2ZEPA

Crystal structure of the human glutaminyl cyclase mutant h319l at 2.1 angstrom resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLLLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zepA00
4O23A 3KQZA 1ARLA 3BI1A 1QQ9A 3PRTA 4JZ0A 3FX6A 3B3SA 5LYDA 4FWUA 4NGPA 3PFOA 2PJ7A 1FT7A 4PXBA 1ZLIA 1CP7A 4G1PA 1ZG7A 5J1QA 4TWEA 2PRQA 2ZEPA 3GB0A 4GM5A 3TX8A 3CPXA 5LYFA 2F7VA 2PCUA 4MHYA 2VL1A 4ZX9A 2ZENA 2OOTA 1YMEA 4DJLA 3PB9X 3B2YA 3IFEA 4OMEA 3H8GA 1F2PA 2WZNA 2XEJA 2RFHA 5LRKA 2GREA 4R76A 2ZELA 5HXDA 1XRYA 3B3CA 2GLJA 5HVHA 3B35A 3T8WA 3GLJA 1YSJA 3WABA 5HVFA 3D7GA 2PJ4A 1LOKA 4R8FA 3SI1A 3WC7A 4B6ZA 3IO1A 4MCSA 2G9DA 4WWVA 4UIBA 1H8LA 1FNOA 3KASA 4CPAA 3ISXA 4DYOA 2ZEDA 4W9YA 1VHOA 4X8IA 5D8NA 2XEIA 3BHXA 4OIDA 2IMOA 3CPAA 3WC5A 4UEFA 4OC2A 4FBEA 3IIBA 3PEIA 5DS0A 2PJ2A 3SJEA 1ZLHA 2IQ6A 1KWMA 4OC5A 2ZEGA 4UIAA 3NH4A 3FECA 4MHPA 2GLFA 1PCAA 1CG2A 4KSIA 3SJFA 1TF9A 4FAIA 3KI9A 1LAPA 2V8VA 3L2NA 1LCPA 2PJ8A 2CTBA 4MCPA 1Y0RA 3D7HA 2ZEFA 3NA6A 4NJRA 3SI0A 1YLOA 4P4BA 1PYTB 4P4DA 1M4LA 3H8FA 5LRGA 1VHEA 2Q51A 1BAVA 3PBBA 3ISZA 3WT4A 3VH9A 4MRIA 1XJOA 2C6CA 4LQGA 1TXRA 4P4IA 4K3NA 3B3WA 2PJBA 1JQGA 3FF3A 1Z8LA 3D4UA 4MHZA 4MMOA 4PXDA 4AXVA 3DGVA 4P4JA 1GYTA 5HVGA 4H2KA 3S9LA 1VIXA 2ZEHA 1XBUA 1ZG8A 3PB8X 4ZY2A 2POKA 3FVLA 1CX8A 1BPNA 4NFRA 3IWWA 2DEAA 3K9TA 4PPZA 3H8EA 1EE3P 1ELMP 2PJ0A 2ABZA 5CBMA 3BI0A 2AFWA 1TKJA 2C6GA 3FMCA 5D29A 4X2TA 1HEEA 3IEHA 4UF4A 2EK9A 3KGQA 3LWUA 4EMEA 4MCRA 1TKFA 2O4HA 4NGRA 1IY7A 2AFUA 4Z65A 6CPAA 3PFEA 2ZEOA 2C6PA 3FH4A 4ZX8A 3WC6A 3S9MA 1Z5RA 2ZEMA 3B3VA 3D68A 1TF8A 4A94A 1TKHA 2XEGA 3FEDA 3NH8A 4NGMA 1XFOA 4ZY0A 3VARA 4R6TA 2OR4A 3IC1A 5LRJA 3S9NA 3KQXA 2PJ5A 2BCOA 3KR5A 4YWYA 4F9UA 4DUKA 2ZOFA 2JEWA 4F8ZA 3RAMA 3RBUA 3RZAA 3V38A 3TC8A 3NFZA 2AFZA 2WYRA 4A38A 4P45A 2QVPA 4ZI6A 5F09A 5JGFA 3B7IA 3PB6X 2FVGA 4IAVA 4OIWA 1AMPA 2V8GA 3KL9A 2V8DA 2C1CA 3JRUA 5ELYA 3HUVA 4MXUA 1Y7EA 3VATA 3KHZA 3MN8A 3B3TA 3FEEA 3SJXA 4ZYQA 1F57A 2PJ6A 1YW6A 4R7MA 1BLLE 2F8HA 4X3RA 3LMSA 3K2KA 1Q7LA 2PJ9A 2HB6A 5THWA 4EWTA 2PJ3A 4F9VA 2IJZA 3D7DA 2AFSA 2HC9A 2PJAA 2EWBA 1RTQA 2QYVA 4P6YA 2JBJA 5K8NA 2V77A 1Y0YA 3V7ZA 2I3CA 2AFOA 1BPMA 4EFDA 2CIJA 2PJCA 5JM6A 4NJQA 2Q4ZA 4OC3A 3N5FA 5K8OA 2BOAA 4A37A 4A39A 2CF4A 3I1UA 3QNVA 2NSMA 2PJ1A 3KHXA 3NH5A 2BO9A 1IGBA 3SJGA 5JH9A 4FUUA 5IB9A 4Q7AA 3SI2A 1ELLP 1CPXA 1CBXA 1CPSA 4BD9A 4P4FA 3GUXA 1AYEA 3HLPA 4ZY1A 4OP4A 2ZEEA 4PQAA 3FJUA 1DTDA 1LANA 3IJ3A 5K8MA 3PB7X 1UWYA 2JBKA 3D7FA 3PBEA 4P44A 4IK2A 1QMUA 4NGSA 1NSAA 2EK8A 3MRUA 4OC4A 2QJ8A 2RB7A 4OC0A 3D66A 1Z2LA 2V8HA 1HDQA 1LFWA 2Q43A 1ZG9A 2AFXA 1R3NA 2AFMA 4JYWA 2PIYA 4PXCA 4MCQA 1CP6A 3BXMA 1OBRA 1DE4C 4P4EA 2CTCA 2PE3A 5K8PA 5LYIA 4IHMA 1LAMA 4YU9A 1R43A 4OC1A 1VGYA 1ARMA 4UEEA 3KR4A 2GU2A 2ZOGA 5LYLA 3CT9A 3DLJA 2ANPA 1HDUA 4OKOA 2XEFA 2O53A 4UEZA 2PIZA 3D67A 2PVWA 4NGQA 2J9AA 4WJBA 5I4MA 2NYQA 3CDXA 5CPAA 4RUHA 3KZWA 1F2OA 4MHNA 4P10A 4NGTA 2PVVA 1YW4A 1XMBA 7CPAA 4NGNA 8CPAA 4TNUA 4PXEA 3PB4X 4ONWA
chains in the Genus database with same CATH superfamily
4Q38A 4O23A 3KQZA 5AG4A 1ARLA 4UFXA 3BI1A 1QQ9A 5IB0A 3PRTA 4JZ0A 3FX6A 2PR1A 5C82A 3R9FA 3B3SA 5LYDA 4FWUA 4NGPA 2WUUA 1M44A 1BOBA 2FS5A 3PFOA 4MFZA 4CAFA 2PJ7A 2Z3KA 2J8NA 4M6IA 4KUBA 1FT7A 4PXBA 1ZLIA 5AG7A 2R1IA 4B12A 1CP7A 4HNXB 4G1PA 1ZG7A 1U6MA 3GYAA 4PSXA 5J1QA 2IL4A 4QUSA 1M4IA 4TWEA 2PRQA 2ZEPA 3GB0A 2REEA 4GM5A 3UY5A 3TX8A 3CPXA 5LYFA 2F7VA 1LRZA 2PCUA 4KVOE 4MHYA 5F49A 2VL1A 4MY0A 3E0KA 4ZX9A 1XMTA 2OU2A 2B5GB 3C26A 3FYNA 4KSFA 2ZENA 4CS0B 2OOTA 1YMEA 4DJLA 2Z3NA 3PB9X 4NF1A 1YQEA 2B4DB 5F48A 3B2YA 3IFEA 2KCWA 4OMEA 2HV2A 3OWCA 3H8GA 4MHDA 5G21A 2BUEA 2Z11A 4AVAA 4B5PA 3LODA 3QB8A 4ONUA 2I00A 1MK4A 3R95A 3EO4A 1F2PA 2WZNA 4K30A 2XEJA 4JJXA 1BO4A 1Y7RA 4Y49B 1NSLA 2FIAA 2RFHA 2GREA 