2ZEOA

Crystal structure of the human glutaminyl cyclase mutant d305e at 1.66 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQEDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeoA00
4O23A 1QMUA 1XMBA 5LYFA 4OKOA 4OC3A 1KWMA 1VGYA 2CF4A 1GYTA 2Q51A 4NGQA 4Q7AA 4KSIA 1F2PA 5I4MA 4MCQA 4P4BA 1YW4A 3V38A 1YW6A 2C6GA 4EMEA 1YSJA 3B35A 1LOKA 5JH9A 4OMEA 3BI1A 3WC6A 1CBXA 3DLJA 4ZX8A 2AFZA 3PFOA 1FNOA 2XEIA 4PXEA 2ZEGA 1PCAA 6CPAA 4PXCA 3D7FA 5J1QA 3VATA 4NGTA 3FEEA 4UEEA 1R3NA 3H8EA 4P4FA 3KL9A 2WZNA 3HUVA 7CPAA 4FWUA 2PJ7A 2ZELA 4ZY1A 2I3CA 4AXVA 2ZEMA 5K8OA 2JBJA 4ZY0A 2Q4ZA 4OP4A 2ZEEA 2O4HA 4DYOA 2ZENA 5CPAA 2ZOGA 3TX8A 3SI0A 4OIWA 1Y0RA 2BCOA 1LANA 1H8LA 4MRIA 2F7VA 2G9DA 3B3CA 5THWA 3KGQA 3GUXA 3KR5A 2ZEFA 2PJ0A 2V8DA 3MN8A 3D7GA 2OR4A 4NJQA 1EE3P 3CPAA 4MCSA 4P4JA 2Q43A 1HDUA 5D29A 4OC5A 2CTBA 5CBMA 2PJ6A 2PVWA 2IJZA 3KZWA 1TXRA 4PXDA 4DJLA 4DUKA 3D66A 3IC1A 1ARLA 2XEGA 1BPNA 4K3NA 2JBKA 3TC8A 1AYEA 3B3TA 1IGBA 4PXBA 8CPAA 4OC0A 4NGRA 1VIXA 3D7HA 3D7DA 5DS0A 1Q7LA 2WYRA 4JYWA 4P45A 3B3VA 4F9VA 1CP7A 1Z8LA 2EK9A 1F2OA 3L2NA 4MHPA 4OC4A 3RBUA 1Y0YA 1Z2LA 3IO1A 4MMOA 2AFWA 2OOTA 3KQXA 2PE3A 1FT7A 3WC5A 2AFSA 1HEEA 4FBEA 2ZEPA 3PBEA 5ELYA 3I1UA 5K8PA 2QJ8A 3WC7A 4WJBA 5F09A 1ZG8A 5JM6A 3S9MA 1BLLE 1CPSA 3N5FA 3FMCA 4ZY2A 1YLOA 4MXUA 3VH9A 4LQGA 2ZEDA 1DTDA 4UEFA 2V8GA 3CPXA 4UIBA 4ZX9A 1RTQA 3IWWA 4RUHA 5LRGA 3D4UA 4Z65A 3SJGA 2PVVA 3NH8A 5LRKA 3PB9X 4X2TA 2HB6A 2POKA 3IEHA 3QNVA 2AFMA 4NFRA 4FUUA 4EWTA 1NSAA 3S9NA 1ZLHA 2AFXA 2PJ2A 3D68A 2FVGA 1VHEA 2GU2A 4YU9A 2RFHA 4W9YA 3PB8X 3FJUA 2AFUA 3WT4A 1CG2A 4MHYA 4UEZA 4H2KA 4WWVA 4A38A 3IJ3A 1XJOA 4IAVA 4MCRA 3FVLA 3ISZA 1AMPA 1ELMP 1XBUA 2CIJA 2ZOFA 4OC1A 3PB4X 1ELLP 1ZG9A 2PJAA 4P4IA 4EFDA 4X3RA 4X8IA 1TKHA 3CDXA 3T8WA 2QVPA 1Y7EA 3SI1A 3NH4A 1CP6A 5LYIA 2V8HA 3RAMA 2PRQA 2O53A 2GREA 1LCPA 4P4DA 2QYVA 1BAVA 3KQZA 2C6CA 1TF8A 2CTCA 2HC9A 2RB7A 3FEDA 4P10A 3KR4A 2AFOA 3B3SA 3PRTA 3FECA 3BXMA 3MRUA 4NGNA 3ISXA 3IIBA 3PEIA 1TKJA 4YWYA 1R43A 4NGMA 2V77A 3PB6X 3H8FA 5LYDA 5HVGA 4R8FA 4UIAA 2IQ6A 1HDQA 2PJ1A 4ONWA 3K9TA 4NGPA 3B7IA 3S9LA 2J9AA 2EK8A 3RZAA 3NH5A 4CPAA 1LFWA 4ZI6A 3SI2A 4R6TA 1VHOA 4R7MA 3B2YA 4OIDA 2VL1A 3SJEA 2PIZA 3KHZA 4MCPA 4MHNA 3SJXA 1QQ9A 4B6ZA 4JZ0A 2PIYA 2ANPA 4FAIA 4PPZA 5K8MA 3H8GA 3CT9A 3NFZA 1Z5RA 3KASA 4IK2A 3JRUA 4F9UA 3WABA 4P4EA 1CX8A 3DGVA 4UF4A 1ZG7A 4G1PA 1LAMA 4OC2A 2PJ8A 4A39A 2NSMA 2PCUA 4P44A 5LYLA 3GLJA 1PYTB 4PQAA 3FX6A 4GM5A 1XFOA 4TWEA 4P6YA 2F8HA 5JGFA 3SJFA 1F57A 3K2KA 2PJBA 1TKFA 1ZLIA 2V8VA 2C1CA 5LRJA 1M4LA 1IY7A 1YMEA 1XRYA 2C6PA 2XEFA 2PJ4A 5HVHA 2ZEOA 1LAPA 2IMOA 4TNUA 5K8NA 3B3WA 2GLJA 1BPMA 1TF9A 2DEAA 2PJCA 5HVFA 3NA6A 4NGSA 5D8NA 3VARA 3KHXA 1ARMA 1DE4C 4IHMA 2ABZA 2XEJA 2JEWA 3BI0A 3HLPA 3GB0A 1JQGA 3PFEA 4MHZA 2GLFA 2PJ3A 2PJ5A 1OBRA 3LMSA 3BHXA 2ZEHA 3PB7X 3PBBA 5IB9A 4ZYQA 4A94A 4R76A 3IFEA 3V7ZA 2PJ9A 2BOAA 5HXDA 1UWYA 1CPXA 4F8ZA 2EWBA 4BD9A 2BO9A 3FH4A 3LWUA 4A37A 3KI9A 3D67A 4NJRA 3FF3A 2NYQA
chains in the Genus database with same CATH superfamily
4O23A 5A28A 1QMUA 5F47A 2EUIA 1XMBA 5LYFA 4OKOA 3TO9A 4KZTA 4OC3A 1KWMA 1VGYA 1YR0A 2BUEA 2Z11A 2CF4A 4KOVA 4DNCA 4R9MA 1GYTA 2Q51A 4NGQA 4Q7AA 3B8GA 4KSIA 1F2PA 2O28A 3FNCA 4XNHB 4ZBGA 4YFJA 3TT2A 4MCQA 5I4MA 4MFJA 2Z3NA 1NSLA 2Z3PA 4P4BA 5KTCA 1YW4A 3OWCA 3V38A 4HKFA 4NCZA 2QECA 1QSMA 1YW6A 2C6GA 4EMEA 5KTAA 5J8FA 2Q0YA 3DR6A 4M85A 1YSJA 2R1IA 3B35A 1LOKA 2GFQA 5AG7A 4OMEA 4CYQA 5JH9A 1JWQA 3BI1A 4IF5A 3WC6A 4UFXA 2FL4A 4L8AA 5IV0A 4E2AA 5EMIA 4NEXA 4FD7A 1CBXA 3DLJA 4ZX8A 2AFZA 3ZZIA 2VQYA 1YVKA 4H6UA 2AE6A 3PFOA 1M44A 1QSRA 2Z3KA 1FNOA 2XEIA 2ZW5A 3G3SA 4PXEA 1YLEA 2ZEGA 1PCAA 3F8KA 6CPAA 4PXCA 2OZHA 4MFKA 2FT0A 3D7FA 5J1QA 3BLNA 3VATA 4NGTA 3FEEA 2ODFA 4UEEA 3W6XA 4B5OA 2RC4A 1R3NA 2IL4A 3H8EA 4P4FA 