2ZEXA

Family 16 carbohydrate binding module
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
GAHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Selectivity and Specificity of Ligand Recognition by the Family 16 Carbohydrate-binding Modules from Thermoanaerobacterium polysaccharolyticum ManA
pubmed doi rcsb
source organism Thermoanaerobacterium polysaccharolyticum
molecule tags Hydrolase
molecule keywords S-layer associated multidomain endoglucanase
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2zexA00
3VDCA 3VD3A 5G05L 3CIHA 4QX0A 1CX1A 3HN3A 2X09A 3IAQA 3SKVA 4P02B 2QQLA 5LA0A 4KMQA 3T08A 2EICA 4DXRA 3BGAA 2W1WA 5HXMA 3ABZA 3MUY1 1O8SA 4QDRA 4QDSA 3VD9A 2BGPA 4W50A 4FI9A 3DYOA 2WO1A 3K4AA 3VDAA 1L7RA 2DCKA 3OEAA 4DEQA 3NRUA 2VZ3A 4YPJA 3VD7A 2WAOA 3UNPA 2HYXA 3SEEA 3WQBA 5DMYA 3I3DA 3CZJA 1KGYA 1UYYA 4XUTA 5I0DA 2C9KA 4PF1A 4TXWA 3HNMA 1UX7A 1JI6A 3OGRA 5IYYA 2V5DA 3A21A 3SEPA 4CU9A 4P5YA 2ZEXA 2QQNA 2E32A 2VO5A 2Y6HA 4GWJA 2DCJA 2Y6GA 2X05A 2VCCA 3CDZB 1W0NA 1K12A 3T0AA 1H6XA 2W94A 4OUEA 3WNLA 2J1EA 4JX0A 1GOFA 2VR4A 2ZXQA 3NJXA 1PMJX 3PUIA 4DUWA 4A44A 5IHRA 3WF3A 3OG2A 1JYNA 3UESA 1WCQA 4XZUG 1I5PA 3FHQA 1JU4A 3C8XA 4LPLA 1PX4A 3K46A 1JZ8A 5DPNA 2Z4FA 5C71A 2YC2A 3NQHA 2J7MA 1L7QA 3T2PA 4JKLA 2W5FA 3ACGA 2VOTA 1T2XA 2WYSA 1F4HA 3ACFA 1UYZA 3ETPA 2VMEA 3ZM8A 1ULPA 2E31A 4QDQA 2VJXA 4PT6A 4UOJA 4QX1A 3HJRA 1CZVA 1GUIA 4GWIA 4XUPA 4A41A 3C7EA 4P00B 4A3ZA 1GNYA 3CKHA 3IAPA 1O59A 1UMIA 1OT5A 2VM9A 4PQQA 5EIYB 2VZOA 3FHAA 5JUVA 1BHGA 4JKKA 3HNYM 2EIDA 3OGSA 1D7PM 3WF1A 4DUVA 1PX3A 3LPGA 3FL7A 2YFZA 3FN9A 1J84A 4OYUA 1ULOA 1J83A 1UY2A 1IQDC 5JXHA 4JKMA 2W92A 2BERA 1US2A 3I2JA 2LW8A 3WNNA 2RJ2A 3WNMA 1UXXX 3VD5A 2W47A 2QQIA 3DYMA 2QQKA 3F2ZA 3MBWA 1GOGA 2W91A 4DUXA 1TG7A 4QPWA 3LE0A 2ID4A 5FUIA 3A23A 4ZXEA 5EJZB 3K4ZA 2WAAA 1JYXA 4LKSA 1NX9A 4KI5M 5A1AA 1JZ6A 3C7HA 2XQXA 2VQUA 2DDUA 2J1TA 2EIBA 3GM8A 1UY0A 4MOAA 4CU6A 4E8CA 1CZSA 2WO2A 2C4XA 1PMHX 5C7GA 2VMDA 3A7QA 3VDBA 2QBXA 4Z2AA 1LNSA 2VZ1A 2VQTA 3LEKA 5LA2A 3T0BA 3WEZA 3WNPA 5DN2A 5LCWL 4P08A 2B9VA 2CDPA 2JDAA 2ORXA 5JXJA 1OF3A 4QAWA 1GMMA 1GOHA 4A42A 3I3EA 2WZEA 2YG0A 4IUGA 3K77A 2J1SA 2V72A 5B4XA 2BGOA 3VD4A 3T2OA 5LA1A 1NKGA 3GGLA 3IB3A 3WNOA 2VMCA 1SDDB 4A4AA 2W3JA 1NUKA 5JMOA 1P8JA 2VZVA 4MADA 2J1VA 5CZKA 3J7HA 1JZ5A 4RYDA 3OB8A 2YB7A 4QB1A 2KD7A 3LEGA 2J1RA 4ET7A 2WZ8A 2W95A 1XC6A 3MV11 1UWWA 2PQSA 4OMDA 3T0DA 4ZZ5A 4LQRA 3WSOA 2V4VA 1SG3A 3I2IA 4UI9L 2XOMA 2VZSA 1JYWA 3WF2A 4DXSA 1K45A 2WN2A 3OGVA 3I2HA 1JZ3A 1W8NA 3LPFA 1UY3A 3HPNA 2E26A 1OH4A 4DEVA 1H6YA 1JZ7A 3MO4A 2ZEWA 3A22A 3WF0A 5IFTA 2WABA 1GU3A 1W9TA 2Y6LA 5IJRA 4L0PA 3U37A 2HLEA 4GZ9A 4ARYA 2W1UA 2OKXA 2QQJA 1SHWB 5IFPA 1F4AA 4XURA 4HG6B 1OF4A 3C7OA 4XUQA 4ZY9A 4ZZ8A 1RYYA 3I2GA 4AG4A 3EYPA 3ECQA 3K75B 5DQ0A 1JYVA 3IDAA 5HPOA 4MGQA 1W99A 4QX3A 2XHNA 4KWUA 1TVGA 3I3BA 2WO3A 4DXTA 3DECA 4TTGA 2J1UA 1O8PA 2E33A 3OEBA 3LQCA 4BJ0A 2B4KA 1CIYA 4ARXA 5B4NA 4CU8A 3MV01 5JXGA 2VZUA 1WKYA 4JHZA 2QQMA 3GXUA 1EUUA 4A45A 2YC4A 2RVAA 3ACHA 2W46A 4M4PA 2BZDA 3JXSA 1UY1A 2VCAA 2WUHA 4OMCA 3IIIA 4M4RA 3W5NA 4BK4A 1W9SA 1K42A 5C70A 3I97A 4D0QA 2VZQA 3C7FA 4XVHA 4XUOA 3CQOA 2LS6A 5J1XA 3EB7A 3WNKA 3P6BA 2XONA 3P1IA 5EJ1B 3HEIA 3MUZ1 3THCA 4CVUA 1US3A 3THDA 1JU3A 1HN1A 2RV9A 2JD9A 2ORZA 2W1SA 3HNBM 4UAPA 1GQPA 2EIEA 2W9XA 4W8JA 3NJVA 3E1F1 2VMFA 1NAEA 3C7GA 4AAXA 2VTFA 4QX2A 3WF4A 1UXZA 2VZRA 4XUNA 1K3IA 5CYYA 1JZ2A 2J1AA 4E8DA 1UY4A 2VCBA 1YQ2A 4BK5A 3GDBA 3ACIA 3K4DA 1W8OA 5G04L 1OD3A 2WDBA 2W1QA 5JXIA 3T09A 4LHSA 2ZEYA 3LEIA 1XNTA 2QQOA 2Y8KA 4BDVB 2JKXA 4QB6A 1MPXA 3NNGA 2VZPA 2WN3A 3D3AA 1EUTA 1XPWA 4W4ZA 3SKJE 2C26A 2L9LA 1UYXA 2WQ8A 4MO3M 4CUAA 2W87A 4MGSA 2VC9A 4D8MA 2VL4A 1CZTA 2Y6KA 5F7UA 3CMGA 3I2FA 1DLCA 1KEXA 4BXSV 3UETA 2BBAA 3OBAA 1W9WA 3W5MA 2WBKA 4OZOA 1DYOA 2YFUA 1JZ4A 2CDOA 2R7EB 4CU7A 2ZEZA 3AC0A 1R64A 3DYPA 5JR2A 2JE8A 3CZUA 1UZ0A 4QB2A 2VZTA 2X10A 3BN6A 1XNAA 1DP0A 4RN5A 3HOBA 4CUBA 1JHJA 3T2QA 3I2KA 2Y6JA 2Y64A 3PUHA 4A6OA 2J22A 4CUCA 1UMHA
