LRKA 1FNOA 2AFZA 4UEFA 1HDQA 3IWWA 3WC5A 4OC4A 3L2NA 3GB0A 3SJXA 3RZAA 2ZEFA 2XEJA 4A37A 3IO1A 4NGRA 3NH8A 1HEEA 2C1CA 4UIAA 3D7FA 3KZWA 1Z2LA 4P4EA 2F8HA 2JBKA 2PVVA 4O23A 5IB9A 2ZEOA 3B3TA 1BPNA 2NSMA 1ARMA 3IEHA 4P4FA 1F57A 3SI1A 3B2YA 1M4LA 3DLJA 2OR4A 1ZLHA 4FAIA 1TF8A 3KI9A 2G9DA 4ZY2A 1LAPA 4OMEA 4R8FA 5LYIA 3CT9A 1BPMA 3D7HA 4P10A 2AFUA 4MHZA 1YMEA 2FVGA 3IJ3A 3H8EA 4BD9A 4MCPA 1Y7EA 5ELYA 2ZOGA 1LAMA 2CIJA 5JH9A 3NH4A 1YW6A 2ZEGA 1Z5RA 3CPXA 1OBRA 3FEDA 4GM5A 4ZY0A 3KGQA 4UEEA 5JM6A 3TX8A 3KR4A 3RBUA 5J1QA 2BO9A 4ZX9A 4Z65A 3QNVA 5LYLA 3K2KA 3I1UA 4WWVA 4PXEA 4ZY1A 4MHNA 4B6ZA 4PXDA 3D4UA 4F9UA 4F9VA 3PRTA 4YWYA 2ABZA 4NGPA 4TNUA 2JEWA 4UEZA 4KSIA 3D66A 4IK2A 2AFOA 2EK9A 4LQGA 3D68A 1DTDA 1TKFA 2Q43A 4JZ0A 2PJ2A 2XEGA 1TKHA 2EWBA 3PFOA 2Q51A 2GLJA 2PE3A 1RTQA 1LOKA 1AYEA 1VHOA 3SJFA 3SI0A 4UIBA 2V8HA 4WJBA 2GREA 4EWTA 4PPZA 4EMEA 4MHYA 3VATA 2PIYA 1LCPA 2ZEPA 4NFRA 2ZEHA 1ZG7A 1ELLP 2O4HA 2BCOA 4X3RA 2PJ8A 4MCRA 3NA6A 1NSAA 4CPAA 4PQAA 4FBEA 4NGTA 2V8DA 3PB7X 2QJ8A 3FEEA 3MRUA 1ZG8A 4Q7AA 4A39A 3CPAA 4R76A 1IGBA 2ANPA 3D7GA 2ZOFA 1F2PA 4AXVA 2NYQA 1XBUA 4R6TA 5F09A 3B3SA 4ZI6A 3H8FA 2V8VA 3T8WA 2GLFA 1DE4C 2HB6A 4PXBA 1VHEA 2POKA 4P6YA 3VARA 4G1PA 2ZENA 3KQXA 2PJ6A 1JQGA 4OP4A 3PBEA 4X8IA 5LYDA 3WC6A 3LMSA 4A38A 3KR5A 2I3CA 4YU9A 8CPAA 2PJ3A 4FWUA 2ZEDA 3IFEA 1UWYA 3FVLA
chains in the Genus database with same CATH superfamily
3NFZA 5GCNA 2PJAA 3SHPA 2AFSA 3EY5A 2Z0ZA 4M6IA 4ONWA 4B5PA 3IIBA 4IAVA 4FUUA 2EK8A 2PR1A 1NSLA 2JDCA 2ZW4A 2OOTA 4DYOA 1Q7LA 1S7KA 2B58A 5CPAA 3FJUA 4MXUA 4P4BA 1MJAA 3W6SA 5IX3A 2IMOA 1QSNA 1U6MA 1PUAA 2AFMA 1R3NA 4IF5A 2CY2A 4R9MA 4CAEA 1XJOA 1YLOA 2YNCC 4AVCA 2RB7A 2G3AA 1V0CA 2PC1A 1Y0RA 4R87A 1CP6A 2J8NA 1GYTA 3TCVA 4L89A 4MFLA 3ISZA 2YNCA 4CGPA 2PJ9A 3JVNA 5JGFA 3PBBA 5KTCA 2IJZA 1B87A 2AFXA 3FF3A 3KASA 4MMOA 4UFVA 5ISVA 1TF9A 2FIAA 3W91A 3CDXA 1Z8LA 2AE6A 4H2KA 4NF1A 4FD7A 4MBUA 3MN8A 5D8NA 5K8OA 2CNMA 2ZEEA 3NE7A 4Q38A 2Q4YA 3K9TA 3PB4X 4KOVA 2CTCA 2PVWA 3BI0A 3DSBA 4MFQA 4AG7A 4CGMA 2Q04A 4NGQA 4UCMA 3D8PA 2CF4A 2GU2A 5HVGA 3FXTA 1FY7A 2EVNA 5G1ZA 3T90A 3PB6X 4CAFA 2GE3A 4KVME 4B11A 3B8GA 1HDUA 4M6GA 4KORA 2Z3PA 2XEFA 2F5IA 4A31A 2PRQA 4AVAA 5F49A 3D3SA 4MCSA 1QSTA 2DEAA 2WSAA 4KVOE 4MJ8A 4KLWA 4UF4A 1MJ9A 4HNXB 3KL9A 5HVHA 2C6PA 4LQ6A 3H8GA 4MCQA 2QIRA 3B35A 3CXSA 1AUGA 2AFWA 2DXQA 1CBXA 2WYRA 4F0XA 4MFPA 1IB1E 2CTBA 2PIZA 3S9MA 4KOSA 2PJBA 2PJ5A 2PRBA 1Z4EA 2FS5A 1Q2CA 2FIWA 3N7ZA 4M85A 1XMTA 5KTDA 3TC8A 3HUVA 4A30A 2PJ1A 4JWPA 1JWQA 4OIDA 2Z3LA 3S9LA 2PJ7A 2VQYA 4PXCA 1S7LA 1OZPA 1ELMP 3BLNA 3R9EA 3UY5A 4E2AA 2BUEA 1XRYA 5JPHA 2Q7BA 1FT7A 1VIXA 2Z3NA 2VZZA 4P4IA 4ZX8A 3IC1A 4OAEA 2B4DB 2F7VA 2K5TA 4NGSA 2PDOA 4F0YA 1CJWA 3P2FA 3D7DA 4F8ZA 2DPTA 4KOTA 3IWEA 4HNWB 1XFOA 1L0CA 4NXYA 5J8FA 4NJQA 3F0AA 1YSJA 3TFYA 5AG7A 3BXMA 5K8PA 4CAVA 3GYAA 4IHMA 3PB9X 1TIQA 4OC0A 3WR7A 3R95A 1BLLE 2CNTA 1S5KA 5HXDA 2P6EA 1LANA 1BOBA 4FD6A 1KUXA 2B4DA 1GHEA 1TKJA 2YNEA 3ISXA 4MI4A 1PU9A 1YK3A 2NMTA 3FMCA 2VL1A 4A95A 4JXRA 2ZW5A 4A33A 1EE3P 2ODFA 3DGVA 4KOXA 4W9YA 2Q0YA 4UWIA 2WZNA 3T9YA 1CPSA 3S9NA 4R7MA 1M44A 2GANA 3B7IA 3VH9A 1YW4A 1KWMA 1KUVA 2PSWA 1YR0A 4P44A 2FT0A 1QMUA 2BOAA 2JDDA 4OC5A 4RN7A 5K8NA 2DPSA 4A94A 4OIWA 1PCAA 4B5OA 4RUHA 1CX8A 2HC9A 4F6AA 1MK4A 3FX6A 4OC1A 4P4JA 5HMNA 4B5PB 3GUXA 3JTKA 4MY0A 3S6FA 2ZELA 5H84A 4KOUA 5A28A 3VWDA 2R1IA 3DDDA 4CYQA 3RNZA 3S6GA 3WC7A 2O53A 1AMPA 3KHXA 3KQZA 2B4BA 4CAWA 2ZEMA 3SJEA 2BEIA 4NGMA 4C68A 5I0CA 3CZXA 4JYWA 3E0KA 2D4PA 5G20A 1WK4A 3W6XA 3LWUA 3TTHA 4II9A 2J9AA 2IQ6A 2FL4A 1VGYA 3N5FA 5CNPA 