2ZEOA

Crystal structure of the human glutaminyl cyclase mutant d305e at 1.66 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQEDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeoA00
2ZEOA 3I1UA 2V8DA 4JZ0A 3RZAA 3PBBA 4K3NA 3FECA 2PRQA 4A38A 2DEAA 4X3RA 4P4BA 2C6CA 3B3VA 1M4LA 3SI1A 3B35A 3D68A 4NGMA 2PJCA 3D67A 2PJAA 2NYQA 3PB7X 3PB9X 2V8HA 1ZG7A 4MCRA 4NGQA 4TWEA 4MCQA 4NGTA 2AFOA 4PXEA 4P6YA 3H8FA 2C6GA 2J9AA 3FMCA 3S9MA 4PXCA 3WT4A 4FBEA 2ZEDA 5D29A 5LRGA 5HVGA 1TKHA 4PXDA 1CX8A 3NH8A 4R76A 2Q4ZA 5CBMA 2PJ3A 2ZOFA 1F2OA 3GLJA 3B3WA 4X2TA 2F8HA 2O4HA 4PPZA 2CTCA 4G1PA 4UF4A 3BXMA 1Y0RA 1Z2LA 3SJEA 4NGSA 5JM6A 1FT7A 2OR4A 4F9VA 4WJBA 2Q43A 2WYRA 3KR4A 1DE4C 4YU9A 3V7ZA 2VL1A 2WZNA 1Q7LA 3H8GA 2V77A 3PRTA 3LWUA 4EWTA 3WC6A 1DTDA 2GREA 2PJ5A 3BI1A 5K8NA 3FH4A 2XEIA 4A94A 1CP6A 4F8ZA 1QQ9A 3SJXA 4R7MA 3SI2A 4PQAA 3KQXA 3NA6A 2EK8A 4ZX9A 3WC7A 4P4EA 3BHXA 2AFXA 1ZG8A 1LAPA 3VATA 1AYEA 3D7FA 2C1CA 3GB0A 2BOAA 2PIYA 2FVGA 5F09A 3H8EA 4MHNA 3ISXA 2POKA 3TX8A 4Q7AA 2HC9A 2HB6A 3FEDA 4FWUA 5LRKA 4MHYA 1QMUA 2IQ6A 5HVFA 1JQGA 3FF3A 2QJ8A 4A39A 3KHXA 4ZX8A 2AFZA 3GUXA 3IFEA 8CPAA 3CT9A 2GLJA 4EMEA 4ZY1A 3KR5A 1LAMA 4OIWA 3NH4A 4IAVA 2PJ0A 4OC0A 2AFSA 5JGFA 3IC1A 2V8VA 3D66A 4W9YA 3JRUA 1R43A 1TF8A 3N5FA 4FUUA 2CTBA 2ANPA 1RTQA 2AFMA 2ZEFA 1Z8LA 4X8IA 2PJ7A 2ZOGA 3K9TA 1CBXA 5JH9A 3CPXA 4O23A 1ELMP 4DJLA 2PJ8A 2JBKA 3PBEA 4MXUA 3KHZA 2RB7A 4LQGA 2XEGA 2ZEGA 3SJGA 3IJ3A 4ONWA 4PXBA 4NGPA 2BCOA 4ZY0A 2RFHA 4KSIA 4OKOA 5ELYA 1VHEA 1HEEA 2BO9A 2PJ1A 4P45A 3WC5A 3LMSA 3PB6X 4Z65A 4DYOA 1CPSA 3T8WA 6CPAA 1ZG9A 5LYIA 2CF4A 2PVWA 3VARA 4NGRA 4IK2A 3HUVA 4H2KA 1TKFA 1XMBA 2I3CA 3FVLA 4DUKA 3NFZA 3KQZA 4YWYA 1IY7A 1F57A 3BI0A 4P4DA 1XRYA 3HLPA 1CPXA 4GM5A 1CG2A 3VH9A 3B2YA 2ZEHA 2XEFA 1AMPA 2XEJA 2OOTA 2Q51A 3D7DA 4WWVA 1UWYA 4MCPA 3V38A 1YW4A 1XFOA 1OBRA 5LYLA 3S9NA 2PJ4A 4F9UA 1PCAA 2CIJA 2PVVA 4MHPA 3PFEA 1XBUA 3RAMA 3KL9A 5I4MA 2PJ9A 2PCUA 2EWBA 2G9DA 3PEIA 4A37A 4MCSA 3B3SA 3KASA 1GYTA 3B3TA 4OC5A 4OC2A 1BPMA 3DLJA 5D8NA 4BD9A 1PYTB 2GU2A 1BAVA 4JYWA 1ELLP 2F7VA 4UEFA 4ZY2A 3D7GA 5HXDA 1F2PA 1TKJA 1ZLHA 1TF9A 4NGNA 3PB8X 4B6ZA 3SI0A 2IMOA 2ZELA 4ZI6A 1YLOA 5CPAA 4NFRA 5K8OA 2GLFA 1R3NA 3B3CA 1CP7A 4EFDA 1HDQA 5THWA 4AXVA 4TNUA 3ISZA 3IEHA 4ZYQA 1BLLE 1VHOA 1NSAA 3L2NA 1Y0YA 1FNOA 1VIXA 4UEZA 2O53A 1H8LA 1LANA 1Y7EA 2AFUA 1HDUA 3SJFA 3IO1A 5LYFA 3D4UA 1YW6A 2JBJA 3D7HA 4UEEA 3S9LA 3IIBA 4OMEA 2C6PA 3KZWA 4R6TA 2ABZA 3FEEA 5DS0A 5IB9A 1IGBA 3QNVA 7CPAA 3CDXA 3RBUA 4P4FA 2NSMA 1YSJA 5K8MA 5K8PA 1VGYA 4NJRA 4P10A 1Z5RA 4MMOA 2ZEMA 4UIBA 3IWWA 2PJBA 1BPNA 1ZLIA 4P4JA 2IJZA 1LOKA 4OC3A 3NH5A 4FAIA 3CPAA 2JEWA 3MRUA 4CPAA 3KI9A 5J1QA 1KWMA 3PB4X 3TC8A 4P44A 1YMEA 4P4IA 5LYDA 4IHMA 1LCPA 2AFWA 2ZENA 5HVHA 2PE3A 4OC1A 3FJUA 2PJ6A 1LFWA 2ZEPA 4MRIA 4MHZA 4UIAA 3PFOA 3B7IA 4OC4A 1ARMA 2EK9A 2QVPA 3K2KA 2ZEEA 3FX6A 1EE3P 2PIZA 3WABA 1TXRA 5LRJA 2QYVA 1ARLA 2PJ2A 2V8GA 4OIDA 4RUHA 4R8FA 3MN8A 1XJOA 3KGQA 4NJQA 4OP4A 3DGVA
chains in the Genus database with same CATH superfamily
2ZEOA 4RN7A 4C2XA 3I1UA 1ZO0A 2V8DA 1M1DA 2PR1A 4JZ0A 2WPWA 3RZAA 3PBBA 4OLLA 4K3NA 3FECA 3JVNA 2PRQA 3DGVA 3EXNA 4A38A 2DEAA 1B6BA 4X3RA 5GCNA 4P4BA 1QSTA 1A2ZA 2C6CA 3SXOA 2D4PA 2HQYA 3B3VA 1M4LA 3LACA 3SI1A 3B35A 3D68A 4NGMA 4PK2A 2PJCA 3D67A 3P2FA 4F6AA 1KZFA 2PJAA 3DDDA 4UA3A 2NYQA 3BLNA 3PB7X 1XE4A 3PB9X 2V8HA 1ZG7A 1WK4A 1XF8A 1YREA 4MCRA 4NGQA 4YRHA 4TWEA 4MCQA 4NGTA 4UFVA 4AVBA 3D8PA 2AFOA 4PXEA 4P6YA 3H8FA 3FYNA 5EBVA 2ZPAA 2QIRA 2C6GA 2J9AA 3FMCA 4H89A 4PXCA 5G1ZA 3S9MA 3WT4A 4FBEA 2ZEDA 4MFPA 2PSWA 5D29A 5LRGA 1I12A 1S60A 2VEZA 5HVGA 1TKHA 4PXDA 2PC1A 1Q2CA 1CX8A 1MJAA 3NH8A 4R76A 2Q4ZA 5CBMA 2FE7A 2PJ3A 2ZOFA 4NSQA 1F2OA 3GLJA 1CJWA 2G3AA 2B3VA 3B3WA 3PP9A 4MY3A 4A30A 4X2TA 2F8HA 2O4HA 4PPZA 