chains in the Genus database with same CATH superfamily
3MYXA 4DMIA 1VB2A 1VE0A 2V09A 5FY4A 4M3CE 4DOUA 2FDHA 2I2SA 3I2OA 2WFPA 3M2MA 1PO13 1WLWA 1ND2C 1QJZA 1HRI3 3SKVA 3POEA 2DU0A 4P02B 4IE7A 2CL2A 4IV1B 5FZ7A 3T2TA 3AKPA 2D98A 4NMIA 3HN1A 4FTEA 3UKNA 1QJU2 3H8UA 2ZGLA 3S7IA 3WDWA 5LA0A 3NAPC 1IGOA 4LBQD 5C4WA 4AR2A 5BNNA 3DPRA 4I3PA 5A3NA 1SBDA 4FOYA 3A0KA 4QQOA 3POSA 4EYUA 1Y4WA 2BEOA 3G6JB 3J8F2 5CKNA 1F8VA 3NSTA 4XABA 2DFBA 4L11A 1DU3D 4FI9A 2YPDA 3PU8A 4PDWB 4UWDA 4BIFA 2OX0A 3VDAA 2I45A 3OY8A 2MNGA 4ES9A 4C8DA 1J1TA 4Z92B 2UWAA 3ZDVA 1RUD3 3P5BA 4AVTA 1RUG3 1S0EA 4U2AA 1DGLA 2VZ3A 3O0VA 4YPJA 3ZFEB 1YI7A 1DZRA 5FYTA 3TBDA 3WG2A 4BQ3A 2XKPA 4W6XA 3SEEA 1N1VA 5FO8B 1VLNA 2ARBA 2WZR2 3FFZA 4Q26A 5DMYA 3A4UA 1ZZ7A 2HEWF 3PVNA 1ZZ6A 1TQ5A 1BBT2 3HBKA 1J59A 3MFAA 2JB8A 2WNUB 5F2SA 1XYNA 4TXWA 3HNMA 1RUC1 4RHV2 3VL9A 3OGRA 1LAJA 1U5XA 3AMNA 4LA3A 1AYN1 5IK4A 5D1IA 1FOD1 3PL0A 3F95A 3ZXEA 5BNPC 4ASKA 3KVBA 2QQNA 1MS4A 3U10A 3J7LA 4ISRA 1MS8A 1AX2A 2AH2A 1AUYA 4LOSA 1WMFA 2WT0A 4F83A 4C1WA 1OMIA 4AI3A 3APBA 1H6XA 3MDPA 2W94A 3VZOA 1H8TA 3OBTA 1IOAA 2J1EA 1OA4A 2W08A 3WLUA 2WRAA 1PGW1 1DYPA 2D3RA 2WO7A 3DPRC 2GN7A 4NHLA 2AZ5A 5EPAA 3MFCA 4Q4Y2 3UESA 2Z69A 4IV3B 1MS1A 2ZAAA 4FVVA 3MLLA 1LHWA 4XZUG 1I5PA 4BU2A 1JU4A 1PX4A 2DUPA 3JZVA 2A6XA 4E2QA 3R6SA 1DYKA 1NZCA 3HD8B 5A7WB 3ZXDA 2Q30A 4UXAA 5DAQA 3UT0A 2P5BA 1QKQA 1KDKA 2RDNA 2VBPA 2FCVA 1PVC2 4MZUA 5L9RA 2JKBA 3UGGA 4KL1A 4DFSA 4A6SA 1XYOA 4FP3A 3V64A 3TEYA 1W9YA 1X36A 3E5XA 5FR3A 1F4HA 2O1QA 3S57A 3CF6E 1XYPA 3BU0A 1FPN3 1SFPA 1V0AA 5ANQA 4QDQA 5T50A 1RMU3 2VJXA 3FZ3A 3E6BA 5BNPA 1NZIA 4P14A 1FMD2 4CDQA 4QX1A 1YO8A 2XXZA 5SV8A 3TAYA 5A3PA 1CIWA 3OPZA 1N3PA 1ND3C 4N43A 4AXOA 4E2GA 4AOCA 4LO7A 4XUPA 5DG1A 4A41A 2YXSA 1YLLA 3C7EA 1ONAA 1O4YA 3OPTA 4IEUA 4NUBA 4PDWC 4B1LA 5KWRA 2P6CA 3K48A 4ATEA 2DFCA 4D6RA 1O7FA 3NV1A 3O0WA 3ON7A 1RUE3 4R9AA 4B4PA 2F4PA 2VM9A 1RTVA 1C57A 1I5ZA 5EIYB 3PU3A 1BHGA 3QH7A 2BTVC 4AHZA 1MQTA 3SNMA 5E89A 3DF0A 1CPMA 1D7PM 5CKMA 3WF1A 3WW3A 4XIKA 1K5MB 1BMV2 3HT1A 4P9LA 4C1XA 2VBDA 2XJQA 2ZHLA 5DDJ1 3J26N 3Q8AA 5HCBA 3VLBB 2P3KA 1D4VB 1AR92 3WP3A 4XHBA 1XE7A 3WQ1A 5LBCA 3RNSA 2JE7A 5DDJ3 4NAOA 2VTXA 3NO8A 2W92A 4BQYA 1S0CA 4XHXA 1US2A 4QT6A 1PZ8A 2HYKA 2P1BA 1RUI1 3U78A 1XQNA 5JIUA 4Y4YA 2DV9A 2LW8A 5F6LB 3WNMA 4NPLA 3OSDA 4FFGA 5A3TA 2MEV2 3VBFC 5DAPA 3VD5A 2W47A 2QQIA 1W39A 3DYMA 4QXCA 3ZIWA 2Q5TA 2TEPA 5FZHA 1GOGA 4QPWA 5I0RA 1RHI1 2QQPA 3A23A 2RHPA 3TEZA 3KSCA 1COV3 3K4ZA 2A3WA 4YLZA 1LOGA 4QPYA 1NE6A 1AXKA 3C7HA 2ZGRA 4P9IA 2PLV3 4Q2FA 5FZEA 1IS4A 4ES8A 5FZLA 3EMRA 1COV1 2FBEA 1OOPC 2JDUA 4AVCA 1SLLA 3HWJA 1VBA2 5ERLA 4AYUA 2J1TA 3VBSA 4E8CA 4RS5B 4XBQA 1LJ7A 1POV1 1ODNA 3QBQA 5HBAA 2VMDA 2IXHA 2ZGSA 3IDBB 2QBXA 3VDBA 3M3IA 1H2LA 1XXNA 5FXVA 4NHKA 2VZ1A 3LEKA 5LA2A 4LEJA 3BKZA 5T3NA 5FPVA 1CAXB 5FY9A 4IETA 5T52A 2IXJA 4PLNA 1H1IA 4FPHA 4WM7A 3B93A 4I0BA 1QHDA 1GP4A 2RDSA 1O91A 4Q0UA 2CDPA 2JDAA 2ORXA 5F3EA 5FZDA 4A7KA 5FPAA 5GZDA 2Q1FA 5LEKA 3I3EA 4IV1A 2ZCWA 1SCRA 1LR5A 4GKYA 1QIQA 4EZHA 1S0BA 3B69A 4Q29A 1FYUA 5J98B 4QM9A 2QZ3A 4DPNA 3SCHA 1WD3A 1O3TA 3WNOA 4TSVA 2XL7A 1H8VA 2W3JA 1NA1B 1UOJA 2HWF3 3S5AA 2VZVA 2V4AA 4MADA 3NJYA 4LKDA 2YU2A 5CZKA 2ZGTA 