2ZEPA

Crystal structure of the human glutaminyl cyclase mutant h319l at 2.1 angstrom resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLLLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zepA00
1GYTA 2V8VA 3IO1A 2BCOA 3CPAA 1ZG7A 2G9DA 4W9YA 4ZX9A 4A94A 4OC1A 5HXDA 3CDXA 3CT9A 2J9AA 3VARA 2WYRA 1DE4C 3B2YA 2PJAA 4P4JA 2C1CA 1YMEA 4UF4A 4MCRA 3B3TA 4CPAA 4MCPA 3ISXA 1CPXA 1KWMA 4PQAA 3SI2A 2HB6A 3B7IA 3H8EA 4P10A 2AFZA 3D68A 4WJBA 1LAPA 4NGSA 3LMSA 1XBUA 3SI0A 3RBUA 2ABZA 1AMPA 4UEEA 3H8FA 4DJLA 3DLJA 3RAMA 3BHXA 5THWA 1H8LA 1YW6A 4PPZA 4AXVA 1ZLIA 4MHYA 3PFEA 4ZY1A 4YWYA 1CX8A 1Q7LA 2Q4ZA 1TKFA 4NGRA 3N5FA 1CBXA 2PJ3A 4WWVA 4H2KA 5JGFA 4RUHA 1Z8LA 5I4MA 3BI0A 4YU9A 2ZEPA 3PBBA 4EWTA 2V8DA 3WC7A 3L2NA 5ELYA 2OR4A 4PXDA 4MHZA 1BLLE 1Z5RA 4G1PA 4Q7AA 4F9VA 2IMOA 4R6TA 3FEDA 1PCAA 2BOAA 5JM6A 1XMBA 3ISZA 4OC4A 1CG2A 2I3CA 3LWUA 4FAIA 3FX6A 1TF9A 2ZEGA 1NSAA 1VHEA 2ZEEA 2PCUA 1F2PA 4UEFA 2PIZA 4GM5A 1LAMA 2EK8A 1TKJA 1Y0YA 4NGNA 4PXEA 3WC5A 3NH4A 4OIDA 4X8IA 2AFOA 5DS0A 4EMEA 3FEEA 2NYQA 3B3CA 1QMUA 4DUKA 3FH4A 2PJ9A 3PB4X 3NFZA 2O53A 4BD9A 1ELMP 4MXUA 5LRKA 2PJ2A 3S9LA 4MCSA 5LYLA 1JQGA 4OC2A 3D66A 3MN8A 1FNOA 1Z2LA 3I1UA 2EWBA 1ZG9A 3PB9X 2CTBA 3V38A 1UWYA 1EE3P 3WC6A 3NH8A 4NGTA 3QNVA 3FJUA 4B6ZA 2ZEFA 3KQZA 3GB0A 3SJXA 2XEGA 2RB7A 4R8FA 1ARLA 1XJOA 1YLOA 4UEZA 3FECA 5LYDA 5JH9A 2GU2A 3S9MA 1M4LA 3KI9A 3KR4A 5K8PA 2PJ6A 4PXCA 3BXMA 2V77A 3HUVA 3K9TA 4KSIA 4P45A 4JZ0A 4R7MA 4TWEA 4OKOA 2PVWA 4MCQA 2F8HA 2IJZA 4JYWA 3B3VA 4IAVA 5HVGA 4NFRA 5LYIA 2NSMA 1VHOA 4OP4A 2C6GA 3SJGA 2XEFA 2PJ0A 4IHMA 1BAVA 4OIWA 4NJRA 3VH9A 2AFMA 3K2KA 4MMOA 1TXRA 1Y7EA 2PJ7A 2XEJA 1F2OA 4P4EA 3IEHA 1YW4A 2DEAA 3IFEA 1CP7A 2PIYA 3KZWA 2ZEOA 3PEIA 4NGMA 2WZNA 2ZEMA 4P6YA 3KQXA 4ZY2A 4ZYQA 4TNUA 5IB9A 1CPSA 3IC1A 4K3NA 3D7FA 3GLJA 4MRIA 1LCPA 5K8MA 2AFWA 3B3SA 1XFOA 4MHNA 2PJBA 4P4FA 2AFUA 4OC5A 4P4BA 3B35A 2ZENA 2JBKA 2POKA 3WABA 1IGBA 1ZLHA 7CPAA 1XRYA 5LRJA 3WT4A 3V7ZA 4X3RA 4UIAA 5LRGA 3D4UA 4ONWA 5HVHA 3KR5A 3PRTA 1ELLP 1RTQA 4ZI6A 2ANPA 2EK9A 2HC9A 2C6PA 3IWWA 2GLFA 4FWUA 2QJ8A 3TX8A 2ZEDA 3NA6A 8CPAA 3SI1A 3NH5A 4UIBA 4A37A 3FF3A 4PXBA 3PB7X 3SJEA 4ZY0A 3IJ3A 1HDQA 3HLPA 3PB8X 3D7HA 3MRUA 3FMCA 2CIJA 3SJFA 3D7DA 3TC8A 3KASA 2PRQA 3PB6X 2VL1A 2FVGA 1PYTB 4O23A 4LQGA 1BPNA 4MHPA 1IY7A 1HEEA 3BI1A 5K8NA 2O4HA 6CPAA 4ZX8A 2ZOFA 4R76A 4A39A 3H8GA 1LFWA 3GUXA 1R43A 1LOKA 3KHZA 3RZAA 2ZELA 2PE3A 4OC3A 5LYFA 2F7VA 3KL9A 1VIXA 1BPMA 1HDUA 4DYOA 2JBJA 3D7GA 3PBEA 2Q51A 1VGYA 2ZOGA 1FT7A 2GLJA 4A38A 2BO9A 3DGVA 4EFDA 4Z65A 1YSJA 4P4IA 5CPAA 2CF4A 3FVLA 2V8HA 2V8GA 2JEWA 1CP6A 3B3WA 2RFHA 3KHXA 2OOTA 1F57A 1LANA 4NJQA 4F8ZA 5CBMA 5K8OA 3JRUA 1Y0RA 4OMEA 2PJCA 2PJ1A 4OC0A 5D8NA 5J1QA 5HVFA 4FBEA 1OBRA 2PJ4A 2GREA 2QVPA 4IK2A 2CTCA 1R3NA 4NGPA 2ZEHA 3T8WA 2QYVA 2IQ6A 3IIBA 2AFSA 2PJ8A 3VATA 3S9NA 4FUUA 2PJ5A 3D67A 2XEIA 1DTDA 1ZG8A 5D29A 2PVVA 2AFXA 1ARMA 2C6CA 1AYEA 2Q43A 4P4DA 1QQ9A 3PFOA 1TKHA 4P44A 1TF8A 4NGQA 4F9UA 3KGQA 5F09A 4X2TA 3CPXA
chains in the Genus database with same CATH superfamily
1GYTA 2V8VA 4CAWA 3G3SA 3IO1A 2BCOA 1V0CA 2K5TA 3CPAA 4UBRA 4Y49B 4CYOA 1IB1E 2Q44A 1ZG7A 2G9DA 4W9YA 2FSRA 4ZX9A 4A94A 4OC1A 5HXDA 3CDXA 3CT9A 2J9AA 1S7NA 3VARA 2ATRA 2REEA 2WYRA 4K30A 2PSWA 1DE4C 2I00A 3B2YA 1NE9A 2Z3PA 4I49A 5KTAA 2PJAA 1BOBA 2DPSA 4P4JA 3D3SA 4B5OA 2C1CA 1YMEA 2ZW4A 1IICA 5IX3A 4C7IA 4UF4A 4ZGYB 4MCRA 3B3TA 4CPAA 2QMLA 4MCPA 2RC4A 2Q4VA 3ISXA 1CPXA 4X5KA 5G1ZA 1KWMA 4UFXA 4B13A 4PQAA 3SI2A 2HB6A 4Y49C 3B7IA 3H8EA 4MFKA 2BUEA 3DR6A 4P10A 2AFZA 3D68A 4M3SA 4JJXA 4MHDA 4WJBA 1LAPA 4NGSA 4Q38A 4II9A 2GE3A 3LMSA 1XBUA 3SI0A 3I9SA 3QAHA 2ABZA 3RBUA 4DNCA 1AMPA 5G22A 5GCNA 4UEEA 3H8FA 3BLNA 4DJLA 3DLJA 3RAMA 3BHXA 5THWA 1MJ9A 1H8LA 4CAXA 1X12A 1YW6A 4PPZA 4AXVA 1ZLIA 4MHYA 4ONUA 