1V0CA 4UA3A 3TFYA 3KL9A 2WZNA 4H6ZA 3HUVA 1KZFA 4F0YA 4R3LA 7CPAA 4FWUA 2PJ7A 2ZELA 3FXTA 4F6AA 3EFAA 4ZY1A 2I3CA 2OB0A 4F0XA 3G8WA 4R3KA 5C88A 4PK3A 4AXVA 4CS0B 1B87A 4M3SA 4MY3A 2ZEMA 3E0KA 5K8OA 2CY2A 3PGPA 1S7NA 2FCKA 4KVOE 2JBJA 4ZY0A 2Q4ZA 3DDDA 1N71A 4MY0A 4OP4A 1M4IA 4HNWB 4CYOA 2ZEEA 5C82A 2O4HA 4DYOA 4JXQA 2JDDA 2OH1A 2ZENA 5CPAA 4CGPA 2ZOGA 3TX8A 2ATRA 1TIQA 3SI0A 4OIWA 1Y0RA 2BCOA 1LANA 3GKRA 3EXNA 4CAXA 4LQ6A 5HMNA 1H8LA 1IB1E 4MRIA 2F7VA 2G9DA 3B3CA 1ZO0A 4KSAA 4UFWA 5THWA 4BINA 3KGQA 3GUXA 3KR5A 2ZEFA 2PJ0A 2V8DA 3MN8A 3D7GA 3ZJ0A 2OR4A 1U6MA 3DR8A 4NJQA 1EE3P 5EBVA 3CPAA 4MCSA 4M6GA 4P4JA 1S7KA 2Q7SA 4Y49B 2Q43A 4MFQA 2Q04A 1HDUA 1NE9A 4NJRA 4AVCA 4B5PB 5AG5A 3NE8A 2J8NA 5D29A 4OC5A 2CTBA 3FBUA 4K30A 3S6HA 1KUXA 5CBMA 2PJ6A 4CYNA 4KOXA 2A4NA 1XEBA 1ON0A 2FIAA 2IJZA 1TXRA 2PVWA 3KZWA 4J3GA 4OLLA 4PXDA 4CYPA 4DJLA 4DUKA 3D66A 3IC1A 5F46A 1ARLA 2XEGA 4UFVA 2GE3A 1BPNA 4K3NA 2JBKA 2VBQA 3TC8A 2FIWA 1AYEA 3B3TA 1IGBA 1Q2CA 1QSOA 4CRZB 4PXBA 4ZGYB 2YGWA 8CPAA 3LACA 4UWJA 4OC0A 1I12A 4NGRA 1S5KA 5JQ4A 2ZPAA 1VIXA 2PR1A 3D7HA 3D7DA 5DS0A 2WUUA 1VHSA 1Y9WA 4JLYA 4KOYA 1FY7A 1R57A 1XIXA 1Q7LA 2WYRA 2Y0MA 4KLWA 4JYWA 4MHDA 4P45A 4QUSA 5G21A 2FE7A 3B3VA 1XF8A 2FS5A 2B5GB 4BBHA 4F9VA 1CP7A 1Z8LA 2HQYA 2EK9A 2YNDA 4CGLA 1F2OA 3L2NA 4MHPA 4OC4A 3RBUA 1YX0A 1Y0YA 2PRBA 4HPSA 3TO6A 1Z2LA 4B14A 3IO1A 4XNHC 3I3GA 4MMOA 2AFWA 2OOTA 3KQXA 4C2XA 2DXQA 5G1ZA 2PE3A 1FT7A 5H84A 3WC5A 3TOBA 4CGMA 2AFSA 4C7IA 4PV6A 1HEEA 4OADA 4RS2A 2HUZA 4FBEA 4I49A 2ZEPA 3SHPA 2B4BA 3PBEA 3I1UA 5ELYA 2QJ8A 5K8PA 4LX9A 1B6BA 1SQHA 2Q44A 2I00A 3WC7A 4WJBA 1IICA 1ZG8A 3R9FA 5F09A 4HNXB 5DWNA 5JM6A 2QMLA 3S9MA 3FYNA 4AVBA 1BLLE 2G0BA 1CPSA 2VEZA 3N5FA 3VWDA 3VWEA 3FMCA 4B13A 4CAVA 5BWAB 4ZY2A 1YLOA 4MXUA 1MJ9A 2J8MA 3W6SA 3N7ZA 2PSWA 1PUAA 3H5ZA 2ZW4A 1K4JA 3LODA 4LQGA 2ZEDA 1DTDA 3NE7A 4R87A 4UEFA 3VH9A 4LUAA 4YGOA 2V8GA 3CPXA 4B10A 2G3AA 4RI1A 2Z10A 4UIBA 4ZX9A 4QVTA 4NXYA 2NMTA 1RTQA 2VXKA 2C27A 3IWWA 3TTHA 1XMTA 4XPKA 3DNSA 4RUHA 5JPHA 5LRGA 3D4UA 3T90A 4MFPA 3GY9A 3CXQA 4GS4A 4Z65A 3SJGA 1Q2DA 2PVVA 3NH8A 4XPDB 3BJ8A 2H5MA 3PB9X 3IWEA 5LRKA 4UCMA 1Z4EA 4HNYB 4X2TA 2HB6A 4MFZA 1S60A 2ZW7A 2POKA 1J4JA 3IEHA 2CXAA 1MJAA 3QNVA 2AFMA 4B5PA 2CNSA 4NFRA 4FUUA 4EWTA 5ISVA 1NSAA 2OU2A 1MK4A 4M6HA 2D4OA 2JDCA 1AUGA 4C2ZA 3R9GA 3GYAA 4X5KA 2Q4YA 3BJ7A 3PZJA 2REFA 4KVXA 3S9NA 1YREA 1YK3A 2CNMA 3FIXA 1ZLHA 1Z8XA 1OZPA 2AFXA 2Z0ZA 2PJ2A 2P6FA 2FVGA 1VHEA 2GU2A 2HV2A 3D68A 4YU9A 3SXNA 2RFHA 4W9YA 3PB8X 1QSTA 1S7LA 3FJUA 4L89A 2AFUA 4KSFA 1CG2A 2OZGA 3EY5A 3R1KA 4MHYA 3WT4A 1YGHA 4UEZA 3S6GA 4A2ZA 4CAEA 2I79A 2Q7BA 4H2KA 5KTDA 4Y49C 4A30A 2B58A 4FD5A 4WWVA 4A38A 4CGOA 1XE4A 3IJ3A 5AG6A 2YNEA 3S6FA 1XJOA 4IAVA 4QBJA 3IU2A 2B5GA 3FVLA 3ISZA 1AMPA 4MCRA 1ELMP 5EC4A 2YNCC 1XBUA 2BL1A 5IB0A 2CIJA 2ZOFA 4OC1A 3PB4X 1ELLP 1ZG9A 2PJAA 2PQ8A 4P4IA 4X3RA 4EFDA 2VI7A 1PU9A 4KUAA 4X8IA 1TKHA 3UY5A 1WK4A 2R7HA 3CDXA 1IYKA 1IYLA 3CXSA 4IUSA 3T8WA 4B11A 2QVPA 1Y7EA 3P2HA 3SI1A 3NH4A 1CP6A 5LYIA 2DF5A 1S7FA 2V8HA 3RAMA 3FB3A 2PRQA 2O53A 2B4DB 2GREA 3FRMA 1LCPA 2B3VA 2QIRA 4P4DA 1Z8TA 1NMTA 1M1DA 3QB8A 2QYVA 3W91A 1BAVA 3F0AA 3KQZA 1L0CA 1YVOA 1IIDA 2C6CA 1RO5A 3JTKA 1TF8A 2CTCA 4EVYA 2HC9A 2RB7A 3MGDA 3TE4A 4R57A 2ARHA 2EVNA 2P0WA 4KLVA 3FEDA 4P10A 5E96A 5DWMA 3KR4A 2AFOA 3IU1A 3B3SA 4MFLA 3PRTA 3FECA 5A27A 3BXMA 3MRUA 4NGNA 3ISXA 2OZUA 3IIBA 5CNPA 3KKWA 1TKJA 3PEIA 4YWYA 3TCVA 1R43A 4NGMA 5F49A 4II9A 2V77A 2VZZA 2Z3LA 2ZXVA 2ZW6A 2P6GA 3H8FA 1CJWA 2JEVA 3PB6X 4OAEA 5LYDA 5HVGA 4R8FA 2Z3MA 4UIAA 4AG7A 2IQ6A 1HDQA 2R98A 2PJ1A 4ONUA 4ONWA 4E8OA 4KOSA 2B3UA 1IU8A 3K9TA 4NGPA 1Y7RA 3B7IA 3S9LA 2WPWA 4UCNA 2J9AA 2VZYA 3D2PA 2EK8A 3RZAA 3NH5A 1Q2YA 1VKCA 4CPAA 3RYOA 3R9EA 1LFWA 4ZI6A 1Z4RA 3JUWA 3SI2A 4R6TA 1VHOA 3QAYA 4YRHA 