5K0UC 1OD5A 2VMIA 2IUWA 3J7HA 1JZ5A 3PJYA 2XBO3 3RJ2X 4G9SB 3PVOA 1RUJ3 5FY7A 3U4SA 2Q8EA 2VG9A 4QB1A 1JBCA 2J1RA 2K9ZA 4ET7A 3JB8A 3BVCA 3PIGA 3PHMA 4NHYA 3SISA 2YBSA 3DV8A 3UK9A 1G9CA 2KM2A 3T0DA 5CFCA 1FX5A 5FZCA 2B42B 2IWGB 3I2IA 3ALQA 1XRUA 3BIWE 2DVBA 1ULGA 3AZXA 4UI9L 2C1FA 1JYWA 1EV13 2P6HA 2RR13 2YV8A 5F8PA 4Q1RA 3WF2A 1R092 4JDOA 4DXSA 1W2AX 3BPZA 2WC2A 3DGTA 1PO21 2OPWA 1ZZ8A 3Q8FA 4FOQA 1Z7S1 4Y3OA 3WOGA 4PIXA 1U5YA 2R062 1ODMA 2VQAA 1H6YA 1VBE3 1GZCA 3A22A 1LOBA 3QCWA 4AQSA 1LECA 1CD3G 4MVTA 2WABA 3SCGA 1W9TA 4Q4V1 3AZYA 4ARYA 2PLV2 3POYA 2OKXA 5L19A 2QQJA 1SHWB 3RI8A 1F4AA 4C0HA 4F8AA 4HG6B 4AWDA 4LORA 1D4M2 1XNBA 2HWE2 5JVVA 5JDBA 1Y7BA 3VBHA 2EXIA 3PMEA 2GC2A 4DY5A 5L9VA 1ZREA 1A34A 1F31A 1B35C 3WW1A 4CEWB 1DIWA 4Q4W3 1S2EA 4YSFA 2W0XA 4MXVA 2ZACA 1VBC2 3E6CC 1S0IA 5DQ0A 3THPA 3IDAA 2Y34A 4EN0A 4FFHA 5JSPA 4EWAA 4MGQA 1AL21 1X7NA 1AR72 5BNNB 1V6IA 4OHXA 2WO3A 3ZOIA 4CDXC 4FPYA 1HX6A 3I3MA 3SH5A 2VXRA 1W2OA 5EYYA 3SC7X 1FOD3 2Z79A 3OEBA 5CFDC 2UYAA 1OQEA 3QH6A 1G8WA 4MH0E 1XOYA 2Z5WA 3HVDA 1HRV3 4PIZA 3SH3A 3IDCB 4E4HA 5JXGA 4MHRA 3VV1A 5EQUA 4EWDA 3M3CA 2BFUL 5FZ4A 2QQMA 4HMZA 4QKFA 1NCRA 4FFIA 3GXUA 3L2YA 4XDOA 2HWD2 2OPKA 4M3CA 3RYRA 1MS3A 4YW1A 2JIGA 1DQ0A 2GU9A 4DQAA 2KXLA 5KXEA 1OC1A 3S7EA 3VN4A 3AMPA 5LA9A 5FPZA 4Y24A 4AHWA 3W5NA 5FXZA 4BK4A 1PK6C 5IK5A 1RUG2 4HVOA 4LIUA 5FYBA 4AFMA 3OUJA 5E88A 3M8LA 3KGZA 2D7FA 1DQ1A 2R1DA 2LS6A 4MGYE 3WDYA 4CE8A 4OUSA 4JQRA 3VBOB 4AEJA 5E1RA 5J1XA 1CWPA 1SFYA 1KDMA 4BMEA 5JOYA 1ASJ3 2GALA 3P1IA 3VHNA 1OH3A 2WLQA 5CKQA 4BCUA 1G9AA 4HETA 1W8HA 3MPPG 4CDXA 3KT7A 3IDEA 2VOVA 3OD0A 4KWJA 5EJ3A 1HN1A 1V6NA 3V0BB 3POIA 5L7OC 2R043 3WDVA 2ORZA 2LUWA 2W1SA 3VBUA 3NNFA 3ITQA 4Q0QA 1REDA 2AUYA 3RGBA 3HNBM 2A7AA 3MIBA 4UAPA 3VKFC 4XF3A 5F2WA 2W9XA 1PZ9A 1W8FA 1GFF2 3MIHA 4RD7A 5CADA 3IM0A 1N3OA 3E1F1 4N8MA 3B3QE 4BE3A 1S55A 1QY4A 1SBFA 1V9U1 1A8DA 3GBGA 5ABJC 2D93A 4I2OA 3WP4A 1MR5A 1ND2A 4UBGA 3H3LA 4B3NA 1LGNA 4Q4X1 1V6OA 4QX2A 4XACA 1UPSA 3GHNA 1H30A 2VZRA 4KU8A 2VVFA 4XUNA 3BB6A 1GLHA 1LTEA 4HLTA 5A33A 1KD7A 2A5ZA 5BNNC 1PVC3 4CDXB 1RIRA 1S1AA 2F6BA 3RI9A 2VCBA 4MGKE 1OKQA 4ORFA 2JECA 2WS91 3KHBA 4KG8A 3I8TA 1BK0A 1W2NA 1RUE2 4RSUA 2VUCA 2AACA 1OUXA 5K8SA 1BBT1 1Q8VA 3RSJA 3T09A 3KQRA 2VXJA 3Q9OA 4LBNA 5C8CA 2GMEA 1ZZ9A 2R49A 4U36A 1PM7A 1LEDA 2QQOA 2D3PA 1Y9GA 2JKXA 1Q56A 3WDXA 1JUHA 1HW5A 3BODA 1LODA 2I74A 4M3CF 1HDKA 1UZZA 3GZTB 1UNBA 4UW6A 3VDDC 2VBBA 4NRMA 4JRLA 2Q4SA 4PHZA 1UYXA 2WQ8A 4MO3M 2JG9B 4J1WA 4Y4RA 4MSVA 3B00A 5FBZA 3ATGA 3ST7A 2VL4A 4XJWA 4UFMA 4CEYB 3OTFA 2P34A 1LHVA 4W6YA 4XCBA 1UU4A 1WA6X 3PUAA 2ZZQA 3WXPA 3UETA 4YFZA 4PBOA 2DTWA 1W9WA 1YQ8A 1RUF3 2HKXA 2WJSA 2OQ7A 4OZOA 4Y1UA 4HKWA 1ZNPA 4GJZA 1RHI3 1VBD2 1YI9A 1JZ4A 4O61A 3ZXGA 3DKWA 1W6NB 5FO7B 1R64A 3NW4A 2E7QA 3KCYA 4PF5A 3URFA 5LY1A 1SPPB 1V6KA 3KMHA 5FZ6A 5KBFA 3CZUA 2UWBA 4IE0A 1KRIA 2HEYF 1M06G 3DKQA 2WNVB 1W2TA 4MUVA 1C3HA 3AYAA 4FPEA 4RN5A 1XU1A 3JD71 4CUBA 3W58A 4XJAA 5F5CA 4BQ1A 5IW0A 4QX7A 1TZOA 3I3QA 2HWB2 1DCSA 1H0BA 1WMXA 2J22A 2B45X 4PLMA 4CUCA 1UMHA 4ARXA 2WT2A 3TYJA 3DEMA 3Q8CA 1HXS1 4P9JA 5JPNB 2R30A 3KV4A 1PO12 4JC1A 2X09A 2YU1A 4QX0A 3IAQA 4V2VA 4YGBA 2ATFA 5T5OA 4DS0A 4IEZA 4BB3A 5JZGA 1OVSA 2RMU1 3IIAA 3MGUA 4QKDA 1MQTB 1J3PA 1HJFA 4FCAA 5FP7A 5T54A 5IT6A 2ARAA 3GZUC 4XF9A 3KD4A 4KMQA 2O8OA 5FP9A 3BALA 3FUQA 4BWOA 1TNFA 5LK5A 5F3GA 2NYYA 1NLRA 4QHZA 4AAPA 2ZGPA 2W1WA 3J4UH 4IGPA 3USSA 4E4SA 4Y5Z0 3BTXA 3VD9A 1AJOA 2BGPA 2A73B 3FBYA 1O3RA 4XFGA 3T4HB 1L7RA 3JD72 2SLIA 3AZZA 5M0TA 1BVVA 2R16A 2VUAA 4DEQA 1BZWA 2OZ6A 3NAPA 4IE4A 3WP5A 3VBRA 4LBOA 2OS2A 2VUJA 1VBC1 