3PFEA 4R3KA 4ZY1A 1IYKA 2Q0YA 4YWYA 2Q7SA 3R9GA 1CX8A 1B6BA 4R87A 1Q7LA 4C2YA 2Q4ZA 3TCVA 1TKFA 3H5ZA 1XF8A 4NGRA 3N5FA 1CBXA 4AG7A 2PJ3A 4WWVA 3SXOA 3T9YA 5KTCA 2FIWA 2FE7A 4H2KA 4JXRA 1M4IA 5JGFA 3TO9A 2O28A 4RUHA 1P4NA 1Z8LA 5A28A 2B4DA 5I4MA 5EMIA 3BI0A 2J8NA 3DR8A 5J8CA 4YU9A 4C2XA 2PRBA 2ZEPA 2P6EA 1S3ZA 2BSWA 3PBBA 1XOVA 4EWTA 3P2HA 2V8DA 4A30A 4AVBA 3WC7A 1VHSA 3L2NA 5ELYA 4PK2A 2WPXA 5HMNA 2OR4A 3QAYA 2Z3MA 1IU8A 4PXDA 1X10A 2J8MA 3CZXA 4MHZA 1I21A 1BLLE 3EFAA 4UWJA 3TTHA 4C7HA 1Z5RA 4Q36A 4G1PA 1IYLA 4Q7AA 4F9VA 1YVKA 4KORA 2IMOA 4R6TA 3FEDA 1I1DA 4KOSA 5IV0A 1QSRA 2B3UA 1WWZA 1PCAA 2BOAA 5JM6A 4XPDB 2Z3KA 4NSQA 1XMBA 2VZZA 4IUSA 3ISZA 3CXSA 4QUSA 3DSBA 4OC4A 1CG2A 4GS4A 2I3CA 3LWUA 3H4QA 2B4BA 4FAIA 3FX6A 4CS0B 3TO7A 5AGEA 1TF9A 3IWGA 2ZEGA 4KVME 1NSAA 1VHEA 3F5BA 2GANA 3EC4A 4CRYB 2ZEEA 2PCUA 1QSMA 1F2PA 2CY2A 4MFQA 2PIZA 4UEFA 4GM5A 1LAMA 2EK8A 5JQ4A 4UCPA 1TKJA 1YX0A 2CNSA 2R98A 1Y0YA 4NGNA 4PXEA 2EBJA 3WC5A 2JDDA 3NH4A 4OIDA 3F0AA 4X8IA 4CGMA 2AFOA 1A2ZA 5DS0A 4EMEA 3D2MA 3FEEA 4KZTA 4BBHA 1XE4A 4HNXB 3KKWA 4UA3A 1MK4A 4E8OA 4F0YA 2NYQA 3B3CA 1QMUA 1JWQA 4KOYA 4DUKA 3FH4A 4L8AA 2PJ9A 3PB4X 3F8KA 5ISVA 3NFZA 5AG6A 2O53A 4BD9A 1ELMP 4CRZB 4CYPA 4MXUA 4A2ZA 3IU2A 1KUYA 2OB0A 2PC1A 2PJ2A 1ZO0A 1NSLA 5BWAB 4KLWA 5LRKA 3S9LA 4MCSA 5LYLA 1JQGA 4OC2A 3D66A 3MN8A 1FNOA 1Z2LA 2DPTA 4HNYB 3I1UA 2EWBA 1ZG9A 3PB9X 2CTBA 4B14A 4KVOE 3V38A 4KSFA 4QB9A 4CGOA 2AE6A 1UWYA 1EE3P 4X2TA 3WC6A 3NH8A 4NGTA 4F0XA 3QNVA 3R1KA 5F49A 3FJUA 1SQHA 1YGHA 1Z8TA 2B5GA 4B6ZA 2ZEFA 4MFZA 3KQZA 3GB0A 3SJXA 4UCNA 2XEGA 2IL4A 2I79A 4R9MA 2Z10A 1IIDA 3S6GA 2RB7A 4R8FA 2BL1A 2ZW7A 1ARLA 1XJOA 3R9EA 4B11A 1AUGA 1YLOA 4UEZA 5G21A 3FECA 5LYDA 5JH9A 2GU2A 2Y0MA 3S9MA 1M4LA 1QSOA 3KI9A 1KUXA 3KR4A 3RO0A 3S6KA 4B5PA 5K8PA 2DF5A 2PJ6A 4PXCA 1S7LA 1K4JA 3BXMA 3K9UA 2V77A 3HUVA 4MY3A 2DXQA 4AVCA 4XPLA 2YNDA 1S7KA 2G0BA 3K9TA 2ZXVA 2Z3OA 4H89A 4KSIA 4P45A 4JZ0A 4R7MA 4KOWA 2OU2A 2Z11A 4TWEA 4OKOA 2PVWA 2ZW5A 4NF1A 4MCQA 4KOVA 2F8HA 2IJZA 1FY7A 2VEZA 4CYQA 2OZHA 4JYWA 3WR7A 2Z3LA 3E0KA 2KCWA 3B3VA 4QBJA 4IAVA 4CGLA 5HVGA 4NFRA 5LYIA 2NSMA 5EC4A 4F6AA 2C27A 5F48A 1VHOA 2JLMA 4OP4A 1R57A 2C6GA 4MFLA 4A31A 5DWNA 3SJGA 3FIXA 2ZPAA 1S7FA 2XEFA 2G3AA 2PJ0A 3D8PA 4IHMA 4A33A 1BAVA 2AJ6A 2FS5A 3TE4A 4OIWA 4NJRA 3VH9A 2AFMA 3K2KA 1YREA 3IWEA 3S6FA 4MMOA 3RYOA 2Q7BA 3R9FA 4U9ZA 1TXRA 1Y7EA 2PJ7A 2XEJA 3FRMA 1F2OA 4P4EA 3IEHA 4CYNA 1YW4A 3TO6A 2DEAA 2EUIA 3LODA 3IFEA 4PSXA 1CP7A 2PIYA 1XIXA 3KZWA 4FD7A 2PQ8A 2ZEOA 3PEIA 1CM0A 4NGMA 5E96A 2WZNA 3IU1A 1KUVA 2ZEMA 4LQ6A 4P6YA 3UY5A 1S60A 2B58A 3KQXA 4KVXA 4ZY2A 3S6HA 4ZYQA 4TNUA 5IB9A 3LD2A 1P0HA 5FVJA 3VWDA 1CPSA 2B3VA 2YNCA 2EVNA 3CXQA 3IC1A 4B10A 4K3NA 4PV6A 3D7FA 4QVTA 1M44A 3GKRA 3GLJA 4FD6A 1RO5A 4MRIA 1LCPA 5K8MA 2AFWA 3B3SA 1XFOA 4AB7A 4MHNA 3FBUA 2PJBA 3JTKA 3I3GA 4CGPA 2ODFA 2AFUA 4P4FA 4OC5A 4P4BA 1Y7RA 1RXTA 3B35A 1TIQA 4A32A 2ZENA 2JBKA 2Z0ZA 2POKA 4KUAA 1IGBA 1ZLHA 3WABA 3R95A 4BINA 1L0CA 1ON0A 2CXAA 3NE8A 4KLVA 7CPAA 1XRYA 4R3LA 5LRJA 3WT4A 4A95A 3V7ZA 3N7ZA 4X3RA 1LRZA 4UIAA 5LRGA 2P6FA 3ZJ0A 1M4DA 1U6MA 3D4UA 4ONWA 4CAEA 1Z4EA 5HVHA 1Q2YA 2X7BA 3KR5A 3PRTA 5AG7A 4H6ZA 5H84A 1ELLP 4MJ8A 1RTQA 3DNSA 4ZI6A 1B87A 2ANPA 2EK9A 2FCKA 2HC9A 3IGRA 4HNWB 5AG5A 4B12A 2C6PA 1QSTA 3TOBA 2PR1A 3IWWA 2FXFA 2ARHA 1MJBA 2GLFA 3GYAA 4FWUA 3R96A 2GFQA 2QJ8A 3TX8A 2ZEDA 3NA6A 8CPAA 1YR0A 2YNEA 1Z4RA 4NEXA 1UFHA 2P6GA 4UCMA 3SI1A 3C26A 3NH5A 4UIBA 4A37A 3FF3A 2BEIA 4PXBA 3PB7X 3SJEA 4CGNA 4ZY0A 3IJ3A 1HDQA 1Y9KA 3HLPA 1J4JA 3PB8X 2JDCA 3D7HA 2GIVA 4KOXA 4JWPA 3B8GA 3MRUA 5G20A 4E0AA 2FT0A 2A4NA 2Q04A 1Q2DA 3FMCA 2CIJA 4LX9A 2CNTA 3BJ8A 3SJFA 5CNPA 3FNCA 3W91A 3D7DA 3TC8A 3KASA 4HKFA 2HUZA 4U5YA 3EXNA 2QIRA 4M6HA 4RN7A 1M1DA 2B4DB 2PRQA 5JPHA 2D4OA 3PB6X 2REFA 2VL1A 