5CBMA 4NSQA 2VBQA 4ONUA 3R9FA 5E96A 3V38A 3WT4A 2JBJA 4NGNA 3EO4A 2GIVA 3PEIA 4U5YA 3BHXA 3LD2A 3ZZIA 7CPAA 4OC2A 1QQ9A 1CPXA 4JXQA 1ARLA 3SI2A 2DF5A 2Q4ZA 5C88A 2OU2A 4CYNA 6CPAA 1KUYA 4XNHC 4PK2A 4B13A 1LFWA 5D29A 1R43A 5THWA 2FCKA 3EXNA 1MJBA 1WWZA 4GS4A 4I49A 3DNSA 3PGPA 5DS0A 3WABA 4UFWA 2JLMA 5I4MA 1CG2A 2ATRA 4P4DA 5LRJA 4K3NA 4MRIA 4CYOA 1XE4A 4ZGYB 2C6GA 1QSOA 5LRGA 1S60A 3G8WA 2O28A 3K9UA 1M1DA 4X2TA 4OLLA 1BAVA 3TO6A 3FECA 3B3VA 2R8VA 4A2ZA 4QB9A 2Q44A 2OZGA 3BI1A 1XIXA 2PCUA 2YNDA 2R98A 4C2XA 4LUAA 4DJLA 2J8RA 2PJ4A 5J8CA 4AG9A 1ZG9A 4FD5A 3JRUA 2EUIA 2PR8A 2QVPA 4P45A 4XPDC 1ON0A 5JQ4A 3KHZA 3V7ZA 2D4OA 2REEA 2H5MA 3B3WA 4EVYA 1TXRA 3PFEA 4OC3A 1PYTB 3SJGA 2P6FA 4NJRA 5EBVA 4KLVA 2J8MA 2PJ0A 5LYFA 3D67A 5AG6A 4KOWA 2RFHA 2WPWA 2V77A 3D2PA 3RAMA 4EFDA 2EBJA 2VI7A 1XMBA 3PB8X 2V8GA 1I1DA 1NMTA 3H5ZA 1H8LA 2QYVA 3B3CA 3FH4A 4OKOA 4AB7A 1YLEA 3HLPA 1P0HA 1XF8A 3GLJA 4Q36A 2C6CA 5AG4A 2Z11A 5AG5A 2G3TA 4ZYQA 4DUKA 3NH5A 1F2OA 1XOVA 1M4IA 1CP7A 3FRMA 5HVFA 1J4JA 2B5GA 2PJCA 4C2YA 4TWEA 1ZLIA 3QAYA 1IY7A 2FE7A 2XEIA 2Q4VA 3TE4A 1Y0YA 2AJ6A 4MHPA 3EC4A 3FNCA 5K8MA 3TO7A 5LRKA 1FNOA 2AFZA 2ARHA 4UEFA 1HDQA 3KKWA 4CRYB 4PSWA 3TOBA 1K4JA 3IWWA 2G0BA 3WC5A 1KZFA 1IOFA 1IYLA 3CXQA 4OC4A 2ZPAA 3L2NA 4XPKA 3RYOA 4L8AA 3NE8A 3GB0A 3SJXA 4MFKA 1S7NA 5DWMA 2ZEFA 3RZAA 4AVBA 3H4QA 2HQYA 3FIXA 2XEJA 4A37A 1CM0A 4JJXA 3IO1A 4NGRA 4U9ZA 5C82A 4A32A 1B6BA 1IOIA 1S3ZA 1HEEA 1ZO0A 2C1CA 3C26A 3NH8A 4UIAA 3D7FA 5EMIA 4CGOA 5AGEA 3KZWA 1Z2LA 3FYNA 4PV6A 4P4EA 2ZW7A 3TOAA 2F8HA 3S6KA 2JBKA 2PVVA 4JD6A 4O23A 4MFJA 5IB9A 1VKCA 4H89A 2Z3KA 4YFJA 2ZEOA 3B3TA 5G21A 1QSRA 1BPNA 2NSMA 3TO9A 4ORFA 2IL4A 1ARMA 4M6HA 2OZHA 3R96A 3IEHA 4P4FA 1F57A 3SI1A 3ZJ0A 4JLYA 3EFAA 3B2YA 4UA3A 2QECA 1M4LA 3DLJA 2OR4A 1ZLHA 2BL1A 4FAIA 1S7FA 1TF8A 1VHSA 3KI9A 2G9DA 3IU2A 4ZY2A 4B14A 4UCPA 1LAPA 4OMEA 1Z9UA 2EO8A 1Q2DA 4BINA 4UBRA 4R8FA 4R3KA 5LYIA 3CT9A 3I9SA 5IV0A 4MFZA 4XNHB 1N71A 2JEVA 4M3SA 1BPMA 4CYPA 4KUBA 5H86A 3FB3A 4B12A 1YGHA 3D7HA 2WUUA 4P10A 2AFUA 4MHZA 1YMEA 2REFA 1YREA 4CGNA 2FVGA 3IJ3A 3H8EA 4BD9A 4MCPA 1Y7EA 5ELYA 1Z4RA 5KTAA 2ZOGA 2OH1A 3V8IA 2ZW6A 1LAMA 1X10A 2I79A 2CIJA 4B10A 2ZXVA 3NH4A 1YW6A 5JH9A 2ZEGA 1Z5RA 1Q2YA 3CPXA 2C27A 1OBRA 1Y7RA 3FEDA 3A9LA 4GM5A 4ZY0A 4PSXA 3KGQA 4UEEA 5JM6A 4ZBGA 3TX8A 1YX0A 3KR4A 3RBUA 5DWNA 5J1QA 2BO9A 1Z8TA 4ZX9A 4QBJA 4Z65A 1YQEA 3QNVA 5LYLA 3K2KA 3I1UA 1BO4A 4XPDB 4KOYA 4WWVA 3P2HA 4PXEA 4ZY1A 4MHNA 4B6ZA 4PXDA 2Y0MA 3D4UA 4NCZA 4R57A 4F9UA 4F9VA 2FXFA 3PRTA 4YWYA 2ABZA 1QSMA 4H6UA 4C2ZA 3D2MA 2VXKA 5IB0A 2PQ8A 4NGPA 4TNUA 2JEWA 4FD4A 4UEZA 4KSIA 1I12A 3BJ8A 4UFXA 3D66A 4IK2A 1IYKA 3GIUA 3PP9A 3JUWA 2AFOA 2EK9A 3PZJA 4LQGA 3D68A 1DTDA 1TKFA 2Q43A 2B5GB 1X12A 1Z8XA 4JZ0A 3QB8A 4YRHA 2PJ2A 4OADA 5BWAB 2XEGA 1YVKA 4PK3A 3OWCA 3R1KA 4KS9A 5F47A 1TKHA 2EWBA 3VWEA 4Y49B 3PFOA 2Q51A 2GLJA 2PE3A 3MGDA 1RTQA 1LOKA 1AYEA 2VEZA 3SXNA 3LACA 1VHOA 2QMLA 3TT2A 1XEBA 3SI0A 3SJFA 4UIBA 4RS2A 2WPXA 4Y49C 2V8HA 4WJBA 4U9YA 2GREA 3GKRA 4EWTA 5A27A 4YGOA 4PPZA 4QC6A 4CS0B 2Z3MA 5FVJA 4EMEA 2FSRA 4MHYA 1M4DA 4CRZB 3BJ7A 4IUSA 4BMHA 3VATA 4RI1A 1A2ZA 3DR8A 1M4GA 2PIYA 3FBUA 4BBHA 1LCPA 1IU8A 2CXAA 2ZEPA 4NFRA 2P6GA 2ZEHA 1ZG7A 3IWGA 2YGWA 1ELLP 4QVTA 4X5KA 5EC4A 2O4HA 2BCOA 3RO0A 4X3RA 2X7BA 2PJ8A 1I21A 4MCRA 3DR6A 4KVXA 3NA6A 1NSAA 4CPAA 4PQAA 4KSFA 4C7HA 4CAXA 4GXHA 4FBEA 1RO5A 4QUSA 4NGTA 2V8DA 1Y9WA 3PB7X 2QJ8A 1LRZA 4UWJA 4MHDA 3FEEA 3MRUA 1ZG8A 4HKFA 4KSAA 3IGRA 4Q7AA 2CNSA 4H6ZA 5F48A 4CGLA 2A4NA 3CPAA 4A39A 4R76A 1IGBA 2ANPA 3D7GA 2HUZA 3I3GA 2ZOFA 2HV2A 2KCWA 1F2PA 