4NIGA 5FO9B 5LW9A 3VD7A 4A7ZA 1QF3A 2HYXA 3POJA 2NMNA 2GMPA 4H2AA 4XFAA 1JOPA 4K21A 3ZXAC 1JN2P 4AGRA 3I3DA 3KV6A 3QLQA 4HK8A 1KGYA 1ALYA 4XFHA 4XUTA 2XWBB 2GNTA 4CA9A 4HPKA 2C9KA 3NNJA 1XB9A 5IYYA 4CU9A 3A21A 1E5IA 4I02A 5FAXA 2VO5A 4HOOA 2XWJB 2DCJA 2Y6GA 3CDZB 3JB4C 1LOAA 5BY5A 1K12A 3T0AA 2WFF1 5AVAA 1A6CA 3WNLA 3D82A 1F5FA 1U12A 3KLSA 4OUEA 1GQGA 5CU1A 1QNYA 4JX0A 3THTA 1GOFA 2ZXQA 4GH4B 4WM7C 5A7PA 3NJXA 1LENA 5DUUA 2D6MA 3PUIA 4LE4A 4RGKA 5KXDA 3VBSB 1J1LA 5IHRA 1ZRDA 4F7ZA 4LLOA 1JYNA 1Q8QA 2FD8A 3LOBA 3GHMA 3ZYGA 1NCQB 4P9XA 4OI0A 4LHLA 3FHQA 4Q4W1 4ZS2A 1NT0A 4QWNA 1W3VA 4IE6A 2C6SA 3K51A 1JZ8A 5DPNA 3LFMA 3N7MA 3ZPOA 5LWBA 1FOD2 3J8F3 1QEXA 4IE5A 4YZ2A 4UF0A 5FFOC 3KCXA 2Q0AA 2Y38A 3PVEA 1ZRFA 5D8AA 2FDKA 1VAVA 2W5FA 2EF6A 3JBG2 2VOTA 4UW3A 5FYIA 2JDYA 1T2XA 2WYSA 1NE4A 3ZN5A 4CCOA 3C2UA 4XQ4A 3ZN6B 4DZGA 4XTPA 3M7AA 4QXBA 3H8XA 3FC0A 1G9FA 1H8TB 3KB5A 1CONA 3R05A 1OUSA 4QPIA 1ULPA 4HKLA 3ZLIA 4CP2A 4PT6A 4GIQA 3ZSLA 2JDMA 2RM22 2HWD3 4UOJA 1BVP1 4WZFA 3HJRA 1RINA 1MS0A 2CWSA 4OI4A 4YZ4A 3SH4A 1SLIA 2P37A 1HLCA 2RS11 3HR9A 4MX3A 4A3ZA 5F5QA 1YIPA 1GNYA 3IAPA 3JU9A 3JD73 4I0WB 5H9RA 2OYZA 3RZJA 1OT5A 2FDGA 2GN3A 2BP6A 3GCWA 3WZ1A 4R8HA 2G4IA 2VZOA 3IMMA 4A2UA 5CG9A 4QU2A 1I6XA 5K0UB 4JKKA 5FY5A 3DN7A 1L7LA 1ASJ2 3E97A 1GWKA 1PX3A 3BPSA 2GC3A 3OCPA 5JSOA 1S2KA 1CAWA 1JUIA 3FL7A 1VAMA 4Z82A 3UGHA 2NQYA 1PO23 4FP2A 3B94A 4CDUB 3FN9A 1J84A 4URTA 3ROUA 2VD7A 1Z7S3 4D6QA 3JBG1 4CP0A 5BNPB 4I3GA 3USUA 4NR1A 1IQDC 1EAH2 1HV0A 2JG8C 2VVDA 4JKMA 5LBEA 4DB5A 3VBHB 4CYDA 1OFNA 3POGA 3WHUA 1ACCA 3BI3A 3I2JA 3HQUA 1H2KA 3H3ZA 4LMFA 3WNNA 1C28A 1W28A 2B7YA 1RXGA 3VL8A 3LWCA 2BPA2 1H9WA 4H14A 2QQKA 3SCFA 5KHHA 5HCAA 3ZFGC 4PBPA 1RVF3 2WNOA 4O9GA 1BMV1 5FUIA 1SLBA 2D40A 5FYVA 2YHJA 1SPPA 3WHTA 3MZHA 5EJZB 2FDIA 1RC6A 4ITCA 2WAAA 3RYPA 3LF7A 1JYXA 1BK1A 3K3NA 4LKSA 4KI5M 4QKBA 1JZ6A 4GULA 1JTZX 1XNDA 2HWC3 1S4CA 5IATA 3AK0A 3WUDA 1R1ZA 2Q8OA 3B01A 1UY0A 4MOAA 2GNBA 1Q8OA 1QJU3 2C5DA 3LA2A 4LUMA 2JWPA 2WNEA 2AREA 3OYWB 1PMHX 3AL5A 4O9EA 4I09A 4XFBA 1B35B 4BQ4A 1DGWX 1LNSA 2ETEA 3ME2A 1UU5A 1UPIA 4B7EA 3S0MA 3H7JA 5DXDA 1OLME 5FPBA 5A7WA 2J42A 5EXOA 5BXXA 1VMFA 4INDA 1VRH1 1Z78A 5EFUA 3NKTA 4P08A 5D8AB 2B9VA 2DUQA 1AR61 1NCRC 1HB2A 4YW5A 1GOHA 1VBB2 4Z1VA 1OPOA 1RUC2 4RHV1 3KGLA 2YG0A 3WCSA 3W21A 1WW4A 5F3IA 1UIJA 1XNKA 1TME1 1UU6A 5FZBA 3UKVA 2BDRA 2IXLA 5FK7A 2QE3A 3ZYJB 2ARCA 3KV5A 5C33A 3OPWA 3WG1A 4UFLA 1ST8A 3H3UA 4HZFA 2WWSA 4XDPA 3ZO0B 4AI2A 1HIXA 2VMCA 1SDDB 3WQ0A 3ZFGA 5JMOA 1CR7A 2Y0IA 3AVRA 5C9AA 2ZMLA 3HIFA 3AMMA 5JAXA 4GB33 4FSJA 2VE1A 4NJ4A 5I0TA 1OBNA 4ISQA 1VBE2 1K5MC 1CAVA 1O4TA 1YFWA 2R063 4Q4Y1 3SHRA 2KD7A 3W59A 3TWIA 3GYDA 4Y33A 4COYA 1JODA 4EE2A 1SLTA 1VMJA 4FPKA 4HN0A 1OA2A 1TMF2 3BCWA 4ZZ5A 5FIXA 3WSOA 4AGGA 4NRQA 4CXYA 1W04A 1SG3A 1D4M3 4E4DX 3O1RA 2XGXA 4CP1A 4AEDA 2PXJA 4N9HA 4GKXA 1HV1A 5IVFA 4HT1T 5IVVA 4GAZA 4TYSA 4ONUA 1SLAA 1POV0 3O1TA 4IDZA 4HONA 3VBFB 3OGVA 1VIWB 3C3VA 3I2HA 4P9YA 3X29B 1WLTA 3LPFA 4CSWA 5J7MA 1RVF2 4P9GA 2HWC1 5I0SA 1V6JA 2RJKA 2WQZC 5IFTA 1AVBA 4ZU7A 1GU3A 4LKFA 1UOFA 2BUKA 4L0PA 5IJRA 5LRRA 3SLIA 2W1UA 1YNAA 1QJX1 2IFRA 3VZKA 2WR9A 2PYTA 2WS92 4RL7A 3ZYBA 3GJAA 1QNWA 1IQAA 2B9UA 1ULCA 5E16A 4CP9B 4WVMA 4J25A 1GZWB 4HXCA 5FMDA 5IK7A 4ZZ8A 4HFSA 1RYYA 4CTEA 1PGW2 1VBC3 4DXZA 3I2GA 2HWB3 2ARXA 3J7MA 2PQQA 3R4DB 5A7OA 2ET7A 2JDZA 3VZJA 4AG4A 3EYPA 3ZIXA 3ZYPA 4K20A 2RDQA 5FP4A 3V0AA 4Y22A 1PNGA 1BBT3 1W99A 2AYHA 2ZPXA 3POFA 4QX3A 3RS6A 3I3BA 2AGSA 1N1YA 4NVPA 3RG0A 5D8AC 3DECA 4HN1A 2J1UA 3D6EA 3VHPA 5J37A 1JOBA 4AEKA 1FNZA 1ZBA3 1RL3A 3KT4A 3MPBA 1NXD1 2PLV1 4BJ0A 