2FVGA 4UFVA 1PYTB 1S5KA 4O23A 5H86A 4LQGA 1BPNA 4MHPA 5F46A 3T90A 1IY7A 1HEEA 3BI1A 4JXQA 2O4HA 4NXYA 4CAFA 6CPAA 5K8NA 4ZX8A 2ZOFA 4R76A 4A39A 4M85A 1YQEA 3H8GA 3SHPA 1LFWA 2PDOA 3GUXA 1M4GA 4OLLA 2WUUA 4C68A 3GY9A 5AG4A 4C2ZA 1R43A 2VZYA 1LOKA 3KHZA 3RZAA 2ZELA 4YGOA 4L89A 2PE3A 4OC3A 1KZFA 2VBQA 5IB0A 2OH1A 4MFPA 5LYFA 1CJWA 2F7VA 2VI7A 3TFYA 3EY5A 5C82A 3KL9A 4KOUA 3CXPA 1VIXA 4M6GA 4RI1A 5J8FA 4ZBGA 1BPMA 1NMTA 4R57A 4MI4A 1HDUA 2FL4A 3FXTA 2VXKA 2YNCC 4XNHB 2Q4YA 4DYOA 2WPWA 4CAVA 2JBJA 3TT2A 3W6XA 3D7GA 3PBEA 2YGWA 2EO8A 2Q51A 1VGYA 1Z8XA 2QECA 2OZUA 3RNZA 4IF5A 5A27A 3PGPA 2ZOGA 4U9YA 1FT7A 2F5IA 2GLJA 1Z8WA 4OAEA 4A38A 2BO9A 3DGVA 3P2FA 4JLYA 4EFDA 4YRHA 4NCZA 1YSJA 4Z65A 4P4IA 5CPAA 2CF4A 3G8WA 3LACA 4MFJA 4XNHC 2J8RA 3SXNA 4KS9A 4ORFA 3PZJA 3FVLA 4PK3A 2V8HA 1XMTA 3PP9A 5HH1A 4M6IA 2V8GA 4KOTA 4LUAA 2JEWA 4OADA 4FD5A 3ZZIA 1CP6A 5KTDA 3B3WA 4UWIA 3JUWA 2RFHA 3MGDA 1BO4A 3KHXA 2OOTA 1Z9UA 1F57A 1LANA 4NJQA 4F8ZA 5CBMA 2FIAA 3D2PA 2JEVA 2G3TA 5K8OA 1YVOA 3JRUA 1Y0RA 4OMEA 1GHEA 2B5GB 2PJ1A 1IOFA 2PJCA 1QSNA 2R8VA 4RS2A 1Y9WA 4BMHA 1I12A 5I0CA 4AVAA 1WK4A 4OC0A 2CNMA 1IOIA 3V8IA 2H5MA 5D8NA 5DWMA 3BJ7A 4FD4A 5J1QA 5HVFA 4FBEA 1OBRA 2PJ4A 1PU9A 2PR8A 1YLEA 4MY0A 3W6SA 2GREA 4B5PB 4EVYA 3DDDA 1XEBA 2QVPA 2WSAA 2Z3NA 2D4PA 4IK2A 2CTCA 4UFWA 3GIUA 1R3NA 4NGPA 2ZEHA 3T8WA 2QYVA 3A9LA 2IQ6A 3IIBA 2AFSA 2PJ8A 1N71A 2OZGA 4YFJA 3FB3A 3FYNA 1OZPA 3VWEA 4J3GA 4XPKA 3VATA 2NMTA 4FUUA 3TOAA 1YK3A 2VQYA 3S9NA 2PJ5A 1Q2CA 3D67A 2XEIA 3OWCA 1DTDA 1ZG8A 2ZW6A 5D29A 4PSWA 1PUAA 4GXHA 5C88A 2PVVA 4H6UA 2R7HA 4XPDC 2P0WA 3NE7A 4JD6A 5EBVA 1MJAA 2AFXA 3EO4A 4HPSA 4KSAA 1ARMA 2C6CA 1AYEA 2Q43A 2HQYA 2R1IA 4MBUA 4P4DA 2HV2A 1QQ9A 3JVNA 3PFOA 4AG9A 3QB8A 5F47A 4KUBA 1TKHA 4QC6A 4P44A 4E2AA 1TF8A 4NGQA 4F9UA 3KGQA 5F09A 1VKCA 3CPXA
chains in the Genus database with same CATH topology
1GYTA 2V8VA 3IO1A 2BCOA 3CPAA 1ZG7A 2G9DA 4W9YA 4ZX9A 4A94A 4OC1A 5HXDA 3CDXA 3CT9A 2J9AA 3VARA 2WYRA 1DE4C 3B2YA 2PJAA 4P4JA 2C1CA 1YMEA 4UF4A 4MCRA 3B3TA 4CPAA 4MCPA 3ISXA 1CPXA 1KWMA 4PQAA 3SI2A 2HB6A 3B7IA 3H8EA 4P10A 2AFZA 3D68A 4WJBA 1LAPA 4NGSA 3LMSA 1XBUA 3SI0A 3RBUA 2ABZA 1AMPA 4UEEA 3H8FA 4DJLA 3DLJA 3RAMA 3BHXA 5THWA 1H8LA 1YW6A 4PPZA 4AXVA 1ZLIA 4MHYA 3PFEA 4ZY1A 4YWYA 1CX8A 1Q7LA 2Q4ZA 1TKFA 4NGRA 3N5FA 1CBXA 2PJ3A 4WWVA 4H2KA 5JGFA 4RUHA 1Z8LA 5I4MA 3BI0A 4YU9A 2ZEPA 3PBBA 4EWTA 2V8DA 3WC7A 3L2NA 5ELYA 2OR4A 4PXDA 4MHZA 1BLLE 1Z5RA 4G1PA 4Q7AA 4F9VA 2IMOA 4R6TA 3FEDA 1PCAA 2BOAA 5JM6A 1XMBA 3ISZA 4OC4A 1CG2A 2I3CA 3LWUA 4FAIA 3FX6A 1TF9A 2ZEGA 1NSAA 1VHEA 2ZEEA 2PCUA 1F2PA 4UEFA 2PIZA 4GM5A 1LAMA 2EK8A 1TKJA 1Y0YA 4NGNA 4PXEA 3WC5A 3NH4A 4OIDA 4X8IA 2AFOA 5DS0A 4EMEA 3FEEA 2NYQA 3B3CA 1QMUA 4DUKA 3FH4A 2PJ9A 3PB4X 3NFZA 2O53A 4BD9A 1ELMP 4MXUA 5LRKA 2PJ2A 3S9LA 4MCSA 5LYLA 1JQGA 4OC2A 3D66A 3MN8A 1FNOA 1Z2LA 3I1UA 2EWBA 1ZG9A 3PB9X 2CTBA 3V38A 1UWYA 1EE3P 3WC6A 3NH8A 4NGTA 3QNVA 3FJUA 4B6ZA 2ZEFA 3KQZA 3GB0A 3SJXA 2XEGA 2RB7A 4R8FA 1ARLA 1XJOA 1YLOA 4UEZA 3FECA 5LYDA 5JH9A 2GU2A 3S9MA 1M4LA 3KI9A 3KR4A 5K8PA 2PJ6A 4PXCA 3BXMA 2V77A 3HUVA 3K9TA 4KSIA 4P45A 4JZ0A 4R7MA 4TWEA 4OKOA 2PVWA 4MCQA 2F8HA 2IJZA 4JYWA 3B3VA 4IAVA 5HVGA 4NFRA 5LYIA 2NSMA 1VHOA 4OP4A 2C6GA 3SJGA 2XEFA 2PJ0A 4IHMA 1BAVA 4OIWA 4NJRA 3VH9A 2AFMA 3K2KA 4MMOA 1TXRA 1Y7EA 2PJ7A 2XEJA 1F2OA 4P4EA 3IEHA 1YW4A 2DEAA 3IFEA 1CP7A 2PIYA 3KZWA 2ZEOA 3PEIA 4NGMA 2WZNA 2ZEMA 4P6YA 3KQXA 4ZY2A 4ZYQA 4TNUA 5IB9A 1CPSA 3IC1A 4K3NA 3D7FA 3GLJA 4MRIA 1LCPA 5K8MA 2AFWA 3B3SA 1XFOA 4MHNA 2PJBA 4P4FA 2AFUA 4OC5A 4P4BA 3B35A 2ZENA 2JBKA 2POKA 3WABA 1IGBA 1ZLHA 7CPAA 1XRYA 5LRJA 3WT4A 3V7ZA 4X3RA 4UIAA 5LRGA 3D4UA 4ONWA 5HVHA 3KR5A 3PRTA 1ELLP 1RTQA 4ZI6A 2ANPA 2EK9A 2HC9A 2C6PA 3IWWA 2GLFA 4FWUA 2QJ8A 3TX8A 2ZEDA 3NA6A 8CPAA 3SI1A 3NH5A 