3GY9A 5HH1A 4AXVA 2R7HA 4HPSA 2NYQA 3SXOA 1XBUA 4R6TA 3CXPA 1YVOA 2I00A 1NE9A 4KUAA 2B3VA 3QAHA 1Y9KA 2RC4A 1R57A 2P0WA 2VZYA 4NEXA 3G3SA 5F09A 3B3SA 4ZI6A 4MY3A 4XPLA 1SQHA 2V8VA 3H8FA 3S6HA 3T8WA 2GLFA 1DE4C 4K30A 2HB6A 4UCNA 5F46A 4LX9A 4PXBA 2BSWA 3F5BA 4E8OA 3F8KA 4E0AA 1UFHA 4DNCA 2Q7SA 1VHEA 2POKA 4P6YA 4R3LA 4G1PA 1RXTA 3VARA 1IIDA 2B3UA 2ZENA 1IICA 4KZTA 3KQXA 1Z8WA 2PJ6A 1JQGA 4OP4A 3PBEA 3IU1A 2OB0A 4X8IA 5LYDA 2Z10A 3LODA 1P4NA 3LMSA 3KR5A 3R9GA 2OZUA 3WC6A 2Z3OA 4A38A 2I3CA 4HNYB 5G22A 4YU9A 8CPAA 2GFQA 2PJ3A 4FWUA 4J3GA 2ZEDA 3IFEA 4C7IA 1UWYA 3FVLA
chains in the Genus database with same CATH topology
3NFZA 2PJAA 2AFSA 4ONWA 3IIBA 4IAVA 4FUUA 2EK8A 2OOTA 4DYOA 1Q7LA 5CPAA 3FJUA 4MXUA 4P4BA 2IMOA 2AFMA 1R3NA 1XJOA 1YLOA 2RB7A 1Y0RA 1CP6A 1GYTA 3ISZA 5JGFA 2PJ9A 3PBBA 2IJZA 2AFXA 3FF3A 3KASA 4MMOA 1TF9A 3CDXA 1Z8LA 4H2KA 5D8NA 3MN8A 5K8OA 2ZEEA 3PB4X 3K9TA 2CTCA 2PVWA 3BI0A 4NGQA 2CF4A 2GU2A 5HVGA 3PB6X 1HDUA 2XEFA 2PRQA 4MCSA 2DEAA 4UF4A 3KL9A 5HVHA 2C6PA 3H8GA 4MCQA 3B35A 2AFWA 2WYRA 1CBXA 2PIZA 2CTBA 3S9MA 2PJBA 2PJ5A 3TC8A 3HUVA 2PJ1A 4OIDA 3S9LA 2PJ7A 4PXCA 1ELMP 1XRYA 1FT7A 1VIXA 4P4IA 4ZX8A 3IC1A 2F7VA 4NGSA 3D7DA 4F8ZA 1XFOA 4NJQA 1YSJA 3BXMA 5K8PA 4IHMA 3PB9X 4OC0A 1BLLE 5HXDA 1LANA 1TKJA 3ISXA 3FMCA 2VL1A 1EE3P 3DGVA 4W9YA 2WZNA 1CPSA 3S9NA 4R7MA 3B7IA 3VH9A 1YW4A 1KWMA 4P44A 1QMUA 2BOAA 4OC5A 5K8NA 4A94A 4OIWA 1PCAA 4RUHA 1CX8A 2HC9A 3FX6A 4OC1A 4P4JA 3GUXA 2ZELA 3WC7A 2O53A 1AMPA 3KHXA 3KQZA 2ZEMA 3SJEA 4NGMA 4JYWA 3LWUA 2J9AA 2IQ6A 3N5FA 1VGYA 5CBMA 3V38A 3WT4A 2JBJA 4NGNA 3PEIA 3BHXA 7CPAA 4OC2A 1QQ9A 1CPXA 3SI2A 1ARLA 2Q4ZA 6CPAA 1LFWA 5D29A 1R43A 5THWA 3WABA 5DS0A 5I4MA 1CG2A 4P4DA 5LRJA 4K3NA 4MRIA 2C6GA 5LRGA 4X2TA 1BAVA 3FECA 3B3VA 3BI1A 2PCUA 4DJLA 2PJ4A 1ZG9A 3JRUA 2QVPA 4P45A 3KHZA 3V7ZA 3B3WA 1TXRA 3PFEA 4OC3A 1PYTB 3SJGA 4NJRA 2PJ0A 5LYFA 3D67A 2RFHA 2V77A 3RAMA 4EFDA 1XMBA 3PB8X 2V8GA 1H8LA 2QYVA 3B3CA 3FH4A 4OKOA 3HLPA 3GLJA 2C6CA 4ZYQA 4DUKA 3NH5A 1F2OA 1CP7A 5HVFA 2PJCA 4TWEA 1ZLIA 1IY7A 2XEIA 1Y0YA 4MHPA 5K8MA 5LRKA 1FNOA 2AFZA 4UEFA 1HDQA 3IWWA 3WC5A 4OC4A 3L2NA 3GB0A 3SJXA 3RZAA 2ZEFA 2XEJA 4A37A 3IO1A 4NGRA 3NH8A 1HEEA 2C1CA 4UIAA 3D7FA 3KZWA 1Z2LA 4P4EA 2F8HA 2JBKA 2PVVA 4O23A 5IB9A 2ZEOA 3B3TA 1BPNA 2NSMA 1ARMA 3IEHA 4P4FA 1F57A 3SI1A 3B2YA 1M4LA 3DLJA 2OR4A 1ZLHA 4FAIA 1TF8A 3KI9A 2G9DA 4ZY2A 1LAPA 4OMEA 4R8FA 5LYIA 3CT9A 1BPMA 3D7HA 4P10A 2AFUA 4MHZA 1YMEA 2FVGA 3IJ3A 3H8EA 4BD9A 4MCPA 1Y7EA 5ELYA 2ZOGA 1LAMA 2CIJA 5JH9A 3NH4A 1YW6A 2ZEGA 1Z5RA 3CPXA 1OBRA 3FEDA 4GM5A 4ZY0A 3KGQA 4UEEA 5JM6A 3TX8A 3KR4A 3RBUA 5J1QA 2BO9A 4ZX9A 4Z65A 3QNVA 5LYLA 3K2KA 3I1UA 4WWVA 4PXEA 4ZY1A 4MHNA 4B6ZA 4PXDA 3D4UA 4F9UA 4F9VA 3PRTA 4YWYA 2ABZA 4NGPA 4TNUA 2JEWA 4UEZA 4KSIA 3D66A 4IK2A 2AFOA 2EK9A 4LQGA 3D68A 1DTDA 1TKFA 2Q43A 4JZ0A 2PJ2A 2XEGA 1TKHA 2EWBA 3PFOA 2Q51A 2GLJA 2PE3A 1RTQA 1LOKA 1AYEA 1VHOA 3SJFA 3SI0A 4UIBA 2V8HA 4WJBA 2GREA 4EWTA 4PPZA 4EMEA 4MHYA 3VATA 2PIYA 1LCPA 2ZEPA 4NFRA 2ZEHA 1ZG7A 1ELLP 2O4HA 2BCOA 4X3RA 2PJ8A 4MCRA 3NA6A 1NSAA 4CPAA 4PQAA 4FBEA 4NGTA 2V8DA 3PB7X 2QJ8A 3FEEA 3MRUA 1ZG8A 4Q7AA 4A39A 3CPAA 4R76A 1IGBA 2ANPA 3D7GA 2ZOFA 1F2PA 4AXVA 2NYQA 1XBUA 4R6TA 5F09A 3B3SA 4ZI6A 3H8FA 2V8VA 3T8WA 2GLFA 1DE4C 2HB6A 4PXBA 1VHEA 2POKA 4P6YA 3VARA 4G1PA 2ZENA 3KQXA 2PJ6A 1JQGA 4OP4A 3PBEA 4X8IA 5LYDA 3WC6A 3LMSA 4A38A 3KR5A 2I3CA 4YU9A 8CPAA 2PJ3A 4FWUA 2ZEDA 3IFEA 1UWYA 3FVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFZ A;  2PJA A;  2AFS A;  4ONW A;  3IIB A;  4IAV A;  4FUU A;  2EK8 A;  2OOT A;  4DYO A;  1Q7L A;  