4IUSA 3JTKA 3TOAA 2OH1A 4A33A 2CTCA 4G1PA 4UF4A 3BXMA 1Y0RA 2B5GA 4UWJA 4F0XA 4CYOA 1Z2LA 2B4DA 3SJEA 4R3LA 3RYOA 2AJ6A 2WSAA 2Z0ZA 5CNPA 2REFA 3TCVA 2PQ8A 4NGSA 1M44A 5JM6A 1FT7A 2OR4A 4Q36A 4F9VA 1PUAA 4WJBA 4CRZB 2BSWA 3IGRA 2Q43A 1S7LA 1X12A 2Q4VA 2VI7A 3T90A 4CGPA 1M4GA 4UBRA 4CYQA 4MBUA 2WYRA 4JWPA 4K30A 4C2ZA 3KR4A 1DE4C 4YU9A 4C7IA 2OB0A 5F49A 4QB9A 4QVTA 3LODA 3V7ZA 2VL1A 4B5PA 4ORFA 2WZNA 2FSRA 4HNYB 5AG5A 2CY2A 1Q7LA 3H8GA 2REEA 2VXKA 2V77A 2G0BA 3G3SA 3PRTA 3LWUA 4CGOA 4EWTA 4MFJA 4AVCA 3WC6A 1DTDA 2GREA 2PJ5A 2ARHA 3BI1A 3DNSA 5K8NA 3FH4A 3R96A 3CZXA 1UFHA 4B12A 2Q4YA 2XEIA 3CXPA 4Y49C 1CP6A 3T9YA 2B5GB 4MFKA 3IWGA 4A94A 4CS0B 4KOTA 4MFLA 4F8ZA 4KVOE 1QQ9A 2PR8A 3SJXA 3CXSA 2FT0A 4R7MA 2Q7SA 4Y49B 4PQAA 3SI2A 4NXYA 3QB8A 3KQXA 3NA6A 2EK8A 4ZX9A 4A95A 4DNCA 3WC7A 2C27A 4P4EA 5EC4A 3VWEA 1XIXA 2ATRA 3BHXA 4L8AA 2VZYA 3S6KA 2BEIA 3D2PA 4LQ6A 3TT2A 1I1DA 4A2ZA 4CAEA 3EC4A 2AFXA 1ZG8A 1LAPA 3VATA 4B5OA 2Z3PA 1XOVA 1AYEA 2DPTA 4Q38A 4KOSA 4XPLA 2FL4A 1KUVA 3D7FA 3KKWA 2C1CA 3BJ8A 3GB0A 4HPSA 4KSFA 2BOAA 3VWDA 4CAWA 2PIYA 2FVGA 2F5IA 5F09A 4KLWA 4U9ZA 4UFWA 5EMIA 1LRZA 3H8EA 4MHNA 1J4JA 3R9GA 3V8IA 1M4IA 4JXQA 1Z8TA 3ISXA 4UCNA 4JXRA 2POKA 3DR8A 4MHDA 4OADA 5G21A 4Q7AA 2G3TA 2HC9A 3TX8A 2HB6A 3W6XA 1S7FA 2R7HA 3FEDA 4FWUA 4E8OA 5LRKA 4HKFA 4MHYA 2Z10A 1QMUA 2IQ6A 4JD6A 1FY7A 5HVFA 1JQGA 3FF3A 4KUAA 2EUIA 1Q2YA 2QJ8A 4XPDC 3I9SA 4A39A 4CGMA 3KHXA 4ZX8A 2AFZA 3GUXA 3S6HA 3IFEA 5AG6A 8CPAA 5DWMA 4CYPA 2GFQA 3CT9A 4XPDB 1SQHA 2GLJA 4EMEA 2Z3NA 3F5BA 3NE8A 3TOBA 4MFQA 4ZY1A 5C88A 2Q0YA 3KR5A 5KTAA 1LAMA 2P6EA 3S6FA 3FNCA 4OIWA 3NH4A 4PSWA 4CRYB 4IAVA 2PJ0A 3K9UA 2FCKA 2GANA 2JDDA 2AFSA 1KUXA 2VBQA 4OC0A 5JGFA 3IC1A 3R1KA 3S6GA 2V8VA 3F0AA 3LD2A 3D66A 4W9YA 4QBJA 5KTCA 2FIWA 1R43A 1TF8A 3JRUA 5A28A 3OWCA 3N5FA 3E0KA 4FUUA 2CTBA 2J8MA 4AG7A 2ANPA 4KUBA 1RTQA 1YR0A 1OZPA 2AFMA 2WUUA 4B14A 4CAXA 2ZEFA 1Z8LA 3EFAA 4C7HA 4X8IA 2PJ7A 2ZOGA 4IF5A 4B13A 3K9TA 4X5KA 2R1IA 3TTHA 3R95A 1CBXA 4R87A 5JH9A 2Z3KA 3CPXA 4HNWB 4O23A 1ELMP 2HUZA 1MK4A 4DJLA 2PJ8A 5E96A 5ISVA 2JBKA 3PBEA 4MXUA 3KHZA 2RB7A 4KLVA 4LQGA 1B87A 2XEGA 2ZEGA 3SJGA 3IJ3A 4ONWA 4PXBA 4NGPA 1K4JA 2BCOA 4ZY0A 2PDOA 5J8FA 2RFHA 4KSIA 1YQEA 5I0CA 4KS9A 1U6MA 4OKOA 5ELYA 3C26A 4KSAA 5H84A 1VHEA 2OU2A 1HEEA 2BO9A 2A4NA 2D4OA 2PJ1A 1Y7RA 2Z11A 4P45A 3WC5A 3LMSA 5HMNA 3TFYA 3PB6X 4NCZA 3UY5A 5F47A 4Z65A 5A27A 2X7BA 4DYOA 1CPSA 3T8WA 4PK3A 6CPAA 4CGLA 1PU9A 1ZG9A 1XEBA 2AE6A 5LYIA 2CF4A 2PVWA 3VARA 4NGRA 1NMTA 2YNCC 4MJ8A 3BJ7A 4IK2A 3HUVA 4H2KA 1TKFA 1XMBA 5IB0A 5AG7A 2OZUA 3PGPA 2I3CA 4JLYA 1I21A 3FVLA 1BOBA 4DUKA 3I3GA 4U9YA 3NFZA 1BO4A 4AVAA 2B58A 3GKRA 2RC4A 3KQZA 2FXFA 2NMTA 3FB3A 2P6GA 4YGOA 4CAFA 4YFJA 4YWYA 1YGHA 1IY7A 1F57A 3BI0A 4P4DA 2OZHA 2B4BA 4ZGYB 1XRYA 4XPKA 3RNZA 1Y9WA 3EO4A 3HLPA 1CPXA 2H5MA 4GXHA 2FS5A 1Z9UA 4GM5A 3GYAA 4R9MA 4F9UA 1RO5A 2Q7BA 2I79A 2DXQA 4PV6A 1CG2A 2J8NA 3H5ZA 5IX3A 4M6HA 2QECA 3VH9A 2EBJA 2I00A 3FRMA 3B2YA 4KOVA 2ZEHA 5JPHA 2XEFA 1AMPA 2XEJA 2OOTA 3ZJ0A 2Q51A 4II9A 3D7DA 3GY9A 4WWVA 1UWYA 4MCPA 3V38A 1YW4A 1XFOA 1L0CA 1Y9KA 3CXQA 2VZZA 2ZW7A 4L89A 1OBRA 4KVME 5KTDA 2YGWA 5LYLA 5F48A 2JEVA 3S9NA 4F0YA 2YNDA 1IYLA 1IU8A 1ON0A 1RXTA 1S3ZA 1YLEA 1PCAA 2PJ4A 2CIJA 2PVVA 2HV2A 3QAHA 1Q2DA 1X10A 3PZJA 4KOWA 4CAVA 1QSRA 4MHPA 5H86A 2R98A 3PFEA 4QUSA 1XBUA 3RAMA 2ZW4A 3KL9A 2QMLA 5I4MA 2PJ9A 2PCUA 2EWBA 4BINA 2G9DA 1IICA 5F46A 3PEIA 4NEXA 5FVJA 4OAEA 4A37A 4MCSA 3W91A 3B3SA 3KASA 1GYTA 2PRBA 2CNSA 3B3TA 1M4DA 4OC5A 4OC2A 1BPMA 3DLJA 2EVNA 4LUAA 5D8NA 3DSBA 5J8CA 4BD9A 1YVOA 1PYTB 3IU2A 4U5YA 4A32A 3GIUA 4MFZA 2GU2A 4M3SA 1BAVA 4JYWA 3FBUA 1ELLP 2F7VA 4UEFA 4ZY2A 3D7GA 5HXDA 3IWEA 3P2HA 4R57A 1F2PA 3D3SA 1TKJA 4GS4A 1ZLHA 1TF9A 2JLMA 4M6IA 3W6SA 4NGNA 4XNHC 3FIXA 1QSNA 3PB8X 4B6ZA 1IOIA 