4R7MA 3B2YA 4PSWA 4OIDA 3TOAA 2VL1A 1P4NA 3SJEA 3IGRA 1P0HA 4RN7A 2PIZA 3EC4A 3KHZA 4MCPA 4MHNA 4JJXA 1RXTA 4Q36A 1X10A 3SJXA 4A31A 4E0AA 5IX3A 1QQ9A 3A9LA 4PSXA 4QC6A 4XPDC 4B6ZA 4JZ0A 2PIYA 2ANPA 4FAIA 4PPZA 5K8MA 3CXPA 4AB7A 3H8GA 4MJ8A 3CT9A 4FD4A 3T9YA 4JD6A 3NFZA 5HH1A 4BMHA 2PDOA 3I9SA 5G22A 2G3TA 1Z5RA 3KASA 2EO8A 4IK2A 3JRUA 3LD2A 4ORFA 4F9UA 3WABA 5AG4A 4P4EA 4CRYB 2DPTA 1CX8A 3TO7A 3DGVA 2WPXA 3PP9A 3QAHA 4A95A 4UF4A 1ZG7A 4G1PA 1X12A 1LAMA 3D8PA 2YNCA 4Q38A 5G20A 4CAFA 1A2ZA 4OC2A 2PJ8A 3S6KA 4A39A 2NSMA 3D2MA 2PCUA 3C26A 4C68A 1KUYA 4P44A 5LYLA 3GLJA 3F5BA 1PYTB 4PQAA 4JXRA 3FX6A 4GM5A 1XFOA 4TWEA 3JVNA 3RO0A 1WWZA 2B4DA 4P6YA 2PR8A 2F8HA 1XOVA 2CNTA 5JGFA 1IOFA 2Z3OA 2GANA 4UWIA 1S3ZA 1BO4A 1F57A 4NSQA 3SJFA 4C7HA 1Z9UA 2FXFA 2PJBA 3K2KA 1TKFA 1ZLIA 2V8VA 2GIVA 4MI4A 4KOUA 1GHEA 2C1CA 2P6EA 5AGEA 5LRJA 1I21A 1M4LA 1IY7A 1M4DA 1YMEA 5H86A 3H4QA 1BOBA 2KCWA 4KORA 4A32A 4U9YA 4XPLA 2JLMA 4PK2A 1XRYA 2C6PA 2XEFA 2PJ4A 4FD6A 3CZXA 5HVHA 2ZEOA 3IWGA 3RNZA 1MJBA 1LAPA 2IMOA 2BSWA 4TNUA 5K8NA 3B3WA 3K9UA 2GLJA 1BPMA 2WSAA 3GIUA 3WR7A 1I1DA 2REEA 4U5YA 3EO4A 3P2FA 4AVAA 1TF9A 2BEIA 2DEAA 2PJCA 4GXHA 2X7BA 2DPSA 2R8VA 1M4GA 4UBRA 5HVFA 4AG9A 3NA6A 4NGSA 5GCNA 2FSRA 5D8NA 3VARA 3KHXA 4JWPA 1ARMA 4MBUA 1DE4C 2F5IA 4IHMA 4CGNA 4KUBA 4KOTA 2ABZA 2XEJA 1KUVA 2JEWA 4B12A 4U9ZA 4KOWA 3BI0A 3HLPA 3R96A 1CM0A 2Q4VA 3GB0A 1JQGA 3DSBA 1UFHA 3PFEA 4MHZA 3V8IA 1IOIA 2GLFA 4KVME 4A33A 2PJ3A 2PJ5A 3SXOA 4M6IA 3R95A 5F48A 5J8CA 1QSNA 1OBRA 3LMSA 4QB9A 3BHXA 4CAWA 1LRZA 2ZEHA 4KS9A 3PB7X 2EBJA 3PBBA 5IB9A 1YQEA 4ZYQA 3D3SA 2K5TA 4UCPA 5FVJA 4A94A 4R76A 3IFEA 3V7ZA 2PJ9A 2BOAA 4H89A 2J8RA 1UWYA 4C2YA 5HXDA 2AJ6A 1CPXA 4F8ZA 2EWBA 1Y9KA 4BD9A 2BO9A 3FH4A 3LWUA 4A37A 5I0CA 3KI9A 3D67A 2D4PA 2PC1A 3FF3A 2NYQA 1Z8WA 4NF1A
chains in the Genus database with same CATH topology
4O23A 1QMUA 1XMBA 5LYFA 4OKOA 4OC3A 1KWMA 1VGYA 2CF4A 1GYTA 2Q51A 4NGQA 4Q7AA 4KSIA 1F2PA 5I4MA 4MCQA 4P4BA 1YW4A 3V38A 1YW6A 2C6GA 4EMEA 1YSJA 3B35A 1LOKA 5JH9A 4OMEA 3BI1A 3WC6A 1CBXA 3DLJA 4ZX8A 2AFZA 3PFOA 1FNOA 2XEIA 4PXEA 2ZEGA 1PCAA 6CPAA 4PXCA 3D7FA 5J1QA 3VATA 4NGTA 3FEEA 4UEEA 1R3NA 3H8EA 4P4FA 3KL9A 2WZNA 3HUVA 7CPAA 4FWUA 2PJ7A 2ZELA 4ZY1A 2I3CA 4AXVA 2ZEMA 5K8OA 2JBJA 4ZY0A 2Q4ZA 4OP4A 2ZEEA 2O4HA 4DYOA 2ZENA 5CPAA 2ZOGA 3TX8A 3SI0A 4OIWA 1Y0RA 2BCOA 1LANA 1H8LA 4MRIA 2F7VA 2G9DA 3B3CA 5THWA 3KGQA 3GUXA 3KR5A 2ZEFA 2PJ0A 2V8DA 3MN8A 3D7GA 2OR4A 4NJQA 1EE3P 3CPAA 4MCSA 4P4JA 2Q43A 1HDUA 5D29A 4OC5A 2CTBA 5CBMA 2PJ6A 2PVWA 2IJZA 3KZWA 1TXRA 4PXDA 4DJLA 4DUKA 3D66A 3IC1A 1ARLA 2XEGA 1BPNA 4K3NA 2JBKA 3TC8A 1AYEA 3B3TA 1IGBA 4PXBA 8CPAA 4OC0A 4NGRA 1VIXA 3D7HA 3D7DA 5DS0A 1Q7LA 2WYRA 4JYWA 4P45A 3B3VA 4F9VA 1CP7A 1Z8LA 2EK9A 1F2OA 3L2NA 4MHPA 4OC4A 3RBUA 1Y0YA 1Z2LA 3IO1A 4MMOA 2AFWA 2OOTA 3KQXA 2PE3A 1FT7A 3WC5A 2AFSA 1HEEA 4FBEA 2ZEPA 3PBEA 5ELYA 3I1UA 5K8PA 2QJ8A 3WC7A 4WJBA 5F09A 1ZG8A 5JM6A 3S9MA 1BLLE 1CPSA 3N5FA 3FMCA 4ZY2A 1YLOA 4MXUA 3VH9A 4LQGA 2ZEDA 1DTDA 4UEFA 2V8GA 3CPXA 4UIBA 4ZX9A 1RTQA 3IWWA 4RUHA 5LRGA 3D4UA 4Z65A 3SJGA 2PVVA 3NH8A 5LRKA 3PB9X 4X2TA 2HB6A 2POKA 3IEHA 3QNVA 2AFMA 4NFRA 4FUUA 4EWTA 1NSAA 3S9NA 1ZLHA 2AFXA 2PJ2A 3D68A 2FVGA 1VHEA 2GU2A 4YU9A 2RFHA 4W9YA 3PB8X 3FJUA 2AFUA 3WT4A 1CG2A 4MHYA 4UEZA 4H2KA 4WWVA 4A38A 3IJ3A 1XJOA 4IAVA 4MCRA 3FVLA 3ISZA 1AMPA 1ELMP 1XBUA 2CIJA 2ZOFA 4OC1A 3PB4X 1ELLP 1ZG9A 2PJAA 4P4IA 4EFDA 4X3RA 4X8IA 1TKHA 3CDXA 3T8WA 2QVPA 1Y7EA 3SI1A 3NH4A 1CP6A 5LYIA 2V8HA 3RAMA 2PRQA 2O53A 2GREA 1LCPA 4P4DA 2QYVA 1BAVA 3KQZA 2C6CA 1TF8A 2CTCA 2HC9A 2RB7A 3FEDA 4P10A 3KR4A 2AFOA 3B3SA 3PRTA 3FECA 3BXMA 3MRUA 4NGNA 3ISXA 3IIBA 3PEIA 1TKJA 4YWYA 1R43A 4NGMA 2V77A 3PB6X 3H8FA 5LYDA 5HVGA 4R8FA 4UIAA 2IQ6A 1HDQA 2PJ1A 4ONWA 3K9TA 4NGPA 3B7IA 3S9LA 2J9AA 2EK8A 