2ZEOA

Crystal structure of the human glutaminyl cyclase mutant d305e at 1.66 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQEDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeoA00
1BPMA 5LYDA 2Q51A 2QVPA 4PXDA 1XRYA 4F9UA 1FT7A 2JEWA 4IAVA 1BPNA 2PE3A 3D7FA 4O23A 2XEGA 3IJ3A 3PB4X 2IMOA 2ANPA 3B35A 4NGQA 2VL1A 3MRUA 4MCRA 5HXDA 3KGQA 4P4EA 1TF9A 5THWA 3SJFA 4ZY1A 2PJ1A 4OC1A 4IK2A 2PIZA 3PBBA 2AFSA 3SI1A 4WWVA 2EWBA 2PJ5A 1VGYA 1TXRA 2CTBA 4P4DA 2PJBA 3FH4A 4OKOA 4F8ZA 4A38A 2GLJA 2V8HA 1TF8A 3D68A 3SJGA 3NH8A 4P4FA 2PJ3A 2O53A 3FF3A 4CPAA 3B3WA 3SI2A 2GU2A 3D7GA 1CG2A 2C1CA 3D67A 1Z2LA 2GREA 4P4BA 4P45A 3TX8A 4ZX8A 1AYEA 5CPAA 1XJOA 3WT4A 1ELMP 3FJUA 3GB0A 4OC5A 2JBKA 1M4LA 3PEIA 1Y0YA 4P4IA 1IY7A 1LANA 4TNUA 4KSIA 4B6ZA 4P6YA 2GLFA 1H8LA 4BD9A 2JBJA 3FVLA 2IQ6A 3S9MA 4R8FA 3H8EA 3ISXA 4NGNA 4MMOA 4NJQA 5DS0A 3T8WA 1TKHA 4A94A 1CPSA 5K8MA 4EWTA 1YLOA 3KZWA 4UEFA 2DEAA 4GM5A 4R76A 5HVHA 1HDQA 4OMEA 5LRKA 2C6PA 4NFRA 1KWMA 2AFXA 4A39A 4FAIA 1GYTA 4ZI6A 2ZEGA 5CBMA 3SI0A 3IO1A 5HVGA 1JQGA 3VATA 5F09A 3NFZA 1AMPA 1LCPA 2FVGA 3IWWA 2RB7A 5JM6A 3PFOA 3PB9X 4ZYQA 1LFWA 2ABZA 3QNVA 3IEHA 2ZEOA 5JGFA 1DE4C 2XEJA 3HLPA 2PJ6A 2PJ8A 3K2KA 4PXEA 3IIBA 2EK8A 1Q7LA 4P4JA 3PBEA 3PFEA 3KL9A 4OC0A 3LMSA 2PJ0A 3BI1A 2PRQA 2BCOA 5LRGA 2PJ4A 1ARLA 1ZG9A 3CPAA 4ZY2A 7CPAA 4MCSA 1Y0RA 5D8NA 4NGPA 2AFMA 3B2YA 3KHXA 3SJEA 3VH9A 1ZG8A 1R43A 2RFHA 1LOKA 2ZEHA 3B3SA 1TKFA 1PYTB 4DJLA 1XMBA 3FEEA 3D66A 1TKJA 3FX6A 3B3VA 1Z8LA 2QYVA 3PB8X 4MCPA 4OIWA 2ZELA 2AFOA 4P10A 2V8GA 4PXBA 5JH9A 1F57A 4YWYA 4NGRA 1EE3P 4AXVA 1VHOA 3SJXA 8CPAA 5K8PA 1CP7A 2AFZA 1R3NA 4MCQA 1CBXA 5HVFA 1YW4A 4P44A 1BLLE 2V77A 3D4UA 4R7MA 3JRUA 3KR4A 2WYRA 2NYQA 3H8GA 3KR5A 1HEEA 4ONWA 1XFOA 4MHPA 4LQGA 4UIBA 1YMEA 4FWUA 2ZEEA 3NH4A 3PB6X 4A37A 4W9YA 2AFWA 1F2OA 3KHZA 4X8IA 4RUHA 1BAVA 3D7DA 2Q43A 4JYWA 1ELLP 1HDUA 3D7HA 3S9NA 1LAMA 3BXMA 4MHZA 2CTCA 1FNOA 2PJAA 3MN8A 4MHNA 4MRIA 1F2PA 2BO9A 3WC7A 5J1QA 2OR4A 2C6CA 1VIXA 2PJ9A 2PVWA 4K3NA 3GLJA 3FEDA 2BOAA 2HC9A 3PRTA 3KQZA 2PVVA 4OC2A 3H8FA 2PJ2A 2ZOGA 1QMUA 3BI0A 4NGSA 1Y7EA 3IC1A 3CPXA 1ZG7A 4X3RA 3TC8A 1QQ9A 2NSMA 2ZEPA 4MXUA 3ISZA 1YW6A 1LAPA 1CPXA 4UEZA 5IB9A 4OC4A 4ZX9A 4TWEA 3NA6A 2G9DA 3V38A 2J9AA 2ZEMA 2EK9A 3CT9A 1VHEA 4FUUA 3BHXA 4H2KA 4YU9A 2C6GA 4G1PA 3WC5A 1IGBA 3RZAA 3S9LA 2V8VA 4FBEA 3KASA 2ZENA 3VARA 1UWYA 1CX8A 3I1UA 4R6TA 4ZY0A 2IJZA 3PB7X 5ELYA 2I3CA 4OIDA 1NSAA 4NGTA 4DYOA 3DGVA 1ZLIA 1DTDA 2QJ8A 3B7IA 1OBRA 4UIAA 4X2TA 3NH5A 5K8NA 5LRJA 3KQXA 4PPZA 5LYLA 6CPAA 1ZLHA 4Z65A 2ZEFA 4JZ0A 3CDXA 2Q4ZA 4IHMA 1PCAA 4WJBA 2XEIA 3N5FA 3RBUA 2O4HA 4PQAA 3GUXA 3KI9A 3IFEA 1RTQA 3V7ZA 4UEEA 1Z5RA 2PIYA 4NJRA 5I4MA 5D29A 4EMEA 5LYIA 4EFDA 4F9VA 2V8DA 4DUKA 2PJ7A 1CP6A 4OP4A 3WABA 1YSJA 2ZOFA 2F8HA 2HB6A 2PCUA 4PXCA 3WC6A 4MHYA 2F7VA 3FECA 4OC3A 5K8OA 2ZEDA 4NGMA 3LWUA 3HUVA 4UF4A 1ARMA 2CF4A 3FMCA 3L2NA 5LYFA 2WZNA 2AFUA 3B3CA 2OOTA 2CIJA 3RAMA 3DLJA 4Q7AA 2POKA 3B3TA 2XEFA 3K9TA 1XBUA 2PJCA
chains in the Genus database with same CATH superfamily
5AG5A 1BPMA 2H5MA 2Q51A 5LYDA 2QVPA 4PXDA 1XRYA 3R9GA 1FT7A 4F9UA 2JEWA 3IWEA 2JLMA 4IAVA 4K30A 3T9YA 5IV0A 2HV2A 1BPNA 2PE3A 3D7FA 4R57A 3JUWA 2EVNA 4MFJA 4O23A 1YVKA 4KORA 1SQHA 4R9MA 2R98A 2XEGA 3IJ3A 4RS2A 4II9A 2DF5A 2R7HA 4CGLA 1IYLA 2QECA 3R95A 5EBVA 3PB4X 3TO6A 2IMOA 2ANPA 3B35A 3WR7A 4NGQA 2F5IA 2VL1A 2CNSA 3MRUA 1NSLA 4MCRA 3S6GA 4CGNA 5HXDA 1S60A 3IWGA 2VBQA 3KGQA 1YX0A 4NSQA 4P4EA 3LACA 1TF9A 5THWA 3R96A 4CAFA 3SJFA 4ZY1A 2OZUA 2PJ1A 3NE7A 4OC1A 2VEZA 4IK2A 4U5YA 2PIZA 4KOUA 3PBBA 2AFSA 1QSMA 1YLEA 3VWEA 3SI1A 2QIRA 3B8GA 4HKFA 4WWVA 1M4GA 2EWBA 2PJ5A 1VGYA 3FRMA 1TXRA 2FCKA 2CTBA 4P4DA 2PJBA 3FH4A 4OKOA 4F8ZA 4A38A 2GLJA 5CNPA 2GFQA 2WPXA 1Q2YA 4AG7A 2V8HA 1TF8A 3D68A 3S6FA 4CYPA 4AVCA 2BUEA 