4UIBA 4A37A 3FF3A 4PXBA 3PB7X 3SJEA 4ZY0A 3IJ3A 1HDQA 3HLPA 3PB8X 3D7HA 3MRUA 3FMCA 2CIJA 3SJFA 3D7DA 3TC8A 3KASA 2PRQA 3PB6X 2VL1A 2FVGA 1PYTB 4O23A 4LQGA 1BPNA 4MHPA 1IY7A 1HEEA 3BI1A 5K8NA 2O4HA 6CPAA 4ZX8A 2ZOFA 4R76A 4A39A 3H8GA 1LFWA 3GUXA 1R43A 1LOKA 3KHZA 3RZAA 2ZELA 2PE3A 4OC3A 5LYFA 2F7VA 3KL9A 1VIXA 1BPMA 1HDUA 4DYOA 2JBJA 3D7GA 3PBEA 2Q51A 1VGYA 2ZOGA 1FT7A 2GLJA 4A38A 2BO9A 3DGVA 4EFDA 4Z65A 1YSJA 4P4IA 5CPAA 2CF4A 3FVLA 2V8HA 2V8GA 2JEWA 1CP6A 3B3WA 2RFHA 3KHXA 2OOTA 1F57A 1LANA 4NJQA 4F8ZA 5CBMA 5K8OA 3JRUA 1Y0RA 4OMEA 2PJCA 2PJ1A 4OC0A 5D8NA 5J1QA 5HVFA 4FBEA 1OBRA 2PJ4A 2GREA 2QVPA 4IK2A 2CTCA 1R3NA 4NGPA 2ZEHA 3T8WA 2QYVA 2IQ6A 3IIBA 2AFSA 2PJ8A 3VATA 3S9NA 4FUUA 2PJ5A 3D67A 2XEIA 1DTDA 1ZG8A 5D29A 2PVVA 2AFXA 1ARMA 2C6CA 1AYEA 2Q43A 4P4DA 1QQ9A 3PFOA 1TKHA 4P44A 1TF8A 4NGQA 4F9UA 3KGQA 5F09A 4X2TA 3CPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYT A;  2V8V A;  3IO1 A;  2BCO A;  3CPA A;  1ZG7 A;  2G9D A;  4W9Y A;  4ZX9 A;  4A94 A;  4OC1 A;  5HXD A;  3CDX A;  3CT9 A;  2J9A A;  3VAR A;  2WYR A;  1DE4 C;  3B2Y A;  2PJA A;  4P4J A;  2C1C A;  1YME A;  4UF4 A;  4MCR A;  3B3T A;  4CPA A;  4MCP A;  3ISX A;  1CPX A;  1KWM A;  4PQA A;  3SI2 A;  2HB6 A;  3B7I A;  3H8E A;  4P10 A;  2AFZ A;  3D68 A;  4WJB A;  1LAP A;  4NGS A;  3LMS A;  1XBU A;  3SI0 A;  3RBU A;  2ABZ A;  1AMP A;  4UEE A;  3H8F A;  4DJL A;  3DLJ A;  3RAM A;  3BHX A;  5THW A;  1H8L A;  1YW6 A;  4PPZ A;  4AXV A;  1ZLI A;  4MHY A;  3PFE A;  4ZY1 A;  4YWY A;  1CX8 A;  1Q7L A;  2Q4Z A;  1TKF A;  4NGR A;  3N5F A;  1CBX A;  2PJ3 A;  4WWV A;  4H2K A;  5JGF A;  4RUH A;  1Z8L A;  5I4M A;  3BI0 A;  4YU9 A;  2ZEP A;  3PBB A;  4EWT A;  2V8D A;  3WC7 A;  3L2N A;  5ELY A;  2OR4 A;  4PXD A;  4MHZ A;  1BLL E;  1Z5R A;  4G1P A;  4Q7A A;  4F9V A;  2IMO A;  4R6T A;  3FED A;  1PCA A;  2BOA A;  5JM6 A;  1XMB A;  3ISZ A;  4OC4 A;  1CG2 A;  2I3C A;  3LWU A;  4FAI A;  3FX6 A;  1TF9 A;  2ZEG A;  1NSA A;  1VHE A;  2ZEE A;  2PCU A;  1F2P A;  4UEF A;  2PIZ A;  4GM5 A;  1LAM A;  2EK8 A;  1TKJ A;  1Y0Y A;  4NGN A;  4PXE A;  3WC5 A;  3NH4 A;  4OID A;  4X8I A;  2AFO A;  5DS0 A;  4EME A;  3FEE A;  2NYQ A;  3B3C A;  1QMU A;  4DUK A;  3FH4 A;  2PJ9 A;  3PB4 X;  3NFZ A;  2O53 A;  4BD9 A;  1ELM P;  4MXU A;  5LRK A;  2PJ2 A;  3S9L A;  4MCS A;  5LYL A;  1JQG A;  4OC2 A;  3D66 A;  3MN8 A;  1FNO A;  1Z2L A;  3I1U A;  2EWB A;  1ZG9 A;  3PB9 X;  2CTB A;  3V38 A;  1UWY A;  1EE3 P;  3WC6 A;  3NH8 A;  4NGT A;  3QNV A;  3FJU A;  4B6Z A;  2ZEF A;  3KQZ A;  3GB0 A;  3SJX A;  2XEG A;  2RB7 A;  4R8F A;  1ARL A;  1XJO A;  1YLO A;  4UEZ A;  3FEC A;  5LYD A;  5JH9 A;  2GU2 A;  3S9M A;  1M4L A;  3KI9 A;  3KR4 A;  5K8P A;  2PJ6 A;  4PXC A;  3BXM A;  2V77 A;  3HUV A;  3K9T A;  4KSI A;  4P45 A;  4JZ0 A;  4R7M A;  4TWE A;  4OKO A;  2PVW A;  4MCQ A;  2F8H A;  2IJZ A;  4JYW A;  3B3V A;  4IAV A;  5HVG A;  4NFR A;  5LYI A;  2NSM A;  1VHO A;  4OP4 A;  2C6G A;  3SJG A;  2XEF A;  2PJ0 A;  4IHM A;  1BAV A;  4OIW A;  4NJR A;  3VH9 A;  2AFM A;  3K2K A;  4MMO A;  1TXR A;  1Y7E A;  2PJ7 A;  2XEJ A;  1F2O A;  4P4E A;  3IEH A;  1YW4 A;  2DEA A;  3IFE A;  1CP7 A;  2PIY A;  3KZW A;  2ZEO A;  3PEI A;  4NGM A;  2WZN A;  2ZEM A;  4P6Y A;  3KQX A;  4ZY2 A;  4ZYQ A;  4TNU A;  5IB9 A;  1CPS A;  3IC1 A;  4K3N A;  3D7F A;  3GLJ A;  4MRI A;  1LCP A;  5K8M A;  2AFW A;  3B3S A;  1XFO A;  4MHN A;  2PJB A;  4P4F A;  2AFU A;  4OC5 A;  4P4B A;  3B35 A;  2ZEN A;  2JBK A;  2POK A;  3WAB A;  1IGB A;  1ZLH A;  7CPA A;  1XRY A;  5LRJ A;  3WT4 A;  3V7Z A;  4X3R A;  4UIA A;  5LRG A;  3D4U A;  4ONW A;  5HVH A;  3KR5 A;  3PRT A;  1ELL P;  1RTQ A;  4ZI6 A;  2ANP A;  2EK9 A;  2HC9 A;  2C6P A;  3IWW A;  2GLF A;  4FWU A;  2QJ8 A;  3TX8 A;  2ZED A;  3NA6 A;  8CPA A;  3SI1 A;  3NH5 A;  4UIB