3RZAA 3NH5A 4CPAA 1LFWA 4ZI6A 3SI2A 4R6TA 1VHOA 4R7MA 3B2YA 4OIDA 2VL1A 3SJEA 2PIZA 3KHZA 4MCPA 4MHNA 3SJXA 1QQ9A 4B6ZA 4JZ0A 2PIYA 2ANPA 4FAIA 4PPZA 5K8MA 3H8GA 3CT9A 3NFZA 1Z5RA 3KASA 4IK2A 3JRUA 4F9UA 3WABA 4P4EA 1CX8A 3DGVA 4UF4A 1ZG7A 4G1PA 1LAMA 4OC2A 2PJ8A 4A39A 2NSMA 2PCUA 4P44A 5LYLA 3GLJA 1PYTB 4PQAA 3FX6A 4GM5A 1XFOA 4TWEA 4P6YA 2F8HA 5JGFA 3SJFA 1F57A 3K2KA 2PJBA 1TKFA 1ZLIA 2V8VA 2C1CA 5LRJA 1M4LA 1IY7A 1YMEA 1XRYA 2C6PA 2XEFA 2PJ4A 5HVHA 2ZEOA 1LAPA 2IMOA 4TNUA 5K8NA 3B3WA 2GLJA 1BPMA 1TF9A 2DEAA 2PJCA 5HVFA 3NA6A 4NGSA 5D8NA 3VARA 3KHXA 1ARMA 1DE4C 4IHMA 2ABZA 2XEJA 2JEWA 3BI0A 3HLPA 3GB0A 1JQGA 3PFEA 4MHZA 2GLFA 2PJ3A 2PJ5A 1OBRA 3LMSA 3BHXA 2ZEHA 3PB7X 3PBBA 5IB9A 4ZYQA 4A94A 4R76A 3IFEA 3V7ZA 2PJ9A 2BOAA 5HXDA 1UWYA 1CPXA 4F8ZA 2EWBA 4BD9A 2BO9A 3FH4A 3LWUA 4A37A 3KI9A 3D67A 4NJRA 3FF3A 2NYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O23 A;  1QMU A;  1XMB A;  5LYF A;  4OKO A;  4OC3 A;  1KWM A;  1VGY A;  2CF4 A;  1GYT A;  2Q51 A;  4NGQ A;  4Q7A A;  4KSI A;  1F2P A;  5I4M A;  4MCQ A;  4P4B A;  1YW4 A;  3V38 A;  1YW6 A;  2C6G A;  4EME A;  1YSJ A;  3B35 A;  1LOK A;  5JH9 A;  4OME A;  3BI1 A;  3WC6 A;  1CBX A;  3DLJ A;  4ZX8 A;  2AFZ A;  3PFO A;  1FNO A;  2XEI A;  4PXE A;  2ZEG A;  1PCA A;  6CPA A;  4PXC A;  3D7F A;  5J1Q A;  3VAT A;  4NGT A;  3FEE A;  4UEE A;  1R3N A;  3H8E A;  4P4F A;  3KL9 A;  2WZN A;  3HUV A;  7CPA A;  4FWU A;  2PJ7 A;  2ZEL A;  4ZY1 A;  2I3C A;  4AXV A;  2ZEM A;  5K8O A;  2JBJ A;  4ZY0 A;  2Q4Z A;  4OP4 A;  2ZEE A;  2O4H A;  4DYO A;  2ZEN A;  5CPA A;  2ZOG A;  3TX8 A;  3SI0 A;  4OIW A;  1Y0R A;  2BCO A;  1LAN A;  1H8L A;  4MRI A;  2F7V A;  2G9D A;  3B3C A;  5THW A;  3KGQ A;  3GUX A;  3KR5 A;  2ZEF A;  2PJ0 A;  2V8D A;  3MN8 A;  3D7G A;  2OR4 A;  4NJQ A;  1EE3 P;  3CPA A;  4MCS A;  4P4J A;  2Q43 A;  1HDU A;  5D29 A;  4OC5 A;  2CTB A;  5CBM A;  2PJ6 A;  2PVW A;  2IJZ A;  3KZW A;  1TXR A;  4PXD A;  4DJL A;  4DUK A;  3D66 A;  3IC1 A;  1ARL A;  2XEG A;  1BPN A;  4K3N A;  2JBK A;  3TC8 A;  1AYE A;  3B3T A;  1IGB A;  4PXB A;  8CPA A;  4OC0 A;  4NGR A;  1VIX A;  3D7H A;  3D7D A;  5DS0 A;  1Q7L A;  2WYR A;  4JYW A;  4P45 A;  3B3V A;  4F9V A;  1CP7 A;  1Z8L A;  2EK9 A;  1F2O A;  3L2N A;  4MHP A;  4OC4 A;  3RBU A;  1Y0Y A;  1Z2L A;  3IO1 A;  4MMO A;  2AFW A;  2OOT A;  3KQX A;  2PE3 A;  1FT7 A;  3WC5 A;  2AFS A;  1HEE A;  4FBE A;  2ZEP A;  3PBE A;  5ELY A;  3I1U A;  5K8P A;  2QJ8 A;  3WC7 A;  4WJB A;  5F09 A;  1ZG8 A;  5JM6 A;  3S9M A;  1BLL E;  1CPS A;  3N5F A;  3FMC A;  4ZY2 A;  1YLO A;  4MXU A;  3VH9 A;  4LQG A;  2ZED A;  1DTD A;  4UEF A;  2V8G A;  3CPX A;  4UIB A;  4ZX9 A;  1RTQ A;  3IWW A;  4RUH A;  5LRG A;  3D4U A;  4Z65 A;  3SJG A;  2PVV A;  3NH8 A;  5LRK A;  3PB9 X;  4X2T A;  2HB6 A;  2POK A;  3IEH A;  3QNV A;  2AFM A;  4NFR A;  4FUU A;  4EWT A;  1NSA A;  3S9N A;  1ZLH A;  2AFX A;  2PJ2 A;  3D68 A;  2FVG A;  1VHE A;  2GU2 A;  4YU9 A;  2RFH A;  4W9Y A;  3PB8 X;  3FJU A;  2AFU A;  3WT4 A;  1CG2 A;  4MHY A;  4UEZ A;  4H2K A;  4WWV A;  4A38 A;  3IJ3 A;  1XJO A;  4IAV A;  4MCR A;  3FVL A;  3ISZ A;  1AMP A;  1ELM P;  1XBU A;  2CIJ A;  2ZOF A;  4OC1 A;  3PB4 X;  1ELL P;  1ZG9 A;  2PJA A;  4P4I A;  4EFD A;  4X3R A;  4X8I A;  1TKH A;  3CDX A;  3T8W A;  2QVP A;  1Y7E A;  3SI1 A;  3NH4 A;  1CP6 A;  5LYI A;  2V8H A;  3RAM A;  2PRQ A;  2O53 A;  2GRE A;  1LCP A;  4P4D A;  2QYV A;  1BAV A;  3KQZ A;  2C6C A;  1TF8 A;  2CTC A;  2HC9 A;  2RB7 A;  3FED A;  4P10 A;  3KR4 A;  2AFO A;  3B3S A;  3PRT A;  3FEC A;  3BXM A;  3MRU A;  4NGN A;  3ISX A;  3IIB A;  3PEI A;  1TKJ A;  4YWY A;  1R43 A;  4NGM A;  2V77 A;  3PB6 X;  3H8F A;  5LYD A;  5HVG A;  4R8F A;  4UIA A;  2IQ6 A;  1HDQ A;  2PJ1 A;  4ONW A;  3K9T A;  4NGP A;  3B7I A;  3S9L A;  2J9A A;  