5CPA A;  3FJU A;  4MXU A;  4P4B A;  2IMO A;  2AFM A;  1R3N A;  1XJO A;  1YLO A;  2RB7 A;  1Y0R A;  1CP6 A;  1GYT A;  3ISZ A;  5JGF A;  2PJ9 A;  3PBB A;  2IJZ A;  2AFX A;  3FF3 A;  3KAS A;  4MMO A;  1TF9 A;  3CDX A;  1Z8L A;  4H2K A;  5D8N A;  3MN8 A;  5K8O A;  2ZEE A;  3PB4 X;  3K9T A;  2CTC A;  2PVW A;  3BI0 A;  4NGQ A;  2CF4 A;  2GU2 A;  5HVG A;  3PB6 X;  1HDU A;  2XEF A;  2PRQ A;  4MCS A;  2DEA A;  4UF4 A;  3KL9 A;  5HVH A;  2C6P A;  3H8G A;  4MCQ A;  3B35 A;  2AFW A;  2WYR A;  1CBX A;  2PIZ A;  2CTB A;  3S9M A;  2PJB A;  2PJ5 A;  3TC8 A;  3HUV A;  2PJ1 A;  4OID A;  3S9L A;  2PJ7 A;  4PXC A;  1ELM P;  1XRY A;  1FT7 A;  1VIX A;  4P4I A;  4ZX8 A;  3IC1 A;  2F7V A;  4NGS A;  3D7D A;  4F8Z A;  1XFO A;  4NJQ A;  1YSJ A;  3BXM A;  5K8P A;  4IHM A;  3PB9 X;  4OC0 A;  1BLL E;  5HXD A;  1LAN A;  1TKJ A;  3ISX A;  3FMC A;  2VL1 A;  1EE3 P;  3DGV A;  4W9Y A;  2WZN A;  1CPS A;  3S9N A;  4R7M A;  3B7I A;  3VH9 A;  1YW4 A;  1KWM A;  4P44 A;  1QMU A;  2BOA A;  4OC5 A;  5K8N A;  4A94 A;  4OIW A;  1PCA A;  4RUH A;  1CX8 A;  2HC9 A;  3FX6 A;  4OC1 A;  4P4J A;  3GUX A;  2ZEL A;  3WC7 A;  2O53 A;  1AMP A;  3KHX A;  3KQZ A;  2ZEM A;  3SJE A;  4NGM A;  4JYW A;  3LWU A;  2J9A A;  2IQ6 A;  3N5F A;  1VGY A;  5CBM A;  3V38 A;  3WT4 A;  2JBJ A;  4NGN A;  3PEI A;  3BHX A;  7CPA A;  4OC2 A;  1QQ9 A;  1CPX A;  3SI2 A;  1ARL A;  2Q4Z A;  6CPA A;  1LFW A;  5D29 A;  1R43 A;  5THW A;  3WAB A;  5DS0 A;  5I4M A;  1CG2 A;  4P4D A;  5LRJ A;  4K3N A;  4MRI A;  2C6G A;  5LRG A;  4X2T A;  1BAV A;  3FEC A;  3B3V A;  3BI1 A;  2PCU A;  4DJL A;  2PJ4 A;  1ZG9 A;  3JRU A;  2QVP A;  4P45 A;  3KHZ A;  3V7Z A;  3B3W A;  1TXR A;  3PFE A;  4OC3 A;  1PYT B;  3SJG A;  4NJR A;  2PJ0 A;  5LYF A;  3D67 A;  2RFH A;  2V77 A;  3RAM A;  4EFD A;  1XMB A;  3PB8 X;  2V8G A;  1H8L A;  2QYV A;  3B3C A;  3FH4 A;  4OKO A;  3HLP A;  3GLJ A;  2C6C A;  4ZYQ A;  4DUK A;  3NH5 A;  1F2O A;  1CP7 A;  5HVF A;  2PJC A;  4TWE A;  1ZLI A;  1IY7 A;  2XEI A;  1Y0Y A;  4MHP A;  5K8M A;  5LRK A;  1FNO A;  2AFZ A;  4UEF A;  1HDQ A;  3IWW A;  3WC5 A;  4OC4 A;  3L2N A;  3GB0 A;  3SJX A;  3RZA A;  2ZEF A;  2XEJ A;  4A37 A;  3IO1 A;  4NGR A;  3NH8 A;  1HEE A;  2C1C A;  4UIA A;  3D7F A;  3KZW A;  1Z2L A;  4P4E A;  2F8H A;  2JBK A;  2PVV A;  4O23 A;  5IB9 A;  2ZEO A;  3B3T A;  1BPN A;  2NSM A;  1ARM A;  3IEH A;  4P4F A;  1F57 A;  3SI1 A;  3B2Y A;  1M4L A;  3DLJ A;  2OR4 A;  1ZLH A;  4FAI A;  1TF8 A;  3KI9 A;  2G9D A;  4ZY2 A;  1LAP A;  4OME A;  4R8F A;  5LYI A;  3CT9 A;  1BPM A;  3D7H A;  4P10 A;  2AFU A;  4MHZ A;  1YME A;  2FVG A;  3IJ3 A;  3H8E A;  4BD9 A;  4MCP A;  1Y7E A;  5ELY A;  2ZOG A;  1LAM A;  2CIJ A;  5JH9 A;  3NH4 A;  1YW6 A;  2ZEG A;  1Z5R A;  3CPX A;  1OBR A;  3FED A;  4GM5 A;  4ZY0 A;  3KGQ A;  4UEE A;  5JM6 A;  3TX8 A;  3KR4 A;  3RBU A;  5J1Q A;  2BO9 A;  4ZX9 A;  4Z65 A;  3QNV A;  5LYL A;  3K2K A;  3I1U A;  4WWV A;  4PXE A;  4ZY1 A;  4MHN A;  4B6Z A;  4PXD A;  3D4U A;  4F9U A;  4F9V A;  3PRT A;  4YWY A;  2ABZ A;  4NGP A;  4TNU A;  2JEW A;  4UEZ A;  4KSI A;  3D66 A;  4IK2 A;  2AFO A;  2EK9 A;  4LQG A;  3D68 A;  1DTD A;  1TKF A;  2Q43 A;  4JZ0 A;  2PJ2 A;  2XEG A;  1TKH A;  2EWB A;  3PFO A;  2Q51 A;  2GLJ A;  2PE3 A;  1RTQ A;  1LOK A;  1AYE A;  1VHO A;  3SJF A;  3SI0 A;  4UIB A;  2V8H A;  4WJB A;  2GRE A;  4EWT A;  4PPZ A;  4EME A;  4MHY A;  3VAT A;  2PIY A;  1LCP A;  2ZEP A;  4NFR A;  2ZEH A;  1ZG7 A;  1ELL P;  2O4H A;  2BCO A;  4X3R A;  2PJ8 A;  4MCR A;  3NA6 A;  1NSA A;  4CPA A;  4PQA A;  4FBE A;  4NGT A;  2V8D A;  3PB7 X;  2QJ8 A;  3FEE A;  3MRU A;  1ZG8 A;  4Q7A A;  4A39 A;  3CPA A;  4R76 A;  1IGB A;  2ANP A;  3D7G A;  2ZOF A;  1F2P A;  4AXV A;  2NYQ A;  1XBU A;  4R6T A;  5F09 A;  3B3S A;  4ZI6 A;  3H8F A;  2V8V A;  3T8W A;  2GLF A;  1DE4 C;  2HB6 A;  4PXB A;  1VHE A;  2POK A;  4P6Y A;  3VAR A;  4G1P A;  2ZEN A;  3KQX A;  2PJ6 A;  1JQG A;  4OP4 A;  3PBE A;  4X8I A;  5LYD A;  3WC6 A;  3LMS A;  4A38 A;  3KR5 A;  2I3C A;  4YU9 A;  8CPA A;  2PJ3 A;  4FWU A;  2ZED A;  3IFE A;  1UWY A;  3FVL A; 