5LRKA 4R76A 2ZELA 1ZO0A 4KUAA 3SXOA 5HXDA 4KLVA 2ZW6A 4LUAA 1ON0A 1XRYA 4CRZB 3B3CA 1L0CA 2GLJA 3DR6A 4U9ZA 5IX3A 5HVHA 4CYOA 3B35A 1Z8XA 3FXTA 4PSWA 4A32A 4MFLA 3T8WA 3TCVA 3GLJA 1YSJA 3WABA 1YLEA 5HVFA 2B3VA 4MBUA 2FT0A 3D7GA 1B87A 2PJ4A 1AUGA 1LOKA 4R8FA 3SI1A 3WC7A 1IYKA 3JUWA 4H6ZA 4YGOA 4B6ZA 3IO1A 4UA3A 4MCSA 2G9DA 4WWVA 3T90A 4UIBA 1H8LA 4KOWA 1FNOA 4IF5A 3KASA 3RNZA 1B6BA 2QIRA 2JLMA 4CPAA 3ISXA 2AJ6A 3S6GA 4DYOA 2GFQA 2J8MA 2ZEDA 1I12A 4W9YA 1Y9WA 1VHOA 4X8IA 1V0CA 5D8NA 2XEIA 3DSBA 1S60A 3BHXA 4M85A 4OIDA 4BBHA 2IMOA 4HKFA 3FRMA 5AGEA 3CPAA 3WC5A 3LACA 4UEFA 4OC2A 4MFJA 3R9EA 4FBEA 3VWEA 1Z8WA 3IIBA 3EXNA 3PEIA 2DPTA 2PJ2A 5DS0A 2Y0MA 4AB7A 4LX9A 2HUZA 3SJEA 4RS2A 4AVBA 1ZLHA 2IQ6A 1KWMA 2B4DA 2ZEGA 4OC5A 4UIAA 3NH4A 3FECA 4MHPA 2GLFA 2GANA 1PCAA 1CG2A 4KSIA 2ARHA 2OZGA 1Z9UA 3SJFA 1TF9A 4FAIA 3KI9A 1LAPA 2V8VA 1XIXA 3L2NA 5IV0A 1LCPA 1I1DA 2CTBA 2CXAA 2PJ8A 4MCPA 4UCPA 1S3ZA 1Y0RA 5J8FA 3D7HA 2CY2A 4XPKA 2ZEFA 3NA6A 4NJRA 3SI0A 1YLOA 4P4BA 1PYTB 4OAEA 4P4DA 5E96A 2B3UA 1M4LA 2PSWA 2P6FA 2R8VA 1IB1E 2VQYA 3H8FA 5LRGA 4AG7A 1VHEA 4E2AA 3W6XA 5EC4A 2REFA 3F5BA 4YRHA 1MJAA 1VKCA 1BAVA 2Q51A 4A31A 3S6FA 1VHSA 3PBBA 3FNCA 2Z0ZA 3ISZA 4XPDC 3WT4A 3VH9A 4MRIA 4MFQA 1XJOA 2C6CA 1YGHA 1S7LA 4ZGYB 4B11A 4LQGA 5A28A 1FY7A 1TXRA 1N71A 4P4IA 4K3NA 3B3WA 2PJBA 4QC6A 1JQGA 3FF3A 5F47A 2JDCA 4L8AA 1Z8LA 4II9A 3D4UA 4MHZA 4MMOA 2WSAA 4PXDA 2P6EA 4A30A 4AXVA 3DGVA 4P4JA 1GYTA 4UFVA 5C88A 3QAYA 4H2KA 5HVGA 3S9LA 1VIXA 2ZEHA 1XBUA 3CZXA 4HNWB 4LQ6A 4PK2A 4XPLA 1ZG8A 3PB8X 4KVME 4ZY2A 2POKA 3FVLA 1CX8A 1BPNA 4NFRA 3NE7A 1Q2CA 3IWWA 2DEAA 3CXQA 2Z3MA 1A2ZA 3GIUA 3K9TA 4YFJA 1MJ9A 1TIQA 4M6GA 4NSQA 4PV6A 4PPZA 1QSMA 4JXQA 2H5MA 3BLNA 4JWPA 1KUXA 3TT2A 3H8EA 4U5YA 2X7BA 3GKRA 1EE3P 1ELMP 2PJ0A 2YNEA 4XNHB 2ZW5A 5KTDA 1QSTA 4F0YA 4BINA 4R9MA 2ZW4A 5GCNA 1P4NA 1IU8A 1QSRA 4AVCA 2ABZA 1X12A 5CBMA 3D3SA 3BI0A 4OADA 2VZYA 1PUAA 4E8OA 3RO0A 1WWZA 2AFWA 1TKJA 2C6GA 3FMCA 5D29A 4A33A 5FVJA 1CM0A 4X2TA 1HEEA 3IEHA 3EC4A 4C2YA 4FD4A 4NXYA 2G0BA 2DF5A 4UF4A 2EK9A 2EBJA 3KKWA 2YGWA 2YNDA 3D8PA 3KGQA 3LWUA 1NMTA 3H4QA 4EMEA 3PZJA 4MCRA 1J4JA 3IU1A 4OLLA 2O4HA 1TKFA 4NGRA 1IY7A 2AFUA 4PK3A 4B13A 4CGNA 3JVNA 4Z65A 6CPAA 3PFEA 2ZEOA 2C6PA 4B5OA 3ZZIA 1I21A 4KOYA 3FH4A 2GIVA 4ZX8A 4C2ZA 3WC6A 3S9MA 3P2HA 3TTHA 2EO8A 1Z5RA 2ZEMA 4JXRA 1S7NA 3B3VA 3D68A 4EVYA 4KOVA 1M1DA 1TF8A 4A94A 4CAWA 2CNSA 3QAHA 1TKHA 2HQYA 2BEIA 2XEGA 4J3GA 2G3AA 3FEDA 3NH8A 4NGMA 1XFOA 4ZY0A 2I79A 1YVOA 2FL4A 2Q7BA 3T9YA 3TO7A 3VARA 4R6TA 5AG6A 2ZPAA 3IGRA 1MJBA 2EUIA 2OR4A 3IC1A 5LRJA 3S9NA 1YR0A 2BL1A 3KQXA 4NCZA 1XOVA 4UBRA 2PJ5A 2ODFA 2BCOA 3KR5A 2DXQA 3WR7A 4YWYA 2Z3LA 4DUKA 2ZOFA 2JEWA 4CAVA 4F8ZA 3DNSA 3RAMA 3RBUA 3RZAA 1IIDA 4UCMA 4KORA 3FB3A 4GXHA 3V38A 1YREA 3TC8A 4A2ZA 3NFZA 4KS9A 1Z4EA 2QECA 1S7KA 2AFZA 4CYPA 2WYRA 4A38A 4CGOA 4P45A 2PDOA 2QVPA 5J8CA 1XF8A 1K4JA 2FXFA 4ZI6A 2Q4YA 5F09A 3A9LA 3MGDA 1CJWA 3CXPA 4UWIA 3BJ8A 3B7IA 5JGFA 2EVNA 2BSWA 5KTAA 4Q36A 3PB6X 2FVGA 3R9GA 2JEVA 4IAVA 4OIWA 1AMPA 2WPWA 2V8GA 3F8KA 1NE9A 5JPHA 3KL9A 2DPSA 2V8DA 2C1CA 3JRUA 5ELYA 5HMNA 3HUVA 3JTKA 1X10A 4MXUA 4QVTA 4QB9A 4R87A 1QSOA 2ATRA 3IWEA 4R57A 2YNCC 1Y7EA 2FIWA 3VATA 3KHZA 2G3TA 4MJ8A 3MN8A 1RO5A 3B3TA 3FEEA 5CNPA 2ZW7A 1YK3A 2O28A 1R57A 3IWGA 3SJXA 4ZYQA 1F57A 2Q44A 4CGLA 2PJ6A 4KSAA 1YW6A 3TOAA 4R3KA 4CGPA 5HH1A 1IOFA 2ZXVA 5G1ZA 4R7MA 1BLLE 1JWQA 2F8HA 2Q7SA 4X3RA 3LMSA 3K2KA 1Q7LA 4MI4A 3CXSA 1QSNA 2HB6A 2PJ9A 5THWA 4EWTA 2PJ3A 4F9VA 1IICA 3IU2A 5H86A 1WK4A 2IJZA 2A4NA 2Q4VA 2Z3PA 3H5ZA 3TFYA 3D7DA 4FD5A 2AFSA 1GHEA 2HC9A 1P0HA 2PJAA 3GY9A 1KUYA 3K9UA 3LD2A 4CYNA 4M6HA 2EWBA 1RTQA 2QYVA 4P6YA 2JBJA 5K8NA 2V77A 5AG5A 4AG9A 1Y0YA 3V7ZA 1Z4RA 2CNTA 2I3CA 3PP9A 2AFOA 4RN7A 4C7HA 2WPXA 2Q04A 2Z3OA 1YVKA 1BPMA 2FE7A 1S7FA 