2EK8 A;  3RZA A;  3NH5 A;  4CPA A;  1LFW A;  4ZI6 A;  3SI2 A;  4R6T A;  1VHO A;  4R7M A;  3B2Y A;  4OID A;  2VL1 A;  3SJE A;  2PIZ A;  3KHZ A;  4MCP A;  4MHN A;  3SJX A;  1QQ9 A;  4B6Z A;  4JZ0 A;  2PIY A;  2ANP A;  4FAI A;  4PPZ A;  5K8M A;  3H8G A;  3CT9 A;  3NFZ A;  1Z5R A;  3KAS A;  4IK2 A;  3JRU A;  4F9U A;  3WAB A;  4P4E A;  1CX8 A;  3DGV A;  4UF4 A;  1ZG7 A;  4G1P A;  1LAM A;  4OC2 A;  2PJ8 A;  4A39 A;  2NSM A;  2PCU A;  4P44 A;  5LYL A;  3GLJ A;  1PYT B;  4PQA A;  3FX6 A;  4GM5 A;  1XFO A;  4TWE A;  4P6Y A;  2F8H A;  5JGF A;  3SJF A;  1F57 A;  3K2K A;  2PJB A;  1TKF A;  1ZLI A;  2V8V A;  2C1C A;  5LRJ A;  1M4L A;  1IY7 A;  1YME A;  1XRY A;  2C6P A;  2XEF A;  2PJ4 A;  5HVH A;  2ZEO A;  1LAP A;  2IMO A;  4TNU A;  5K8N A;  3B3W A;  2GLJ A;  1BPM A;  1TF9 A;  2DEA A;  2PJC A;  5HVF A;  3NA6 A;  4NGS A;  5D8N A;  3VAR A;  3KHX A;  1ARM A;  1DE4 C;  4IHM A;  2ABZ A;  2XEJ A;  2JEW A;  3BI0 A;  3HLP A;  3GB0 A;  1JQG A;  3PFE A;  4MHZ A;  2GLF A;  2PJ3 A;  2PJ5 A;  1OBR A;  3LMS A;  3BHX A;  2ZEH A;  3PB7 X;  3PBB A;  5IB9 A;  4ZYQ A;  4A94 A;  4R76 A;  3IFE A;  3V7Z A;  2PJ9 A;  2BOA A;  5HXD A;  1UWY A;  1CPX A;  4F8Z A;  2EWB A;  4BD9 A;  2BO9 A;  3FH4 A;  3LWU A;  4A37 A;  3KI9 A;  3D67 A;  4NJR A;  3FF3 A;  2NYQ A; 
#chains in the Genus database with same CATH topology
 4O23 A;  5A28 A;  1QMU A;  5F47 A;  2EUI A;  1XMB A;  5LYF A;  4OKO A;  3TO9 A;  4KZT A;  4OC3 A;  1KWM A;  1VGY A;  1YR0 A;  2BUE A;  2Z11 A;  2CF4 A;  4KOV A;  4DNC A;  4R9M A;  1GYT A;  2Q51 A;  4NGQ A;  4Q7A A;  3B8G A;  4KSI A;  1F2P A;  2O28 A;  3FNC A;  4XNH B;  4ZBG A;  4YFJ A;  3TT2 A;  4MCQ A;  5I4M A;  4MFJ A;  2Z3N A;  1NSL A;  2Z3P A;  4P4B A;  5KTC A;  1YW4 A;  3OWC A;  3V38 A;  4HKF A;  4NCZ A;  2QEC A;  1QSM A;  1YW6 A;  2C6G A;  4EME A;  5KTA A;  5J8F A;  2Q0Y A;  3DR6 A;  4M85 A;  1YSJ A;  2R1I A;  3B35 A;  1LOK A;  2GFQ A;  5AG7 A;  4OME A;  4CYQ A;  5JH9 A;  1JWQ A;  3BI1 A;  4IF5 A;  3WC6 A;  4UFX A;  2FL4 A;  4L8A A;  5IV0 A;  4E2A A;  5EMI A;  4NEX A;  4FD7 A;  1CBX A;  3DLJ A;  4ZX8 A;  2AFZ A;  3ZZI A;  2VQY A;  1YVK A;  4H6U A;  2AE6 A;  3PFO A;  1M44 A;  1QSR A;  2Z3K A;  1FNO A;  2XEI A;  2ZW5 A;  3G3S A;  4PXE A;  1YLE A;  2ZEG A;  1PCA A;  3F8K A;  6CPA A;  4PXC A;  2OZH A;  4MFK A;  2FT0 A;  3D7F A;  5J1Q A;  3BLN A;  3VAT A;  4NGT A;  3FEE A;  2ODF A;  4UEE A;  3W6X A;  4B5O A;  2RC4 A;  1R3N A;  2IL4 A;  3H8E A;  4P4F A;  1V0C A;  4UA3 A;  3TFY A;  3KL9 A;  2WZN A;  4H6Z A;  3HUV A;  1KZF A;  4F0Y A;  4R3L A;  7CPA A;  4FWU A;  2PJ7 A;  2ZEL A;  3FXT A;  4F6A A;  3EFA A;  4ZY1 A;  2I3C A;  2OB0 A;  4F0X A;  3G8W A;  4R3K A;  5C88 A;  4PK3 A;  4AXV A;  4CS0 B;  1B87 A;  4M3S A;  4MY3 A;  2ZEM A;  3E0K A;  5K8O A;  2CY2 A;  3PGP A;  1S7N A;  2FCK A;  4KVO E;  2JBJ A;  4ZY0 A;  2Q4Z A;  3DDD A;  1N71 A;  4MY0 A;  4OP4 A;  1M4I A;  4HNW B;  4CYO A;  2ZEE A;  5C82 A;  2O4H A;  4DYO A;  4JXQ A;  2JDD A;  2OH1 A;  2ZEN A;  5CPA A;  4CGP A;  2ZOG A;  3TX8 A;  2ATR A;  1TIQ A;  3SI0 A;  4OIW A;  1Y0R A;  2BCO A;  1LAN A;  3GKR A;  3EXN A;  4CAX A;  4LQ6 A;  5HMN A;  1H8L A;  1IB1 E;  4MRI A;  2F7V A;  2G9D A;  3B3C A;  1ZO0 A;  4KSA A;  4UFW A;  5THW A;  4BIN A;  3KGQ A;  3GUX A;  3KR5 A;  2ZEF A;  2PJ0 A;  2V8D A;  3MN8 A;  3D7G A;  3ZJ0 A;  2OR4 A;  1U6M A;  3DR8 A;  4NJQ A;  1EE3 P;  5EBV A;  3CPA A;  4MCS A;  4M6G A;  4P4J A;  1S7K A;  2Q7S A;  4Y49 B;  2Q43 A;  4MFQ A;  2Q04 A;  1HDU A;  1NE9 A;  4NJR A;  4AVC A;  4B5P B;  5AG5 A;  3NE8 A;  2J8N A;  5D29 A;  4OC5 A;  2CTB A;  3FBU A;  4K30 A;  3S6H A;  1KUX A;  5CBM A;  2PJ6 A;  4CYN A;  4KOX A;  2A4N A;  1XEB A;  1ON0 A;  2FIA A;  2IJZ A;  1TXR A;  2PVW A;  3KZW A;  4J3G A;  4OLL A;  4PXD A;  4CYP A;  4DJL A;  