A;  4A37 A;  3FF3 A;  4PXB A;  3PB7 X;  3SJE A;  4ZY0 A;  3IJ3 A;  1HDQ A;  3HLP A;  3PB8 X;  3D7H A;  3MRU A;  3FMC A;  2CIJ A;  3SJF A;  3D7D A;  3TC8 A;  3KAS A;  2PRQ A;  3PB6 X;  2VL1 A;  2FVG A;  1PYT B;  4O23 A;  4LQG A;  1BPN A;  4MHP A;  1IY7 A;  1HEE A;  3BI1 A;  5K8N A;  2O4H A;  6CPA A;  4ZX8 A;  2ZOF A;  4R76 A;  4A39 A;  3H8G A;  1LFW A;  3GUX A;  1R43 A;  1LOK A;  3KHZ A;  3RZA A;  2ZEL A;  2PE3 A;  4OC3 A;  5LYF A;  2F7V A;  3KL9 A;  1VIX A;  1BPM A;  1HDU A;  4DYO A;  2JBJ A;  3D7G A;  3PBE A;  2Q51 A;  1VGY A;  2ZOG A;  1FT7 A;  2GLJ A;  4A38 A;  2BO9 A;  3DGV A;  4EFD A;  4Z65 A;  1YSJ A;  4P4I A;  5CPA A;  2CF4 A;  3FVL A;  2V8H A;  2V8G A;  2JEW A;  1CP6 A;  3B3W A;  2RFH A;  3KHX A;  2OOT A;  1F57 A;  1LAN A;  4NJQ A;  4F8Z A;  5CBM A;  5K8O A;  3JRU A;  1Y0R A;  4OME A;  2PJC A;  2PJ1 A;  4OC0 A;  5D8N A;  5J1Q A;  5HVF A;  4FBE A;  1OBR A;  2PJ4 A;  2GRE A;  2QVP A;  4IK2 A;  2CTC A;  1R3N A;  4NGP A;  2ZEH A;  3T8W A;  2QYV A;  2IQ6 A;  3IIB A;  2AFS A;  2PJ8 A;  3VAT A;  3S9N A;  4FUU A;  2PJ5 A;  3D67 A;  2XEI A;  1DTD A;  1ZG8 A;  5D29 A;  2PVV A;  2AFX A;  1ARM A;  2C6C A;  1AYE A;  2Q43 A;  4P4D A;  1QQ9 A;  3PFO A;  1TKH A;  4P44 A;  1TF8 A;  4NGQ A;  4F9U A;  3KGQ A;  5F09 A;  4X2T A;  3CPX A; 
#chains in the Genus database with same CATH topology
 1GYT A;  2V8V A;  4CAW A;  3G3S A;  3IO1 A;  2BCO A;  1V0C A;  2K5T A;  3CPA A;  4UBR A;  4Y49 B;  4CYO A;  1IB1 E;  2Q44 A;  1ZG7 A;  2G9D A;  4W9Y A;  2FSR A;  4ZX9 A;  4A94 A;  4OC1 A;  5HXD A;  3CDX A;  3CT9 A;  2J9A A;  1S7N A;  3VAR A;  2ATR A;  2REE A;  2WYR A;  4K30 A;  2PSW A;  1DE4 C;  2I00 A;  3B2Y A;  1NE9 A;  2Z3P A;  4I49 A;  5KTA A;  2PJA A;  1BOB A;  2DPS A;  4P4J A;  3D3S A;  4B5O A;  2C1C A;  1YME A;  2ZW4 A;  1IIC A;  5IX3 A;  4C7I A;  4UF4 A;  4ZGY B;  4MCR A;  3B3T A;  4CPA A;  2QML A;  4MCP A;  2RC4 A;  2Q4V A;  3ISX A;  1CPX A;  4X5K A;  5G1Z A;  1KWM A;  4UFX A;  4B13 A;  4PQA A;  3SI2 A;  2HB6 A;  4Y49 C;  3B7I A;  3H8E A;  4MFK A;  2BUE A;  3DR6 A;  4P10 A;  2AFZ A;  3D68 A;  4M3S A;  4JJX A;  4MHD A;  4WJB A;  1LAP A;  4NGS A;  4Q38 A;  4II9 A;  2GE3 A;  3LMS A;  1XBU A;  3SI0 A;  3I9S A;  3QAH A;  2ABZ A;  3RBU A;  4DNC A;  1AMP A;  5G22 A;  5GCN A;  4UEE A;  3H8F A;  3BLN A;  4DJL A;  3DLJ A;  3RAM A;  3BHX A;  5THW A;  1MJ9 A;  1H8L A;  4CAX A;  1X12 A;  1YW6 A;  4PPZ A;  4AXV A;  1ZLI A;  4MHY A;  4ONU A;  3PFE A;  4R3K A;  4ZY1 A;  1IYK A;  2Q0Y A;  4YWY A;  2Q7S A;  3R9G A;  1CX8 A;  1B6B A;  4R87 A;  1Q7L A;  4C2Y A;  2Q4Z A;  3TCV A;  1TKF A;  3H5Z A;  1XF8 A;  4NGR A;  3N5F A;  1CBX A;  4AG7 A;  2PJ3 A;  4WWV A;  3SXO A;  3T9Y A;  5KTC A;  2FIW A;  2FE7 A;  4H2K A;  4JXR A;  1M4I A;  5JGF A;  3TO9 A;  2O28 A;  4RUH A;  1P4N A;  1Z8L A;  5A28 A;  2B4D A;  5I4M A;  5EMI A;  3BI0 A;  2J8N A;  3DR8 A;  5J8C A;  4YU9 A;  4C2X A;  2PRB A;  2ZEP A;  2P6E A;  1S3Z A;  2BSW A;  3PBB A;  1XOV A;  4EWT A;  3P2H A;  2V8D A;  4A30 A;  4AVB A;  3WC7 A;  1VHS A;  3L2N A;  5ELY A;  4PK2 A;  2WPX A;  5HMN A;  2OR4 A;  3QAY A;  2Z3M A;  1IU8 A;  4PXD A;  1X10 A;  2J8M A;  3CZX A;  4MHZ A;  1I21 A;  1BLL E;  3EFA A;  4UWJ A;  3TTH A;  4C7H A;  1Z5R A;  4Q36 A;  4G1P A;  1IYL A;  4Q7A A;  4F9V A;  1YVK A;  4KOR A;  2IMO A;  4R6T A;  3FED A;  1I1D A;  4KOS A;  5IV0 A;  1QSR A;  2B3U A;  1WWZ A;  1PCA A;  2BOA A;  5JM6 A;  4XPD B;  2Z3K A;  4NSQ A;  1XMB A;  2VZZ A;  4IUS A;  3ISZ A;  3CXS A;  4QUS A;  3DSB A;  4OC4 A;  1CG2 A;  4GS4 A;  2I3C A;  3LWU A;  3H4Q A;  2B4B A;  4FAI A;  3FX6 A;  4CS0 B;  3TO7 A;  5AGE A;  1TF9 A;  3IWG A;  2ZEG A;  4KVM E;  1NSA A;  1VHE A;  3F5B A;  2GAN A;  3EC4 A;  4CRY B;  2ZEE A;  2PCU A;  1QSM A;  1F2P A;  2CY2 A;  4MFQ A;  2PIZ A;  4UEF A;  