1MJ9A 4M6GA 1P0HA 4C2YA 1QSMA 4H6UA 2IMOA 2WPXA 3SI0A 1S5KA 2ZELA 4XNHB 4ZI6A 4M85A 1YLOA 5CPAA 4NFRA 3RO0A 3DR6A 5AGEA 4KZTA 5K8OA 2GLFA 2YNEA 1R3NA 3B3CA 4B10A 1CP7A 4BMHA 4LX9A 1IOFA 1Z4EA 1NSLA 3R9FA 4EFDA 1HDQA 1MJBA 1VKCA 1GHEA 2YNCA 5THWA 1P4NA 4AXVA 4E2AA 4TNUA 3ISZA 2P0WA 3TO7A 4AB7A 3IEHA 4ZYQA 1BLLE 1VHOA 3A9LA 1NSAA 2CNTA 1Y0YA 3L2NA 2ZXVA 4CGNA 1FNOA 1VIXA 4UEZA 2O53A 1H8LA 4FD5A 2J8RA 1LANA 2ZW6A 4KORA 1AUGA 1Y7EA 1Z4RA 2AFUA 1HDUA 2Z3LA 1Z8WA 3IO1A 3SJFA 5LYFA 4PSXA 1S7NA 3IU1A 3D4UA 4UCPA 1YW6A 1YX0A 2JBJA 3D7HA 4UEEA 3S9LA 2B3UA 1YK3A 3IIBA 5AG4A 2KCWA 3N7ZA 4KOUA 4OMEA 2C6PA 1CM0A 2DF5A 3KZWA 4R6TA 3TO6A 2ABZA 3FEEA 4E0AA 5DWNA 5DS0A 5IB9A 2CNMA 1IGBA 3QNVA 4NF1A 5IV0A 2BUEA 1XMTA 3MGDA 7CPAA 3CDXA 3RBUA 4P4FA 2NSMA 1YSJA 4J3GA 3B8GA 3R9EA 5K8MA 5C82A 5K8PA 4H6ZA 5JQ4A 1VGYA 4JJXA 4KVXA 4NJRA 3NE7A 3TE4A 4FD4A 4P10A 3SXNA 1Z5RA 4MMOA 4RS2A 4EVYA 4I49A 2FIAA 2ZEMA 2CXAA 3JUWA 4HNXB 4KOYA 4UIBA 2IL4A 2PJBA 1BPNA 3IWWA 4AG9A 1ZLIA 4P4JA 4A31A 2BL1A 2IJZA 1YVKA 1LOKA 4OC3A 3NH5A 4FAIA 4RI1A 3CPAA 1R57A 2JEWA 3MRUA 4CPAA 2Q04A 1IIDA 4FD7A 3KI9A 5G22A 5J1QA 5HH1A 1KWMA 1V0CA 3FXTA 1NE9A 3PB4X 3TC8A 4P44A 3F8KA 3QAYA 4ONUA 2JDCA 5BWAB 2B4DB 1YMEA 1WWZA 4P4IA 4MI4A 2K5TA 4UWIA 2Z3OA 3TO9A 1IB1E 3G8WA 5LYDA 1TIQA 4IHMA 1LCPA 2AFWA 2OZGA 2Y0MA 3ZZIA 2ZENA 4KOXA 3D2MA 4QC6A 4UCMA 5HVHA 2PE3A 4OC1A 3FJUA 2PJ6A 4R3KA 4B11A 3EY5A 1LFWA 2ZEPA 1KUYA 4MRIA 1Z8XA 4MHZA 4UIAA 3PFOA 2ODFA 4FD6A 3B7IA 1JWQA 1VHSA 4B5PB 4OC4A 1ARMA 2EK9A 1N71A 3H4QA 2GIVA 2R8VA 4BBHA 3WR7A 2P6FA 2Q44A 3K2KA 2Z3MA 2ZEEA 3FX6A 2VQYA 1EE3P 2PIZA 3SHPA 1TXRA 3WABA 2ZW5A 5LRJA 2QYVA 1ARLA 2PJ2A 2V8GA 2EO8A 4OIDA 4RUHA 4MY0A 5G20A 2DPSA 4C68A 1IYKA 4R8FA 4UFXA 4CYNA 1QSOA 2GE3A 3MN8A 1XJOA 3KGQA 2O28A 4NJQA 4OP4A 4ZBGA 1S7KA 2QVPA
chains in the Genus database with same CATH topology
2ZEOA 3I1UA 2V8DA 4JZ0A 3RZAA 3PBBA 4K3NA 3FECA 2PRQA 4A38A 2DEAA 4X3RA 4P4BA 2C6CA 3B3VA 1M4LA 3SI1A 3B35A 3D68A 4NGMA 2PJCA 3D67A 2PJAA 2NYQA 3PB7X 3PB9X 2V8HA 1ZG7A 4MCRA 4NGQA 4TWEA 4MCQA 4NGTA 2AFOA 4PXEA 4P6YA 3H8FA 2C6GA 2J9AA 3FMCA 3S9MA 4PXCA 3WT4A 4FBEA 2ZEDA 5D29A 5LRGA 5HVGA 1TKHA 4PXDA 1CX8A 3NH8A 4R76A 2Q4ZA 5CBMA 2PJ3A 2ZOFA 1F2OA 3GLJA 3B3WA 4X2TA 2F8HA 2O4HA 4PPZA 2CTCA 4G1PA 4UF4A 3BXMA 1Y0RA 1Z2LA 3SJEA 4NGSA 5JM6A 1FT7A 2OR4A 4F9VA 4WJBA 2Q43A 2WYRA 3KR4A 1DE4C 4YU9A 3V7ZA 2VL1A 2WZNA 1Q7LA 3H8GA 2V77A 3PRTA 3LWUA 4EWTA 3WC6A 1DTDA 2GREA 2PJ5A 3BI1A 5K8NA 3FH4A 2XEIA 4A94A 1CP6A 4F8ZA 1QQ9A 3SJXA 4R7MA 3SI2A 4PQAA 3KQXA 3NA6A 2EK8A 4ZX9A 3WC7A 4P4EA 3BHXA 2AFXA 1ZG8A 1LAPA 3VATA 1AYEA 3D7FA 2C1CA 3GB0A 2BOAA 2PIYA 2FVGA 5F09A 3H8EA 4MHNA 3ISXA 2POKA 3TX8A 4Q7AA 2HC9A 2HB6A 3FEDA 4FWUA 5LRKA 4MHYA 1QMUA 2IQ6A 5HVFA 1JQGA 3FF3A 2QJ8A 4A39A 3KHXA 4ZX8A 2AFZA 3GUXA 3IFEA 8CPAA 3CT9A 2GLJA 4EMEA 4ZY1A 3KR5A 1LAMA 4OIWA 3NH4A 4IAVA 2PJ0A 4OC0A 2AFSA 5JGFA 3IC1A 2V8VA 3D66A 4W9YA 3JRUA 1R43A 1TF8A 3N5FA 4FUUA 2CTBA 2ANPA 1RTQA 2AFMA 2ZEFA 1Z8LA 4X8IA 2PJ7A 2ZOGA 3K9TA 1CBXA 5JH9A 3CPXA 4O23A 1ELMP 4DJLA 2PJ8A 2JBKA 3PBEA 4MXUA 3KHZA 2RB7A 4LQGA 2XEGA 2ZEGA 3SJGA 3IJ3A 4ONWA 4PXBA 4NGPA 2BCOA 4ZY0A 2RFHA 4KSIA 4OKOA 5ELYA 1VHEA 1HEEA 2BO9A 2PJ1A 4P45A 3WC5A 3LMSA 3PB6X 4Z65A 4DYOA 1CPSA 3T8WA 6CPAA 1ZG9A 5LYIA 2CF4A 2PVWA 3VARA 4NGRA 4IK2A 3HUVA 4H2KA 1TKFA 1XMBA 2I3CA 3FVLA 4DUKA 3NFZA 3KQZA 4YWYA 1IY7A 1F57A 3BI0A 4P4DA 1XRYA 3HLPA 1CPXA 4GM5A 1CG2A 3VH9A 3B2YA 2ZEHA 2XEFA 1AMPA 2XEJA 2OOTA 2Q51A 3D7DA 4WWVA 1UWYA 4MCPA 3V38A 1YW4A 1XFOA 1OBRA 5LYLA 3S9NA 2PJ4A 4F9UA 1PCAA 2CIJA 2PVVA 4MHPA 3PFEA 1XBUA 3RAMA 3KL9A 5I4MA 2PJ9A 2PCUA 2EWBA 2G9DA 3PEIA 4A37A 4MCSA 3B3SA 3KASA 1GYTA 3B3TA 4OC5A 4OC2A 1BPMA 3DLJA 5D8NA 4BD9A 1PYTB 2GU2A 1BAVA 4JYWA 1ELLP 2F7VA 4UEFA 4ZY2A 3D7GA 5HXDA 1F2PA 1TKJA 1ZLHA 