2P6EA 3SJGA 2B4DA 3K9UA 3NH8A 4P4FA 4CAXA 2PJ3A 3IU2A 4E0AA 2O53A 3FF3A 4CPAA 2B3VA 3B3WA 2PSWA 3SI2A 2GU2A 1KZFA 4PSWA 1QSTA 3D7GA 1CG2A 3IGRA 2C1CA 4KLVA 3D67A 3S6HA 1K4JA 1Z2LA 1XEBA 2GREA 4MFLA 4OAEA 4M85A 2J8NA 4P4BA 4P45A 3TX8A 4CYQA 4ZX8A 1S5KA 1AYEA 1QSOA 1XE4A 4L8AA 5CPAA 4C68A 1XMTA 2EUIA 1XJOA 3WT4A 1ELMP 3FJUA 3GB0A 4OC5A 2JBKA 4PSXA 4QVTA 2C27A 2P6FA 1M4LA 2DPSA 2Z3PA 3LD2A 4CAVA 3PEIA 1Y0YA 3G8WA 4UWJA 2FE7A 4P4IA 1IY7A 3EY5A 4GXHA 1LANA 5HH1A 4TNUA 3TE4A 2REEA 4KSIA 4B6ZA 4P6YA 2GLFA 1H8LA 4BD9A 2ZW7A 3DNSA 1Q2DA 2Z10A 2ZPAA 4XPDB 4Q36A 2JBJA 3FVLA 2IQ6A 4C7IA 3S9MA 1YVOA 4B11A 4R8FA 3H8EA 3ISXA 4NGNA 3TOBA 4MMOA 4CYNA 4KOTA 4MFQA 4NJQA 5DS0A 2PR8A 4M3SA 4KZTA 3DSBA 1TKHA 3T8WA 1CPSA 4A94A 5K8MA 5EMIA 3W6SA 2X7BA 2HUZA 4EWTA 1A2ZA 1YQEA 5I0CA 1YLOA 2B4DB 3KZWA 4UEFA 4A2ZA 4BINA 4CAWA 2DEAA 4GM5A 4JXRA 4LQ6A 4R76A 1M4IA 3FNCA 3BJ7A 5HVHA 3TT2A 2EBJA 1HDQA 1V0CA 1QSRA 4KOXA 1XOVA 2WUUA 2J8RA 4OMEA 5LRKA 3QAHA 2VZZA 4A30A 2OU2A 2FIWA 3TTHA 2C6PA 3KKWA 4NFRA 3CZXA 4AVBA 1KWMA 2AFXA 4A39A 4YGOA 4CGMA 4FAIA 1GYTA 4AG9A 4ZI6A 4KOSA 2ZEGA 4YFJA 5CBMA 2FT0A 4FD4A 3PGPA 3IO1A 4UBRA 3SI0A 2R1IA 4B13A 1MJBA 5HVGA 4OADA 1JQGA 1VHSA 1Y9WA 3VATA 5F09A 5E96A 1Z8TA 3R9EA 3NFZA 1AMPA 1LCPA 2FVGA 3IWWA 2RB7A 3PP9A 5JM6A 2FS5A 3PFOA 5KTCA 4NXYA 3EC4A 2JDDA 3EXNA 1YREA 2QMLA 2CNTA 3PB9X 4ZYQA 1LFWA 2ABZA 5DWMA 2BEIA 3QNVA 4QUSA 3IEHA 5BWAB 1I21A 3E0KA 4UWIA 1M1DA 2ZEOA 4HPSA 1P4NA 1RXTA 3F5BA 5JGFA 1DE4C 2ARHA 2XEJA 3HLPA 2PJ6A 5G22A 3ZJ0A 4CRYB 4FD6A 2JEVA 5AG7A 4B5OA 2ATRA 4L89A 4ZBGA 5FVJA 2PJ8A 3K2KA 5G1ZA 3FBUA 4PXEA 4PV6A 2YNCC 3IIBA 3W6XA 2A4NA 2G3AA 1QSNA 2EK8A 1Q7LA 4P4JA 3PBEA 4LX9A 3F8KA 5C88A 4B12A 3DDDA 3KL9A 3PFEA 4JWPA 3H4QA 3LMSA 1Z8WA 2PJ0A 3BI1A 4OC0A 3VWDA 4C2ZA 2PRQA 2BCOA 2B5GA 3F0AA 5LRGA 1B87A 4Y49B 2PJ4A 4R3KA 1ARLA 1ZG9A 3CPAA 1P0HA 1NE9A 2B3UA 2Z3OA 4XNHB 4MI4A 4ZY2A 7CPAA 4UFWA 1JWQA 1Y0RA 4MCSA 5D8NA 4CYOA 4NGPA 1LRZA 2AFMA 1S7FA 4AVAA 3B2YA 3KHXA 3SJEA 3VH9A 1S7NA 4JXQA 1ZG8A 1R43A 2CY2A 2GANA 2RFHA 1LOKA 2ZEHA 3FXTA 4I49A 3IU1A 3B3SA 2ZW4A 4A95A 1TKFA 1PYTB 4DJLA 1XMBA 3FEEA 4U9YA 3D66A 1TKJA 5F46A 1MK4A 3FX6A 3B3VA 1Z8LA 5F49A 2QYVA 4F0YA 2G3TA 4NCZA 2NMTA 1S7LA 3PB8X 1I12A 2YNEA 4MCPA 4OIWA 2VQYA 2ZELA 2AFOA 4IF5A 1Z4RA 2AJ6A 3TO9A 1B6BA 1S3ZA 2CNMA 3FIXA 4P10A 4HNYB 3MGDA 2PC1A 1X10A 4XPDC 2V8GA 4PXBA 5JH9A 3DR6A 1F57A 2Q7SA 1YR0A 4YWYA 2WSAA 5IX3A 4NGRA 1EE3P 4AXVA 1YGHA 1VHOA 4KUAA 4KVOE 4A31A 3SJXA 3SXOA 4KLWA 2B5GB 2ZXVA 8CPAA 1Y7RA 5K8PA 1CP7A 2AFZA 5G20A 3JTKA 1R3NA 4KS9A 4UFXA 4R3LA 2ZW5A 1CBXA 4MCQA 5H84A 4PK3A 5HVFA 3R1KA 1YW4A 4P44A 3QAYA 1BLLE 3EFAA 2V77A 3D4UA 1UFHA 4ORFA 5A28A 4MY3A 4R7MA 4CGPA 4LUAA 3JRUA 3KR4A 2WYRA 2NYQA 3H8GA 3EO4A 4JD6A 2R8VA 3C26A 3KR5A 1HEEA 5A27A 2J8MA 3W91A 5KTDA 4ONWA 1XFOA 4MHPA 1KUXA 2Q04A 2PDOA 4KUBA 2Q0YA 1YMEA 4LQGA 4UIBA 4FWUA 2ZEEA 2ODFA 3NH4A 3H5ZA 3PB6X 4C2XA 1VKCA 2I79A 4A37A 4W9YA 2AFWA 1F2OA 3KHZA 3TO7A 3CXPA 4M6HA 4X8IA 5AG6A 1M44A 4RI1A 4RUHA 1BAVA 2JDCA 4B5PA 3D7DA 2Q43A 5HMNA 3D2MA 2PR1A 3BJ8A 1AUGA 1TIQA 3RNZA 1CM0A 4JYWA 4R87A 4AB7A 1ELLP 4HNWB 2Z3NA 2AE6A 1HDUA 2BL1A 3UY5A 4BMHA 3D7HA 3S9NA 1LAMA 4Q38A 3BXMA 1X12A 4MHZA 2DPTA 2CTCA 2REFA 1FNOA 2PJAA 3MN8A 4MHNA 4MRIA 1F2PA 2BO9A 3WC7A 2Z3LA 5J1QA 3GY9A 1L0CA 3P2HA 2OR4A 1Q2CA 2C6CA 4QB9A 1VIXA 4U9ZA 2PJ9A 2PVWA 4K3NA 4JJXA 3GLJA 5C82A 2G0BA 3QB8A 2Z3MA 3S6KA 1WWZA 3FEDA 2BOAA 2HC9A 3PRTA 1PU9A 4MBUA 4F6AA 3KQZA 4YRHA 4PK2A 2PVVA 3FYNA 4OC2A 3A9LA 3BLNA 2Z3KA 4GS4A 2K5TA 3H8FA 2KCWA 1PUAA 2PJ2A 2ZOGA 5DWNA 1QMUA 3BI0A 4NGSA 1Y7EA 4UCPA 4Y49C 5AG4A 3IC1A 3CPXA 2IL4A 1ZG7A 4X3RA 3TC8A 4XNHC 2Z11A 1QQ9A 2NSMA 4E2AA 4IUSA 2ZEPA 3TOAA 4MXUA 4QBJA 5EC4A 4B5PB 3ISZA 1YW6A 1LAPA 1CPXA 4ONUA 3LODA 4UEZA 5IB9A 4KOWA 4OC4A 3SHPA 2ZW6A 4A32A 