4GM5 A;  1LAM A;  2EK8 A;  5JQ4 A;  4UCP A;  1TKJ A;  1YX0 A;  2CNS A;  2R98 A;  1Y0Y A;  4NGN A;  4PXE A;  2EBJ A;  3WC5 A;  2JDD A;  3NH4 A;  4OID A;  3F0A A;  4X8I A;  4CGM A;  2AFO A;  1A2Z A;  5DS0 A;  4EME A;  3D2M A;  3FEE A;  4KZT A;  4BBH A;  1XE4 A;  4HNX B;  3KKW A;  4UA3 A;  1MK4 A;  4E8O A;  4F0Y A;  2NYQ A;  3B3C A;  1QMU A;  1JWQ A;  4KOY A;  4DUK A;  3FH4 A;  4L8A A;  2PJ9 A;  3PB4 X;  3F8K A;  5ISV A;  3NFZ A;  5AG6 A;  2O53 A;  4BD9 A;  1ELM P;  4CRZ B;  4CYP A;  4MXU A;  4A2Z A;  3IU2 A;  1KUY A;  2OB0 A;  2PC1 A;  2PJ2 A;  1ZO0 A;  1NSL A;  5BWA B;  4KLW A;  5LRK A;  3S9L A;  4MCS A;  5LYL A;  1JQG A;  4OC2 A;  3D66 A;  3MN8 A;  1FNO A;  1Z2L A;  2DPT A;  4HNY B;  3I1U A;  2EWB A;  1ZG9 A;  3PB9 X;  2CTB A;  4B14 A;  4KVO E;  3V38 A;  4KSF A;  4QB9 A;  4CGO A;  2AE6 A;  1UWY A;  1EE3 P;  4X2T A;  3WC6 A;  3NH8 A;  4NGT A;  4F0X A;  3QNV A;  3R1K A;  5F49 A;  3FJU A;  1SQH A;  1YGH A;  1Z8T A;  2B5G A;  4B6Z A;  2ZEF A;  4MFZ A;  3KQZ A;  3GB0 A;  3SJX A;  4UCN A;  2XEG A;  2IL4 A;  2I79 A;  4R9M A;  2Z10 A;  1IID A;  3S6G A;  2RB7 A;  4R8F A;  2BL1 A;  2ZW7 A;  1ARL A;  1XJO A;  3R9E A;  4B11 A;  1AUG A;  1YLO A;  4UEZ A;  5G21 A;  3FEC A;  5LYD A;  5JH9 A;  2GU2 A;  2Y0M A;  3S9M A;  1M4L A;  1QSO A;  3KI9 A;  1KUX A;  3KR4 A;  3RO0 A;  3S6K A;  4B5P A;  5K8P A;  2DF5 A;  2PJ6 A;  4PXC A;  1S7L A;  1K4J A;  3BXM A;  3K9U A;  2V77 A;  3HUV A;  4MY3 A;  2DXQ A;  4AVC A;  4XPL A;  2YND A;  1S7K A;  2G0B A;  3K9T A;  2ZXV A;  2Z3O A;  4H89 A;  4KSI A;  4P45 A;  4JZ0 A;  4R7M A;  4KOW A;  2OU2 A;  2Z11 A;  4TWE A;  4OKO A;  2PVW A;  2ZW5 A;  4NF1 A;  4MCQ A;  4KOV A;  2F8H A;  2IJZ A;  1FY7 A;  2VEZ A;  4CYQ A;  2OZH A;  4JYW A;  3WR7 A;  2Z3L A;  3E0K A;  2KCW A;  3B3V A;  4QBJ A;  4IAV A;  4CGL A;  5HVG A;  4NFR A;  5LYI A;  2NSM A;  5EC4 A;  4F6A A;  2C27 A;  5F48 A;  1VHO A;  2JLM A;  4OP4 A;  1R57 A;  2C6G A;  4MFL A;  4A31 A;  5DWN A;  3SJG A;  3FIX A;  2ZPA A;  1S7F A;  2XEF A;  2G3A A;  2PJ0 A;  3D8P A;  4IHM A;  4A33 A;  1BAV A;  2AJ6 A;  2FS5 A;  3TE4 A;  4OIW A;  4NJR A;  3VH9 A;  2AFM A;  3K2K A;  1YRE A;  3IWE A;  3S6F A;  4MMO A;  3RYO A;  2Q7B A;  3R9F A;  4U9Z A;  1TXR A;  1Y7E A;  2PJ7 A;  2XEJ A;  3FRM A;  1F2O A;  4P4E A;  3IEH A;  4CYN A;  1YW4 A;  3TO6 A;  2DEA A;  2EUI A;  3LOD A;  3IFE A;  4PSX A;  1CP7 A;  2PIY A;  1XIX A;  3KZW A;  4FD7 A;  2PQ8 A;  2ZEO A;  3PEI A;  1CM0 A;  4NGM A;  5E96 A;  2WZN A;  3IU1 A;  1KUV A;  2ZEM A;  4LQ6 A;  4P6Y A;  3UY5 A;  1S60 A;  2B58 A;  3KQX A;  4KVX A;  4ZY2 A;  3S6H A;  4ZYQ A;  4TNU A;  5IB9 A;  3LD2 A;  1P0H A;  5FVJ A;  3VWD A;  1CPS A;  2B3V A;  2YNC A;  2EVN A;  3CXQ A;  3IC1 A;  4B10 A;  4K3N A;  4PV6 A;  3D7F A;  4QVT A;  1M44 A;  3GKR A;  3GLJ A;  4FD6 A;  1RO5 A;  4MRI A;  1LCP A;  5K8M A;  2AFW A;  3B3S A;  1XFO A;  4AB7 A;  4MHN A;  3FBU A;  2PJB A;  3JTK A;  3I3G A;  4CGP A;  2ODF A;  2AFU A;  4P4F A;  4OC5 A;  4P4B A;  1Y7R A;  1RXT A;  3B35 A;  1TIQ A;  4A32 A;  2ZEN A;  2JBK A;  2Z0Z A;  2POK A;  4KUA A;  1IGB A;  1ZLH A;  3WAB A;  3R95 A;  4BIN A;  1L0C A;  1ON0 A;  2CXA A;  3NE8 A;  4KLV A;  7CPA A;  1XRY A;  4R3L A;  5LRJ A;  3WT4 A;  4A95 A;  3V7Z A;  3N7Z A;  4X3R A;  1LRZ A;  4UIA A;  5LRG A;  2P6F A;  3ZJ0 A;  1M4D A;  1U6M A;  3D4U A;  4ONW A;  4CAE A;  1Z4E A;  5HVH A;  1Q2Y A;  2X7B A;  3KR5 A;  3PRT A;  5AG7 A;  4H6Z A;  5H84 A;  1ELL P;  4MJ8 A;  1RTQ A;  3DNS A;  4ZI6 A;  1B87 A;  2ANP A;  2EK9 A;  2FCK A;  2HC9 A;  3IGR A;  4HNW B;  5AG5 A;  4B12 A;  2C6P A;  1QST A;  3TOB A;  2PR1 A;  3IWW A;  2FXF A;  2ARH A;  1MJB A;  2GLF A;  3GYA A;  4FWU A;  3R96 A;  2GFQ A;  2QJ8 A;  3TX8 A;  2ZED A;  3NA6 A;  8CPA A;  1YR0 A;  2YNE A;  1Z4R A;  4NEX A;  1UFH A;  