1TF9A 4NGNA 3PB8X 4B6ZA 3SI0A 2IMOA 2ZELA 4ZI6A 1YLOA 5CPAA 4NFRA 5K8OA 2GLFA 1R3NA 3B3CA 1CP7A 4EFDA 1HDQA 5THWA 4AXVA 4TNUA 3ISZA 3IEHA 4ZYQA 1BLLE 1VHOA 1NSAA 3L2NA 1Y0YA 1FNOA 1VIXA 4UEZA 2O53A 1H8LA 1LANA 1Y7EA 2AFUA 1HDUA 3SJFA 3IO1A 5LYFA 3D4UA 1YW6A 2JBJA 3D7HA 4UEEA 3S9LA 3IIBA 4OMEA 2C6PA 3KZWA 4R6TA 2ABZA 3FEEA 5DS0A 5IB9A 1IGBA 3QNVA 7CPAA 3CDXA 3RBUA 4P4FA 2NSMA 1YSJA 5K8MA 5K8PA 1VGYA 4NJRA 4P10A 1Z5RA 4MMOA 2ZEMA 4UIBA 3IWWA 2PJBA 1BPNA 1ZLIA 4P4JA 2IJZA 1LOKA 4OC3A 3NH5A 4FAIA 3CPAA 2JEWA 3MRUA 4CPAA 3KI9A 5J1QA 1KWMA 3PB4X 3TC8A 4P44A 1YMEA 4P4IA 5LYDA 4IHMA 1LCPA 2AFWA 2ZENA 5HVHA 2PE3A 4OC1A 3FJUA 2PJ6A 1LFWA 2ZEPA 4MRIA 4MHZA 4UIAA 3PFOA 3B7IA 4OC4A 1ARMA 2EK9A 2QVPA 3K2KA 2ZEEA 3FX6A 1EE3P 2PIZA 3WABA 1TXRA 5LRJA 2QYVA 1ARLA 2PJ2A 2V8GA 4OIDA 4RUHA 4R8FA 3MN8A 1XJOA 3KGQA 4NJQA 4OP4A 3DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEO A;  3I1U A;  2V8D A;  4JZ0 A;  3RZA A;  3PBB A;  4K3N A;  3FEC A;  2PRQ A;  4A38 A;  2DEA A;  4X3R A;  4P4B A;  2C6C A;  3B3V A;  1M4L A;  3SI1 A;  3B35 A;  3D68 A;  4NGM A;  2PJC A;  3D67 A;  2PJA A;  2NYQ A;  3PB7 X;  3PB9 X;  2V8H A;  1ZG7 A;  4MCR A;  4NGQ A;  4TWE A;  4MCQ A;  4NGT A;  2AFO A;  4PXE A;  4P6Y A;  3H8F A;  2C6G A;  2J9A A;  3FMC A;  3S9M A;  4PXC A;  3WT4 A;  4FBE A;  2ZED A;  5D29 A;  5LRG A;  5HVG A;  1TKH A;  4PXD A;  1CX8 A;  3NH8 A;  4R76 A;  2Q4Z A;  5CBM A;  2PJ3 A;  2ZOF A;  1F2O A;  3GLJ A;  3B3W A;  4X2T A;  2F8H A;  2O4H A;  4PPZ A;  2CTC A;  4G1P A;  4UF4 A;  3BXM A;  1Y0R A;  1Z2L A;  3SJE A;  4NGS A;  5JM6 A;  1FT7 A;  2OR4 A;  4F9V A;  4WJB A;  2Q43 A;  2WYR A;  3KR4 A;  1DE4 C;  4YU9 A;  3V7Z A;  2VL1 A;  2WZN A;  1Q7L A;  3H8G A;  2V77 A;  3PRT A;  3LWU A;  4EWT A;  3WC6 A;  1DTD A;  2GRE A;  2PJ5 A;  3BI1 A;  5K8N A;  3FH4 A;  2XEI A;  4A94 A;  1CP6 A;  4F8Z A;  1QQ9 A;  3SJX A;  4R7M A;  3SI2 A;  4PQA A;  3KQX A;  3NA6 A;  2EK8 A;  4ZX9 A;  3WC7 A;  4P4E A;  3BHX A;  2AFX A;  1ZG8 A;  1LAP A;  3VAT A;  1AYE A;  3D7F A;  2C1C A;  3GB0 A;  2BOA A;  2PIY A;  2FVG A;  5F09 A;  3H8E A;  4MHN A;  3ISX A;  2POK A;  3TX8 A;  4Q7A A;  2HC9 A;  2HB6 A;  3FED A;  4FWU A;  5LRK A;  4MHY A;  1QMU A;  2IQ6 A;  5HVF A;  1JQG A;  3FF3 A;  2QJ8 A;  4A39 A;  3KHX A;  4ZX8 A;  2AFZ A;  3GUX A;  3IFE A;  8CPA A;  3CT9 A;  2GLJ A;  4EME A;  4ZY1 A;  3KR5 A;  1LAM A;  4OIW A;  3NH4 A;  4IAV A;  2PJ0 A;  4OC0 A;  2AFS A;  5JGF A;  3IC1 A;  2V8V A;  3D66 A;  4W9Y A;  3JRU A;  1R43 A;  1TF8 A;  3N5F A;  4FUU A;  2CTB A;  2ANP A;  1RTQ A;  2AFM A;  2ZEF A;  1Z8L A;  4X8I A;  2PJ7 A;  2ZOG A;  3K9T A;  1CBX A;  5JH9 A;  3CPX A;  4O23 A;  1ELM P;  4DJL A;  2PJ8 A;  2JBK A;  3PBE A;  4MXU A;  3KHZ A;  2RB7 A;  4LQG A;  2XEG A;  2ZEG A;  3SJG A;  3IJ3 A;  4ONW A;  4PXB A;  4NGP A;  2BCO A;  4ZY0 A;  2RFH A;  4KSI A;  4OKO A;  5ELY A;  1VHE A;  1HEE A;  2BO9 A;  2PJ1 A;  4P45 A;  3WC5 A;  3LMS A;  3PB6 X;  4Z65 A;  4DYO A;  1CPS A;  3T8W A;  6CPA A;  1ZG9 A;  5LYI A;  2CF4 A;  2PVW A;  3VAR A;  4NGR A;  4IK2 A;  3HUV A;  4H2K A;  1TKF A;  1XMB A;  2I3C A;  3FVL A;  4DUK A;  3NFZ A;  3KQZ A;  4YWY A;  1IY7 A;  1F57 A;  3BI0 A;  4P4D A;  1XRY A;  3HLP A;  1CPX A;  4GM5 A;  1CG2 A;  3VH9 A;  3B2Y A;  2ZEH A;  2XEF A;  1AMP A;  2XEJ A;  2OOT A;  2Q51 A;  3D7D A;  4WWV A;  1UWY A;  4MCP A;  3V38 A;  1YW4 A;  1XFO A;  1OBR A;  5LYL A;  3S9N A;  2PJ4 A;  4F9U A;  1PCA A;  2CIJ A;  2PVV A;  4MHP A;  3PFE A;  1XBU A;  3RAM A;  3KL9 A;  5I4M A;  2PJ9 A;  2PCU A;  2EWB A;  2G9D A;  3PEI A;  4A37 A;  4MCS A;  3B3S A;  3KAS A;  1GYT A;  3B3T A;  4OC5 A;  4OC2 A;  1BPM A;  3DLJ A;  5D8N A;  4BD9 A;  1PYT B;  2GU2 A;  1BAV A;  4JYW A;  1ELL P;  2F7V A;  4UEF A;  4ZY2 A;  3D7G A;  5HXD A;  1F2P A;  1TKJ A;  