1OZPA 4ZX9A 4TWEA 2Q4VA 3NA6A 2G9DA 4C2YA 1N71A 1Z8XA 3V38A 4CAEA 4ZGYB 4H6ZA 3FB3A 3SXNA 2OZHA 1IOFA 2OZGA 2J9AA 1IU8A 2B4BA 4E8OA 5IB0A 2ZEMA 2EK9A 3CT9A 2P0WA 1VHEA 4FUUA 2FSRA 3BHXA 1S7KA 4H2KA 4YU9A 2C6GA 1R57A 3RO0A 4G1PA 4KVME 4H6UA 3WC5A 1IGBA 3RZAA 3S9LA 5G21A 5KTAA 2O28A 2V8VA 3D3SA 4QC6A 4XPKA 4FBEA 3KASA 5F47A 2ZENA 3VARA 1U6MA 1I1DA 2Q44A 2Y0MA 1UWYA 1CX8A 3I1UA 3GKRA 4NF1A 4R6TA 1KUYA 1ON0A 4ZY0A 2FL4A 1BO4A 2PRBA 2VI7A 2IJZA 4KSFA 4CRZB 4FD7A 3PB7X 5ELYA 4M6IA 3R9FA 4X5KA 2I3CA 2I00A 4OIDA 4UCNA 3D2PA 4J3GA 1FY7A 3DR8A 2VZYA 1NSAA 4NGTA 4DYOA 4KSAA 4MY0A 3DGVA 1XF8A 4FD5A 1WK4A 1ZLIA 1DTDA 2QJ8A 3B7IA 1OBRA 1M4DA 4UIAA 1KUVA 4X2TA 4UCMA 3NH5A 5K8NA 3P2FA 5LRJA 3KQXA 5J8FA 2Z0ZA 4PPZA 3GYAA 5LYLA 6CPAA 1ZLHA 2HQYA 4Z65A 1J4JA 4DNCA 2ZEFA 3D8PA 4JZ0A 1GHEA 4MFZA 5H86A 3RYOA 5J8CA 3CDXA 1MJAA 2Q4ZA 5F48A 3NE8A 4B10A 4CGOA 3GIUA 4IHMA 1PCAA 2B58A 4WJBA 2XEIA 2CXAA 4KVXA 2FIAA 3N5FA 1Y9KA 3RBUA 2O4HA 1Z9UA 4PQAA 4MFPA 4A33A 2OB0A 5ISVA 2D4OA 5JQ4A 5JPHA 1NMTA 3GUXA 3KI9A 3IFEA 3CXSA 2DXQA 4JLYA 4RN7A 1RTQA 3V7ZA 4M6GA 4UEEA 1Z5RA 1MJ9A 2PIYA 1IOIA 3JVNA 1IB1E 4C7HA 4MJ8A 4NJRA 1IICA 1IIDA 1YK3A 3OWCA 5D29A 4EVYA 5I4MA 4EMEA 3I3GA 2BSWA 5LYIA 4EFDA 4H89A 4F9VA 3N7ZA 2Q7BA 1IYKA 2YNDA 2GE3A 2V8DA 4UFVA 4DUKA 2PJ7A 2Q4YA 4HNXB 1XIXA 1Z4EA 2PQ8A 2VXKA 4CS0B 1CP6A 3V8IA 4B14A 2EO8A 4OP4A 3WABA 3CXQA 1CJWA 1YSJA 1BOBA 2OH1A 2YGWA 2D4PA 2ZOFA 2F8HA 2HB6A 2PCUA 4PXCA 3TCVA 4MHDA 4MHYA 3WC6A 5GCNA 2F7VA 3FECA 4OC3A 5K8OA 2ZEDA 4OLLA 4NGMA 3LWUA 3HUVA 4KOVA 4NEXA 4UF4A 1ARMA 2WPWA 2CF4A 3FMCA 3L2NA 5LYFA 2WZNA 4XPLA 3TFYA 3PZJA 1ZO0A 3T90A 2AFUA 3B3CA 5AGEA 2OOTA 3I9SA 2CIJA 3RAMA 2P6GA 3DLJA 2YNCA 4Q7AA 2FXFA 2POKA 4MFKA 4UA3A 4F0XA 2RC4A 2GIVA 3G3SA 3B3TA 2XEFA 3ZZIA 1RO5A 3K9TA 1XBUA 4BBHA 4KOYA 2PJCA
chains in the Genus database with same CATH topology
1BPMA 5LYDA 2Q51A 2QVPA 4PXDA 1XRYA 4F9UA 1FT7A 2JEWA 4IAVA 1BPNA 2PE3A 3D7FA 4O23A 2XEGA 3IJ3A 3PB4X 2IMOA 2ANPA 3B35A 4NGQA 2VL1A 3MRUA 4MCRA 5HXDA 3KGQA 4P4EA 1TF9A 5THWA 3SJFA 4ZY1A 2PJ1A 4OC1A 4IK2A 2PIZA 3PBBA 2AFSA 3SI1A 4WWVA 2EWBA 2PJ5A 1VGYA 1TXRA 2CTBA 4P4DA 2PJBA 3FH4A 4OKOA 4F8ZA 4A38A 2GLJA 2V8HA 1TF8A 3D68A 3SJGA 3NH8A 4P4FA 2PJ3A 2O53A 3FF3A 4CPAA 3B3WA 3SI2A 2GU2A 3D7GA 1CG2A 2C1CA 3D67A 1Z2LA 2GREA 4P4BA 4P45A 3TX8A 4ZX8A 1AYEA 5CPAA 1XJOA 3WT4A 1ELMP 3FJUA 3GB0A 4OC5A 2JBKA 1M4LA 3PEIA 1Y0YA 4P4IA 1IY7A 1LANA 4TNUA 4KSIA 4B6ZA 4P6YA 2GLFA 1H8LA 4BD9A 2JBJA 3FVLA 2IQ6A 3S9MA 4R8FA 3H8EA 3ISXA 4NGNA 4MMOA 4NJQA 5DS0A 3T8WA 1TKHA 4A94A 1CPSA 5K8MA 4EWTA 1YLOA 3KZWA 4UEFA 2DEAA 4GM5A 4R76A 5HVHA 1HDQA 4OMEA 5LRKA 2C6PA 4NFRA 1KWMA 2AFXA 4A39A 4FAIA 1GYTA 4ZI6A 2ZEGA 5CBMA 3SI0A 3IO1A 5HVGA 1JQGA 3VATA 5F09A 3NFZA 1AMPA 1LCPA 2FVGA 3IWWA 2RB7A 5JM6A 3PFOA 3PB9X 4ZYQA 1LFWA 2ABZA 3QNVA 3IEHA 2ZEOA 5JGFA 1DE4C 2XEJA 3HLPA 2PJ6A 2PJ8A 3K2KA 4PXEA 3IIBA 2EK8A 1Q7LA 4P4JA 3PBEA 3PFEA 3KL9A 4OC0A 3LMSA 2PJ0A 3BI1A 2PRQA 2BCOA 5LRGA 2PJ4A 1ARLA 1ZG9A 3CPAA 4ZY2A 7CPAA 4MCSA 1Y0RA 5D8NA 4NGPA 2AFMA 3B2YA 3KHXA 3SJEA 3VH9A 1ZG8A 1R43A 2RFHA 1LOKA 2ZEHA 3B3SA 1TKFA 1PYTB 4DJLA 1XMBA 3FEEA 3D66A 1TKJA 3FX6A 3B3VA 1Z8LA 2QYVA 3PB8X 4MCPA 4OIWA 2ZELA 2AFOA 4P10A 2V8GA 4PXBA 5JH9A 1F57A 4YWYA 4NGRA 1EE3P 4AXVA 1VHOA 3SJXA 8CPAA 5K8PA 1CP7A 2AFZA 1R3NA 4MCQA 1CBXA 5HVFA 1YW4A 4P44A 1BLLE 2V77A 3D4UA 4R7MA 3JRUA 3KR4A 2WYRA 2NYQA 3H8GA 3KR5A 1HEEA 4ONWA 1XFOA 4MHPA 4LQGA 4UIBA 1YMEA 4FWUA 2ZEEA 3NH4A 3PB6X 4A37A 4W9YA 2AFWA 1F2OA 3KHZA 4X8IA 4RUHA 1BAVA 3D7DA 2Q43A 4JYWA 1ELLP 1HDUA 3D7HA 3S9NA 1LAMA 3BXMA 4MHZA 2CTCA 1FNOA 2PJAA 3MN8A 4MHNA 4MRIA 1F2PA 2BO9A 3WC7A 5J1QA 2OR4A 2C6CA 1VIXA 2PJ9A 2PVWA 4K3NA 3GLJA 3FEDA 2BOAA 2HC9A 3PRTA 3KQZA 2PVVA 4OC2A 3H8FA 2PJ2A 2ZOGA 1QMUA 3BI0A 4NGSA 1Y7EA 3IC1A 3CPXA 1ZG7A 