2P6G A;  4UCM A;  3SI1 A;  3C26 A;  3NH5 A;  4UIB A;  4A37 A;  3FF3 A;  2BEI A;  4PXB A;  3PB7 X;  3SJE A;  4CGN A;  4ZY0 A;  3IJ3 A;  1HDQ A;  1Y9K A;  3HLP A;  1J4J A;  3PB8 X;  2JDC A;  3D7H A;  2GIV A;  4KOX A;  4JWP A;  3B8G A;  3MRU A;  5G20 A;  4E0A A;  2FT0 A;  2A4N A;  2Q04 A;  1Q2D A;  3FMC A;  2CIJ A;  4LX9 A;  2CNT A;  3BJ8 A;  3SJF A;  5CNP A;  3FNC A;  3W91 A;  3D7D A;  3TC8 A;  3KAS A;  4HKF A;  2HUZ A;  4U5Y A;  3EXN A;  2QIR A;  4M6H A;  4RN7 A;  1M1D A;  2B4D B;  2PRQ A;  5JPH A;  2D4O A;  3PB6 X;  2REF A;  2VL1 A;  2FVG A;  4UFV A;  1PYT B;  1S5K A;  4O23 A;  5H86 A;  4LQG A;  1BPN A;  4MHP A;  5F46 A;  3T90 A;  1IY7 A;  1HEE A;  3BI1 A;  4JXQ A;  2O4H A;  4NXY A;  4CAF A;  6CPA A;  5K8N A;  4ZX8 A;  2ZOF A;  4R76 A;  4A39 A;  4M85 A;  1YQE A;  3H8G A;  3SHP A;  1LFW A;  2PDO A;  3GUX A;  1M4G A;  4OLL A;  2WUU A;  4C68 A;  3GY9 A;  5AG4 A;  4C2Z A;  1R43 A;  2VZY A;  1LOK A;  3KHZ A;  3RZA A;  2ZEL A;  4YGO A;  4L89 A;  2PE3 A;  4OC3 A;  1KZF A;  2VBQ A;  5IB0 A;  2OH1 A;  4MFP A;  5LYF A;  1CJW A;  2F7V A;  2VI7 A;  3TFY A;  3EY5 A;  5C82 A;  3KL9 A;  4KOU A;  3CXP A;  1VIX A;  4M6G A;  4RI1 A;  5J8F A;  4ZBG A;  1BPM A;  1NMT A;  4R57 A;  4MI4 A;  1HDU A;  2FL4 A;  3FXT A;  2VXK A;  2YNC C;  4XNH B;  2Q4Y A;  4DYO A;  2WPW A;  4CAV A;  2JBJ A;  3TT2 A;  3W6X A;  3D7G A;  3PBE A;  2YGW A;  2EO8 A;  2Q51 A;  1VGY A;  1Z8X A;  2QEC A;  2OZU A;  3RNZ A;  4IF5 A;  5A27 A;  3PGP A;  2ZOG A;  4U9Y A;  1FT7 A;  2F5I A;  2GLJ A;  1Z8W A;  4OAE A;  4A38 A;  2BO9 A;  3DGV A;  3P2F A;  4JLY A;  4EFD A;  4YRH A;  4NCZ A;  1YSJ A;  4Z65 A;  4P4I A;  5CPA A;  2CF4 A;  3G8W A;  3LAC A;  4MFJ A;  4XNH C;  2J8R A;  3SXN A;  4KS9 A;  4ORF A;  3PZJ A;  3FVL A;  4PK3 A;  2V8H A;  1XMT A;  3PP9 A;  5HH1 A;  4M6I A;  2V8G A;  4KOT A;  4LUA A;  2JEW A;  4OAD A;  4FD5 A;  3ZZI A;  1CP6 A;  5KTD A;  3B3W A;  4UWI A;  3JUW A;  2RFH A;  3MGD A;  1BO4 A;  3KHX A;  2OOT A;  1Z9U A;  1F57 A;  1LAN A;  4NJQ A;  4F8Z A;  5CBM A;  2FIA A;  3D2P A;  2JEV A;  2G3T A;  5K8O A;  1YVO A;  3JRU A;  1Y0R A;  4OME A;  1GHE A;  2B5G B;  2PJ1 A;  1IOF A;  2PJC A;  1QSN A;  2R8V A;  4RS2 A;  1Y9W A;  4BMH A;  1I12 A;  5I0C A;  4AVA A;  1WK4 A;  4OC0 A;  2CNM A;  1IOI A;  3V8I A;  2H5M A;  5D8N A;  5DWM A;  3BJ7 A;  4FD4 A;  5J1Q A;  5HVF A;  4FBE A;  1OBR A;  2PJ4 A;  1PU9 A;  2PR8 A;  1YLE A;  4MY0 A;  3W6S A;  2GRE A;  4B5P B;  4EVY A;  3DDD A;  1XEB A;  2QVP A;  2WSA A;  2Z3N A;  2D4P A;  4IK2 A;  2CTC A;  4UFW A;  3GIU A;  1R3N A;  4NGP A;  2ZEH A;  3T8W A;  2QYV A;  3A9L A;  2IQ6 A;  3IIB A;  2AFS A;  2PJ8 A;  1N71 A;  2OZG A;  4YFJ A;  3FB3 A;  3FYN A;  1OZP A;  3VWE A;  4J3G A;  4XPK A;  3VAT A;  2NMT A;  4FUU A;  3TOA A;  1YK3 A;  2VQY A;  3S9N A;  2PJ5 A;  1Q2C A;  3D67 A;  2XEI A;  3OWC A;  1DTD A;  1ZG8 A;  2ZW6 A;  5D29 A;  4PSW A;  1PUA A;  4GXH A;  5C88 A;  2PVV A;  4H6U A;  2R7H A;  4XPD C;  2P0W A;  3NE7 A;  4JD6 A;  5EBV A;  1MJA A;  2AFX A;  3EO4 A;  4HPS A;  4KSA A;  1ARM A;  2C6C A;  1AYE A;  2Q43 A;  2HQY A;  2R1I A;  4MBU A;  4P4D A;  2HV2 A;  1QQ9 A;  3JVN A;  3PFO A;  4AG9 A;  3QB8 A;  5F47 A;  4KUB A;  1TKH A;  4QC6 A;  4P44 A;  4E2A A;  1TF8 A;  4NGQ A;  4F9U A;  3KGQ A;  5F09 A;  1VKC A;  3CPX A; 
#chains in the Genus database with same CATH homology