4DUK A;  3D66 A;  3IC1 A;  5F46 A;  1ARL A;  2XEG A;  4UFV A;  2GE3 A;  1BPN A;  4K3N A;  2JBK A;  2VBQ A;  3TC8 A;  2FIW A;  1AYE A;  3B3T A;  1IGB A;  1Q2C A;  1QSO A;  4CRZ B;  4PXB A;  4ZGY B;  2YGW A;  8CPA A;  3LAC A;  4UWJ A;  4OC0 A;  1I12 A;  4NGR A;  1S5K A;  5JQ4 A;  2ZPA A;  1VIX A;  2PR1 A;  3D7H A;  3D7D A;  5DS0 A;  2WUU A;  1VHS A;  1Y9W A;  4JLY A;  4KOY A;  1FY7 A;  1R57 A;  1XIX A;  1Q7L A;  2WYR A;  2Y0M A;  4KLW A;  4JYW A;  4MHD A;  4P45 A;  4QUS A;  5G21 A;  2FE7 A;  3B3V A;  1XF8 A;  2FS5 A;  2B5G B;  4BBH A;  4F9V A;  1CP7 A;  1Z8L A;  2HQY A;  2EK9 A;  2YND A;  4CGL A;  1F2O A;  3L2N A;  4MHP A;  4OC4 A;  3RBU A;  1YX0 A;  1Y0Y A;  2PRB A;  4HPS A;  3TO6 A;  1Z2L A;  4B14 A;  3IO1 A;  4XNH C;  3I3G A;  4MMO A;  2AFW A;  2OOT A;  3KQX A;  4C2X A;  2DXQ A;  5G1Z A;  2PE3 A;  1FT7 A;  5H84 A;  3WC5 A;  3TOB A;  4CGM A;  2AFS A;  4C7I A;  4PV6 A;  1HEE A;  4OAD A;  4RS2 A;  2HUZ A;  4FBE A;  4I49 A;  2ZEP A;  3SHP A;  2B4B A;  3PBE A;  3I1U A;  5ELY A;  2QJ8 A;  5K8P A;  4LX9 A;  1B6B A;  1SQH A;  2Q44 A;  2I00 A;  3WC7 A;  4WJB A;  1IIC A;  1ZG8 A;  3R9F A;  5F09 A;  4HNX B;  5DWN A;  5JM6 A;  2QML A;  3S9M A;  3FYN A;  4AVB A;  1BLL E;  2G0B A;  1CPS A;  2VEZ A;  3N5F A;  3VWD A;  3VWE A;  3FMC A;  4B13 A;  4CAV A;  5BWA B;  4ZY2 A;  1YLO A;  4MXU A;  1MJ9 A;  2J8M A;  3W6S A;  3N7Z A;  2PSW A;  1PUA A;  3H5Z A;  2ZW4 A;  1K4J A;  3LOD A;  4LQG A;  2ZED A;  1DTD A;  3NE7 A;  4R87 A;  4UEF A;  3VH9 A;  4LUA A;  4YGO A;  2V8G A;  3CPX A;  4B10 A;  2G3A A;  4RI1 A;  2Z10 A;  4UIB A;  4ZX9 A;  4QVT A;  4NXY A;  2NMT A;  1RTQ A;  2VXK A;  2C27 A;  3IWW A;  3TTH A;  1XMT A;  4XPK A;  3DNS A;  4RUH A;  5JPH A;  5LRG A;  3D4U A;  3T90 A;  4MFP A;  3GY9 A;  3CXQ A;  4GS4 A;  4Z65 A;  3SJG A;  1Q2D A;  2PVV A;  3NH8 A;  4XPD B;  3BJ8 A;  2H5M A;  3PB9 X;  3IWE A;  5LRK A;  4UCM A;  1Z4E A;  4HNY B;  4X2T A;  2HB6 A;  4MFZ A;  1S60 A;  2ZW7 A;  2POK A;  1J4J A;  3IEH A;  2CXA A;  1MJA A;  3QNV A;  2AFM A;  4B5P A;  2CNS A;  4NFR A;  4FUU A;  4EWT A;  5ISV A;  1NSA A;  2OU2 A;  1MK4 A;  4M6H A;  2D4O A;  2JDC A;  1AUG A;  4C2Z A;  3R9G A;  3GYA A;  4X5K A;  2Q4Y A;  3BJ7 A;  3PZJ A;  2REF A;  4KVX A;  3S9N A;  1YRE A;  1YK3 A;  2CNM A;  3FIX A;  1ZLH A;  1Z8X A;  1OZP A;  2AFX A;  2Z0Z A;  2PJ2 A;  2P6F A;  2FVG A;  1VHE A;  2GU2 A;  2HV2 A;  3D68 A;  4YU9 A;  3SXN A;  2RFH A;  4W9Y A;  3PB8 X;  1QST A;  1S7L A;  3FJU A;  4L89 A;  2AFU A;  4KSF A;  1CG2 A;  2OZG A;  3EY5 A;  3R1K A;  4MHY A;  3WT4 A;  1YGH A;  4UEZ A;  3S6G A;  4A2Z A;  4CAE A;  2I79 A;  2Q7B A;  4H2K A;  5KTD A;  4Y49 C;  4A30 A;  2B58 A;  4FD5 A;  4WWV A;  4A38 A;  4CGO A;  1XE4 A;  3IJ3 A;  5AG6 A;  2YNE A;  3S6F A;  1XJO A;  4IAV A;  4QBJ A;  3IU2 A;  2B5G A;  3FVL A;  3ISZ A;  1AMP A;  4MCR A;  1ELM P;  5EC4 A;  2YNC C;  1XBU A;  2BL1 A;  5IB0 A;  2CIJ A;  2ZOF A;  4OC1 A;  3PB4 X;  1ELL P;  1ZG9 A;  2PJA A;  2PQ8 A;  4P4I A;  4X3R A;  4EFD A;  2VI7 A;  1PU9 A;  4KUA A;  4X8I A;  1TKH A;  3UY5 A;  1WK4 A;  2R7H A;  3CDX A;  1IYK A;  1IYL A;  3CXS A;  4IUS A;  3T8W A;  4B11 A;  2QVP A;  1Y7E A;  3P2H A;  3SI1 A;  3NH4 A;  1CP6 A;  5LYI A;  2DF5 A;  1S7F A;  2V8H A;  3RAM A;  3FB3 A;  2PRQ A;  2O53 A;  2B4D B;  2GRE A;  3FRM A;  1LCP A;  2B3V A;  2QIR A;  4P4D A;  1Z8T A;  1NMT A;  1M1D A;  3QB8 A;  2QYV A;  3W91 A;  1BAV A;  3F0A A;  3KQZ A;  1L0C A;  1YVO A;  1IID A;  2C6C A;  1RO5 A;  3JTK A;  1TF8 A;  2CTC A;  4EVY A;  2HC9 A;  2RB7 A;  3MGD A;  3TE4 A;  4R57 A;  2ARH A;  2EVN A;  2P0W A;  4KLV A;  3FED A;  4P10 A;  5E96 A;  5DWM A;  3KR4 A;  2AFO A;  3IU1 A;  3B3S A;  4MFL A;  3PRT A;  3FEC A;  5A27 A;  3BXM A;  3MRU A;  4NGN A;  3ISX A;  2OZU A;  3IIB A;  5CNP A;  3KKW A;  1TKJ A;  3PEI A;  4YWY A;  3TCV A;  1R43 A;  4NGM A;  5F49 A;  4II9 A;  2V77 A;  2VZZ A;  2Z3L A;  2ZXV A;  2ZW6 A;  2P6G A;  3H8F A;  1CJW A;  2JEV A;  3PB6 X;  4OAE A;  5LYD A;  5HVG A;  4R8F A;  2Z3M A;  4UIA A;  4AG7 A;  2IQ6 A;  1HDQ A;  2R98 A;  2PJ1 A;  4ONU A;  4ONW A;  4E8O A;  4KOS A;  2B3U A;  1IU8 A;  3K9T A;  4NGP A;  1Y7R A;  3B7I A;  3S9L A;  2WPW A;  4UCN A;  2J9A A;  2VZY A;  3D2P A;  2EK8 A;  3RZA A;  3NH5 A;  1Q2Y A;  1VKC A;  4CPA A;  3RYO A;  3R9E A;  1LFW A;  4ZI6 A;  1Z4R A;  3JUW A;  3SI2 A;  4R6T A;  1VHO A;  3QAY A;  4YRH A;  4R7M A;  3B2Y A;  4PSW A;  4OID A;  3TOA A;  2VL1 A;  1P4N A;  3SJE A;  3IGR A;  1P0H A;  4RN7 A;  2PIZ A;  3EC4 A;  3KHZ A;  4MCP A;  4MHN A;  4JJX A;  1RXT A;  4Q36 A;  1X10 A;  3SJX A;  4A31 A;  4E0A A;  5IX3 A;  1QQ9 A;  3A9L A;  4PSX A;  4QC6 A;  4XPD C;  4B6Z A;  4JZ0 A;  2PIY A;  2ANP A;  4FAI A;  4PPZ A;  5K8M A;  3CXP A;  4AB7 A;  3H8G A;  4MJ8 A;  3CT9 A;  4FD4 A;  3T9Y A;  4JD6 A;  3NFZ A;  5HH1 A;  4BMH A;  2PDO A;  3I9S A;  5G22 A;  2G3T A;  1Z5R A;  3KAS A;  2EO8 A;  4IK2 A;  3JRU A;  3LD2 A;  4ORF A;  4F9U A;  3WAB A;  5AG4 A;  4P4E A;  4CRY B;  2DPT A;  1CX8 A;  3TO7 A;  3DGV A;  2WPX A;  3PP9 A;  3QAH A;  4A95 A;  4UF4 A;  1ZG7 A;  4G1P A;  1X12 A;  1LAM A;  3D8P A;  2YNC A;  4Q38 A;  5G20 A;  4CAF A;  1A2Z A;  4OC2 A;  2PJ8 A;  3S6K A;  4A39 A;  2NSM A;  3D2M A;  2PCU A;  3C26 A;  4C68 A;  1KUY A;  4P44 A;  5LYL A;  3GLJ A;  3F5B A;  1PYT B;  4PQA A;  4JXR A;  3FX6 A;  4GM5 A;  1XFO A;  4TWE A;  3JVN A;  3RO0 A;  1WWZ A;  2B4D A;  4P6Y A;  2PR8 A;  2F8H A;  1XOV A;  2CNT A;  5JGF A;  1IOF A;  2Z3O A;  2GAN A;  4UWI A;  1S3Z A;  1BO4 A;  1F57 A;  4NSQ A;  3SJF A;  4C7H A;  1Z9U A;  2FXF A;  2PJB A;  3K2K A;  1TKF A;  1ZLI A;  2V8V A;  2GIV A;  4MI4 A;  4KOU A;  1GHE A;  2C1C A;  2P6E A;  5AGE A;  5LRJ A;  1I21 A;  1M4L A;  1IY7 A;  1M4D A;  1YME A;  5H86 A;  3H4Q A;  1BOB A;  2KCW A;  4KOR A;  4A32 A;  4U9Y A;  4XPL A;  2JLM A;  4PK2 A;  1XRY A;  2C6P A;  2XEF A;  2PJ4 A;  4FD6 A;  3CZX A;  5HVH A;  2ZEO A;  3IWG A;  3RNZ A;  1MJB A;  1LAP A;  2IMO A;  2BSW A;  4TNU A;  5K8N A;  3B3W A;  3K9U A;  2GLJ A;  1BPM A;  2WSA A;  3GIU A;  3WR7 A;  1I1D A;  2REE A;  4U5Y A;  3EO4 A;  3P2F A;  4AVA A;  1TF9 A;  2BEI A;  2DEA A;  2PJC A;  4GXH A;  2X7B A;  2DPS A;  2R8V A;  1M4G A;  4UBR A;  5HVF A;  4AG9 A;  3NA6 A;  4NGS A;  5GCN A;  2FSR A;  5D8N A;  3VAR A;  3KHX A;  4JWP A;  1ARM A;  4MBU A;  1DE4 C;  2F5I A;  4IHM A;  4CGN A;  4KUB A;  4KOT A;  2ABZ A;  2XEJ A;  1KUV A;  2JEW A;  4B12 A;  4U9Z A;  4KOW A;  3BI0 A;  3HLP A;  3R96 A;  1CM0 A;  2Q4V A;  3GB0 A;  1JQG A;  3DSB A;  1UFH A;  3PFE A;  4MHZ A;  3V8I A;  1IOI A;  2GLF A;  4KVM E;  4A33 A;  2PJ3 A;  2PJ5 A;  3SXO A;  4M6I A;  3R95 A;  5F48 A;  5J8C A;  1QSN A;  1OBR A;  3LMS A;  4QB9 A;  3BHX A;  4CAW A;  1LRZ A;  2ZEH A;  4KS9 A;  3PB7 X;  2EBJ A;  3PBB A;  5IB9 A;  1YQE A;  4ZYQ A;  3D3S A;  2K5T A;  4UCP A;  5FVJ A;  4A94 A;  4R76 A;  3IFE A;  3V7Z A;  2PJ9 A;  2BOA A;  4H89 A;  2J8R A;  1UWY A;  4C2Y A;  5HXD A;  2AJ6 A;  1CPX A;  4F8Z A;  2EWB A;  1Y9K A;  4BD9 A;  2BO9 A;  3FH4 A;  3LWU A;  4A37 A;  5I0C A;  3KI9 A;  3D67 A;  2D4P A;  2PC1 A;  3FF3 A;  2NYQ A;  1Z8W A;  4NF1 A; 
#chains in the Genus database with same CATH homology