4X3RA 3TC8A 1QQ9A 2NSMA 2ZEPA 4MXUA 3ISZA 1YW6A 1LAPA 1CPXA 4UEZA 5IB9A 4OC4A 4ZX9A 4TWEA 3NA6A 2G9DA 3V38A 2J9AA 2ZEMA 2EK9A 3CT9A 1VHEA 4FUUA 3BHXA 4H2KA 4YU9A 2C6GA 4G1PA 3WC5A 1IGBA 3RZAA 3S9LA 2V8VA 4FBEA 3KASA 2ZENA 3VARA 1UWYA 1CX8A 3I1UA 4R6TA 4ZY0A 2IJZA 3PB7X 5ELYA 2I3CA 4OIDA 1NSAA 4NGTA 4DYOA 3DGVA 1ZLIA 1DTDA 2QJ8A 3B7IA 1OBRA 4UIAA 4X2TA 3NH5A 5K8NA 5LRJA 3KQXA 4PPZA 5LYLA 6CPAA 1ZLHA 4Z65A 2ZEFA 4JZ0A 3CDXA 2Q4ZA 4IHMA 1PCAA 4WJBA 2XEIA 3N5FA 3RBUA 2O4HA 4PQAA 3GUXA 3KI9A 3IFEA 1RTQA 3V7ZA 4UEEA 1Z5RA 2PIYA 4NJRA 5I4MA 5D29A 4EMEA 5LYIA 4EFDA 4F9VA 2V8DA 4DUKA 2PJ7A 1CP6A 4OP4A 3WABA 1YSJA 2ZOFA 2F8HA 2HB6A 2PCUA 4PXCA 3WC6A 4MHYA 2F7VA 3FECA 4OC3A 5K8OA 2ZEDA 4NGMA 3LWUA 3HUVA 4UF4A 1ARMA 2CF4A 3FMCA 3L2NA 5LYFA 2WZNA 2AFUA 3B3CA 2OOTA 2CIJA 3RAMA 3DLJA 4Q7AA 2POKA 3B3TA 2XEFA 3K9TA 1XBUA 2PJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPM A;  5LYD A;  2Q51 A;  2QVP A;  4PXD A;  1XRY A;  4F9U A;  1FT7 A;  2JEW A;  4IAV A;  1BPN A;  2PE3 A;  3D7F A;  4O23 A;  2XEG A;  3IJ3 A;  3PB4 X;  2IMO A;  2ANP A;  3B35 A;  4NGQ A;  2VL1 A;  3MRU A;  4MCR A;  5HXD A;  3KGQ A;  4P4E A;  1TF9 A;  5THW A;  3SJF A;  4ZY1 A;  2PJ1 A;  4OC1 A;  4IK2 A;  2PIZ A;  3PBB A;  2AFS A;  3SI1 A;  4WWV A;  2EWB A;  2PJ5 A;  1VGY A;  1TXR A;  2CTB A;  4P4D A;  2PJB A;  3FH4 A;  4OKO A;  4F8Z A;  4A38 A;  2GLJ A;  2V8H A;  1TF8 A;  3D68 A;  3SJG A;  3NH8 A;  4P4F A;  2PJ3 A;  2O53 A;  3FF3 A;  4CPA A;  3B3W A;  3SI2 A;  2GU2 A;  3D7G A;  1CG2 A;  2C1C A;  3D67 A;  1Z2L A;  2GRE A;  4P4B A;  4P45 A;  3TX8 A;  4ZX8 A;  1AYE A;  5CPA A;  1XJO A;  3WT4 A;  1ELM P;  3FJU A;  3GB0 A;  4OC5 A;  2JBK A;  1M4L A;  3PEI A;  1Y0Y A;  4P4I A;  1IY7 A;  1LAN A;  4TNU A;  4KSI A;  4B6Z A;  4P6Y A;  2GLF A;  1H8L A;  4BD9 A;  2JBJ A;  3FVL A;  2IQ6 A;  3S9M A;  4R8F A;  3H8E A;  3ISX A;  4NGN A;  4MMO A;  4NJQ A;  5DS0 A;  3T8W A;  1TKH A;  4A94 A;  1CPS A;  5K8M A;  4EWT A;  1YLO A;  3KZW A;  4UEF A;  2DEA A;  4GM5 A;  4R76 A;  5HVH A;  1HDQ A;  4OME A;  5LRK A;  2C6P A;  4NFR A;  1KWM A;  2AFX A;  4A39 A;  4FAI A;  1GYT A;  4ZI6 A;  2ZEG A;  5CBM A;  3SI0 A;  3IO1 A;  5HVG A;  1JQG A;  3VAT A;  5F09 A;  3NFZ A;  1AMP A;  1LCP A;  2FVG A;  3IWW A;  2RB7 A;  5JM6 A;  3PFO A;  3PB9 X;  4ZYQ A;  1LFW A;  2ABZ A;  3QNV A;  3IEH A;  2ZEO A;  5JGF A;  1DE4 C;  2XEJ A;  3HLP A;  2PJ6 A;  2PJ8 A;  3K2K A;  4PXE A;  3IIB A;  2EK8 A;  1Q7L A;  4P4J A;  3PBE A;  3PFE A;  3KL9 A;  4OC0 A;  3LMS A;  2PJ0 A;  3BI1 A;  2PRQ A;  2BCO A;  5LRG A;  2PJ4 A;  1ARL A;  1ZG9 A;  3CPA A;  4ZY2 A;  7CPA A;  4MCS A;  1Y0R A;  5D8N A;  4NGP A;  2AFM A;  3B2Y A;  3KHX A;  3SJE A;  3VH9 A;  1ZG8 A;  1R43 A;  2RFH A;  1LOK A;  2ZEH A;  3B3S A;  1TKF A;  1PYT B;  4DJL A;  1XMB A;  3FEE A;  3D66 A;  1TKJ A;  3FX6 A;  3B3V A;  1Z8L A;  2QYV A;  3PB8 X;  4MCP A;  4OIW A;  2ZEL A;  2AFO A;  4P10 A;  2V8G A;  4PXB A;  5JH9 A;  1F57 A;  4YWY A;  4NGR A;  1EE3 P;  4AXV A;  1VHO A;  3SJX A;  8CPA A;  5K8P A;  1CP7 A;  2AFZ A;  1R3N A;  4MCQ A;  1CBX A;  5HVF A;  1YW4 A;  4P44 A;  1BLL E;  2V77 A;  3D4U A;  4R7M A;  3JRU A;  3KR4 A;  2WYR A;  2NYQ A;  3H8G A;  3KR5 A;  1HEE A;  4ONW A;  1XFO A;  4MHP A;  4LQG A;  4UIB A;  1YME A;  4FWU A;  2ZEE A;  3NH4 A;  3PB6 X;  4A37 A;  4W9Y A;  2AFW A;  1F2O A;  3KHZ A;  4X8I A;  4RUH A;  1BAV A;  3D7D A;  2Q43 A;  4JYW A;  1ELL P;  1HDU A;  3D7H A;  3S9N A;  1LAM A;  3BXM A;  4MHZ A;  2CTC A;  1FNO A;  2PJA A;  3MN8 A;  4MHN A;  4MRI A;  1F2P A;  2BO9 A;  3WC7 A;  5J1Q A;  2OR4 A;  2C6C A;  1VIX A;  2PJ9 A;  2PVW A;  4K3N A;  3GLJ A;  3FED A;  2BOA A;  2HC9 A;  3PRT A;  3KQZ A;  2PVV A;  4OC2 A;  3H8F A;  2PJ2 A;  2ZOG A;  1QMU A;  3BI0 A;  4NGS A;  1Y7E A;  3IC1 A;  3CPX A;  