#chains in the Genus database with same CATH topology
 3NFZ A;  5GCN A;  2PJA A;  3SHP A;  2AFS A;  3EY5 A;  2Z0Z A;  4M6I A;  4ONW A;  4B5P A;  3IIB A;  4IAV A;  4FUU A;  2EK8 A;  2PR1 A;  1NSL A;  2JDC A;  2ZW4 A;  2OOT A;  4DYO A;  1Q7L A;  1S7K A;  2B58 A;  5CPA A;  3FJU A;  4MXU A;  4P4B A;  1MJA A;  3W6S A;  5IX3 A;  2IMO A;  1QSN A;  1U6M A;  1PUA A;  2AFM A;  1R3N A;  4IF5 A;  2CY2 A;  4R9M A;  4CAE A;  1XJO A;  1YLO A;  2YNC C;  4AVC A;  2RB7 A;  2G3A A;  1V0C A;  2PC1 A;  1Y0R A;  4R87 A;  1CP6 A;  2J8N A;  1GYT A;  3TCV A;  4L89 A;  4MFL A;  3ISZ A;  2YNC A;  4CGP A;  2PJ9 A;  3JVN A;  5JGF A;  3PBB A;  5KTC A;  2IJZ A;  1B87 A;  2AFX A;  3FF3 A;  3KAS A;  4MMO A;  4UFV A;  5ISV A;  1TF9 A;  2FIA A;  3W91 A;  3CDX A;  1Z8L A;  2AE6 A;  4H2K A;  4NF1 A;  4FD7 A;  4MBU A;  3MN8 A;  5D8N A;  5K8O A;  2CNM A;  2ZEE A;  3NE7 A;  4Q38 A;  2Q4Y A;  3K9T A;  3PB4 X;  4KOV A;  2CTC A;  2PVW A;  3BI0 A;  3DSB A;  4MFQ A;  4AG7 A;  4CGM A;  2Q04 A;  4NGQ A;  4UCM A;  3D8P A;  2CF4 A;  2GU2 A;  5HVG A;  3FXT A;  1FY7 A;  2EVN A;  5G1Z A;  3T90 A;  3PB6 X;  4CAF A;  2GE3 A;  4KVM E;  4B11 A;  3B8G A;  1HDU A;  4M6G A;  4KOR A;  2Z3P A;  2XEF A;  2F5I A;  4A31 A;  2PRQ A;  4AVA A;  5F49 A;  3D3S A;  4MCS A;  1QST A;  2DEA A;  2WSA A;  4KVO E;  4MJ8 A;  4KLW A;  4UF4 A;  1MJ9 A;  4HNX B;  3KL9 A;  5HVH A;  2C6P A;  4LQ6 A;  3H8G A;  4MCQ A;  2QIR A;  3B35 A;  3CXS A;  1AUG A;  2AFW A;  2DXQ A;  1CBX A;  2WYR A;  4F0X A;  4MFP A;  1IB1 E;  2CTB A;  2PIZ A;  3S9M A;  4KOS A;  2PJB A;  2PJ5 A;  2PRB A;  1Z4E A;  2FS5 A;  1Q2C A;  2FIW A;  3N7Z A;  4M85 A;  1XMT A;  5KTD A;  3TC8 A;  3HUV A;  4A30 A;  2PJ1 A;  4JWP A;  1JWQ A;  4OID A;  2Z3L A;  3S9L A;  2PJ7 A;  2VQY A;  4PXC A;  1S7L A;  1OZP A;  1ELM P;  3BLN A;  3R9E A;  3UY5 A;  4E2A A;  2BUE A;  1XRY A;  5JPH A;  2Q7B A;  1FT7 A;  1VIX A;  2Z3N A;  2VZZ A;  4P4I A;  4ZX8 A;  3IC1 A;  4OAE A;  2B4D B;  2F7V A;  2K5T A;  4NGS A;  2PDO A;  4F0Y A;  1CJW A;  3P2F A;  3D7D A;  4F8Z A;  2DPT A;  4KOT A;  3IWE A;  4HNW B;  1XFO A;  1L0C A;  4NXY A;  5J8F A;  4NJQ A;  3F0A A;  1YSJ A;  3TFY A;  5AG7 A;  3BXM A;  5K8P A;  4CAV A;  3GYA A;  4IHM A;  3PB9 X;  1TIQ A;  4OC0 A;  3WR7 A;  3R95 A;  1BLL E;  2CNT A;  1S5K A;  5HXD A;  2P6E A;  1LAN A;  1BOB A;  4FD6 A;  1KUX A;  2B4D A;  1GHE A;  1TKJ A;  2YNE A;  3ISX A;  4MI4 A;  1PU9 A;  1YK3 A;  2NMT A;  3FMC A;  2VL1 A;  4A95 A;  4JXR A;  2ZW5 A;  4A33 A;  1EE3 P;  2ODF A;  3DGV A;  4KOX A;  4W9Y A;  2Q0Y A;  4UWI A;  2WZN A;  3T9Y A;  1CPS A;  3S9N A;  4R7M A;  1M44 A;  2GAN A;  3B7I A;  3VH9 A;  1YW4 A;  1KWM A;  1KUV A;  2PSW A;  1YR0 A;  4P44 A;  2FT0 A;  1QMU A;  2BOA A;  2JDD A;  4OC5 A;  4RN7 A;  5K8N A;  2DPS A;  4A94 A;  4OIW A;  1PCA A;  4B5O A;  4RUH A;  1CX8 A;  2HC9 A;  4F6A A;  1MK4 A;  3FX6 A;  4OC1 A;  4P4J A;  5HMN A;  4B5P B;  3GUX A;  3JTK A;  4MY0 A;  3S6F A;  2ZEL A;  5H84 A;  4KOU A;  5A28 A;  3VWD A;  2R1I A;  3DDD A;  4CYQ A;  3RNZ A;  3S6G A;  3WC7 A;  2O53 A;  1AMP A;  3KHX A;  3KQZ A;  2B4B A;  4CAW A;  