 4O23 A;  1QMU A;  1XMB A;  5LYF A;  4OKO A;  4OC3 A;  1KWM A;  1VGY A;  2CF4 A;  1GYT A;  2Q51 A;  4NGQ A;  4Q7A A;  4KSI A;  1F2P A;  5I4M A;  4MCQ A;  4P4B A;  1YW4 A;  3V38 A;  1YW6 A;  2C6G A;  4EME A;  1YSJ A;  3B35 A;  1LOK A;  5JH9 A;  4OME A;  3BI1 A;  3WC6 A;  1CBX A;  3DLJ A;  4ZX8 A;  2AFZ A;  3PFO A;  1FNO A;  2XEI A;  4PXE A;  2ZEG A;  1PCA A;  6CPA A;  4PXC A;  3D7F A;  5J1Q A;  3VAT A;  4NGT A;  3FEE A;  4UEE A;  1R3N A;  3H8E A;  4P4F A;  3KL9 A;  2WZN A;  3HUV A;  7CPA A;  4FWU A;  2PJ7 A;  2ZEL A;  4ZY1 A;  2I3C A;  4AXV A;  2ZEM A;  5K8O A;  2JBJ A;  4ZY0 A;  2Q4Z A;  4OP4 A;  2ZEE A;  2O4H A;  4DYO A;  2ZEN A;  5CPA A;  2ZOG A;  3TX8 A;  3SI0 A;  4OIW A;  1Y0R A;  2BCO A;  1LAN A;  1H8L A;  4MRI A;  2F7V A;  2G9D A;  3B3C A;  5THW A;  3KGQ A;  3GUX A;  3KR5 A;  2ZEF A;  2PJ0 A;  2V8D A;  3MN8 A;  3D7G A;  2OR4 A;  4NJQ A;  1EE3 P;  3CPA A;  4MCS A;  4P4J A;  2Q43 A;  1HDU A;  5D29 A;  4OC5 A;  2CTB A;  5CBM A;  2PJ6 A;  2PVW A;  2IJZ A;  3KZW A;  1TXR A;  4PXD A;  4DJL A;  4DUK A;  3D66 A;  3IC1 A;  1ARL A;  2XEG A;  1BPN A;  4K3N A;  2JBK A;  3TC8 A;  1AYE A;  3B3T A;  1IGB A;  4PXB A;  8CPA A;  4OC0 A;  4NGR A;  1VIX A;  3D7H A;  3D7D A;  5DS0 A;  1Q7L A;  2WYR A;  4JYW A;  4P45 A;  3B3V A;  4F9V A;  1CP7 A;  1Z8L A;  2EK9 A;  1F2O A;  3L2N A;  4MHP A;  4OC4 A;  3RBU A;  1Y0Y A;  1Z2L A;  3IO1 A;  4MMO A;  2AFW A;  2OOT A;  3KQX A;  2PE3 A;  1FT7 A;  3WC5 A;  2AFS A;  1HEE A;  4FBE A;  2ZEP A;  3PBE A;  5ELY A;  3I1U A;  5K8P A;  2QJ8 A;  3WC7 A;  4WJB A;  5F09 A;  1ZG8 A;  5JM6 A;  3S9M A;  1BLL E;  1CPS A;  3N5F A;  3FMC A;  4ZY2 A;  1YLO A;  4MXU A;  3VH9 A;  4LQG A;  2ZED A;  1DTD A;  4UEF A;  2V8G A;  3CPX A;  4UIB A;  4ZX9 A;  1RTQ A;  3IWW A;  4RUH A;  5LRG A;  3D4U A;  4Z65 A;  3SJG A;  2PVV A;  3NH8 A;  5LRK A;  3PB9 X;  4X2T A;  2HB6 A;  2POK A;  3IEH A;  3QNV A;  2AFM A;  4NFR A;  4FUU A;  4EWT A;  1NSA A;  3S9N A;  1ZLH A;  2AFX A;  2PJ2 A;  3D68 A;  2FVG A;  1VHE A;  2GU2 A;  4YU9 A;  2RFH A;  4W9Y A;  3PB8 X;  3FJU A;  2AFU A;  3WT4 A;  1CG2 A;  4MHY A;  4UEZ A;  4H2K A;  4WWV A;  4A38 A;  3IJ3 A;  1XJO A;  4IAV A;  4MCR A;  3FVL A;  3ISZ A;  1AMP A;  1ELM P;  1XBU A;  2CIJ A;  2ZOF A;  4OC1 A;  3PB4 X;  1ELL P;  1ZG9 A;  2PJA A;  4P4I A;  4EFD A;  4X3R A;  4X8I A;  1TKH A;  3CDX A;  3T8W A;  2QVP A;  1Y7E A;  3SI1 A;  3NH4 A;  1CP6 A;  5LYI A;  2V8H A;  3RAM A;  2PRQ A;  2O53 A;  2GRE A;  1LCP A;  4P4D A;  2QYV A;  1BAV A;  3KQZ A;  2C6C A;  1TF8 A;  2CTC A;  2HC9 A;  2RB7 A;  3FED A;  4P10 A;  3KR4 A;  2AFO A;  3B3S A;  3PRT A;  3FEC A;  3BXM A;  3MRU A;  4NGN A;  3ISX A;  3IIB A;  3PEI A;  1TKJ A;  4YWY A;  1R43 A;  4NGM A;  2V77 A;  3PB6 X;  3H8F A;  5LYD A;  5HVG A;  4R8F A;  4UIA A;  2IQ6 A;  1HDQ A;  2PJ1 A;  4ONW A;  3K9T A;  4NGP A;  3B7I A;  3S9L A;  2J9A A;  2EK8 A;  3RZA A;  3NH5 A;  4CPA A;  1LFW A;  4ZI6 A;  3SI2 A;  4R6T A;  1VHO A;  4R7M A;  3B2Y A;  4OID A;  2VL1 A;  3SJE A;  2PIZ A;  3KHZ A;  4MCP A;  4MHN A;  3SJX A;  1QQ9 A;  4B6Z A;  4JZ0 A;  2PIY A;  2ANP A;  4FAI A;  4PPZ A;  5K8M A;  3H8G A;  3CT9 A;  3NFZ A;  1Z5R A;  3KAS A;  4IK2 A;  3JRU A;  4F9U A;  3WAB A;  4P4E A;  1CX8 A;  3DGV A;  4UF4 A;  1ZG7 A;  4G1P A;  1LAM A;  4OC2 A;  2PJ8 A;  4A39 A;  2NSM A;  2PCU A;  4P44 A;  5LYL A;  3GLJ A;  1PYT B;  4PQA A;  3FX6 A;  4GM5 A;  1XFO A;  4TWE A;  4P6Y A;  2F8H A;  5JGF A;  3SJF A;  1F57 A;  3K2K A;  2PJB A;  1TKF A;  1ZLI A;  2V8V A;  2C1C A;  5LRJ A;  1M4L A;  1IY7 A;  1YME A;  1XRY A;  2C6P A;  2XEF A;  2PJ4 A;  5HVH A;  2ZEO A;  1LAP A;  2IMO A;  4TNU A;  5K8N A;  3B3W A;  2GLJ A;  1BPM A;  1TF9 A;  2DEA A;  2PJC A;  5HVF A;  3NA6 A;  4NGS A;  5D8N A;  3VAR A;  3KHX A;  1ARM A;  1DE4 C;  4IHM A;  2ABZ A;  2XEJ A;  2JEW A;  3BI0 A;  3HLP A;  3GB0 A;  1JQG A;  3PFE A;  4MHZ A;  2GLF A;  2PJ3 A;  2PJ5 A;  1OBR A;  3LMS A;  3BHX A;  2ZEH A;  3PB7 X;  3PBB A;  5IB9 A;  4ZYQ A;  4A94 A;  4R76 A;  3IFE A;  3V7Z A;  2PJ9 A;  2BOA A;  5HXD A;  1UWY A;  1CPX A;  4F8Z A;  2EWB A;  4BD9 A;  2BO9 A;  3FH4 A;  3LWU A;  4A37 A;  3KI9 A;  3D67 A;  4NJR A;  3FF3 A;  2NYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...