1ZG7 A;  4X3R A;  3TC8 A;  1QQ9 A;  2NSM A;  2ZEP A;  4MXU A;  3ISZ A;  1YW6 A;  1LAP A;  1CPX A;  4UEZ A;  5IB9 A;  4OC4 A;  4ZX9 A;  4TWE A;  3NA6 A;  2G9D A;  3V38 A;  2J9A A;  2ZEM A;  2EK9 A;  3CT9 A;  1VHE A;  4FUU A;  3BHX A;  4H2K A;  4YU9 A;  2C6G A;  4G1P A;  3WC5 A;  1IGB A;  3RZA A;  3S9L A;  2V8V A;  4FBE A;  3KAS A;  2ZEN A;  3VAR A;  1UWY A;  1CX8 A;  3I1U A;  4R6T A;  4ZY0 A;  2IJZ A;  3PB7 X;  5ELY A;  2I3C A;  4OID A;  1NSA A;  4NGT A;  4DYO A;  3DGV A;  1ZLI A;  1DTD A;  2QJ8 A;  3B7I A;  1OBR A;  4UIA A;  4X2T A;  3NH5 A;  5K8N A;  5LRJ A;  3KQX A;  4PPZ A;  5LYL A;  6CPA A;  1ZLH A;  4Z65 A;  2ZEF A;  4JZ0 A;  3CDX A;  2Q4Z A;  4IHM A;  1PCA A;  4WJB A;  2XEI A;  3N5F A;  3RBU A;  2O4H A;  4PQA A;  3GUX A;  3KI9 A;  3IFE A;  1RTQ A;  3V7Z A;  4UEE A;  1Z5R A;  2PIY A;  4NJR A;  5I4M A;  5D29 A;  4EME A;  5LYI A;  4EFD A;  4F9V A;  2V8D A;  4DUK A;  2PJ7 A;  1CP6 A;  4OP4 A;  3WAB A;  1YSJ A;  2ZOF A;  2F8H A;  2HB6 A;  2PCU A;  4PXC A;  3WC6 A;  4MHY A;  2F7V A;  3FEC A;  4OC3 A;  5K8O A;  2ZED A;  4NGM A;  3LWU A;  3HUV A;  4UF4 A;  1ARM A;  2CF4 A;  3FMC A;  3L2N A;  5LYF A;  2WZN A;  2AFU A;  3B3C A;  2OOT A;  2CIJ A;  3RAM A;  3DLJ A;  4Q7A A;  2POK A;  3B3T A;  2XEF A;  3K9T A;  1XBU A;  2PJC A; 
#chains in the Genus database with same CATH topology
 5AG5 A;  1BPM A;  2H5M A;  2Q51 A;  5LYD A;  2QVP A;  4PXD A;  1XRY A;  3R9G A;  1FT7 A;  4F9U A;  2JEW A;  3IWE A;  2JLM A;  4IAV A;  4K30 A;  3T9Y A;  5IV0 A;  2HV2 A;  1BPN A;  2PE3 A;  3D7F A;  4R57 A;  3JUW A;  2EVN A;  4MFJ A;  4O23 A;  1YVK A;  4KOR A;  1SQH A;  4R9M A;  2R98 A;  2XEG A;  3IJ3 A;  4RS2 A;  4II9 A;  2DF5 A;  2R7H A;  4CGL A;  1IYL A;  2QEC A;  3R95 A;  5EBV A;  3PB4 X;  3TO6 A;  2IMO A;  2ANP A;  3B35 A;  3WR7 A;  4NGQ A;  2F5I A;  2VL1 A;  2CNS A;  3MRU A;  1NSL A;  4MCR A;  3S6G A;  4CGN A;  5HXD A;  1S60 A;  3IWG A;  2VBQ A;  3KGQ A;  1YX0 A;  4NSQ A;  4P4E A;  3LAC A;  1TF9 A;  5THW A;  3R96 A;  4CAF A;  3SJF A;  4ZY1 A;  2OZU A;  2PJ1 A;  3NE7 A;  4OC1 A;  2VEZ A;  4IK2 A;  4U5Y A;  2PIZ A;  4KOU A;  3PBB A;  2AFS A;  1QSM A;  1YLE A;  3VWE A;  3SI1 A;  2QIR A;  3B8G A;  4HKF A;  4WWV A;  1M4G A;  2EWB A;  2PJ5 A;  1VGY A;  3FRM A;  1TXR A;  2FCK A;  2CTB A;  4P4D A;  2PJB A;  3FH4 A;  4OKO A;  4F8Z A;  4A38 A;  2GLJ A;  5CNP A;  2GFQ A;  2WPX A;  1Q2Y A;  4AG7 A;  2V8H A;  1TF8 A;  3D68 A;  3S6F A;  4CYP A;  4AVC A;  2BUE A;  2P6E A;  3SJG A;  2B4D A;  3K9U A;  3NH8 A;  4P4F A;  4CAX A;  2PJ3 A;  3IU2 A;  4E0A A;  2O53 A;  3FF3 A;  4CPA A;  2B3V A;  3B3W A;  2PSW A;  3SI2 A;  2GU2 A;  1KZF A;  4PSW A;  1QST A;  3D7G A;  1CG2 A;  3IGR A;  2C1C A;  4KLV A;  3D67 A;  3S6H A;  1K4J A;  1Z2L A;  1XEB A;  2GRE A;  4MFL A;  4OAE A;  4M85 A;  2J8N A;  4P4B A;  4P45 A;  3TX8 A;  4CYQ A;  4ZX8 A;  1S5K A;  1AYE A;  1QSO A;  1XE4 A;  4L8A A;  5CPA A;  4C68 A;  1XMT A;  2EUI A;  1XJO A;  3WT4 A;  1ELM P;  3FJU A;  3GB0 A;  4OC5 A;  2JBK A;  4PSX A;  4QVT A;  2C27 A;  2P6F A;  1M4L A;  2DPS A;  2Z3P A;  3LD2 A;  4CAV A;  3PEI A;  1Y0Y A;  3G8W A;  4UWJ A;  2FE7 A;  4P4I A;  1IY7 A;  3EY5 A;  4GXH A;  1LAN A;  5HH1 A;  4TNU A;  3TE4 A;  2REE A;  4KSI A;  4B6Z A;  4P6Y A;  2GLF A;  1H8L A;  4BD9 A;  2ZW7 A;  3DNS A;  1Q2D A;  2Z10 A;  2ZPA A;  4XPD B;  4Q36 A;  2JBJ A;  3FVL A;  2IQ6 A;  4C7I A;  3S9M A;  1YVO A;  4B11 A;  4R8F A;  3H8E A;  3ISX A;  4NGN A;  3TOB A;  4MMO A;  4CYN A;  4KOT A;  4MFQ A;  4NJQ A;  5DS0 A;  2PR8 A;  4M3S A;  4KZT A;  3DSB A;  1TKH A;  3T8W A;  1CPS A;  4A94 A;  5K8M A;  5EMI A;  3W6S A;  2X7B A;  2HUZ A;  4EWT A;  1A2Z A;  1YQE A;  5I0C A;  1YLO A;  2B4D B;  3KZW A;  4UEF A;  4A2Z A;  4BIN A;  4CAW A;  2DEA A;  4GM5 A;  4JXR A;  4LQ6 A;  4R76 A;  1M4I A;  3FNC A;  3BJ7 A;  5HVH A;  3TT2 A;  2EBJ A;  1HDQ A;  1V0C A;  1QSR A;  4KOX A;  1XOV A;  2WUU A;  2J8R A;  4OME A;  5LRK A;  3QAH A;  2VZZ A;  4A30 A;  2OU2 A;  2FIW A;  3TTH A;  2C6P A;  3KKW A;  4NFR A;  3CZX A;  4AVB A;  1KWM A;  2AFX A;  4A39 A;  4YGO A;  4CGM A;  4FAI A;  1GYT A;  4AG9 A;  4ZI6 A;  4KOS A;  2ZEG A;  4YFJ A;  5CBM A;  2FT0 A;  4FD4 A;  3PGP A;  3IO1 A;  4UBR A;  3SI0 A;  2R1I A;  4B13 A;  1MJB A;  5HVG A;  4OAD A;  1JQG A;  1VHS A;  1Y9W A;  3VAT A;  5F09 A;  5E96 A;  1Z8T A;  3R9E A;  3NFZ A;  1AMP A;  1LCP A;  2FVG A;  3IWW A;  2RB7 A;  3PP9 A;  5JM6 A;  2FS5 A;  3PFO A;  5KTC A;  4NXY A;  3EC4 A;  2JDD A;  3EXN A;  1YRE A;  2QML A;  2CNT A;  3PB9 X;  4ZYQ A;  1LFW A;  2ABZ A;  5DWM A;  2BEI A;  3QNV A;  4QUS A;  3IEH A;  5BWA B;  1I21 A;  3E0K A;  4UWI A;  1M1D A;  2ZEO A;  4HPS A;  1P4N A;  1RXT A;  3F5B A;  5JGF A;  1DE4 C;  2ARH A;  2XEJ A;  3HLP A;  2PJ6 A;  5G22 A;  3ZJ0 A;  4CRY B;  4FD6 A;  2JEV A;  5AG7 A;  4B5O A;  2ATR A;  4L89 A;  4ZBG A;  5FVJ A;  2PJ8 A;  3K2K A;  5G1Z A;  3FBU A;  4PXE A;  4PV6 A;  2YNC C;  3IIB A;  3W6X A;  2A4N A;  2G3A A;  1QSN A;  2EK8 A;  1Q7L A;  4P4J A;  3PBE A;  4LX9 A;  3F8K A;  5C88 A;  4B12 A;  3DDD A;  3KL9 A;  3PFE A;  4JWP A;  3H4Q A;  3LMS A;  1Z8W A;  2PJ0 A;  3BI1 A;  4OC0 A;  3VWD A;  4C2Z A;  2PRQ A;  2BCO A;  2B5G A;  3F0A A;  5LRG A;  1B87 A;  4Y49 B;  2PJ4 A;  4R3K A;  1ARL A;  1ZG9 A;  3CPA A;  1P0H A;  1NE9 A;  2B3U A;  2Z3O A;  4XNH B;  4MI4 A;  4ZY2 A;  7CPA A;  4UFW A;  1JWQ A;  1Y0R A;  4MCS A;  5D8N A;  4CYO A;  4NGP A;  1LRZ A;  2AFM A;  1S7F A;  4AVA A;  3B2Y A;  3KHX A;  3SJE A;  3VH9 A;  1S7N A;  4JXQ A;  1ZG8 A;  1R43 A;  2CY2 A;  2GAN A;  2RFH A;  1LOK A;  2ZEH A;  3FXT A;  4I49 A;  3IU1 A;  3B3S A;  2ZW4 A;  4A95 A;  1TKF A;  1PYT B;  4DJL A;  1XMB A;  3FEE A;  4U9Y A;  3D66 A;  1TKJ A;  5F46 A;  1MK4 A;  3FX6 A;  3B3V A;  1Z8L A;  5F49 A;  2QYV A;  4F0Y A;  2G3T A;  4NCZ A;  2NMT A;  1S7L A;  3PB8 X;  1I12 A;  2YNE A;  4MCP A;  4OIW A;  2VQY A;  2ZEL A;  2AFO A;  4IF5 A;  1Z4R A;  2AJ6 A;  3TO9 A;  1B6B A;  1S3Z A;  2CNM A;  3FIX A;  4P10 A;  4HNY B;  3MGD A;  2PC1 A;  1X10 A;  4XPD C;  2V8G A;  4PXB A;  5JH9 A;  3DR6 A;  1F57 A;  2Q7S A;  1YR0 A;  4YWY A;  2WSA A;  5IX3 A;  4NGR A;  1EE3 P;  4AXV A;  1YGH A;  1VHO A;  4KUA A;  4KVO E;  4A31 A;  3SJX A;  3SXO A;  4KLW A;  2B5G B;  2ZXV A;  8CPA A;  1Y7R A;  5K8P A;  1CP7 A;  2AFZ A;  5G20 A;  3JTK A;  1R3N A;  4KS9 A;  4UFX A;  4R3L A;  2ZW5 A;  1CBX A;  4MCQ A;  5H84 A;  4PK3 A;  5HVF A;  3R1K A;  1YW4 A;  4P44 A;  3QAY A;  1BLL E;  3EFA A;  2V77 A;  3D4U A;  1UFH A;  4ORF A;  5A28 A;  4MY3 A;  4R7M A;  4CGP A;  4LUA A;  3JRU A;  3KR4 A;  2WYR A;  2NYQ A;  3H8G A;  3EO4 A;  4JD6 A;  2R8V A;  3C26 A;  3KR5 A;  1HEE A;  5A27 A;  2J8M A;  3W91 A;  5KTD A;  4ONW A;  1XFO A;  4MHP A;  1KUX A;  2Q04 A;  2PDO A;  4KUB A;  2Q0Y A;  1YME A;  4LQG A;  4UIB A;  4FWU A;  2ZEE A;  2ODF A;  3NH4 A;  3H5Z A;  3PB6 X;  4C2X A;  1VKC A;  2I79 A;  4A37 A;  4W9Y A;  2AFW A;  1F2O A;  3KHZ A;  3TO7 A;  3CXP A;  4M6H A;  4X8I A;  5AG6 A;  1M44 A;  4RI1 A;  4RUH A;  1BAV A;  2JDC A;  4B5P A;  3D7D A;  2Q43 A;  5HMN A;  3D2M A;  2PR1 A;  3BJ8 A;  1AUG A;  1TIQ A;  3RNZ A;  1CM0 A;  4JYW A;  4R87 A;  4AB7 A;  1ELL P;  4HNW B;  2Z3N A;  2AE6 A;  1HDU A;  2BL1 A;  3UY5 A;  4BMH A;  3D7H A;  3S9N A;  1LAM A;  4Q38 A;  3BXM A;  1X12 A;  4MHZ A;  2DPT A;  2CTC A;  2REF A;  1FNO A;  2PJA A;  3MN8 A;  4MHN A;  4MRI A;  1F2P A;  2BO9 A;  3WC7 A;  2Z3L A;  5J1Q A;  3GY9 A;  1L0C A;  3P2H A;  2OR4 A;  1Q2C A;  2C6C A;  4QB9 A;  1VIX A;  4U9Z A;  2PJ9 A;  2PVW A;  4K3N A;  4JJX A;  3GLJ A;  5C82 A;  2G0B A;  3QB8 A;  2Z3M A;  3S6K A;  1WWZ A;  3FED