 1GYT A;  2V8V A;  3IO1 A;  2BCO A;  3CPA A;  1ZG7 A;  2G9D A;  4W9Y A;  4ZX9 A;  4A94 A;  4OC1 A;  5HXD A;  3CDX A;  3CT9 A;  2J9A A;  3VAR A;  2WYR A;  1DE4 C;  3B2Y A;  2PJA A;  4P4J A;  2C1C A;  1YME A;  4UF4 A;  4MCR A;  3B3T A;  4CPA A;  4MCP A;  3ISX A;  1CPX A;  1KWM A;  4PQA A;  3SI2 A;  2HB6 A;  3B7I A;  3H8E A;  4P10 A;  2AFZ A;  3D68 A;  4WJB A;  1LAP A;  4NGS A;  3LMS A;  1XBU A;  3SI0 A;  3RBU A;  2ABZ A;  1AMP A;  4UEE A;  3H8F A;  4DJL A;  3DLJ A;  3RAM A;  3BHX A;  5THW A;  1H8L A;  1YW6 A;  4PPZ A;  4AXV A;  1ZLI A;  4MHY A;  3PFE A;  4ZY1 A;  4YWY A;  1CX8 A;  1Q7L A;  2Q4Z A;  1TKF A;  4NGR A;  3N5F A;  1CBX A;  2PJ3 A;  4WWV A;  4H2K A;  5JGF A;  4RUH A;  1Z8L A;  5I4M A;  3BI0 A;  4YU9 A;  2ZEP A;  3PBB A;  4EWT A;  2V8D A;  3WC7 A;  3L2N A;  5ELY A;  2OR4 A;  4PXD A;  4MHZ A;  1BLL E;  1Z5R A;  4G1P A;  4Q7A A;  4F9V A;  2IMO A;  4R6T A;  3FED A;  1PCA A;  2BOA A;  5JM6 A;  1XMB A;  3ISZ A;  4OC4 A;  1CG2 A;  2I3C A;  3LWU A;  4FAI A;  3FX6 A;  1TF9 A;  2ZEG A;  1NSA A;  1VHE A;  2ZEE A;  2PCU A;  1F2P A;  4UEF A;  2PIZ A;  4GM5 A;  1LAM A;  2EK8 A;  1TKJ A;  1Y0Y A;  4NGN A;  4PXE A;  3WC5 A;  3NH4 A;  4OID A;  4X8I A;  2AFO A;  5DS0 A;  4EME A;  3FEE A;  2NYQ A;  3B3C A;  1QMU A;  4DUK A;  3FH4 A;  2PJ9 A;  3PB4 X;  3NFZ A;  2O53 A;  4BD9 A;  1ELM P;  4MXU A;  5LRK A;  2PJ2 A;  3S9L A;  4MCS A;  5LYL A;  1JQG A;  4OC2 A;  3D66 A;  3MN8 A;  1FNO A;  1Z2L A;  3I1U A;  2EWB A;  1ZG9 A;  3PB9 X;  2CTB A;  3V38 A;  1UWY A;  1EE3 P;  3WC6 A;  3NH8 A;  4NGT A;  3QNV A;  3FJU A;  4B6Z A;  2ZEF A;  3KQZ A;  3GB0 A;  3SJX A;  2XEG A;  2RB7 A;  4R8F A;  1ARL A;  1XJO A;  1YLO A;  4UEZ A;  3FEC A;  5LYD A;  5JH9 A;  2GU2 A;  3S9M A;  1M4L A;  3KI9 A;  3KR4 A;  5K8P A;  2PJ6 A;  4PXC A;  3BXM A;  2V77 A;  3HUV A;  3K9T A;  4KSI A;  4P45 A;  4JZ0 A;  4R7M A;  4TWE A;  4OKO A;  2PVW A;  4MCQ A;  2F8H A;  2IJZ A;  4JYW A;  3B3V A;  4IAV A;  5HVG A;  4NFR A;  5LYI A;  2NSM A;  1VHO A;  4OP4 A;  2C6G A;  3SJG A;  2XEF A;  2PJ0 A;  4IHM A;  1BAV A;  4OIW A;  4NJR A;  3VH9 A;  2AFM A;  3K2K A;  4MMO A;  1TXR A;  1Y7E A;  2PJ7 A;  2XEJ A;  1F2O A;  4P4E A;  3IEH A;  1YW4 A;  2DEA A;  3IFE A;  1CP7 A;  2PIY A;  3KZW A;  2ZEO A;  3PEI A;  4NGM A;  2WZN A;  2ZEM A;  4P6Y A;  3KQX A;  4ZY2 A;  4ZYQ A;  4TNU A;  5IB9 A;  1CPS A;  3IC1 A;  4K3N A;  3D7F A;  3GLJ A;  4MRI A;  1LCP A;  5K8M A;  2AFW A;  3B3S A;  1XFO A;  4MHN A;  2PJB A;  4P4F A;  2AFU A;  4OC5 A;  4P4B A;  3B35 A;  2ZEN A;  2JBK A;  2POK A;  3WAB A;  1IGB A;  1ZLH A;  7CPA A;  1XRY A;  5LRJ A;  3WT4 A;  3V7Z A;  4X3R A;  4UIA A;  5LRG A;  3D4U A;  4ONW A;  5HVH A;  3KR5 A;  3PRT A;  1ELL P;  1RTQ A;  4ZI6 A;  2ANP A;  2EK9 A;  2HC9 A;  2C6P A;  3IWW A;  2GLF A;  4FWU A;  2QJ8 A;  3TX8 A;  2ZED A;  3NA6 A;  8CPA A;  3SI1 A;  3NH5 A;  4UIB A;  4A37 A;  3FF3 A;  4PXB A;  3PB7 X;  3SJE A;  4ZY0 A;  3IJ3 A;  1HDQ A;  3HLP A;  3PB8 X;  3D7H A;  3MRU A;  3FMC A;  2CIJ A;  3SJF A;  3D7D A;  3TC8 A;  3KAS A;  2PRQ A;  3PB6 X;  2VL1 A;  2FVG A;  1PYT B;  4O23 A;  4LQG A;  1BPN A;  4MHP A;  1IY7 A;  1HEE A;  3BI1 A;  5K8N A;  2O4H A;  6CPA A;  4ZX8 A;  2ZOF A;  4R76 A;  4A39 A;  3H8G A;  1LFW A;  3GUX A;  1R43 A;  1LOK A;  3KHZ A;  3RZA A;  2ZEL A;  2PE3 A;  4OC3 A;  5LYF A;  2F7V A;  3KL9 A;  1VIX A;  1BPM A;  1HDU A;  4DYO A;  2JBJ A;  3D7G A;  3PBE A;  2Q51 A;  1VGY A;  2ZOG A;  1FT7 A;  2GLJ A;  4A38 A;  2BO9 A;  3DGV A;  4EFD A;  4Z65 A;  1YSJ A;  4P4I A;  5CPA A;  2CF4 A;  3FVL A;  2V8H A;  2V8G A;  2JEW A;  1CP6 A;  3B3W A;  2RFH A;  3KHX A;  2OOT A;  1F57 A;  1LAN A;  4NJQ A;  4F8Z A;  5CBM A;  5K8O A;  3JRU A;  1Y0R A;  4OME A;  2PJC A;  2PJ1 A;  4OC0 A;  5D8N A;  5J1Q A;  5HVF A;  4FBE A;  1OBR A;  2PJ4 A;  2GRE A;  2QVP A;  4IK2 A;  2CTC A;  1R3N A;  4NGP A;  2ZEH A;  3T8W A;  2QYV A;  2IQ6 A;  3IIB A;  2AFS A;  2PJ8 A;  3VAT A;  3S9N A;  4FUU A;  2PJ5 A;  3D67 A;  2XEI A;  1DTD A;  1ZG8 A;  5D29 A;  2PVV A;  2AFX A;  1ARM A;  2C6C A;  1AYE A;  2Q43 A;  4P4D A;  1QQ9 A;  3PFO A;  1TKH A;  4P44 A;  1TF8 A;  4NGQ A;  4F9U A;  3KGQ A;  5F09 A;  4X2T A;  3CPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...