1ZLH A;  1TF9 A;  4NGN A;  3PB8 X;  4B6Z A;  3SI0 A;  2IMO A;  2ZEL A;  4ZI6 A;  1YLO A;  5CPA A;  4NFR A;  5K8O A;  2GLF A;  1R3N A;  3B3C A;  1CP7 A;  4EFD A;  1HDQ A;  5THW A;  4AXV A;  4TNU A;  3ISZ A;  3IEH A;  4ZYQ A;  1BLL E;  1VHO A;  1NSA A;  3L2N A;  1Y0Y A;  1FNO A;  1VIX A;  4UEZ A;  2O53 A;  1H8L A;  1LAN A;  1Y7E A;  2AFU A;  1HDU A;  3SJF A;  3IO1 A;  5LYF A;  3D4U A;  1YW6 A;  2JBJ A;  3D7H A;  4UEE A;  3S9L A;  3IIB A;  4OME A;  2C6P A;  3KZW A;  4R6T A;  2ABZ A;  3FEE A;  5DS0 A;  5IB9 A;  1IGB A;  3QNV A;  7CPA A;  3CDX A;  3RBU A;  4P4F A;  2NSM A;  1YSJ A;  5K8M A;  5K8P A;  1VGY A;  4NJR A;  4P10 A;  1Z5R A;  4MMO A;  2ZEM A;  4UIB A;  3IWW A;  2PJB A;  1BPN A;  1ZLI A;  4P4J A;  2IJZ A;  1LOK A;  4OC3 A;  3NH5 A;  4FAI A;  3CPA A;  2JEW A;  3MRU A;  4CPA A;  3KI9 A;  5J1Q A;  1KWM A;  3PB4 X;  3TC8 A;  4P44 A;  1YME A;  4P4I A;  5LYD A;  4IHM A;  1LCP A;  2AFW A;  2ZEN A;  5HVH A;  2PE3 A;  4OC1 A;  3FJU A;  2PJ6 A;  1LFW A;  2ZEP A;  4MRI A;  4MHZ A;  4UIA A;  3PFO A;  3B7I A;  4OC4 A;  1ARM A;  2EK9 A;  2QVP A;  3K2K A;  2ZEE A;  3FX6 A;  1EE3 P;  2PIZ A;  3WAB A;  1TXR A;  5LRJ A;  2QYV A;  1ARL A;  2PJ2 A;  2V8G A;  4OID A;  4RUH A;  4R8F A;  3MN8 A;  1XJO A;  3KGQ A;  4NJQ A;  4OP4 A;  3DGV A; 
#chains in the Genus database with same CATH topology
 2ZEO A;  4RN7 A;  4C2X A;  3I1U A;  1ZO0 A;  2V8D A;  1M1D A;  2PR1 A;  4JZ0 A;  2WPW A;  3RZA A;  3PBB A;  4OLL A;  4K3N A;  3FEC A;  3JVN A;  2PRQ A;  3DGV A;  3EXN A;  4A38 A;  2DEA A;  1B6B A;  4X3R A;  5GCN A;  4P4B A;  1QST A;  1A2Z A;  2C6C A;  3SXO A;  2D4P A;  2HQY A;  3B3V A;  1M4L A;  3LAC A;  3SI1 A;  3B35 A;  3D68 A;  4NGM A;  4PK2 A;  2PJC A;  3D67 A;  3P2F A;  4F6A A;  1KZF A;  2PJA A;  3DDD A;  4UA3 A;  2NYQ A;  3BLN A;  3PB7 X;  1XE4 A;  3PB9 X;  2V8H A;  1ZG7 A;  1WK4 A;  1XF8 A;  1YRE A;  4MCR A;  4NGQ A;  4YRH A;  4TWE A;  4MCQ A;  4NGT A;  4UFV A;  4AVB A;  3D8P A;  2AFO A;  4PXE A;  4P6Y A;  3H8F A;  3FYN A;  5EBV A;  2ZPA A;  2QIR A;  2C6G A;  2J9A A;  3FMC A;  4H89 A;  4PXC A;  5G1Z A;  3S9M A;  3WT4 A;  4FBE A;  2ZED A;  4MFP A;  2PSW A;  5D29 A;  5LRG A;  1I12 A;  1S60 A;  2VEZ A;  5HVG A;  1TKH A;  4PXD A;  2PC1 A;  1Q2C A;  1CX8 A;  1MJA A;  3NH8 A;  4R76 A;  2Q4Z A;  5CBM A;  2FE7 A;  2PJ3 A;  2ZOF A;  4NSQ A;  1F2O A;  3GLJ A;  1CJW A;  2G3A A;  2B3V A;  3B3W A;  3PP9 A;  4MY3 A;  4A30 A;  4X2T A;  2F8H A;  2O4H A;  4PPZ A;  4IUS A;  3JTK A;  3TOA A;  2OH1 A;  4A33 A;  2CTC A;  4G1P A;  4UF4 A;  3BXM A;  1Y0R A;  2B5G A;  4UWJ A;  4F0X A;  4CYO A;  1Z2L A;  2B4D A;  3SJE A;  4R3L A;  3RYO A;  2AJ6 A;  2WSA A;  2Z0Z A;  5CNP A;  2REF A;  3TCV A;  2PQ8 A;  4NGS A;  1M44 A;  5JM6 A;  1FT7 A;  2OR4 A;  4Q36 A;  4F9V A;  1PUA A;  4WJB A;  4CRZ B;  2BSW A;  3IGR A;  2Q43 A;  1S7L A;  1X12 A;  2Q4V A;  2VI7 A;  3T90 A;  4CGP A;  1M4G A;  4UBR A;  4CYQ A;  4MBU A;  2WYR A;  4JWP A;  4K30 A;  4C2Z A;  3KR4 A;  1DE4 C;  4YU9 A;  4C7I A;  2OB0 A;  5F49 A;  4QB9 A;  4QVT A;  3LOD A;  3V7Z A;  2VL1 A;  4B5P A;  4ORF A;  2WZN A;  2FSR A;  4HNY B;  5AG5 A;  2CY2 A;  1Q7L A;  3H8G A;  2REE A;  2VXK A;  2V77 A;  2G0B A;  3G3S A;  3PRT A;  3LWU A;  4CGO A;  4EWT A;  4MFJ A;  4AVC A;  3WC6 A;  1DTD A;  2GRE A;  2PJ5 A;  2ARH A;  3BI1 A;  3DNS A;  5K8N A;  3FH4 A;  3R96 A;  3CZX A;  1UFH A;  4B12 A;  2Q4Y A;  2XEI A;  3CXP A;  4Y49 C;  1CP6 A;  3T9Y A;  2B5G B;  4MFK A;  3IWG A;  4A94 A;  4CS0 B;  4KOT A;  4MFL A;  4F8Z A;  4KVO E;  1QQ9 A;  2PR8 A;  3SJX A;  3CXS A;  2FT0 A;  4R7M A;  2Q7S A;  4Y49 B;  4PQA A;  3SI2 A;  4NXY A;  3QB8 A;  3KQX A;  3NA6 A;  2EK8 A;  4ZX9 A;  4A95 A;  4DNC A;  3WC7 A;  2C27 A;  4P4E A;  5EC4 A;  3VWE A;  1XIX A;  2ATR A;  3BHX A;  4L8A A;  2VZY A;  