A;  2BOA A;  2HC9 A;  3PRT A;  1PU9 A;  4MBU A;  4F6A A;  3KQZ A;  4YRH A;  4PK2 A;  2PVV A;  3FYN A;  4OC2 A;  3A9L A;  3BLN A;  2Z3K A;  4GS4 A;  2K5T A;  3H8F A;  2KCW A;  1PUA A;  2PJ2 A;  2ZOG A;  5DWN A;  1QMU A;  3BI0 A;  4NGS A;  1Y7E A;  4UCP A;  4Y49 C;  5AG4 A;  3IC1 A;  3CPX A;  2IL4 A;  1ZG7 A;  4X3R A;  3TC8 A;  4XNH C;  2Z11 A;  1QQ9 A;  2NSM A;  4E2A A;  4IUS A;  2ZEP A;  3TOA A;  4MXU A;  4QBJ A;  5EC4 A;  4B5P B;  3ISZ A;  1YW6 A;  1LAP A;  1CPX A;  4ONU A;  3LOD A;  4UEZ A;  5IB9 A;  4KOW A;  4OC4 A;  3SHP A;  2ZW6 A;  4A32 A;  1OZP A;  4ZX9 A;  4TWE A;  2Q4V A;  3NA6 A;  2G9D A;  4C2Y A;  1N71 A;  1Z8X A;  3V38 A;  4CAE A;  4ZGY B;  4H6Z A;  3FB3 A;  3SXN A;  2OZH A;  1IOF A;  2OZG A;  2J9A A;  1IU8 A;  2B4B A;  4E8O A;  5IB0 A;  2ZEM A;  2EK9 A;  3CT9 A;  2P0W A;  1VHE A;  4FUU A;  2FSR A;  3BHX A;  1S7K A;  4H2K A;  4YU9 A;  2C6G A;  1R57 A;  3RO0 A;  4G1P A;  4KVM E;  4H6U A;  3WC5 A;  1IGB A;  3RZA A;  3S9L A;  5G21 A;  5KTA A;  2O28 A;  2V8V A;  3D3S A;  4QC6 A;  4XPK A;  4FBE A;  3KAS A;  5F47 A;  2ZEN A;  3VAR A;  1U6M A;  1I1D A;  2Q44 A;  2Y0M A;  1UWY A;  1CX8 A;  3I1U A;  3GKR A;  4NF1 A;  4R6T A;  1KUY A;  1ON0 A;  4ZY0 A;  2FL4 A;  1BO4 A;  2PRB A;  2VI7 A;  2IJZ A;  4KSF A;  4CRZ B;  4FD7 A;  3PB7 X;  5ELY A;  4M6I A;  3R9F A;  4X5K A;  2I3C A;  2I00 A;  4OID A;  4UCN A;  3D2P A;  4J3G A;  1FY7 A;  3DR8 A;  2VZY A;  1NSA A;  4NGT A;  4DYO A;  4KSA A;  4MY0 A;  3DGV A;  1XF8 A;  4FD5 A;  1WK4 A;  1ZLI A;  1DTD A;  2QJ8 A;  3B7I A;  1OBR A;  1M4D A;  4UIA A;  1KUV A;  4X2T A;  4UCM A;  3NH5 A;  5K8N A;  3P2F A;  5LRJ A;  3KQX A;  5J8F A;  2Z0Z A;  4PPZ A;  3GYA A;  5LYL A;  6CPA A;  1ZLH A;  2HQY A;  4Z65 A;  1J4J A;  4DNC A;  2ZEF A;  3D8P A;  4JZ0 A;  1GHE A;  4MFZ A;  5H86 A;  3RYO A;  5J8C A;  3CDX A;  1MJA A;  2Q4Z A;  5F48 A;  3NE8 A;  4B10 A;  4CGO A;  3GIU A;  4IHM A;  1PCA A;  2B58 A;  4WJB A;  2XEI A;  2CXA A;  4KVX A;  2FIA A;  3N5F A;  1Y9K A;  3RBU A;  2O4H A;  1Z9U A;  4PQA A;  4MFP A;  4A33 A;  2OB0 A;  5ISV A;  2D4O A;  5JQ4 A;  5JPH A;  1NMT A;  3GUX A;  3KI9 A;  3IFE A;  3CXS A;  2DXQ A;  4JLY A;  4RN7 A;  1RTQ A;  3V7Z A;  4M6G A;  4UEE A;  1Z5R A;  1MJ9 A;  2PIY A;  1IOI A;  3JVN A;  1IB1 E;  4C7H A;  4MJ8 A;  4NJR A;  1IIC A;  1IID A;  1YK3 A;  3OWC A;  5D29 A;  4EVY A;  5I4M A;  4EME A;  3I3G A;  2BSW A;  5LYI A;  4EFD A;  4H89 A;  4F9V A;  3N7Z A;  2Q7B A;  1IYK A;  2YND A;  2GE3 A;  2V8D A;  4UFV A;  4DUK A;  2PJ7 A;  2Q4Y A;  4HNX B;  1XIX A;  1Z4E A;  2PQ8 A;  2VXK A;  4CS0 B;  1CP6 A;  3V8I A;  4B14 A;  2EO8 A;  4OP4 A;  3WAB A;  3CXQ A;  1CJW A;  1YSJ A;  1BOB A;  2OH1 A;  2YGW A;  2D4P A;  2ZOF A;  2F8H A;  2HB6 A;  2PCU A;  4PXC A;  3TCV A;  4MHD A;  4MHY A;  3WC6 A;  5GCN A;  2F7V A;  3FEC A;  4OC3 A;  5K8O A;  2ZED A;  4OLL A;  4NGM A;  3LWU A;  3HUV A;  4KOV A;  4NEX A;  4UF4 A;  1ARM A;  2WPW A;  2CF4 A;  3FMC A;  3L2N A;  5LYF A;  2WZN A;  4XPL A;  3TFY A;  3PZJ A;  1ZO0 A;  3T90 A;  2AFU A;  3B3C A;  5AGE A;  2OOT A;  3I9S A;  2CIJ A;  3RAM A;  2P6G A;  3DLJ A;  2YNC A;  4Q7A A;  2FXF A;  2POK A;  4MFK A;  4UA3 A;  4F0X A;  2RC4 A;  2GIV A;  3G3S A;  3B3T A;  2XEF A;  3ZZI A;  1RO5 A;  3K9T A;  1XBU A;  4BBH A;  4KOY A;  2PJC A; 
#chains in the Genus database with same CATH homology