4KZTA 4EFDA 2CIJA 2PJCA 3D2PA 5JM6A 1YX0A 4NJQA 2Q4ZA 4OC3A 4R3LA 4C68A 3N5FA 4ORFA 5K8OA 4MFPA 5BWAB 4MY3A 2BOAA 4A37A 4C2XA 4A39A 4FD6A 4L89A 4F6AA 2CF4A 1M4DA 3I1UA 2NSMA 2PC1A 3QNVA 2PJ1A 5DWMA 3KHXA 3NH5A 2BO9A 4ZBGA 1IGBA 3SJGA 4B10A 5JH9A 4FUUA 5IB9A 2VBQA 3VWDA 4H6UA 4C7IA 4Q7AA 3SI2A 5G22A 1ELLP 1CPXA 5A27A 1CBXA 3I3GA 2PQ8A 3NE8A 4F9UA 1CPSA 4E0AA 4BD9A 3V8IA 4P4FA 3N7ZA 4UFWA 4X5KA 3F0AA 3GUXA 1AYEA 4BMHA 3HLPA 1UFHA 4JD6A 2Q0YA 4ZY1A 1Q2YA 4OP4A 3W6SA 4HPSA 2OB0A 2F5IA 2Z10A 3B8GA 2ZEEA 5EBVA 4PQAA 3FJUA 4FD7A 3R96A 1DTDA 1RXTA 1LANA 2OZHA 3IJ3A 2GE3A 5K8MA 3PB7X 5ISVA 4XPDB 1UWYA 3D2MA 3W91A 3BJ7A 1XEBA 4IUSA 5DWNA 4QBJA 2JBKA 1KUVA 3D7FA 3PBEA 4KOXA 4P44A 2OZUA 4IK2A 1QMUA 4NGSA 2RC4A 2R7HA 3TO6A 1NSAA 3SHPA 2EK8A 3MRUA 4OC4A 2FCKA 4HNYB 2QJ8A 3ZJ0A 2RB7A 4CGMA 4OC0A 5F46A 3D66A 1Z2LA 2V8HA 1HDQA 1LFWA 4UWJA 2Q43A 4KLWA 4CAXA 1S5KA 1Z8TA 2QMLA 3DR8A 4A95A 4CYQA 1ZG9A 2R98A 2B4BA 2AFXA 5EMIA 1R3NA 5KTCA 1Q2DA 4F0XA 3TE4A 2PRBA 1PU9A 2AFMA 2D4PA 4KOTA 4JYWA 2PIYA 4RI1A 4PXCA 4XNHC 3TOBA 2OH1A 4MCQA 1CP6A 3BXMA 1OBRA 1DE4C 3PGPA 2J8RA 2CNMA 3FBUA 2CTCA 3FIXA 4P4EA 2VEZA 3S6HA 2FSRA 2C27A 2PE3A 5K8PA 5LYIA 1IOIA 4IHMA 3DDDA 4B14A 1LAMA 5I0CA 4YU9A 1R43A 3R1KA 4OC1A 1VGYA 2B5GA 2P6GA 1ARMA 2VXKA 4UEEA 4U9YA 3G3SA 3KR4A 2GU2A 2ZOGA 1XE4A 4Y49C 5LYLA 3CT9A 4MFKA 3DLJA 2ANPA 1Y9KA 5G20A 4DNCA 1HDUA 4GS4A 3I9SA 4UCNA 4OKOA 2XEFA 2O53A 4KOSA 1SQHA 4M3SA 3S6KA 4UEZA 4B5PB 2VZZA 2JDDA 2PIZA 2PR8A 3EY5A 2AE6A 4KVXA 4NEXA 1IYLA 2K5TA 3D67A 2PVWA 4NGQA 4JLYA 5JQ4A 2J9AA 4WJBA 3SXNA 2YNCA 3RYOA 1KZFA 5I4MA 4KOUA 3EFAA 3G8WA 4CAEA 2NYQA 3CDXA 5CPAA 4RUHA 3KZWA 1F2OA 4I49A 2P0WA 4MHNA 4P10A 4NGTA 2NMTA 2PVVA 1YW4A 1XMBA 7CPAA 4H89A 2D4OA 4NGNA 8CPAA 2B58A 4TNUA 4PXEA 5H84A 1OZPA 1M4GA 3PB4X 3P2FA 4CRYB 2VI7A 3TO9A 4ONWA
chains in the Genus database with same CATH topology
4O23A 3KQZA 1ARLA 3BI1A 1QQ9A 3PRTA 4JZ0A 3FX6A 3B3SA 5LYDA 4FWUA 4NGPA 3PFOA 2PJ7A 1FT7A 4PXBA 1ZLIA 1CP7A 4G1PA 1ZG7A 5J1QA 4TWEA 2PRQA 2ZEPA 3GB0A 4GM5A 3TX8A 3CPXA 5LYFA 2F7VA 2PCUA 4MHYA 2VL1A 4ZX9A 2ZENA 2OOTA 1YMEA 4DJLA 3PB9X 3B2YA 3IFEA 4OMEA 3H8GA 1F2PA 2WZNA 2XEJA 2RFHA 5LRKA 2GREA 4R76A 2ZELA 5HXDA 1XRYA 3B3CA 2GLJA 5HVHA 3B35A 3T8WA 3GLJA 1YSJA 3WABA 5HVFA 3D7GA 2PJ4A 1LOKA 4R8FA 3SI1A 3WC7A 4B6ZA 3IO1A 4MCSA 2G9DA 4WWVA 4UIBA 1H8LA 1FNOA 3KASA 4CPAA 3ISXA 4DYOA 2ZEDA 4W9YA 1VHOA 4X8IA 5D8NA 2XEIA 3BHXA 4OIDA 2IMOA 3CPAA 3WC5A 4UEFA 4OC2A 4FBEA 3IIBA 3PEIA 5DS0A 2PJ2A 3SJEA 1ZLHA 2IQ6A 1KWMA 4OC5A 2ZEGA 4UIAA 3NH4A 3FECA 4MHPA 2GLFA 1PCAA 1CG2A 4KSIA 3SJFA 1TF9A 4FAIA 3KI9A 1LAPA 2V8VA 3L2NA 1LCPA 2PJ8A 2CTBA 4MCPA 1Y0RA 3D7HA 2ZEFA 3NA6A 4NJRA 3SI0A 1YLOA 4P4BA 1PYTB 4P4DA 1M4LA 3H8FA 5LRGA 1VHEA 2Q51A 1BAVA 3PBBA 3ISZA 3WT4A 3VH9A 4MRIA 1XJOA 2C6CA 4LQGA 1TXRA 4P4IA 4K3NA 3B3WA 2PJBA 1JQGA 3FF3A 1Z8LA 3D4UA 4MHZA 4MMOA 4PXDA 4AXVA 3DGVA 4P4JA 1GYTA 5HVGA 4H2KA 3S9LA 1VIXA 2ZEHA 1XBUA 1ZG8A 3PB8X 4ZY2A 2POKA 3FVLA 1CX8A 1BPNA 4NFRA 3IWWA 2DEAA 3K9TA 4PPZA 3H8EA 1EE3P 1ELMP 2PJ0A 2ABZA 5CBMA 3BI0A 2AFWA 1TKJA 2C6GA 3FMCA 5D29A 4X2TA 1HEEA 3IEHA 4UF4A 2EK9A 3KGQA 3LWUA 4EMEA 4MCRA 1TKFA 2O4HA 4NGRA 1IY7A 2AFUA 4Z65A 6CPAA 3PFEA 2ZEOA 2C6PA 3FH4A 4ZX8A 3WC6A 3S9MA 1Z5RA 2ZEMA 3B3VA 3D68A 1TF8A 4A94A 1TKHA 2XEGA 3FEDA 3NH8A 4NGMA 1XFOA 4ZY0A 3VARA 4R6TA 2OR4A 3IC1A 5LRJA 3S9NA 3KQXA 2PJ5A 2BCOA 3KR5A 4YWYA 4F9UA 4DUKA 2ZOFA 2JEWA 4F8ZA 3RAMA 3RBUA 3RZAA 3V38A 3TC8A 3NFZA 2AFZA 2WYRA 4A38A 4P45A 2QVPA 4ZI6A 5F09A 5JGFA 3B7IA 3PB6X 2FVGA 4IAVA 4OIWA 1AMPA 2V8GA 3KL9A 2V8DA 2C1CA 3JRUA 5ELYA 3HUVA 4MXUA 1Y7EA 3VATA 3KHZA 3MN8A 3B3TA 3FEEA 3SJXA 4ZYQA 1F57A 2PJ6A 1YW6A 4R7MA 1BLLE 2F8HA 4X3RA 3LMSA 3K2KA 1Q7LA 2PJ9A 2HB6A 5THWA 4EWTA 2PJ3A 4F9VA 2IJZA 3D7DA 2AFSA 2HC9A 2PJAA 2EWBA 1RTQA 2QYVA 4P6YA 