3S6K A;  2BEI A;  3D2P A;  4LQ6 A;  3TT2 A;  1I1D A;  4A2Z A;  4CAE A;  3EC4 A;  2AFX A;  1ZG8 A;  1LAP A;  3VAT A;  4B5O A;  2Z3P A;  1XOV A;  1AYE A;  2DPT A;  4Q38 A;  4KOS A;  4XPL A;  2FL4 A;  1KUV A;  3D7F A;  3KKW A;  2C1C A;  3BJ8 A;  3GB0 A;  4HPS A;  4KSF A;  2BOA A;  3VWD A;  4CAW A;  2PIY A;  2FVG A;  2F5I A;  5F09 A;  4KLW A;  4U9Z A;  4UFW A;  5EMI A;  1LRZ A;  3H8E A;  4MHN A;  1J4J A;  3R9G A;  3V8I A;  1M4I A;  4JXQ A;  1Z8T A;  3ISX A;  4UCN A;  4JXR A;  2POK A;  3DR8 A;  4MHD A;  4OAD A;  5G21 A;  4Q7A A;  2G3T A;  2HC9 A;  3TX8 A;  2HB6 A;  3W6X A;  1S7F A;  2R7H A;  3FED A;  4FWU A;  4E8O A;  5LRK A;  4HKF A;  4MHY A;  2Z10 A;  1QMU A;  2IQ6 A;  4JD6 A;  1FY7 A;  5HVF A;  1JQG A;  3FF3 A;  4KUA A;  2EUI A;  1Q2Y A;  2QJ8 A;  4XPD C;  3I9S A;  4A39 A;  4CGM A;  3KHX A;  4ZX8 A;  2AFZ A;  3GUX A;  3S6H A;  3IFE A;  5AG6 A;  8CPA A;  5DWM A;  4CYP A;  2GFQ A;  3CT9 A;  4XPD B;  1SQH A;  2GLJ A;  4EME A;  2Z3N A;  3F5B A;  3NE8 A;  3TOB A;  4MFQ A;  4ZY1 A;  5C88 A;  2Q0Y A;  3KR5 A;  5KTA A;  1LAM A;  2P6E A;  3S6F A;  3FNC A;  4OIW A;  3NH4 A;  4PSW A;  4CRY B;  4IAV A;  2PJ0 A;  3K9U A;  2FCK A;  2GAN A;  2JDD A;  2AFS A;  1KUX A;  2VBQ A;  4OC0 A;  5JGF A;  3IC1 A;  3R1K A;  3S6G A;  2V8V A;  3F0A A;  3LD2 A;  3D66 A;  4W9Y A;  4QBJ A;  5KTC A;  2FIW A;  1R43 A;  1TF8 A;  3JRU A;  5A28 A;  3OWC A;  3N5F A;  3E0K A;  4FUU A;  2CTB A;  2J8M A;  4AG7 A;  2ANP A;  4KUB A;  1RTQ A;  1YR0 A;  1OZP A;  2AFM A;  2WUU A;  4B14 A;  4CAX A;  2ZEF A;  1Z8L A;  3EFA A;  4C7H A;  4X8I A;  2PJ7 A;  2ZOG A;  4IF5 A;  4B13 A;  3K9T A;  4X5K A;  2R1I A;  3TTH A;  3R95 A;  1CBX A;  4R87 A;  5JH9 A;  2Z3K A;  3CPX A;  4HNW B;  4O23 A;  1ELM P;  2HUZ A;  1MK4 A;  4DJL A;  2PJ8 A;  5E96 A;  5ISV A;  2JBK A;  3PBE A;  4MXU A;  3KHZ A;  2RB7 A;  4KLV A;  4LQG A;  1B87 A;  2XEG A;  2ZEG A;  3SJG A;  3IJ3 A;  4ONW A;  4PXB A;  4NGP A;  1K4J A;  2BCO A;  4ZY0 A;  2PDO A;  5J8F A;  2RFH A;  4KSI A;  1YQE A;  5I0C A;  4KS9 A;  1U6M A;  4OKO A;  5ELY A;  3C26 A;  4KSA A;  5H84 A;  1VHE A;  2OU2 A;  1HEE A;  2BO9 A;  2A4N A;  2D4O A;  2PJ1 A;  1Y7R A;  2Z11 A;  4P45 A;  3WC5 A;  3LMS A;  5HMN A;  3TFY A;  3PB6 X;  4NCZ A;  3UY5 A;  5F47 A;  4Z65 A;  5A27 A;  2X7B A;  4DYO A;  1CPS A;  3T8W A;  4PK3 A;  6CPA A;  4CGL A;  1PU9 A;  1ZG9 A;  1XEB A;  2AE6 A;  5LYI A;  2CF4 A;  2PVW A;  3VAR A;  4NGR A;  1NMT A;  2YNC C;  4MJ8 A;  3BJ7 A;  4IK2 A;  3HUV A;  4H2K A;  1TKF A;  1XMB A;  5IB0 A;  5AG7 A;  2OZU A;  3PGP A;  2I3C A;  4JLY A;  1I21 A;  3FVL A;  1BOB A;  4DUK A;  3I3G A;  4U9Y A;  3NFZ A;  1BO4 A;  4AVA A;  2B58 A;  3GKR A;  2RC4 A;  3KQZ A;  2FXF A;  2NMT A;  3FB3 A;  2P6G A;  4YGO A;  4CAF A;  4YFJ A;  4YWY A;  1YGH A;  1IY7 A;  1F57 A;  3BI0 A;  4P4D A;  2OZH A;  2B4B A;  4ZGY B;  1XRY A;  4XPK A;  3RNZ A;  1Y9W A;  3EO4 A;  3HLP A;  1CPX A;  2H5M A;  4GXH A;  2FS5 A;  1Z9U A;  4GM5 A;  3GYA A;  4R9M A;  4F9U A;  1RO5 A;  2Q7B A;  2I79 A;  2DXQ A;  4PV6 A;  1CG2 A;  2J8N A;  3H5Z A;  5IX3 A;  4M6H A;  2QEC A;  3VH9 A;  2EBJ A;  2I00 A;  3FRM A;  3B2Y A;  4KOV A;  2ZEH A;  5JPH A;  2XEF A;  1AMP A;  2XEJ A;  2OOT A;  3ZJ0 A;  2Q51 A;  4II9 A;  3D7D A;  3GY9 A;  4WWV A;  1UWY A;  4MCP A;  3V38 A;  1YW4 A;  1XFO A;  1L0C A;  1Y9K A;  3CXQ A;  2VZZ A;  2ZW7 A;  4L89 A;  1OBR A;  4KVM E;  5KTD A;  2YGW A;  5LYL A;  5F48 A;  2JEV A;  3S9N A;  4F0Y A;  2YND A;  1IYL A;  1IU8 A;  1ON0 A;  1RXT A;  1S3Z A;  1YLE A;  1PCA A;  2PJ4 A;  2CIJ A;  2PVV A;  2HV2 A;  3QAH A;  1Q2D A;  1X10 A;  3PZJ A;  4KOW A;  4CAV A;  1QSR A;  4MHP A;  5H86 A;  2R98 A;  3PFE A;  4QUS A;  1XBU A;  3RAM A;  2ZW4 A;  3KL9 A;  2QML A;  5I4M A;  2PJ9 A;  2PCU A;  2EWB A;  4BIN A;  2G9D A;  1IIC A;  5F46 