 1BPM A;  5LYD A;  2Q51 A;  2QVP A;  4PXD A;  1XRY A;  4F9U A;  1FT7 A;  2JEW A;  4IAV A;  1BPN A;  2PE3 A;  3D7F A;  4O23 A;  2XEG A;  3IJ3 A;  3PB4 X;  2IMO A;  2ANP A;  3B35 A;  4NGQ A;  2VL1 A;  3MRU A;  4MCR A;  5HXD A;  3KGQ A;  4P4E A;  1TF9 A;  5THW A;  3SJF A;  4ZY1 A;  2PJ1 A;  4OC1 A;  4IK2 A;  2PIZ A;  3PBB A;  2AFS A;  3SI1 A;  4WWV A;  2EWB A;  2PJ5 A;  1VGY A;  1TXR A;  2CTB A;  4P4D A;  2PJB A;  3FH4 A;  4OKO A;  4F8Z A;  4A38 A;  2GLJ A;  2V8H A;  1TF8 A;  3D68 A;  3SJG A;  3NH8 A;  4P4F A;  2PJ3 A;  2O53 A;  3FF3 A;  4CPA A;  3B3W A;  3SI2 A;  2GU2 A;  3D7G A;  1CG2 A;  2C1C A;  3D67 A;  1Z2L A;  2GRE A;  4P4B A;  4P45 A;  3TX8 A;  4ZX8 A;  1AYE A;  5CPA A;  1XJO A;  3WT4 A;  1ELM P;  3FJU A;  3GB0 A;  4OC5 A;  2JBK A;  1M4L A;  3PEI A;  1Y0Y A;  4P4I A;  1IY7 A;  1LAN A;  4TNU A;  4KSI A;  4B6Z A;  4P6Y A;  2GLF A;  1H8L A;  4BD9 A;  2JBJ A;  3FVL A;  2IQ6 A;  3S9M A;  4R8F A;  3H8E A;  3ISX A;  4NGN A;  4MMO A;  4NJQ A;  5DS0 A;  3T8W A;  1TKH A;  4A94 A;  1CPS A;  5K8M A;  4EWT A;  1YLO A;  3KZW A;  4UEF A;  2DEA A;  4GM5 A;  4R76 A;  5HVH A;  1HDQ A;  4OME A;  5LRK A;  2C6P A;  4NFR A;  1KWM A;  2AFX A;  4A39 A;  4FAI A;  1GYT A;  4ZI6 A;  2ZEG A;  5CBM A;  3SI0 A;  3IO1 A;  5HVG A;  1JQG A;  3VAT A;  5F09 A;  3NFZ A;  1AMP A;  1LCP A;  2FVG A;  3IWW A;  2RB7 A;  5JM6 A;  3PFO A;  3PB9 X;  4ZYQ A;  1LFW A;  2ABZ A;  3QNV A;  3IEH A;  2ZEO A;  5JGF A;  1DE4 C;  2XEJ A;  3HLP A;  2PJ6 A;  2PJ8 A;  3K2K A;  4PXE A;  3IIB A;  2EK8 A;  1Q7L A;  4P4J A;  3PBE A;  3PFE A;  3KL9 A;  4OC0 A;  3LMS A;  2PJ0 A;  3BI1 A;  2PRQ A;  2BCO A;  5LRG A;  2PJ4 A;  1ARL A;  1ZG9 A;  3CPA A;  4ZY2 A;  7CPA A;  4MCS A;  1Y0R A;  5D8N A;  4NGP A;  2AFM A;  3B2Y A;  3KHX A;  3SJE A;  3VH9 A;  1ZG8 A;  1R43 A;  2RFH A;  1LOK A;  2ZEH A;  3B3S A;  1TKF A;  1PYT B;  4DJL A;  1XMB A;  3FEE A;  3D66 A;  1TKJ A;  3FX6 A;  3B3V A;  1Z8L A;  2QYV A;  3PB8 X;  4MCP A;  4OIW A;  2ZEL A;  2AFO A;  4P10 A;  2V8G A;  4PXB A;  5JH9 A;  1F57 A;  4YWY A;  4NGR A;  1EE3 P;  4AXV A;  1VHO A;  3SJX A;  8CPA A;  5K8P A;  1CP7 A;  2AFZ A;  1R3N A;  4MCQ A;  1CBX A;  5HVF A;  1YW4 A;  4P44 A;  1BLL E;  2V77 A;  3D4U A;  4R7M A;  3JRU A;  3KR4 A;  2WYR A;  2NYQ A;  3H8G A;  3KR5 A;  1HEE A;  4ONW A;  1XFO A;  4MHP A;  4LQG A;  4UIB A;  1YME A;  4FWU A;  2ZEE A;  3NH4 A;  3PB6 X;  4A37 A;  4W9Y A;  2AFW A;  1F2O A;  3KHZ A;  4X8I A;  4RUH A;  1BAV A;  3D7D A;  2Q43 A;  4JYW A;  1ELL P;  1HDU A;  3D7H A;  3S9N A;  1LAM A;  3BXM A;  4MHZ A;  2CTC A;  1FNO A;  2PJA A;  3MN8 A;  4MHN A;  4MRI A;  1F2P A;  2BO9 A;  3WC7 A;  5J1Q A;  2OR4 A;  2C6C A;  1VIX A;  2PJ9 A;  2PVW A;  4K3N A;  3GLJ A;  3FED A;  2BOA A;  2HC9 A;  3PRT A;  3KQZ A;  2PVV A;  4OC2 A;  3H8F A;  2PJ2 A;  2ZOG A;  1QMU A;  3BI0 A;  4NGS A;  1Y7E A;  3IC1 A;  3CPX A;  1ZG7 A;  4X3R A;  3TC8 A;  1QQ9 A;  2NSM A;  2ZEP A;  4MXU A;  3ISZ A;  1YW6 A;  1LAP A;  1CPX A;  4UEZ A;  5IB9 A;  4OC4 A;  4ZX9 A;  4TWE A;  3NA6 A;  2G9D A;  3V38 A;  2J9A A;  2ZEM A;  2EK9 A;  3CT9 A;  1VHE A;  4FUU A;  3BHX A;  4H2K A;  4YU9 A;  2C6G A;  4G1P A;  3WC5 A;  1IGB A;  3RZA A;  3S9L A;  2V8V A;  4FBE A;  3KAS A;  2ZEN A;  3VAR A;  1UWY A;  1CX8 A;  3I1U A;  4R6T A;  4ZY0 A;  2IJZ A;  3PB7 X;  5ELY A;  2I3C A;  4OID A;  1NSA A;  4NGT A;  4DYO A;  3DGV A;  1ZLI A;  1DTD A;  2QJ8 A;  3B7I A;  1OBR A;  4UIA A;  4X2T A;  3NH5 A;  5K8N A;  5LRJ A;  3KQX A;  4PPZ A;  5LYL A;  6CPA A;  1ZLH A;  4Z65 A;  2ZEF A;  4JZ0 A;  3CDX A;  2Q4Z A;  4IHM A;  1PCA A;  4WJB A;  2XEI A;  3N5F A;  3RBU A;  2O4H A;  4PQA A;  3GUX A;  3KI9 A;  3IFE A;  1RTQ A;  3V7Z A;  4UEE A;  1Z5R A;  2PIY A;  4NJR A;  5I4M A;  5D29 A;  4EME A;  5LYI A;  4EFD A;  4F9V A;  2V8D A;  4DUK A;  2PJ7 A;  1CP6 A;  4OP4 A;  3WAB A;  1YSJ A;  2ZOF A;  2F8H A;  2HB6 A;  2PCU A;  4PXC A;  3WC6 A;  4MHY A;  2F7V A;  3FEC A;  4OC3 A;  5K8O A;  2ZED A;  4NGM A;  3LWU A;  3HUV A;  4UF4 A;  1ARM A;  2CF4 A;  3FMC A;  3L2N A;  5LYF A;  2WZN A;  2AFU A;  3B3C A;  2OOT A;  2CIJ A;  3RAM A;  3DLJ A;  4Q7A A;  2POK A;  3B3T A;  2XEF A;  3K9T A;  1XBU A;  2PJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...