2JBJA 5K8NA 2V77A 1Y0YA 3V7ZA 2I3CA 2AFOA 1BPMA 4EFDA 2CIJA 2PJCA 5JM6A 4NJQA 2Q4ZA 4OC3A 3N5FA 5K8OA 2BOAA 4A37A 4A39A 2CF4A 3I1UA 3QNVA 2NSMA 2PJ1A 3KHXA 3NH5A 2BO9A 1IGBA 3SJGA 5JH9A 4FUUA 5IB9A 4Q7AA 3SI2A 1ELLP 1CPXA 1CBXA 1CPSA 4BD9A 4P4FA 3GUXA 1AYEA 3HLPA 4ZY1A 4OP4A 2ZEEA 4PQAA 3FJUA 1DTDA 1LANA 3IJ3A 5K8MA 3PB7X 1UWYA 2JBKA 3D7FA 3PBEA 4P44A 4IK2A 1QMUA 4NGSA 1NSAA 2EK8A 3MRUA 4OC4A 2QJ8A 2RB7A 4OC0A 3D66A 1Z2LA 2V8HA 1HDQA 1LFWA 2Q43A 1ZG9A 2AFXA 1R3NA 2AFMA 4JYWA 2PIYA 4PXCA 4MCQA 1CP6A 3BXMA 1OBRA 1DE4C 4P4EA 2CTCA 2PE3A 5K8PA 5LYIA 4IHMA 1LAMA 4YU9A 1R43A 4OC1A 1VGYA 1ARMA 4UEEA 3KR4A 2GU2A 2ZOGA 5LYLA 3CT9A 3DLJA 2ANPA 1HDUA 4OKOA 2XEFA 2O53A 4UEZA 2PIZA 3D67A 2PVWA 4NGQA 2J9AA 4WJBA 5I4MA 2NYQA 3CDXA 5CPAA 4RUHA 3KZWA 1F2OA 4MHNA 4P10A 4NGTA 2PVVA 1YW4A 1XMBA 7CPAA 4NGNA 8CPAA 4TNUA 4PXEA 3PB4X 4ONWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O23 A;  3KQZ A;  1ARL A;  3BI1 A;  1QQ9 A;  3PRT A;  4JZ0 A;  3FX6 A;  3B3S A;  5LYD A;  4FWU A;  4NGP A;  3PFO A;  2PJ7 A;  1FT7 A;  4PXB A;  1ZLI A;  1CP7 A;  4G1P A;  1ZG7 A;  5J1Q A;  4TWE A;  2PRQ A;  2ZEP A;  3GB0 A;  4GM5 A;  3TX8 A;  3CPX A;  5LYF A;  2F7V A;  2PCU A;  4MHY A;  2VL1 A;  4ZX9 A;  2ZEN A;  2OOT A;  1YME A;  4DJL A;  3PB9 X;  3B2Y A;  3IFE A;  4OME A;  3H8G A;  1F2P A;  2WZN A;  2XEJ A;  2RFH A;  5LRK A;  2GRE A;  4R76 A;  2ZEL A;  5HXD A;  1XRY A;  3B3C A;  2GLJ A;  5HVH A;  3B35 A;  3T8W A;  3GLJ A;  1YSJ A;  3WAB A;  5HVF A;  3D7G A;  2PJ4 A;  1LOK A;  4R8F A;  3SI1 A;  3WC7 A;  4B6Z A;  3IO1 A;  4MCS A;  2G9D A;  4WWV A;  4UIB A;  1H8L A;  1FNO A;  3KAS A;  4CPA A;  3ISX A;  4DYO A;  2ZED A;  4W9Y A;  1VHO A;  4X8I A;  5D8N A;  2XEI A;  3BHX A;  4OID A;  2IMO A;  3CPA A;  3WC5 A;  4UEF A;  4OC2 A;  4FBE A;  3IIB A;  3PEI A;  5DS0 A;  2PJ2 A;  3SJE A;  1ZLH A;  2IQ6 A;  1KWM A;  4OC5 A;  2ZEG A;  4UIA A;  3NH4 A;  3FEC A;  4MHP A;  2GLF A;  1PCA A;  1CG2 A;  4KSI A;  3SJF A;  1TF9 A;  4FAI A;  3KI9 A;  1LAP A;  2V8V A;  3L2N A;  1LCP A;  2PJ8 A;  2CTB A;  4MCP A;  1Y0R A;  3D7H A;  2ZEF A;  3NA6 A;  4NJR A;  3SI0 A;  1YLO A;  4P4B A;  1PYT B;  4P4D A;  1M4L A;  3H8F A;  5LRG A;  1VHE A;  2Q51 A;  1BAV A;  3PBB A;  3ISZ A;  3WT4 A;  3VH9 A;  4MRI A;  1XJO A;  2C6C A;  4LQG A;  1TXR A;  4P4I A;  4K3N A;  3B3W A;  2PJB A;  1JQG A;  3FF3 A;  1Z8L A;  3D4U A;  4MHZ A;  4MMO A;  4PXD A;  4AXV A;  3DGV A;  4P4J A;  1GYT A;  5HVG A;  4H2K A;  3S9L A;  1VIX A;  2ZEH A;  1XBU A;  1ZG8 A;  3PB8 X;  4ZY2 A;  2POK A;  3FVL A;  1CX8 A;  1BPN A;  4NFR A;  3IWW A;  2DEA A;  3K9T A;  4PPZ A;  3H8E A;  1EE3 P;  1ELM P;  2PJ0 A;  2ABZ A;  5CBM A;  3BI0 A;  2AFW A;  1TKJ A;  2C6G A;  3FMC A;  5D29 A;  4X2T A;  1HEE A;  3IEH A;  4UF4 A;  2EK9 A;  3KGQ A;  3LWU A;  4EME A;  4MCR A;  1TKF A;  2O4H A;  4NGR A;  1IY7 A;  2AFU A;  4Z65 A;  6CPA A;  3PFE A;  2ZEO A;  2C6P A;  3FH4 A;  4ZX8 A;  3WC6 A;  3S9M A;  1Z5R A;  2ZEM A;  3B3V A;  3D68 A;  1TF8 A;  4A94 A;  1TKH A;  2XEG A;  3FED A;  3NH8 A;  4NGM A;  1XFO A;  4ZY0 A;  3VAR A;  4R6T A;  2OR4 A;  3IC1 A;  5LRJ A;  3S9N A;  3KQX A;  2PJ5 A;  2BCO A;  3KR5 A;  4YWY A;  4F9U A;  4DUK A;  2ZOF A;  2JEW A;  4F8Z A;  3RAM A;  3RBU A;  3RZA A;  3V38 A;  3TC8 A;  3NFZ A;  2AFZ A;  2WYR A;  4A38 A;  4P45 A;  2QVP A;  4ZI6 A;  5F09 A;  5JGF A;  3B7I A;  3PB6 X;  2FVG A;  4IAV A;  4OIW A;  1AMP A;  2V8G A;  3KL9 A;  2V8D A;  2C1C A;  3JRU A;  5ELY A;  3HUV A;  4MXU A;  1Y7E A;  3VAT A;  3KHZ A;  3MN8 A;  3B3T A;  3FEE A;  3SJX A;  4ZYQ A;  1F57 A;  2PJ6 A;  1YW6 A;  4R7M A;  1BLL E;  2F8H A;  4X3R A;  3LMS A;  3K2K A;  1Q7L A;  2PJ9 A;  2HB6 A;  5THW A;  4EWT A;  2PJ3 A;  4F9V A;  2IJZ A;  3D7D A;  2AFS A;  2HC9 A;  2PJA A;  2EWB A;  1RTQ A;  2QYV A;  4P6Y