1HRV2 3ZSJA 4LE3A 5EV7A 1S0FA 5H9PA 5I93A 4K1YA 1VAKA 4XJ9A 3TN92 1N1SA 3U14A 3VKMA 3NV2A 1QQP2 2VZUA 1F2NA 1WKYA 1YJKA 1RVF1 4Y1XA 2HJIA 4YGCA 1CJPA 1H1AA 1BEV2 1SBEA 2JXAA 2MEV3 5FDBA 2A1XA 1EYBA 1R093 4XETA 4A45A 1H1MA 3OOXA 3DL3A 1SQ4A 2E7TA 1QJX2 5AVPA 2BOJA 4M4PA 2WSUA 2VNOA 3E5UA 3JXSA 4GALA 2WUHA 3O1VA 5F3CA 3AYEA 1SMVA 2JX9A 3MIEA 3IIIA 1I9RA 3ZYHA 1W9SA 1ZM1A 3CO2A 5FP8A 2A3YA 2JIJA 3VZMA 1M4WA 4D7YA 2RE9A 4D0QA 2VZQA 3RMXA 5FLHA 4LULA 4OI1A 4JGYA 2QTWB 5LB6A 5LBBA 4FPCA 4FTSA 1VBA1 2WL1A 3AP4A 1YFUA 4E27A 2FDFA 3MW4A 4XC9A 3H1YA 4GJYA 1E5RA 2VOKA 3LA7A 4AHYA 2B46X 3WINE 3LIHA 4CVUA 1MACA 2G1MA 2ENRA 2OVUA 1AR71 1JU3A 1MEC3 1ULDA 3U4XA 4EN9B 1PO11 1W6MA 4N53C 1LULA 2YBKA 4XMAA 5FMOL 4FTBA 2BBVA 3N3HA 4AEDB 2YPJA 4PI2A 2CAUA 3T1MA 2OW4A 3JBG3 5DUXA 4NIDA 2WNVC 3IN9A 2A6WA 5LBFA 1W6QB 2ZAHA 1WLCA 3LB9A 5GJ6A 4AI8A 4C0BA 5KHKA 1RUD2 4LBMA 4B7KA 1NAEA 2UYBA 1X8EA 4WM8A 4BLIA 3AM2A 4XJUA 1Q3EA 3ZN4A 5BNQA 4DY3A 4QQHA 2VCMA 2EXKA 4YM2A 3KF3A 4AAXA 1G7YA 1UXZA 3EHKA 5I0UA 3MF6A 2BNNA 4E4ZA 2RM23 1RUJ2 4FT8A 2GC0A 1IS3A 5CYYA 1S0GA 5A7QA 4GXLA 1RUNA 2PFWA 1WMEA 3AJYA 1C1FA 1VR3A 1RUG1 4E8DA 5JSRA 1UZYA 1UY4A 2GMMA 2RS13 4V1PA 4DNYA 3WCRA 1AYN2 3ES1A 5FPXA 1D2SA 5AC91 2EVXA 5B2GB 3K4DA 1UO9A 4IV1C 5J96B 2WDBA 5F5AA 1QQP3 4C90A 5K4LA 5HV4A 1APNA 3R4SA 1RUI3 4HPKB 2E6VA 1AJKA 4Y22B 1A78A 1YFYA 5KC6A 2JE9A 4CP9A 1ZRCA 2D44A 4XAEA 2N7GA 3OD4A 4LHSA 4OUMA 2XHKA 1V6LA 2ZEYA 1XNTA 2E53A 5FYZA 3NNGA 2VZPA 5FZOB 4WVWA 2WN3A 3LA3A 3MEPA 2OXBA 4EN8B 4EZ4A 4LO5B 4LO8A 2ADDA 2C26A 2L9LA 2Z42A 1YFXA 3GBFA 3WR0A 1PK6B 2XDVA 2G9ZA 2NN8A 5T5PA 4MGSA 1QH6A 2IC1A 2Z2SB 1JYIA 1E5SA 1VBA3 5F7UA 1ZRIA 2Q1MA 3ORJA 4Y26A 5IWFA 3CU7A 1KEXA 4BXSV 4YG6A 4Q4X2 2BBAA 1WW5A 1CPNA 1RUH2 3VDDA 2AC1A 4Q4W2 3VKLA 2JJ6A 1VBB1 4AGVA 5LK7B 3B5LB 4CPBD 3N9QA 1KJRA 3TEWA 3CL1A 2YFUA 5DUWA 2CGPA 3LIGA 4IEPA 1N47A 3AC0A 4QPGB 5IVJA 4RGGA 2IVJA 3BOPA 3U1XA 4XILA 3E5QA 3MIGA 2DVDA 4YARA 5JR2A 1OFSA 2JE8A 5F37A 3I2DA 4QB2A 1KXGA 2VZTA 4AEDC 1JHNA 2R071 1PVXA 4RQPB 3NWKA 4UF0B 4YW4A 5A7NA 5CIRA 3DPRB 3HOBA 3NL1A 1FPN2 2X53S 5FUPA 5A6YA 3PMSA 1IHMA 2RS32 1JHJA 5A3UA 3KVAA 4CPBA 2WSVA 2Y6JA 1X33A 3IPVB 1WW7A 5C8WA 5LASA 5FZAA 5GLUA 4Q0VA 1B35A 4QXKA 3M1HA 4S2HA 1YQ5A 1BJQA 1LHUA 4L92A 1YHFA 5G05L 5FZFA 2VULA 3CIHA 3VGIA 2MPFA 3HQXA 3N36A 3AP5A 2PELA 1CX1A 3HN3A 4DRRA 2KR2A 5DZEA 4CDQB 1X9PA 5AC93 3KHCA 5C6CA 2PHFA 4Q1PA 1J58A 1UMZA 4Y5SA 5DAVA 1R082 1DQ6A 5FCCA 5CFDA 3VBUB 1N1TA 4WBBA 1RUH1 2VOWA 1Q8SA 1X9TA 3FJSA 1WCSA 3D0JA 2YMZA 2PHRA 1RUI2 1HB3A 2GZWA 5FK8A 4GD4A 3MW3A 2JDHA 4YW3A 5I8SA 4GWMA 1NY71 3N35A 1G9BA 1OSGA 4K7JA 3T08A 2EICA 4CCDA 3BGAA 3ABZA 5DABA 4P9WA 4LUKA 2IXIA 3MUY1 4QDRA 4QDSA 5C9AB 1ZYBA 3OJBA 4N9IA 1X82A 1HXS2 2R072 3AXDA 4WVVA 2PAMA 1X50A 5A7SA 3ELNA 3O1UA 2XJPA 3OEAA 5BYNA 5BNOC 1C5IA 4XBNA 4FOVA 1SCSA 3NRUA 2DCTA 1U0AA 3IKWA 3OUHA 5CVRA 4TWTA 1SZBA 3TEXA 3TOJA 4JRAA 1W0OA 4S2GA 2BYVE 4GQ7A 4KU7A 3PTRB 2JG8A 3WG4A 3RVHA 3UNPA 2X5IA 3FLRA 4Q0PA 3WQBA 3HQRA 5C5UA 4CRQA 2YROA 3CZJA 4PLOA 2ZKLA 2P3JA 1ZA7A 3NJZA 4IL7A 2XVKA 3WNXA 5I0DA 1OHFA 3Q8BA 4WV8A 4CDWC 3SEPA 4LITA 5C4WB 2JICA 2XKOA 4P5YA 2ERFA 2XJSA 2E32A 5FZ9A 2Y6HA 2PHLA 4GWJA 2D3SA 4I0AA 3OGJA 5IAXA 1AL23 1UZWA 2VECA 2VCCA 5ACA3 2PHUA 2ZGUA 1A8MA 4YM0A 3EXUA 2GSYA 2QQWA 4AQ6A 5FJHA 1NY72 2VR4A 1PMJX 2FZ1A 4BISA 5A6QA 1PK6A 2A3XA 3IZOA 4BM8A 4KH9A 4Q27A 3OG2A 1DBNA 2DF7A 2RS33 5JWPA 3T3YA 2CTVA 1VRH2 5IVYA 1OQ1A 2FDJA 5J09A 2DVFA 2RS51 3C8XA 4LPLA 1S2BA 1YXWA 3K46A 4GA9A 5BNOA 1AF9A 1AX1A 3IBMA 3POBA 4UFJA 5C71A 1TE1B 2WNVA 1FT9A 1NOVA 3ACLA 3NQHA 2XVGA 3T2PA 3H1MA 4JKLA 