A;  3PEI A;  4NEX A;  5FVJ A;  4OAE A;  4A37 A;  4MCS A;  3W91 A;  3B3S A;  3KAS A;  1GYT A;  2PRB A;  2CNS A;  3B3T A;  1M4D A;  4OC5 A;  4OC2 A;  1BPM A;  3DLJ A;  2EVN A;  4LUA A;  5D8N A;  3DSB A;  5J8C A;  4BD9 A;  1YVO A;  1PYT B;  3IU2 A;  4U5Y A;  4A32 A;  3GIU A;  4MFZ A;  2GU2 A;  4M3S A;  1BAV A;  4JYW A;  3FBU A;  1ELL P;  2F7V A;  4UEF A;  4ZY2 A;  3D7G A;  5HXD A;  3IWE A;  3P2H A;  4R57 A;  1F2P A;  3D3S A;  1TKJ A;  4GS4 A;  1ZLH A;  1TF9 A;  2JLM A;  4M6I A;  3W6S A;  4NGN A;  4XNH C;  3FIX A;  1QSN A;  3PB8 X;  4B6Z A;  1IOI A;  1MJ9 A;  4M6G A;  1P0H A;  4C2Y A;  1QSM A;  4H6U A;  2IMO A;  2WPX A;  3SI0 A;  1S5K A;  2ZEL A;  4XNH B;  4ZI6 A;  4M85 A;  1YLO A;  5CPA A;  4NFR A;  3RO0 A;  3DR6 A;  5AGE A;  4KZT A;  5K8O A;  2GLF A;  2YNE A;  1R3N A;  3B3C A;  4B10 A;  1CP7 A;  4BMH A;  4LX9 A;  1IOF A;  1Z4E A;  1NSL A;  3R9F A;  4EFD A;  1HDQ A;  1MJB A;  1VKC A;  1GHE A;  2YNC A;  5THW A;  1P4N A;  4AXV A;  4E2A A;  4TNU A;  3ISZ A;  2P0W A;  3TO7 A;  4AB7 A;  3IEH A;  4ZYQ A;  1BLL E;  1VHO A;  3A9L A;  1NSA A;  2CNT A;  1Y0Y A;  3L2N A;  2ZXV A;  4CGN A;  1FNO A;  1VIX A;  4UEZ A;  2O53 A;  1H8L A;  4FD5 A;  2J8R A;  1LAN A;  2ZW6 A;  4KOR A;  1AUG A;  1Y7E A;  1Z4R A;  2AFU A;  1HDU A;  2Z3L A;  1Z8W A;  3IO1 A;  3SJF A;  5LYF A;  4PSX A;  1S7N A;  3IU1 A;  3D4U A;  4UCP A;  1YW6 A;  1YX0 A;  2JBJ A;  3D7H A;  4UEE A;  3S9L A;  2B3U A;  1YK3 A;  3IIB A;  5AG4 A;  2KCW A;  3N7Z A;  4KOU A;  4OME A;  2C6P A;  1CM0 A;  2DF5 A;  3KZW A;  4R6T A;  3TO6 A;  2ABZ A;  3FEE A;  4E0A A;  5DWN A;  5DS0 A;  5IB9 A;  2CNM A;  1IGB A;  3QNV A;  4NF1 A;  5IV0 A;  2BUE A;  1XMT A;  3MGD A;  7CPA A;  3CDX A;  3RBU A;  4P4F A;  2NSM A;  1YSJ A;  4J3G A;  3B8G A;  3R9E A;  5K8M A;  5C82 A;  5K8P A;  4H6Z A;  5JQ4 A;  1VGY A;  4JJX A;  4KVX A;  4NJR A;  3NE7 A;  3TE4 A;  4FD4 A;  4P10 A;  3SXN A;  1Z5R A;  4MMO A;  4RS2 A;  4EVY A;  4I49 A;  2FIA A;  2ZEM A;  2CXA A;  3JUW A;  4HNX B;  4KOY A;  4UIB A;  2IL4 A;  2PJB A;  1BPN A;  3IWW A;  4AG9 A;  1ZLI A;  4P4J A;  4A31 A;  2BL1 A;  2IJZ A;  1YVK A;  1LOK A;  4OC3 A;  3NH5 A;  4FAI A;  4RI1 A;  3CPA A;  1R57 A;  2JEW A;  3MRU A;  4CPA A;  2Q04 A;  1IID A;  4FD7 A;  3KI9 A;  5G22 A;  5J1Q A;  5HH1 A;  1KWM A;  1V0C A;  3FXT A;  1NE9 A;  3PB4 X;  3TC8 A;  4P44 A;  3F8K A;  3QAY A;  4ONU A;  2JDC A;  5BWA B;  2B4D B;  1YME A;  1WWZ A;  4P4I A;  4MI4 A;  2K5T A;  4UWI A;  2Z3O A;  3TO9 A;  1IB1 E;  3G8W A;  5LYD A;  1TIQ A;  4IHM A;  1LCP A;  2AFW A;  2OZG A;  2Y0M A;  3ZZI A;  2ZEN A;  4KOX A;  3D2M A;  4QC6 A;  4UCM A;  5HVH A;  2PE3 A;  4OC1 A;  3FJU A;  2PJ6 A;  4R3K A;  4B11 A;  3EY5 A;  1LFW A;  2ZEP A;  1KUY A;  4MRI A;  1Z8X A;  4MHZ A;  4UIA A;  3PFO A;  2ODF A;  4FD6 A;  3B7I A;  1JWQ A;  1VHS A;  4B5P B;  4OC4 A;  1ARM A;  2EK9 A;  1N71 A;  3H4Q A;  2GIV A;  2R8V A;  4BBH A;  3WR7 A;  2P6F A;  2Q44 A;  3K2K A;  2Z3M A;  2ZEE A;  3FX6 A;  2VQY A;  1EE3 P;  2PIZ A;  3SHP A;  1TXR A;  3WAB A;  2ZW5 A;  5LRJ A;  2QYV A;  1ARL A;  2PJ2 A;  2V8G A;  2EO8 A;  4OID A;  4RUH A;  4MY0 A;  5G20 A;  2DPS A;  4C68 A;  1IYK A;  4R8F A;  4UFX A;  4CYN A;  1QSO A;  2GE3 A;  3MN8 A;  1XJO A;  3KGQ A;  2O28 A;  4NJQ A;  4OP4 A;  4ZBG A;  1S7K A;  2QVP A; 
#chains in the Genus database with same CATH homology