A;  2JBJ A;  5K8N A;  2V77 A;  1Y0Y A;  3V7Z A;  2I3C A;  2AFO A;  1BPM A;  4EFD A;  2CIJ A;  2PJC A;  5JM6 A;  4NJQ A;  2Q4Z A;  4OC3 A;  3N5F A;  5K8O A;  2BOA A;  4A37 A;  4A39 A;  2CF4 A;  3I1U A;  3QNV A;  2NSM A;  2PJ1 A;  3KHX A;  3NH5 A;  2BO9 A;  1IGB A;  3SJG A;  5JH9 A;  4FUU A;  5IB9 A;  4Q7A A;  3SI2 A;  1ELL P;  1CPX A;  1CBX A;  1CPS A;  4BD9 A;  4P4F A;  3GUX A;  1AYE A;  3HLP A;  4ZY1 A;  4OP4 A;  2ZEE A;  4PQA A;  3FJU A;  1DTD A;  1LAN A;  3IJ3 A;  5K8M A;  3PB7 X;  1UWY A;  2JBK A;  3D7F A;  3PBE A;  4P44 A;  4IK2 A;  1QMU A;  4NGS A;  1NSA A;  2EK8 A;  3MRU A;  4OC4 A;  2QJ8 A;  2RB7 A;  4OC0 A;  3D66 A;  1Z2L A;  2V8H A;  1HDQ A;  1LFW A;  2Q43 A;  1ZG9 A;  2AFX A;  1R3N A;  2AFM A;  4JYW A;  2PIY A;  4PXC A;  4MCQ A;  1CP6 A;  3BXM A;  1OBR A;  1DE4 C;  4P4E A;  2CTC A;  2PE3 A;  5K8P A;  5LYI A;  4IHM A;  1LAM A;  4YU9 A;  1R43 A;  4OC1 A;  1VGY A;  1ARM A;  4UEE A;  3KR4 A;  2GU2 A;  2ZOG A;  5LYL A;  3CT9 A;  3DLJ A;  2ANP A;  1HDU A;  4OKO A;  2XEF A;  2O53 A;  4UEZ A;  2PIZ A;  3D67 A;  2PVW A;  4NGQ A;  2J9A A;  4WJB A;  5I4M A;  2NYQ A;  3CDX A;  5CPA A;  4RUH A;  3KZW A;  1F2O A;  4MHN A;  4P10 A;  4NGT A;  2PVV A;  1YW4 A;  1XMB A;  7CPA A;  4NGN A;  8CPA A;  4TNU A;  4PXE A;  3PB4 X;  4ONW A; 
#chains in the Genus database with same CATH topology
 4Q38 A;  4O23 A;  3KQZ A;  5AG4 A;  1ARL A;  4UFX A;  3BI1 A;  1QQ9 A;  5IB0 A;  3PRT A;  4JZ0 A;  3FX6 A;  2PR1 A;  5C82 A;  3R9F A;  3B3S A;  5LYD A;  4FWU A;  4NGP A;  2WUU A;  1M44 A;  1BOB A;  2FS5 A;  3PFO A;  4MFZ A;  4CAF A;  2PJ7 A;  2Z3K A;  2J8N A;  4M6I A;  4KUB A;  1FT7 A;  4PXB A;  1ZLI A;  5AG7 A;  2R1I A;  4B12 A;  1CP7 A;  4HNX B;  4G1P A;  1ZG7 A;  1U6M A;  3GYA A;  4PSX A;  5J1Q A;  2IL4 A;  4QUS A;  1M4I A;  4TWE A;  2PRQ A;  2ZEP A;  3GB0 A;  2REE A;  4GM5 A;  3UY5 A;  3TX8 A;  3CPX A;  5LYF A;  2F7V A;  1LRZ A;  2PCU A;  4KVO E;  4MHY A;  5F49 A;  2VL1 A;  4MY0 A;  3E0K A;  4ZX9 A;  1XMT A;  2OU2 A;  2B5G B;  3C26 A;  3FYN A;  4KSF A;  2ZEN A;  4CS0 B;  2OOT A;  1YME A;  4DJL A;  2Z3N A;  3PB9 X;  4NF1 A;  1YQE A;  2B4D B;  5F48 A;  3B2Y A;  3IFE A;  2KCW A;  4OME A;  2HV2 A;  3OWC A;  3H8G A;  4MHD A;  5G21 A;  2BUE A;  2Z11 A;  4AVA A;  4B5P A;  3LOD A;  3QB8 A;  4ONU A;  2I00 A;  1MK4 A;  3R95 A;  3EO4 A;  1F2P A;  2WZN A;  4K30 A;  2XEJ A;  4JJX A;  1BO4 A;  1Y7R A;  4Y49 B;  1NSL A;  2FIA A;  2RFH A;  2GRE A;  5LRK A;  4R76 A;  2ZEL A;  1ZO0 A;  4KUA A;  3SXO A;  5HXD A;  4KLV A;  2ZW6 A;  4LUA A;  1ON0 A;  1XRY A;  4CRZ B;  3B3C A;  1L0C A;  2GLJ A;  3DR6 A;  4U9Z A;  5IX3 A;  5HVH A;  4CYO A;  3B35 A;  1Z8X A;  3FXT A;  4PSW A;  4A32 A;  4MFL A;  3T8W A;  3TCV A;  3GLJ A;  1YSJ A;  3WAB A;  1YLE A;  5HVF A;  2B3V A;  4MBU A;  2FT0 A;  3D7G A;  1B87 A;  2PJ4 A;  1AUG A;  1LOK A;  4R8F A;  3SI1 A;  3WC7 A;  1IYK A;  3JUW A;  4H6Z A;  4YGO A;  4B6Z A;  3IO1 A;  4UA3 A;  4MCS A;  2G9D A;  4WWV A;  3T90 A;  4UIB A;  1H8L A;  4KOW A;  1FNO A;  4IF5 A;  3KAS A;  3RNZ A;  1B6B A;  2QIR A;  2JLM A;  4CPA A;  3ISX A;  2AJ6 A;  3S6G A;  4DYO A;  2GFQ A;  2J8M A;  2ZED A;  1I12 A;  4W9Y A;  1Y9W A;  1VHO A;  4X8I A;  1V0C A;  5D8N A;  2XEI A;  3DSB A;  1S60 A;  3BHX A;  4M85 A;  4OID A;  4BBH A;  2IMO A;  4HKF A;  3FRM A;  5AGE A;  3CPA A;  3WC5 A;  3LAC A;  4UEF A;  4OC2 A;  4MFJ A;  3R9E A;  4FBE A;  3VWE A;  1Z8W A;  3IIB A;  3EXN A;  3PEI A;  2DPT A;  2PJ2 A;  5DS0 A;  2Y0M A;  4AB7 A;  4LX9 A;  2HUZ A;  3SJE A;  4RS2 A;  4AVB A;  1ZLH A;  2IQ6 A;  1KWM A;  2B4D A;  2ZEG A;  4OC5 A;  4UIA A;  3NH4 A;  3FEC A;  4MHP A;  2GLF A;  2GAN A;  1PCA A;  1CG2 A;  4KSI A;  2ARH A;  2OZG A;  1Z9U A;  3SJF A;  1TF9 A;  4FAI A;  3KI9 A;  1LAP A;  2V8V A;  1XIX A;  3L2N A;  5IV0 