3ACGA 4NE9A 5FLJA 4UYBA 5F1RA 4XDQA 3TN93 1ND2B 2UY9A 4K9SA 2HWF1 4B4RA 3LCPA 1OLQA 2VNGA 3B9IA 4CCCA 4C91A 2BNOA 4LHNA 1MQTC 1V70A 1SACA 3LOIA 4UT5A 4B4QA 1PNFA 4MV2A 1IKPA 5FOJB 1CAVB 2O14A 2QKDA 1MVEA 4OULA 1SLCA 2BVBA 2VMEA 4XFFA 2QZ2A 4CDWA 2W2IA 4K6BA 2OZJA 4XF0A 4OQ9A 4COZA 2QDNA 2DCYA 2K0GA 2V5YA 2LM3A 3SQOA 3PUQA 3O0XA 4NPMA 1O6UA 5ABJA 3IPVA 4QKNA 1CZVA 1EP0A 1NCRB 1GUIA 1BLZA 3ILNA 1PIV1 5C9AC 1MEC1 3LDRA 2OT7A 3WDTA 5JCTA 4BPZA 1TMF1 1AL0G 2R061 4P00B 2XUMA 4MHUA 2R042 1KFXL 4Q8KA 2WFF2 5A6ZA 5J48A 3AKSA 3CKHA 5H9QA 2YYOA 1QU0A 4KGQA 4QPIC 4RA0A 5C3QA 4META 1O59A 2F17A 2ZX1A 1TMF3 1W6OA 5FXWA 2XLAA 1VJ2A 4PQQA 4FXGB 5JZGB 3FHAA 1HRI1 2P2KA 5FZ0A 2ZMKA 1RUJ1 4YFWA 3ZSKA 1QOTA 1ENXA 1WCDJ 3EBRA 4IESA 1MZEA 1V9U3 3LPGA 3AFKA 1GSLA 1W06A 2NZ9A 4OVEA 4ZS3A 3RFRA 3WW4A 2YFZA 2ZGOA 5ANNA 3UL2A 3GJBA 4LR4A 5ACA1 1J83A 3N9OA 4WVMB 5JXHA 2W68A 1C8M3 2BERA 2QUOA 4AVSA 2D6LX 3MLKA 1EV11 2RR11 3WX5A 3N9LA 4AK3A 1I3HA 3LAGA 1MVQA 5FYYA 3WDUA 4J1XA 3VKNA 2ET1A 1DGRN 1YRZA 2H0VA 1AR82 3GZAA 4AI0A 4WM7B 2DBNA 1FV2A 2LALA 2QJVA 3LD8A 4YVSB 5APAA 5FZGA 5GZCA 1VRH3 1WCUA 2ES3A 4UFHA 2W91A 2DUOA 3BOWA 4FAGA 1MEC2 1OKOA 2ID4A 4NOTA 1JXNA 3OBZA 3QACA 4Q4V3 5JIAA 1UCXA 4AI9A 5EP9A 1Y9QA 4O65A 4CEWA 1GBGA 5FQ0A 1NX9A 3HT2A 3J9SA 5KHGA 1WUVA 1VBB3 2PHXA 4QGLA 2QCSB 3VZNA 1XNCA 2VQUA 1WWYA 3WY6A 1QJY2 2VTXJ 3WP6A 1BQPA 3CJIC 3QD6A 3JUUA 4XJZA 1BYHA 5T5LA 2EIBA 3GM8A 1AHSA 2F4LA 3USUB 5CISA 4QGNA 1CZSA 5GM0A 2XLGA 1XE8A 4I01A 4JHTA 2VMGA 4K1ZA 5FKBA 4Z2AA 3AB0A 4YW6A 2UURA 2VQTA 1LU1A 3R4UA 1V00A 4Q4Y3 1RB8G 4LO4B 4AHXA 5LCWL 2V73A 1RUF2 3B9CA 2A6ZA 4YW2A 4TLFA 4OHZA 5CFCC 2D6KA 3ES4A 3W9AA 4B8EA 3Q8EA 4A42A 5KHJA 3N4MA 4CCMA 3K77A 2J1SA 4GWNA 5FY1A 5B4XA 1DGWA 4DRVA 3BIEA 2XUEA 4XQWA 3T2OA 1GWMA 2PN5A 3B7MA 5FRAA 1NKGA 2CSGA 5LA1A 4FPLA 4QU1A 4GMP1 4LTAA 4OFGA 2O0OA 4A4AA 4LO6B 5JZGC 2HWE3 4Y20A 1UD1A 4W65A 5L36A 2J1VA 4M0HA 3VKOA 1W6MB 3AKQA 3M3QA 3V65A 3ZN6A 1AXZA 5EHDA 1V9U2 4AVBA 1GNHA 3D8CA 4KBBA 1PVC1 2YB7A 4XXPA 1UF2C 1OXCA 3LEGA 4L8QA 5A80A 3ZVXA 1R081 3EJKA 1PZ7A 2WZ8A 4COVA 4B29A 2UU8A 1XC6A 2CAVA 1AR62 3RZZA 3ENRA 4FOWA 3RZMA 2Q8DA 1F5JA 4LQRA 4J6GA 1AX0A 4KG0A 4BLJA 4CCNA 4AFDA 3L2HA 2V4VA 4YZ1A 3LSEA 5E6HA 2NM1A 1FI2A 5FJKA 3QOPA 1LHNA 2XJUA 4SBVA 4EJRA 4FPJA 2D5HA 1UW8A 1ZBE1 2Q1ZB 1JW6A 4KBZA 4NRPA 4ZONA 1PGL1 4XXAA 1W8NA 1UY3A 3AJZA 1G6NA 1OH4A 1D2QA 5L7OB 1JZ7A 1D0HA 5C3RA 2ZEWA 3AYCA 4RFRB 5FKCA 4X8PA 5FWEA 3W20A 1LU2A 4H3WA 4D6SA 2WS93 3PUSA 1IS6A 3U37A 1UQXA 3AVSA 1STMA 2HLEA 5CA6A 3U0ZA 1YCIA 2RM21 4AVAA 3I4IA 4NIIA 2E9QA 5AC92 4XURA 2FMYA 1H2NA 4FPOB 1NQJA 2R6QA 3AZWA 3AKRA 5EYXA 4WVZA 2JENA 5JOWA 3S30A 1Q43A 1OF4A 1NCQA 3C7OA 3IWZA 4LNVA 2W39A 4RS5C 4YG0A 4YYOA 3WVJA 1UX6A 3ZYIB 1UKGA 1CESA 3CHXA 1GP6A 2BU9A 1W0PA 5A1FA 2XR4A 3ECQA 3K75B 4AF9A 3H9AA 4DO0A 2BWAA 1JYVA 3N7LA 5FZ1A 4CCJA 5CG8A 1MZFA 5GLWA 1JYCA 4GB32 1TVGA 3NNLA 4DXTA 4SLIA 1ZZBA 3RQ0A 1A3KA 4TTGA 4TN7A 1O8PA 3I49A 4CCEA 5TSWA 4XQDA 5IK8A 2Y60A 5A6XA 1CIYA 5FZOA 3T30A 5C3SA 5B4NA 4JDMA 2OUHA 4CU8A 2DYCA 3MIFA 1R1A1 2ZGMA 5FWJA 5DAWA 2C0ZA 4CUGA 5GLVA 2TBVA 3I59B 4AE2A 1F9KA 4M01A 5F6KA 3INAA 4Z07A 1G9DA 3ZX7A 4BQ2A 4Q5OA 4FPFA 4N43B 2X29A 1EUUA 3WG3A 1JMUB 1G86A 2E51A 4D7TA 2EALA 1COV2 4I30A 3WQ7A 1DHKB 2W46A 5HV0A 4R9BA 2BZDA 1UY1A 2VCAA 3K3OA 4OMCA 3VDDB 3KV9A 3LSDA 1W2UA 1AR63 4JV4A 4HK9A 1K42A 5JMCA 1QOSA 1VPHA 5C70A 3I97A 3SMHA 2PHDA 3PVBB 4QPGA 4XVHA 4CEYC 4UW5A 5KXBA 2ZABA 1HQNA 4H7MA 5FY0A 2YZ4A 3TNPB 3RZLA 3IMNA 3LFIA 3TN91 3EB7A 4UFIA 2A75A 3VZLA 2BJSA 2AENA 2XONA 4IGOA 3ZSEA 4IXLA 5FZIA 3HEIA 1ENRA 3MUZ1 1IPSA 1O3QA 5FMCA 4NAMA 