 2ZEO A;  3I1U A;  2V8D A;  4JZ0 A;  3RZA A;  3PBB A;  4K3N A;  3FEC A;  2PRQ A;  4A38 A;  2DEA A;  4X3R A;  4P4B A;  2C6C A;  3B3V A;  1M4L A;  3SI1 A;  3B35 A;  3D68 A;  4NGM A;  2PJC A;  3D67 A;  2PJA A;  2NYQ A;  3PB7 X;  3PB9 X;  2V8H A;  1ZG7 A;  4MCR A;  4NGQ A;  4TWE A;  4MCQ A;  4NGT A;  2AFO A;  4PXE A;  4P6Y A;  3H8F A;  2C6G A;  2J9A A;  3FMC A;  3S9M A;  4PXC A;  3WT4 A;  4FBE A;  2ZED A;  5D29 A;  5LRG A;  5HVG A;  1TKH A;  4PXD A;  1CX8 A;  3NH8 A;  4R76 A;  2Q4Z A;  5CBM A;  2PJ3 A;  2ZOF A;  1F2O A;  3GLJ A;  3B3W A;  4X2T A;  2F8H A;  2O4H A;  4PPZ A;  2CTC A;  4G1P A;  4UF4 A;  3BXM A;  1Y0R A;  1Z2L A;  3SJE A;  4NGS A;  5JM6 A;  1FT7 A;  2OR4 A;  4F9V A;  4WJB A;  2Q43 A;  2WYR A;  3KR4 A;  1DE4 C;  4YU9 A;  3V7Z A;  2VL1 A;  2WZN A;  1Q7L A;  3H8G A;  2V77 A;  3PRT A;  3LWU A;  4EWT A;  3WC6 A;  1DTD A;  2GRE A;  2PJ5 A;  3BI1 A;  5K8N A;  3FH4 A;  2XEI A;  4A94 A;  1CP6 A;  4F8Z A;  1QQ9 A;  3SJX A;  4R7M A;  3SI2 A;  4PQA A;  3KQX A;  3NA6 A;  2EK8 A;  4ZX9 A;  3WC7 A;  4P4E A;  3BHX A;  2AFX A;  1ZG8 A;  1LAP A;  3VAT A;  1AYE A;  3D7F A;  2C1C A;  3GB0 A;  2BOA A;  2PIY A;  2FVG A;  5F09 A;  3H8E A;  4MHN A;  3ISX A;  2POK A;  3TX8 A;  4Q7A A;  2HC9 A;  2HB6 A;  3FED A;  4FWU A;  5LRK A;  4MHY A;  1QMU A;  2IQ6 A;  5HVF A;  1JQG A;  3FF3 A;  2QJ8 A;  4A39 A;  3KHX A;  4ZX8 A;  2AFZ A;  3GUX A;  3IFE A;  8CPA A;  3CT9 A;  2GLJ A;  4EME A;  4ZY1 A;  3KR5 A;  1LAM A;  4OIW A;  3NH4 A;  4IAV A;  2PJ0 A;  4OC0 A;  2AFS A;  5JGF A;  3IC1 A;  2V8V A;  3D66 A;  4W9Y A;  3JRU A;  1R43 A;  1TF8 A;  3N5F A;  4FUU A;  2CTB A;  2ANP A;  1RTQ A;  2AFM A;  2ZEF A;  1Z8L A;  4X8I A;  2PJ7 A;  2ZOG A;  3K9T A;  1CBX A;  5JH9 A;  3CPX A;  4O23 A;  1ELM P;  4DJL A;  2PJ8 A;  2JBK A;  3PBE A;  4MXU A;  3KHZ A;  2RB7 A;  4LQG A;  2XEG A;  2ZEG A;  3SJG A;  3IJ3 A;  4ONW A;  4PXB A;  4NGP A;  2BCO A;  4ZY0 A;  2RFH A;  4KSI A;  4OKO A;  5ELY A;  1VHE A;  1HEE A;  2BO9 A;  2PJ1 A;  4P45 A;  3WC5 A;  3LMS A;  3PB6 X;  4Z65 A;  4DYO A;  1CPS A;  3T8W A;  6CPA A;  1ZG9 A;  5LYI A;  2CF4 A;  2PVW A;  3VAR A;  4NGR A;  4IK2 A;  3HUV A;  4H2K A;  1TKF A;  1XMB A;  2I3C A;  3FVL A;  4DUK A;  3NFZ A;  3KQZ A;  4YWY A;  1IY7 A;  1F57 A;  3BI0 A;  4P4D A;  1XRY A;  3HLP A;  1CPX A;  4GM5 A;  1CG2 A;  3VH9 A;  3B2Y A;  2ZEH A;  2XEF A;  1AMP A;  2XEJ A;  2OOT A;  2Q51 A;  3D7D A;  4WWV A;  1UWY A;  4MCP A;  3V38 A;  1YW4 A;  1XFO A;  1OBR A;  5LYL A;  3S9N A;  2PJ4 A;  4F9U A;  1PCA A;  2CIJ A;  2PVV A;  4MHP A;  3PFE A;  1XBU A;  3RAM A;  3KL9 A;  5I4M A;  2PJ9 A;  2PCU A;  2EWB A;  2G9D A;  3PEI A;  4A37 A;  4MCS A;  3B3S A;  3KAS A;  1GYT A;  3B3T A;  4OC5 A;  4OC2 A;  1BPM A;  3DLJ A;  5D8N A;  4BD9 A;  1PYT B;  2GU2 A;  1BAV A;  4JYW A;  1ELL P;  2F7V A;  4UEF A;  4ZY2 A;  3D7G A;  5HXD A;  1F2P A;  1TKJ A;  1ZLH A;  1TF9 A;  4NGN A;  3PB8 X;  4B6Z A;  3SI0 A;  2IMO A;  2ZEL A;  4ZI6 A;  1YLO A;  5CPA A;  4NFR A;  5K8O A;  2GLF A;  1R3N A;  3B3C A;  1CP7 A;  4EFD A;  1HDQ A;  5THW A;  4AXV A;  4TNU A;  3ISZ A;  3IEH A;  4ZYQ A;  1BLL E;  1VHO A;  1NSA A;  3L2N A;  1Y0Y A;  1FNO A;  1VIX A;  4UEZ A;  2O53 A;  1H8L A;  1LAN A;  1Y7E A;  2AFU A;  1HDU A;  3SJF A;  3IO1 A;  5LYF A;  3D4U A;  1YW6 A;  2JBJ A;  3D7H A;  4UEE A;  3S9L A;  3IIB A;  4OME A;  2C6P A;  3KZW A;  4R6T A;  2ABZ A;  3FEE A;  5DS0 A;  5IB9 A;  1IGB A;  3QNV A;  7CPA A;  3CDX A;  3RBU A;  4P4F A;  2NSM A;  1YSJ A;  5K8M A;  5K8P A;  1VGY A;  4NJR A;  4P10 A;  1Z5R A;  4MMO A;  2ZEM A;  4UIB A;  3IWW A;  2PJB A;  1BPN A;  1ZLI A;  4P4J A;  2IJZ A;  1LOK A;  4OC3 A;  3NH5 A;  4FAI A;  3CPA A;  2JEW A;  3MRU A;  4CPA A;  3KI9 A;  5J1Q A;  1KWM A;  3PB4 X;  3TC8 A;  4P44 A;  1YME A;  4P4I A;  5LYD A;  4IHM A;  1LCP A;  2AFW A;  2ZEN A;  5HVH A;  2PE3 A;  4OC1 A;  3FJU A;  2PJ6 A;  1LFW A;  2ZEP A;  4MRI A;  4MHZ A;  4UIA A;  3PFO A;  3B7I A;  4OC4 A;  1ARM A;  2EK9 A;  2QVP A;  3K2K A;  2ZEE A;  3FX6 A;  1EE3 P;  2PIZ A;  3WAB A;  1TXR A;  5LRJ A;  2QYV A;  1ARL A;  2PJ2 A;  2V8G A;  4OID A;  4RUH A;  4R8F A;  3MN8 A;  1XJO A;  3KGQ A;  4NJQ A;  4OP4 A;  3DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...