A;  1LCP A;  1I1D A;  2CTB A;  2CXA A;  2PJ8 A;  4MCP A;  4UCP A;  1S3Z A;  1Y0R A;  5J8F A;  3D7H A;  2CY2 A;  4XPK A;  2ZEF A;  3NA6 A;  4NJR A;  3SI0 A;  1YLO A;  4P4B A;  1PYT B;  4OAE A;  4P4D A;  5E96 A;  2B3U A;  1M4L A;  2PSW A;  2P6F A;  2R8V A;  1IB1 E;  2VQY A;  3H8F A;  5LRG A;  4AG7 A;  1VHE A;  4E2A A;  3W6X A;  5EC4 A;  2REF A;  3F5B A;  4YRH A;  1MJA A;  1VKC A;  1BAV A;  2Q51 A;  4A31 A;  3S6F A;  1VHS A;  3PBB A;  3FNC A;  2Z0Z A;  3ISZ A;  4XPD C;  3WT4 A;  3VH9 A;  4MRI A;  4MFQ A;  1XJO A;  2C6C A;  1YGH A;  1S7L A;  4ZGY B;  4B11 A;  4LQG A;  5A28 A;  1FY7 A;  1TXR A;  1N71 A;  4P4I A;  4K3N A;  3B3W A;  2PJB A;  4QC6 A;  1JQG A;  3FF3 A;  5F47 A;  2JDC A;  4L8A A;  1Z8L A;  4II9 A;  3D4U A;  4MHZ A;  4MMO A;  2WSA A;  4PXD A;  2P6E A;  4A30 A;  4AXV A;  3DGV A;  4P4J A;  1GYT A;  4UFV A;  5C88 A;  3QAY A;  4H2K A;  5HVG A;  3S9L A;  1VIX A;  2ZEH A;  1XBU A;  3CZX A;  4HNW B;  4LQ6 A;  4PK2 A;  4XPL A;  1ZG8 A;  3PB8 X;  4KVM E;  4ZY2 A;  2POK A;  3FVL A;  1CX8 A;  1BPN A;  4NFR A;  3NE7 A;  1Q2C A;  3IWW A;  2DEA A;  3CXQ A;  2Z3M A;  1A2Z A;  3GIU A;  3K9T A;  4YFJ A;  1MJ9 A;  1TIQ A;  4M6G A;  4NSQ A;  4PV6 A;  4PPZ A;  1QSM A;  4JXQ A;  2H5M A;  3BLN A;  4JWP A;  1KUX A;  3TT2 A;  3H8E A;  4U5Y A;  2X7B A;  3GKR A;  1EE3 P;  1ELM P;  2PJ0 A;  2YNE A;  4XNH B;  2ZW5 A;  5KTD A;  1QST A;  4F0Y A;  4BIN A;  4R9M A;  2ZW4 A;  5GCN A;  1P4N A;  1IU8 A;  1QSR A;  4AVC A;  2ABZ A;  1X12 A;  5CBM A;  3D3S A;  3BI0 A;  4OAD A;  2VZY A;  1PUA A;  4E8O A;  3RO0 A;  1WWZ A;  2AFW A;  1TKJ A;  2C6G A;  3FMC A;  5D29 A;  4A33 A;  5FVJ A;  1CM0 A;  4X2T A;  1HEE A;  3IEH A;  3EC4 A;  4C2Y A;  4FD4 A;  4NXY A;  2G0B A;  2DF5 A;  4UF4 A;  2EK9 A;  2EBJ A;  3KKW A;  2YGW A;  2YND A;  3D8P A;  3KGQ A;  3LWU A;  1NMT A;  3H4Q A;  4EME A;  3PZJ A;  4MCR A;  1J4J A;  3IU1 A;  4OLL A;  2O4H A;  1TKF A;  4NGR A;  1IY7 A;  2AFU A;  4PK3 A;  4B13 A;  4CGN A;  3JVN A;  4Z65 A;  6CPA A;  3PFE A;  2ZEO A;  2C6P A;  4B5O A;  3ZZI A;  1I21 A;  4KOY A;  3FH4 A;  2GIV A;  4ZX8 A;  4C2Z A;  3WC6 A;  3S9M A;  3P2H A;  3TTH A;  2EO8 A;  1Z5R A;  2ZEM A;  4JXR A;  1S7N A;  3B3V A;  3D68 A;  4EVY A;  4KOV A;  1M1D A;  1TF8 A;  4A94 A;  4CAW A;  2CNS A;  3QAH A;  1TKH A;  2HQY A;  2BEI A;  2XEG A;  4J3G A;  2G3A A;  3FED A;  3NH8 A;  4NGM A;  1XFO A;  4ZY0 A;  2I79 A;  1YVO A;  2FL4 A;  2Q7B A;  3T9Y A;  3TO7 A;  3VAR A;  4R6T A;  5AG6 A;  2ZPA A;  3IGR A;  1MJB A;  2EUI A;  2OR4 A;  3IC1 A;  5LRJ A;  3S9N A;  1YR0 A;  2BL1 A;  3KQX A;  4NCZ A;  1XOV A;  4UBR A;  2PJ5 A;  2ODF A;  2BCO A;  3KR5 A;  2DXQ A;  3WR7 A;  4YWY A;  2Z3L A;  4DUK A;  2ZOF A;  2JEW A;  4CAV A;  4F8Z A;  3DNS A;  3RAM A;  3RBU A;  3RZA A;  1IID A;  4UCM A;  4KOR A;  3FB3 A;  4GXH A;  3V38 A;  1YRE A;  3TC8 A;  4A2Z A;  3NFZ A;  4KS9 A;  1Z4E A;  2QEC A;  1S7K A;  2AFZ A;  4CYP A;  2WYR A;  4A38 A;  4CGO A;  4P45 A;  2PDO A;  2QVP A;  5J8C A;  1XF8 A;  1K4J A;  2FXF A;  4ZI6 A;  2Q4Y A;  5F09 A;  3A9L A;  3MGD A;  1CJW A;  3CXP A;  4UWI A;  3BJ8 A;  3B7I A;  5JGF A;  2EVN A;  2BSW A;  5KTA A;  4Q36 A;  3PB6 X;  2FVG A;  3R9G A;  2JEV A;  4IAV A;  4OIW A;  1AMP A;  2WPW A;  2V8G A;  3F8K A;  1NE9 A;  5JPH A;  3KL9 A;  2DPS A;  2V8D A;  2C1C A;  3JRU A;  5ELY A;  5HMN A;  3HUV A;  3JTK A;  1X10 A;  4MXU A;  4QVT A;  4QB9 A;  4R87 A;  1QSO A;  2ATR A;  3IWE A;  4R57 A;  2YNC C;  1Y7E A;  2FIW A;  3VAT A;  3KHZ A;  2G3T A;  4MJ8 A;  3MN8 A;  1RO5 A;  3B3T A;  3FEE A;  5CNP A;  2ZW7 A;  1YK3 A;  2O28 A;  1R57 A;  3IWG A;  3SJX A;  4ZYQ A;  1F57 A;  2Q44 A;  4CGL A;  2PJ6 A;  4KSA A;  1YW6 A;  3TOA A;  4R3K A;  4CGP A;  5HH1 A;  1IOF A;  2ZXV A;  5G1Z A;  4R7M A;  1BLL E;  1JWQ A;  2F8H A;  2Q7S A;  4X3R A;  