4BIOA 2FCUA 3I59A 1US3A 2IXCA 1VRBA 1W8ZA 1VMHA 4PI0A 4X8NA 3THDA 3ZDSA 4CZSA 1U5IA 1FV3A 5E8AA 4XOGA 4COUA 2RS53 2JD9A 1LEMA 5GZEA 5JOXA 3SITA 5LZ6A 2A70A 4IEVA 2G9FA 5FZ3A 2CWMA 5FUNA 4A3XA 4OCTA 4OZXA 2WZR1 2X8KA 1ZVFA 3NKGA 3NJVA 3UKTA 3OGGA 1IS5A 1ZZCA 2ZX4A 2VVEA 5A32B 4OLLA 4XJ8A 2VMFA 3U75A 5FTTC 5FMBA 4AZZA 1PMIA 1KITA 1QJFA 3C7GA 1MZ5A 5D21A 4L9BA 4MXWB 4YGEA 4CEWC 2IVIB 4PDWA 2FCTA 4FPGA 1QH7A 4M00A 1KS5A 3WF4A 4CXXA 5KHIA 4H7LA 1FNYA 2XMLA 1W6PB 4LT5A 1DQ4A 3LEMA 1QJX3 4AFBA 1TNRA 4HSLA 4ASMB 1JZ2A 5JOZA 3VBRB 2K46A 1VBE1 3D4KA 2UY8A 3OYWA 3M3EA 1S0JA 1FXZA 1YQ6A 3VBUC 3ACIA 1N3QA 2CU5A 1OD3A 4NO4A 1DZTA 1ZBE3 2FZ2A 1RUD1 4XTMA 1CVNA 2W1QA 4OHVA 4QQLA 4XFCA 4FXKB 4ZPIA 3GNEA 5A1LA 3V0AB 2ADEA 5FV3A 5C3OA 2HEVF 4AQ2A 5JXIA 3FWEA 5FMOS 1H4GA 2EXJA 4KGGA 5IAVA 4N43C 1ENSA 5DG2A 3UYJA 1RMU2 1C5HA 2PAKA 3T4VA 1MPXA 2WFF3 1XSRA 2I07B 3D3AA 3N9NA 5CB7A 1CAWB 2DCZA 1EUTA 3SXWA 2HWC2 4LLFA 5A33B 3I54A 5DUVA 4N7UA 4AFAA 4EN7B 1ZBA1 4D8MA 4ZXKA 3ZFEC 3JQXA 4IGQA 5FBJA 1AR83 2EIGA 3ZFFA 2Y6KA 4AL9A 1YJLA 3M4FA 3B02A 2EA7A 2CNAA 2LTNA 3VBOC 1Z0HA 4AQTA 5J3UA 2CY6A 1JH5A 1QJU1 3AL6A 1RUF1 4H55A 2E7AA 2ZX2A 3OBAA 3D5OA 4EROA 5CEHA 1AYM1 1RXFA 4NHXA 5FYSA 4LIVA 3W5MA 4YM1A 1OURA 1OLRA 1DYOA 4KQ7A 1H2MA 2XVLA 5AFEA 2OIIA 1WD4A 2CDOA 2R7EB 3ILFA 4IV3A 4RR3C 1O4ZA 3LDBA 3ZSMA 5C8CC 4FO9A 2GP3A 2Y26A 3O1SA 2P17A 1UZ0A 3UJOA 1R083 3WUCA 4ZKTB 1EPWA 5F39A 4LBLA 4GH4C 2X10A 2RS12 4NROA 1QDOA 1QGLA 1XNAA 5FOBB 1DP0A 2VH9A 2W52A 1HN0A 1GNZA 2JG9A 1UKRA 4CCKA 1HRV1 3FX3A 1DZQA 1ZX5A 4QHBA 3T2QA 3PLQA 2VY0A 3I2KA 4QXHA 3RYKA 2HH9A 4X6RB 4QMAA 3UGFA 4URAA 5ABJB 2NP0A 1H4HA 2Y64A 1MS9A 2P4EA 3PUHA 2JEMA 1V6MA 2YUEA 5A3LA 4LOTA 3OY8B 4DINB 3VDCA 1BEV1 3ZYRA 3MF9A 1W9FA 3VD3A 3WW2A 2NMOA 5CNAA 3O14A 4BZ4A 4NIAA 1DG6A 2RMU3 4XZPA 2H6BA 1UAIA 2IXKA 3AFGA 3ZFEA 3DUIA 4BA6A 5I8YA 2PAEA 4QX5A 1XE0A 1UL9A 1ZBE2 1QXPA 4D3WA 1AYM2 2JDPA 1EAH1 2ZHMA 1HRI2 4YNIA 1MZ6A 5DZFA 3LKJA 3RRDA 3K2OA 2ZGNA 1SFNA 1WCKA 2PHWA 4YZ3A 4YVWA 2QQLA 3PURA 3ZXFA 3RZHA 1KFUL 3OBRA 5I8TA 3O7OA 3GZEA 4DXRA 4WM8B 5HXMA 1CAUA 1ND3B 4R9DA 3ZR6A 1O8SA 4N7IA 1QDCA 2XH6A 4W50A 5ISLA 2SBAA 4A7YA 2GP5A 3DYOA 3KZ4C 5EWSA 3WD5A 2WO1A 3K4AA 4O7XA 3FMGA 2DCKA 2ZGQA 1RUOA 4GH4A 2D6PA 4M0NA 4MLOA 5BV6A 4DIQA 2QDRA 3N7JA 3M3OA 2R0FA 2JG9C 1C4RA 1NLSA 3KS7A 1GANA 1C1LA 4HKOA 4EN6B 2JB4A 3LGRA 4BOWA 2WAOA 1UOBA 4COWA 1QQP1 2PHTA 2YGLA 2YDEA 3MHZA 3S6PA 1ULFA 1R1A3 3AMHA 4XW3A 1UYYA 1QMJA 4ATFA 2VNRA 1W05A 2BOIA 2DTYA 5CBLA 1FATA 5KXCA 1I1EA 4EQVA 4PF1A 3RMYA 3PNAA 2A6VA 1BXHA 1UX7A 4CDUC 1JI6A 2ZJCA 1GZTA 1DF0A 2V5DA 2VMHA 2VPVA 1Y9MA 3DCQA 2XJRA 2JDKA 5FPLA 2ZEXA 4Q4V2 2P3YA 5C8CB 3VBHC 1Y3TA 2X05A 4JQTA 1W0NA 2FMDA 3AYDA 3AZVA 1QJY3 4S2DA 1UOGA 1LOFA 4Y1VA 1YWKA 5JLVA 1B09A 4RQPC 4XFIA 4KNCA 5LY2A 1GICA 1UN1A 2RJLA 1CN1A 1K5JA 4FQ4A 1IPJA 4YW7A 4DUWA 4A44A 4EV0A 1IKQA 1TME2 3WF3A 5K9YA 2D43A 1Q5OA 2K2SA 2B8MA 2TNFA 1IG3A 1U5ZA 1GZWA 2XPJA 1GYKA 1WCQA 3FBMA 4JGYC 5F9TA 4F3JA 1REEA 2NPIA 3RZGA 3EO6A 3T1LA 3FLTA 2Z4FA 3DXUA 1RUC3 5IUQA 4YZ5A 4HL0A 5HCFA 2VW0A 2WNUA 5C5TA 1AYN3 2YC2A 1QXJA 2QNKA 3ETQA 4LK6A 3CJIB 4PIYA 3VHOA 2ZTNA 1OI6A 5HXVA 2J7MA 3O5SA 1L7QA 1O5LA 3EQEA 5FLIA 4FAHA 1EAH3 4LXLA 3U07A 1O5UA 4YWAA 3BTAA 1S0DA 3NV4A 2VAUA 1PGSA 2MHFA 3L9JT 3O1MA 4HVQA 2AR6A 5L9BA 3HMYA 1AYM3 1PHMA 5F5IA 1LCLA 3ACFA 5D2AA 1VBD1 1IG0A 1UYZA 3ETPA 1D0GA 3ZM8A 3N7KA 3NVCA 2HWD1 1LRHA 2E31A 1YEWA 4Q0SA 1RHI2 1NA1A 1VBD3 4LBQA 4MYEA 4XMIA 4BHPA 2XJTA 4E2SA 5L73A 1AR91 4WM8C 1Y43B 3LZZA 5CFCB 1DDLA 4E9KA 1FMD3 4GWIA 3H8RA 2E63A 1AR73 1D4M1 5A3WA 1LOFC 5SV5A 1NXMA 4JGZC 5DAXA 1VB4A 