2ZEM A;  3SJE A;  2BEI A;  4NGM A;  4C68 A;  5I0C A;  3CZX A;  4JYW A;  3E0K A;  2D4P A;  5G20 A;  1WK4 A;  3W6X A;  3LWU A;  3TTH A;  4II9 A;  2J9A A;  2IQ6 A;  2FL4 A;  1VGY A;  3N5F A;  5CNP A;  5CBM A;  4NSQ A;  2VBQ A;  4ONU A;  3R9F A;  5E96 A;  3V38 A;  3WT4 A;  2JBJ A;  4NGN A;  3EO4 A;  2GIV A;  3PEI A;  4U5Y A;  3BHX A;  3LD2 A;  3ZZI A;  7CPA A;  4OC2 A;  1QQ9 A;  1CPX A;  4JXQ A;  1ARL A;  3SI2 A;  2DF5 A;  2Q4Z A;  5C88 A;  2OU2 A;  4CYN A;  6CPA A;  1KUY A;  4XNH C;  4PK2 A;  4B13 A;  1LFW A;  5D29 A;  1R43 A;  5THW A;  2FCK A;  3EXN A;  1MJB A;  1WWZ A;  4GS4 A;  4I49 A;  3DNS A;  3PGP A;  5DS0 A;  3WAB A;  4UFW A;  2JLM A;  5I4M A;  1CG2 A;  2ATR A;  4P4D A;  5LRJ A;  4K3N A;  4MRI A;  4CYO A;  1XE4 A;  4ZGY B;  2C6G A;  1QSO A;  5LRG A;  1S60 A;  3G8W A;  2O28 A;  3K9U A;  1M1D A;  4X2T A;  4OLL A;  1BAV A;  3TO6 A;  3FEC A;  3B3V A;  2R8V A;  4A2Z A;  4QB9 A;  2Q44 A;  2OZG A;  3BI1 A;  1XIX A;  2PCU A;  2YND A;  2R98 A;  4C2X A;  4LUA A;  4DJL A;  2J8R A;  2PJ4 A;  5J8C A;  4AG9 A;  1ZG9 A;  4FD5 A;  3JRU A;  2EUI A;  2PR8 A;  2QVP A;  4P45 A;  4XPD C;  1ON0 A;  5JQ4 A;  3KHZ A;  3V7Z A;  2D4O A;  2REE A;  2H5M A;  3B3W A;  4EVY A;  1TXR A;  3PFE A;  4OC3 A;  1PYT B;  3SJG A;  2P6F A;  4NJR A;  5EBV A;  4KLV A;  2J8M A;  2PJ0 A;  5LYF A;  3D67 A;  5AG6 A;  4KOW A;  2RFH A;  2WPW A;  2V77 A;  3D2P A;  3RAM A;  4EFD A;  2EBJ A;  2VI7 A;  1XMB A;  3PB8 X;  2V8G A;  1I1D A;  1NMT A;  3H5Z A;  1H8L A;  2QYV A;  3B3C A;  3FH4 A;  4OKO A;  4AB7 A;  1YLE A;  3HLP A;  1P0H A;  1XF8 A;  3GLJ A;  4Q36 A;  2C6C A;  5AG4 A;  2Z11 A;  5AG5 A;  2G3T A;  4ZYQ A;  4DUK A;  3NH5 A;  1F2O A;  1XOV A;  1M4I A;  1CP7 A;  3FRM A;  5HVF A;  1J4J A;  2B5G A;  2PJC A;  4C2Y A;  4TWE A;  1ZLI A;  3QAY A;  1IY7 A;  2FE7 A;  2XEI A;  2Q4V A;  3TE4 A;  1Y0Y A;  2AJ6 A;  4MHP A;  3EC4 A;  3FNC A;  5K8M A;  3TO7 A;  5LRK A;  1FNO A;  2AFZ A;  2ARH A;  4UEF A;  1HDQ A;  3KKW A;  4CRY B;  4PSW A;  3TOB A;  1K4J A;  3IWW A;  2G0B A;  3WC5 A;  1KZF A;  1IOF A;  1IYL A;  3CXQ A;  4OC4 A;  2ZPA A;  3L2N A;  4XPK A;  3RYO A;  4L8A A;  3NE8 A;  3GB0 A;  3SJX A;  4MFK A;  1S7N A;  5DWM A;  2ZEF A;  3RZA A;  4AVB A;  3H4Q A;  2HQY A;  3FIX A;  2XEJ A;  4A37 A;  1CM0 A;  4JJX A;  3IO1 A;  4NGR A;  4U9Z A;  5C82 A;  4A32 A;  1B6B A;  1IOI A;  1S3Z A;  1HEE A;  1ZO0 A;  2C1C A;  3C26 A;  3NH8 A;  4UIA A;  3D7F A;  5EMI A;  4CGO A;  5AGE A;  3KZW A;  1Z2L A;  3FYN A;  4PV6 A;  4P4E A;  2ZW7 A;  3TOA A;  2F8H A;  3S6K A;  2JBK A;  2PVV A;  4JD6 A;  4O23 A;  4MFJ A;  5IB9 A;  1VKC A;  4H89 A;  2Z3K A;  4YFJ A;  2ZEO A;  3B3T A;  5G21 A;  1QSR A;  1BPN A;  2NSM A;  3TO9 A;  4ORF A;  2IL4 A;  1ARM A;  4M6H A;  2OZH A;  3R96 A;  3IEH A;  4P4F A;  1F57 A;  3SI1 A;  3ZJ0 A;  4JLY A;  3EFA A;  3B2Y A;  4UA3 A;  2QEC A;  1M4L A;  3DLJ A;  2OR4 A;  1ZLH A;  2BL1 A;  4FAI A;  1S7F A;  1TF8 A;  1VHS A;  3KI9 A;  2G9D A;  3IU2 A;  4ZY2 A;  4B14 A;  4UCP A;  1LAP A;  4OME A;  1Z9U A;  2EO8 A;  1Q2D A;  4BIN A;  4UBR A;  4R8F A;  4R3K A;  5LYI A;  3CT9 A;  3I9S A;  5IV0 A;  4MFZ A;  4XNH B;  1N71 A;  2JEV A;  4M3S A;  1BPM A;  4CYP A;  4KUB A;  5H86 A;  3FB3 A;  4B12 A;  1YGH A;  3D7H A;  2WUU A;  4P10 A;  2AFU A;  4MHZ A;  1YME A;  2REF A;  1YRE A;  4CGN A;  2FVG A;  3IJ3 A;  3H8E A;  4BD9 A;  4MCP A;  1Y7E A;  5ELY A;  1Z4R A;  5KTA A;  2ZOG A;  2OH1 A;  3V8I A;  2ZW6 A;  1LAM A;  1X10 A;  2I79 A;  2CIJ A;  4B10 A;  2ZXV A;  3NH4 A;  1YW6 A;  5JH9 A;  2ZEG A;  1Z5R A;  1Q2Y A;  3CPX A;  2C27 A;  1OBR A;  1Y7R