3LMS A;  3K2K A;  1Q7L A;  4MI4 A;  3CXS A;  1QSN A;  2HB6 A;  2PJ9 A;  5THW A;  4EWT A;  2PJ3 A;  4F9V A;  1IIC A;  3IU2 A;  5H86 A;  1WK4 A;  2IJZ A;  2A4N A;  2Q4V A;  2Z3P A;  3H5Z A;  3TFY A;  3D7D A;  4FD5 A;  2AFS A;  1GHE A;  2HC9 A;  1P0H A;  2PJA A;  3GY9 A;  1KUY A;  3K9U A;  3LD2 A;  4CYN A;  4M6H A;  2EWB A;  1RTQ A;  2QYV A;  4P6Y A;  2JBJ A;  5K8N A;  2V77 A;  5AG5 A;  4AG9 A;  1Y0Y A;  3V7Z A;  1Z4R A;  2CNT A;  2I3C A;  3PP9 A;  2AFO A;  4RN7 A;  4C7H A;  2WPX A;  2Q04 A;  2Z3O A;  1YVK A;  1BPM A;  2FE7 A;  1S7F A;  4KZT A;  4EFD A;  2CIJ A;  2PJC A;  3D2P A;  5JM6 A;  1YX0 A;  4NJQ A;  2Q4Z A;  4OC3 A;  4R3L A;  4C68 A;  3N5F A;  4ORF A;  5K8O A;  4MFP A;  5BWA B;  4MY3 A;  2BOA A;  4A37 A;  4C2X A;  4A39 A;  4FD6 A;  4L89 A;  4F6A A;  2CF4 A;  1M4D A;  3I1U A;  2NSM A;  2PC1 A;  3QNV A;  2PJ1 A;  5DWM A;  3KHX A;  3NH5 A;  2BO9 A;  4ZBG A;  1IGB A;  3SJG A;  4B10 A;  5JH9 A;  4FUU A;  5IB9 A;  2VBQ A;  3VWD A;  4H6U A;  4C7I A;  4Q7A A;  3SI2 A;  5G22 A;  1ELL P;  1CPX A;  5A27 A;  1CBX A;  3I3G A;  2PQ8 A;  3NE8 A;  4F9U A;  1CPS A;  4E0A A;  4BD9 A;  3V8I A;  4P4F A;  3N7Z A;  4UFW A;  4X5K A;  3F0A A;  3GUX A;  1AYE A;  4BMH A;  3HLP A;  1UFH A;  4JD6 A;  2Q0Y A;  4ZY1 A;  1Q2Y A;  4OP4 A;  3W6S A;  4HPS A;  2OB0 A;  2F5I A;  2Z10 A;  3B8G A;  2ZEE A;  5EBV A;  4PQA A;  3FJU A;  4FD7 A;  3R96 A;  1DTD A;  1RXT A;  1LAN A;  2OZH A;  3IJ3 A;  2GE3 A;  5K8M A;  3PB7 X;  5ISV A;  4XPD B;  1UWY A;  3D2M A;  3W91 A;  3BJ7 A;  1XEB A;  4IUS A;  5DWN A;  4QBJ A;  2JBK A;  1KUV A;  3D7F A;  3PBE A;  4KOX A;  4P44 A;  2OZU A;  4IK2 A;  1QMU A;  4NGS A;  2RC4 A;  2R7H A;  3TO6 A;  1NSA A;  3SHP A;  2EK8 A;  3MRU A;  4OC4 A;  2FCK A;  4HNY B;  2QJ8 A;  3ZJ0 A;  2RB7 A;  4CGM A;  4OC0 A;  5F46 A;  3D66 A;  1Z2L A;  2V8H A;  1HDQ A;  1LFW A;  4UWJ A;  2Q43 A;  4KLW A;  4CAX A;  1S5K A;  1Z8T A;  2QML A;  3DR8 A;  4A95 A;  4CYQ A;  1ZG9 A;  2R98 A;  2B4B A;  2AFX A;  5EMI A;  1R3N A;  5KTC A;  1Q2D A;  4F0X A;  3TE4 A;  2PRB A;  1PU9 A;  2AFM A;  2D4P A;  4KOT A;  4JYW A;  2PIY A;  4RI1 A;  4PXC A;  4XNH C;  3TOB A;  2OH1 A;  4MCQ A;  1CP6 A;  3BXM A;  1OBR A;  1DE4 C;  3PGP A;  2J8R A;  2CNM A;  3FBU A;  2CTC A;  3FIX A;  4P4E A;  2VEZ A;  3S6H A;  2FSR A;  2C27 A;  2PE3 A;  5K8P A;  5LYI A;  1IOI A;  4IHM A;  3DDD A;  4B14 A;  1LAM A;  5I0C A;  4YU9 A;  1R43 A;  3R1K A;  4OC1 A;  1VGY A;  2B5G A;  2P6G A;  1ARM A;  2VXK A;  4UEE A;  4U9Y A;  3G3S A;  3KR4 A;  2GU2 A;  2ZOG A;  1XE4 A;  4Y49 C;  5LYL A;  3CT9 A;  4MFK A;  3DLJ A;  2ANP A;  1Y9K A;  5G20 A;  4DNC A;  1HDU A;  4GS4 A;  3I9S A;  4UCN A;  4OKO A;  2XEF A;  2O53 A;  4KOS A;  1SQH A;  4M3S A;  3S6K A;  4UEZ A;  4B5P B;  2VZZ A;  2JDD A;  2PIZ A;  2PR8 A;  3EY5 A;  2AE6 A;  4KVX A;  4NEX A;  1IYL A;  2K5T A;  3D67 A;  2PVW A;  4NGQ A;  4JLY A;  5JQ4 A;  2J9A A;  4WJB A;  3SXN A;  2YNC A;  3RYO A;  1KZF A;  5I4M A;  4KOU A;  3EFA A;  3G8W A;  4CAE A;  2NYQ A;  3CDX A;  5CPA A;  4RUH A;  3KZW A;  1F2O A;  4I49 A;  2P0W A;  4MHN A;  4P10 A;  4NGT A;  2NMT A;  2PVV A;  1YW4 A;  1XMB A;  7CPA A;  4H89 A;  2D4O A;  4NGN A;  8CPA A;  2B58 A;  4TNU A;  4PXE A;  5H84 A;  1OZP A;  1M4G A;  3PB4 X;  3P2F A;  4CRY B;  2VI7 A;  3TO9 A;  4ONW A; 
#chains in the Genus database with same CATH homology