A;  3FED A;  3A9L A;  4GM5 A;  4ZY0 A;  4PSX A;  3KGQ A;  4UEE A;  5JM6 A;  4ZBG A;  3TX8 A;  1YX0 A;  3KR4 A;  3RBU A;  5DWN A;  5J1Q A;  2BO9 A;  1Z8T A;  4ZX9 A;  4QBJ A;  4Z65 A;  1YQE A;  3QNV A;  5LYL A;  3K2K A;  3I1U A;  1BO4 A;  4XPD B;  4KOY A;  4WWV A;  3P2H A;  4PXE A;  4ZY1 A;  4MHN A;  4B6Z A;  4PXD A;  2Y0M A;  3D4U A;  4NCZ A;  4R57 A;  4F9U A;  4F9V A;  2FXF A;  3PRT A;  4YWY A;  2ABZ A;  1QSM A;  4H6U A;  4C2Z A;  3D2M A;  2VXK A;  5IB0 A;  2PQ8 A;  4NGP A;  4TNU A;  2JEW A;  4FD4 A;  4UEZ A;  4KSI A;  1I12 A;  3BJ8 A;  4UFX A;  3D66 A;  4IK2 A;  1IYK A;  3GIU A;  3PP9 A;  3JUW A;  2AFO A;  2EK9 A;  3PZJ A;  4LQG A;  3D68 A;  1DTD A;  1TKF A;  2Q43 A;  2B5G B;  1X12 A;  1Z8X A;  4JZ0 A;  3QB8 A;  4YRH A;  2PJ2 A;  4OAD A;  5BWA B;  2XEG A;  1YVK A;  4PK3 A;  3OWC A;  3R1K A;  4KS9 A;  5F47 A;  1TKH A;  2EWB A;  3VWE A;  4Y49 B;  3PFO A;  2Q51 A;  2GLJ A;  2PE3 A;  3MGD A;  1RTQ A;  1LOK A;  1AYE A;  2VEZ A;  3SXN A;  3LAC A;  1VHO A;  2QML A;  3TT2 A;  1XEB A;  3SI0 A;  3SJF A;  4UIB A;  4RS2 A;  2WPX A;  4Y49 C;  2V8H A;  4WJB A;  4U9Y A;  2GRE A;  3GKR A;  4EWT A;  5A27 A;  4YGO A;  4PPZ A;  4QC6 A;  4CS0 B;  2Z3M A;  5FVJ A;  4EME A;  2FSR A;  4MHY A;  1M4D A;  4CRZ B;  3BJ7 A;  4IUS A;  4BMH A;  3VAT A;  4RI1 A;  1A2Z A;  3DR8 A;  1M4G A;  2PIY A;  3FBU A;  4BBH A;  1LCP A;  1IU8 A;  2CXA A;  2ZEP A;  4NFR A;  2P6G A;  2ZEH A;  1ZG7 A;  3IWG A;  2YGW A;  1ELL P;  4QVT A;  4X5K A;  5EC4 A;  2O4H A;  2BCO A;  3RO0 A;  4X3R A;  2X7B A;  2PJ8 A;  1I21 A;  4MCR A;  3DR6 A;  4KVX A;  3NA6 A;  1NSA A;  4CPA A;  4PQA A;  4KSF A;  4C7H A;  4CAX A;  4GXH A;  4FBE A;  1RO5 A;  4QUS A;  4NGT A;  2V8D A;  1Y9W A;  3PB7 X;  2QJ8 A;  1LRZ A;  4UWJ A;  4MHD A;  3FEE A;  3MRU A;  1ZG8 A;  4HKF A;  4KSA A;  3IGR A;  4Q7A A;  2CNS A;  4H6Z A;  5F48 A;  4CGL A;  2A4N A;  3CPA A;  4A39 A;  4R76 A;  1IGB A;  2ANP A;  3D7G A;  2HUZ A;  3I3G A;  2ZOF A;  2HV2 A;  2KCW A;  1F2P A;  3GY9 A;  5HH1 A;  4AXV A;  2R7H A;  4HPS A;  2NYQ A;  3SXO A;  1XBU A;  4R6T A;  3CXP A;  1YVO A;  2I00 A;  1NE9 A;  4KUA A;  2B3V A;  3QAH A;  1Y9K A;  2RC4 A;  1R57 A;  2P0W A;  2VZY A;  4NEX A;  3G3S A;  5F09 A;  3B3S A;  4ZI6 A;  4MY3 A;  4XPL A;  1SQH A;  2V8V A;  3H8F A;  3S6H A;  3T8W A;  2GLF A;  1DE4 C;  4K30 A;  2HB6 A;  4UCN A;  5F46 A;  4LX9 A;  4PXB A;  2BSW A;  3F5B A;  4E8O A;  3F8K A;  4E0A A;  1UFH A;  4DNC A;  2Q7S A;  1VHE A;  2POK A;  4P6Y A;  4R3L A;  4G1P A;  1RXT A;  3VAR A;  1IID A;  2B3U A;  2ZEN A;  1IIC A;  4KZT A;  3KQX A;  1Z8W A;  2PJ6 A;  1JQG A;  4OP4 A;  3PBE A;  3IU1 A;  2OB0 A;  4X8I A;  5LYD A;  2Z10 A;  3LOD A;  1P4N A;  3LMS A;  3KR5 A;  3R9G A;  2OZU A;  3WC6 A;  2Z3O A;  4A38 A;  2I3C A;  4HNY B;  5G22 A;  4YU9 A;  8CPA A;  2GFQ A;  2PJ3 A;  4FWU A;  4J3G A;  2ZED A;  3IFE A;  4C7I A;  1UWY A;  3FVL A; 
#chains in the Genus database with same CATH homology
 3NFZ A;  2PJA A;  2AFS A;  4ONW A;  3IIB A;  4IAV A;  4FUU A;  2EK8 A;  2OOT A;  4DYO A;  1Q7L A;  5CPA A;  3FJU A;  4MXU A;  4P4B A;  2IMO A;  2AFM A;  1R3N A;  1XJO A;  1YLO A;  2RB7 A;  1Y0R A;  1CP6 A;  1GYT A;  3ISZ A;  5JGF A;  2PJ9 A;  3PBB A;  2IJZ A;  2AFX A;  3FF3 A;  3KAS A;  4MMO A;  1TF9 A;  3CDX A;  1Z8L A;  4H2K A;  5D8N A;  3MN8 A;  5K8O A;  2ZEE A;  3PB4 X;  3K9T A;  2CTC A;  2PVW A;  3BI0 A;  4NGQ A;  2CF4 A;  2GU2 A;  5HVG A;  3PB6 X;  1HDU A;  2XEF A;  2PRQ A;  4MCS A;  2DEA A;  4UF4 A;  3KL9 A;  5HVH A;  2C6P A;  3H8G A;  4MCQ A;  3B35 A;  2AFW A;  2WYR A;  1CBX A;  2PIZ A;  2CTB A;  3S9M A;  2PJB A;  2PJ5 A;  3TC8 A;  3HUV A;  2PJ1 A;  4OID A;  3S9L A;  2PJ7 A;  4PXC A;  1ELM P;  1XRY A;  1FT7 A;  1VIX A;  4P4I A;  4ZX8 A;  3IC1 A;  2F7V A;  4NGS A;  3D7D A;  4F8Z A;  1XFO A;  4NJQ A;  1YSJ A;  3BXM A;  5K8P A;  4IHM A;  3PB9 X;  4OC0 A;  1BLL E;  5HXD A;  1LAN A;  1TKJ A;  3ISX A;  3FMC A;  2VL1 A;  1EE3 P;  3DGV A;  4W9Y A;  2WZN A;  1CPS A;  3S9N A;  4R7M A;  3B7I A;  3VH9 A;  1YW4 A;  1KWM A;  4P44 A;  1QMU A;  2BOA A;  4OC5 A;  5K8N A;  4A94 A;  4OIW A;  1PCA A;  4RUH A;  1CX8 A;  2HC9 A;  3FX6 A;  4OC1 A;  4P4J A;  3GUX A;  2ZEL A;  3WC7 A;  2O53 A;  1AMP A;  3KHX A;  3KQZ A;  2ZEM A;  3SJE A;  4NGM A;  4JYW A;  3LWU A;  2J9A A;  2IQ6 A;  3N5F A;  1VGY A;  5CBM A;  3V38 A;  3WT4 A;  2JBJ A;  4NGN A;  3PEI A;  3BHX A;  7CPA A;  4OC2 A;  1QQ9 A;  1CPX A;  3SI2 A;  1ARL A;  2Q4Z A;  6CPA A;  1LFW A;  5D29 A;  1R43 A;  5THW A;  3WAB A;  5DS0 A;  5I4M A;  1CG2 A;  4P4D A;  5LRJ A;  4K3N A;  4MRI A;  2C6G A;  5LRG A;  4X2T A;  1BAV A;  3FEC A;  3B3V A;  3BI1 A;  2PCU A;  4DJL A;  2PJ4 A;  1ZG9 A;  3JRU A;  2QVP A;  4P45 A;  3KHZ A;  3V7Z A;  3B3W A;  1TXR A;  3PFE A;  4OC3 A;  1PYT B;  3SJG A;  4NJR A;  2PJ0 A;  5LYF A;  3D67 A;  2RFH A;  2V77 A;  3RAM A;  4EFD A;  1XMB A;  3PB8 X;  2V8G A;  1H8L A;  2QYV A;  3B3C A;  3FH4 A;  4OKO A;  3HLP A;  3GLJ A;  2C6C A;  4ZYQ A;  4DUK A;  3NH5 A;  1F2O A;  1CP7 A;  5HVF A;  2PJC A;  4TWE A;  1ZLI A;  1IY7 A;  2XEI A;  1Y0Y A;  4MHP A;  5K8M A;  5LRK A;  1FNO A;  2AFZ A;  4UEF A;  1HDQ A;  3IWW A;  3WC5 A;  4OC4 A;  3L2N A;  3GB0 A;  3SJX A;  3RZA A;  2ZEF A;  2XEJ A;  4A37 A;  3IO1 A;  4NGR A;  3NH8 A;  1HEE A;  2C1C A;  4UIA A;  3D7F A;  3KZW A;  1Z2L A;  4P4E A;  2F8H A;  2JBK A;  2PVV A;  4O23 A;  5IB9 A;  2ZEO A;  3B3T A;  1BPN A;  2NSM A;  1ARM A;  3IEH A;  4P4F A;  1F57 A;  3SI1 A;  3B2Y A;  1M4L A;  3DLJ A;  2OR4 A;  1ZLH A;  4FAI A;  1TF8 A;  3KI9 A;  2G9D A;  4ZY2 A;  1LAP A;  4OME A;  4R8F A;  5LYI A;  3CT9 A;  1BPM A;  3D7H A;  4P10 A;  2AFU A;  4MHZ A;  1YME A;  2FVG A;  3IJ3 A;  3H8E A;  4BD9 A;  4MCP A;  1Y7E A;  5ELY A;  2ZOG A;  1LAM A;  2CIJ A;  5JH9 A;  3NH4 A;  1YW6 A;  2ZEG A;  1Z5R A;  3CPX A;  1OBR A;  3FED A;  4GM5 A;  4ZY0 A;  3KGQ A;  4UEE A;  5JM6 A;  3TX8 A;  3KR4 A;  3RBU A;  5J1Q A;  2BO9 A;  4ZX9 A;  4Z65 A;  3QNV A;  5LYL A;  3K2K A;  3I1U A;  4WWV A;  4PXE A;  4ZY1 A;  4MHN A;  4B6Z A;  4PXD A;  3D4U A;  4F9U A;  4F9V A;  3PRT A;  4YWY A;  2ABZ A;  4NGP A;  4TNU A;  2JEW A;  4UEZ A;  4KSI A;  3D66 A;  4IK2 A;  2AFO A;  2EK9 A;  4LQG A;  3D68 A;  1DTD A;  1TKF A;  2Q43 A;  4JZ0 A;  2PJ2 A;  2XEG A;  1TKH A;  2EWB A;  3PFO A;  2Q51 A;  2GLJ A;  2PE3 A;  1RTQ A;  1LOK A;  1AYE A;  1VHO A;  3SJF A;  3SI0 A;  4UIB A;  2V8H A;  4WJB A;  2GRE A;  4EWT A;  4PPZ A;  4EME A;  4MHY A;  3VAT A;  2PIY A;  1LCP A;  2ZEP A;  4NFR A;  2ZEH A;  1ZG7 A;  1ELL P;  2O4H A;  2BCO A;  4X3R A;  2PJ8 A;  4MCR A;  3NA6 A;  1NSA A;  4CPA A;  4PQA A;  4FBE A;  4NGT A;  2V8D A;  3PB7 X;  2QJ8 A;  3FEE A;  3MRU A;  1ZG8 A;  4Q7A A;  4A39 A;  3CPA A;  4R76 A;  1IGB A;  2ANP A;  3D7G A;  2ZOF A;  1F2P A;  4AXV A;  2NYQ A;  1XBU A;  4R6T A;  5F09 A;  3B3S A;  4ZI6 A;  3H8F A;  2V8V A;  3T8W A;  2GLF A;  1DE4 C;  2HB6 A;  4PXB A;  1VHE A;  2POK A;  4P6Y A;  3VAR A;  4G1P A;  2ZEN A;  3KQX A;  2PJ6 A;  1JQG A;  4OP4 A;  3PBE A;  4X8I A;  5LYD A;  3WC6 A;  3LMS A;  4A38 A;  3KR5 A;  2I3C A;  4YU9 A;  8CPA A;  2PJ3 A;  4FWU A;  2ZED A;  3IFE A;  1UWY A;  3FVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...