 4O23 A;  3KQZ A;  1ARL A;  3BI1 A;  1QQ9 A;  3PRT A;  4JZ0 A;  3FX6 A;  3B3S A;  5LYD A;  4FWU A;  4NGP A;  3PFO A;  2PJ7 A;  1FT7 A;  4PXB A;  1ZLI A;  1CP7 A;  4G1P A;  1ZG7 A;  5J1Q A;  4TWE A;  2PRQ A;  2ZEP A;  3GB0 A;  4GM5 A;  3TX8 A;  3CPX A;  5LYF A;  2F7V A;  2PCU A;  4MHY A;  2VL1 A;  4ZX9 A;  2ZEN A;  2OOT A;  1YME A;  4DJL A;  3PB9 X;  3B2Y A;  3IFE A;  4OME A;  3H8G A;  1F2P A;  2WZN A;  2XEJ A;  2RFH A;  5LRK A;  2GRE A;  4R76 A;  2ZEL A;  5HXD A;  1XRY A;  3B3C A;  2GLJ A;  5HVH A;  3B35 A;  3T8W A;  3GLJ A;  1YSJ A;  3WAB A;  5HVF A;  3D7G A;  2PJ4 A;  1LOK A;  4R8F A;  3SI1 A;  3WC7 A;  4B6Z A;  3IO1 A;  4MCS A;  2G9D A;  4WWV A;  4UIB A;  1H8L A;  1FNO A;  3KAS A;  4CPA A;  3ISX A;  4DYO A;  2ZED A;  4W9Y A;  1VHO A;  4X8I A;  5D8N A;  2XEI A;  3BHX A;  4OID A;  2IMO A;  3CPA A;  3WC5 A;  4UEF A;  4OC2 A;  4FBE A;  3IIB A;  3PEI A;  5DS0 A;  2PJ2 A;  3SJE A;  1ZLH A;  2IQ6 A;  1KWM A;  4OC5 A;  2ZEG A;  4UIA A;  3NH4 A;  3FEC A;  4MHP A;  2GLF A;  1PCA A;  1CG2 A;  4KSI A;  3SJF A;  1TF9 A;  4FAI A;  3KI9 A;  1LAP A;  2V8V A;  3L2N A;  1LCP A;  2PJ8 A;  2CTB A;  4MCP A;  1Y0R A;  3D7H A;  2ZEF A;  3NA6 A;  4NJR A;  3SI0 A;  1YLO A;  4P4B A;  1PYT B;  4P4D A;  1M4L A;  3H8F A;  5LRG A;  1VHE A;  2Q51 A;  1BAV A;  3PBB A;  3ISZ A;  3WT4 A;  3VH9 A;  4MRI A;  1XJO A;  2C6C A;  4LQG A;  1TXR A;  4P4I A;  4K3N A;  3B3W A;  2PJB A;  1JQG A;  3FF3 A;  1Z8L A;  3D4U A;  4MHZ A;  4MMO A;  4PXD A;  4AXV A;  3DGV A;  4P4J A;  1GYT A;  5HVG A;  4H2K A;  3S9L A;  1VIX A;  2ZEH A;  1XBU A;  1ZG8 A;  3PB8 X;  4ZY2 A;  2POK A;  3FVL A;  1CX8 A;  1BPN A;  4NFR A;  3IWW A;  2DEA A;  3K9T A;  4PPZ A;  3H8E A;  1EE3 P;  1ELM P;  2PJ0 A;  2ABZ A;  5CBM A;  3BI0 A;  2AFW A;  1TKJ A;  2C6G A;  3FMC A;  5D29 A;  4X2T A;  1HEE A;  3IEH A;  4UF4 A;  2EK9 A;  3KGQ A;  3LWU A;  4EME A;  4MCR A;  1TKF A;  2O4H A;  4NGR A;  1IY7 A;  2AFU A;  4Z65 A;  6CPA A;  3PFE A;  2ZEO A;  2C6P A;  3FH4 A;  4ZX8 A;  3WC6 A;  3S9M A;  1Z5R A;  2ZEM A;  3B3V A;  3D68 A;  1TF8 A;  4A94 A;  1TKH A;  2XEG A;  3FED A;  3NH8 A;  4NGM A;  1XFO A;  4ZY0 A;  3VAR A;  4R6T A;  2OR4 A;  3IC1 A;  5LRJ A;  3S9N A;  3KQX A;  2PJ5 A;  2BCO A;  3KR5 A;  4YWY A;  4F9U A;  4DUK A;  2ZOF A;  2JEW A;  4F8Z A;  3RAM A;  3RBU A;  3RZA A;  3V38 A;  3TC8 A;  3NFZ A;  2AFZ A;  2WYR A;  4A38 A;  4P45 A;  2QVP A;  4ZI6 A;  5F09 A;  5JGF A;  3B7I A;  3PB6 X;  2FVG A;  4IAV A;  4OIW A;  1AMP A;  2V8G A;  3KL9 A;  2V8D A;  2C1C A;  3JRU A;  5ELY A;  3HUV A;  4MXU A;  1Y7E A;  3VAT A;  3KHZ A;  3MN8 A;  3B3T A;  3FEE A;  3SJX A;  4ZYQ A;  1F57 A;  2PJ6 A;  1YW6 A;  4R7M A;  1BLL E;  2F8H A;  4X3R A;  3LMS A;  3K2K A;  1Q7L A;  2PJ9 A;  2HB6 A;  5THW A;  4EWT A;  2PJ3 A;  4F9V A;  2IJZ A;  3D7D A;  2AFS A;  2HC9 A;  2PJA A;  2EWB A;  1RTQ A;  2QYV A;  4P6Y A;  2JBJ A;  5K8N A;  2V77 A;  1Y0Y A;  3V7Z A;  2I3C A;  2AFO A;  1BPM A;  4EFD A;  2CIJ A;  2PJC A;  5JM6 A;  4NJQ A;  2Q4Z A;  4OC3 A;  3N5F A;  5K8O A;  2BOA A;  4A37 A;  4A39 A;  2CF4 A;  3I1U A;  3QNV A;  2NSM A;  2PJ1 A;  3KHX A;  3NH5 A;  2BO9 A;  1IGB A;  3SJG A;  5JH9 A;  4FUU A;  5IB9 A;  4Q7A A;  3SI2 A;  1ELL P;  1CPX A;  1CBX A;  1CPS A;  4BD9 A;  4P4F A;  3GUX A;  1AYE A;  3HLP A;  4ZY1 A;  4OP4 A;  2ZEE A;  4PQA A;  3FJU A;  1DTD A;  1LAN A;  3IJ3 A;  5K8M A;  3PB7 X;  1UWY A;  2JBK A;  3D7F A;  3PBE A;  4P44 A;  4IK2 A;  1QMU A;  4NGS A;  1NSA A;  2EK8 A;  3MRU A;  4OC4 A;  2QJ8 A;  2RB7 A;  4OC0 A;  3D66 A;  1Z2L A;  2V8H A;  1HDQ A;  1LFW A;  2Q43 A;  1ZG9 A;  2AFX A;  1R3N A;  2AFM A;  4JYW A;  2PIY A;  4PXC A;  4MCQ A;  1CP6 A;  3BXM A;  1OBR A;  1DE4 C;  4P4E A;  2CTC A;  2PE3 A;  5K8P A;  5LYI A;  4IHM A;  1LAM A;  4YU9 A;  1R43 A;  4OC1 A;  1VGY A;  1ARM A;  4UEE A;  3KR4 A;  2GU2 A;  2ZOG A;  5LYL A;  3CT9 A;  3DLJ A;  2ANP A;  1HDU A;  4OKO A;  2XEF A;  2O53 A;  4UEZ A;  2PIZ A;  3D67 A;  2PVW A;  4NGQ A;  2J9A A;  4WJB A;  5I4M A;  2NYQ A;  3CDX A;  5CPA A;  4RUH A;  3KZW A;  1F2O A;  4MHN A;  4P10 A;  4NGT A;  2PVV A;  1YW4 A;  1XMB A;  7CPA A;  4NGN A;  8CPA A;  4TNU A;  4PXE A;  3PB4 X;  4ONW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...