3AX4A 4HSJA 4BXFA 5BNOB 1F15A 1J3RA 1OPMA 2B5HA 3GF6A 4CCLA 2OA2A 3R0RA 1UMIA 4YM3A 4TLGA 3FHIB 1YUDA 1GZ9A 2PMWB 3ZR5A 1WW6A 2C24A 1EY2A 1REFA 4Q4X3 1XBFA 3ZXKA 5JUVA 1RUH3 1DQ5A 1OQDA 2BRTA 4D7SA 5JPMB 3HNYM 2EIDA 1WGPA 1KS4A 2EXHA 2XQRA 3MICA 3OGSA 4KWKA 4DUVA 5FREA 4OHYA 1WLDA 4OHWA 1FPN1 2JD4A 2R0HA 4LHKA 5FYCA 5H9SA 3GALA 3VBFA 4QM8A 1AXYA 2VW2A 4CDWB 1WA4A 4QX8A 2D5FA 4OYUA 1ULOA 4IEXA 5A3OA 4YGDA 1UY2A 3CNAA 4RS5A 5JI7A 3WV6A 4AW7A 4XBLA 5C4WC 1CGPA 3TRSB 1HB4A 2CV6A 2QVSB 5HCHA 1LESA 1W90A 3N9MA 1XJAA 5EZWA 5FP3A 5A3MA 2RJ2A 1W8UA 1OOPA 3BU7A 3ZYFA 1UXXX 3HAGA 4XEZA 2AEYA 3MBWA 1POV3 1QOOA 3F2ZA 4AEMA 3DXTA 4G4FA 1UIKA 5FXXA 4DUXA 1TG7A 3LE0A 1NCQC 4JTNA 2CYFA 3JCIA 4ZXEA 2OUJA 2ZMNA 1DFQA 5A1AA 2ZOEB 4AFCA 1ZBA2 1WZXA 3KM5A 4Y1ZA 2XQXA 2QQUA 4EWEA 1QXRA 1WBLA 2DDUA 2CGOA 1JS9A 2WA4A 4CU6A 1BKZA 2LRPA 3MLJA 2WO2A 4AVVA 2C4XA 2FQPA 5C7GA 3A7QA 2RG4A 4LBJA 4M3CB 5IVEA 3VUOA 4YG3A 1AR81 2PA7A 4AI1A 1J3QA 1DGRA 1F35A 1H8TC 4PJYA 4UW4A 1PO22 3T0BA 3WEZA 5LEJA 4LBKA 5CAZA 3HBZA 3WNPA 2VNVA 5DN2A 1RGSA 1HB1A 1GR3A 4BYYA 4YVSA 1W8WA 3MIDA 1ZA4A 5JXJA 1OF3A 1X8MA 4QAWA 1YYNA 5CFDB 5IVCA 1GMMA 3O12A 1DLLA 2WZEA 2LROA 2WA3A 4JAAA 4IUGA 1IZ3A 2ZA9A 2V72A 3D0SA 1L3JA 2BGOA 2O8QA 4JGZB 3VD4A 2DU1A 2A6YA 4QPIB 2GNDA 4XAAA 3GGLA 3IB3A 3CBNA 4S2FA 1R091 2D6NA 3AKTA 3JQWA 5K7PA 1LOEA 4Z2WA 1EPZA 1NUKA 4LBQB 1CAUB 1ND3A 1P8JA 3V0BA 4CEYA 2X5IC 3ZFFB 4JZRA 1SEFA 3AP7A 4RYDA 4NN0A 2WIIB 3OB8A 4IW3A 2BV4A 4L2NA 1YIFA 1CAXA 1NG0A 1AL22 2KA3A 1JYTA 3ZPYA 3KWVA 2QFEA 1POQA 2W95A 3MV11 1QWRA 1UWWA 1RUE1 1W6OB 4XIOA 5FYHA 3H42B 2PQSA 4CXWA 4OMDA 1PIV3 3NNMA 2EAKA 2JG8B 3CEWA 3UV9A 4HANA 2R32A 2R1BA 4HVRA 3H8OA 2H0BA 2HWE1 5FPUA 1SDWA 4Y1YA 2WWUA 5FYMA 2XOMA 2VZSA 2WZR3 2YY1A 3IT8A 1ENQA 5FZMA 5GLZA 4QQ2A 1K45A 2PTMA 2XL9A 2WN2A 4CDUA 3CJXA 2HWF2 3CLPA 3RDIA 1W03A 4YVSC 4ASLA 1JZ3A 4NWWA 3HPNA 4NIHA 4X6QB 3ZFGB 2E26A 1JOJA 2XB6C 4K40A 4DEVA 3MO4A 4N53B 4R52A 5DDJ2 1HJGA 3WF0A 3RZKA 4MXWA 4NPRA 1K5MA 1ULEA 2Y6LA 2IFWA 1NYWA 3BYWA 4PQ9A 2VQ0A 2EAAA 2HBUA 4GZ9A 5FYUA 1LKNA 2BVVA 1KJLA 5IFPA 4XYXA 1OOPB 2ILMA 1C8M1 2GDFA 3UJQA 2B39A 1VALA 4LKEA 1OLMA 4FQZA 4XUQA 2WYFA 5GALA 4ZY9A 1URXA 3H0OA 2GH2A 2WINB 4HBNA 4XE9A 3BUCA 2Q8CA 1LGCA 3S5QA 4QD2A 2WT1A 2WKKA 4TZDA 4WZCA 1PGL2 4BQWA 2XJVA 2BQPA 4RFT0 5HPOA 1UZVA 4Y5TA 3ZMNA 2XHNA 4KWUA 4ZHNA 2VU9A 1OA3A 3M70A 3PTYA 4K3UA 2ZBJA 4XF1A 4K8FA 3VBRC 5GLTA 3AP9A 5FZ8A 3WT3A 2E33A 2BW8A 2VUDA 3LQCA 4L99A 5FQ0B 2B4KA 2DVGA 4QHOA 5HI0A 2ZZJA 3MV01 1LHOA 5FY8A 5ACA2 3N9PA 5LATA 2Y33A 4BQ5A 4JTOA 2NLRA 5F32A 3V56A 2GH8A 1CJDA 4QGMA 4JHZA 4R4ZA 3BTZA 1CQ9A 1LB2A 4IERA 1NA1C 3VB9A 3KQ4B 1W6NA 4BQXA 1FAYA 2YC4A 3A0NA 1UYPA 2X5IB 3ZFFC 2XG3A 2OQ6A 2RVAA 1RITA 2RS31 3ACHA 1RJ8A 3OF1A 4GB31 1C8M2 4JGZA 1YC61 4YRDA 1W6QA 4ZU5A 2YGMA 1PIV2 4M4RA 1YQCA 4MG2A 4ZU4A 1HKDA 2R041 4BMBA 1IPKA 2ZKNA 3C7FA 5K0UA 4XUOA 3CQOA 2YC0A 3H7YA 1QJY1 3KF5A 2DBIA 1R1A2 2ZHNA 1TME3 1W3XA 3FFQA 3WNKA 3P6BA 2Y6FA 1ZRRA 1VP6A 4R9CA 1W6PA 5EJ1B 3KCCA 3BTYA 4L97A 3THCA 1PM4A 1NQDA 4PCRA 3ASIA 4RR3B 2WQ4A 4Y20B 1CX4A 4JDNA 2RV9A 4QPGC 2BGCA 3AP6A 5DZGA 3VHRA 3ZXLA 1AR93 3NMBA 1HXS3 5BPXA 1BCXA 2FHRA 1XU2A 2ZX0A 3MI8A 4R4XA 2IZWA 1FMD1 2AEZA 4IEQA 1GQPA 4YVWC 2EIEA 3RPQA 5GZGA 1EV12 2RR12 4W8JA 4IEYA 3GCXA 3E6DA 4K8RB 4UBHA 3CJIA 3RWNA 2DVAA 4OI2A 2CHHA 1T6BX 3PDQA 4G3YC 3ILRA 2G19A 3MW2A 4NHMA 2P3IA 3KT1A 3ZMOA 4IEOA 3ZKUA 4N90A 4XF4A 2VGDA 3P3NA 4MGTA 3AXEA 3RWKX 1GKBA 1GP5A 1NLQA 5JI9A 3TNQA 4JCKA 2VTFA 4XPVA 1Z7S2 5GZFA 3RJRA 4XCAA 3O1OA 5FZKA 1HQLA 1K3IA 4CDQC 1WMDA 2J1AA 1KQRA 5I91A 3NV3A 4D94A 5KC5A 1AZDA 2JDNA 3FE5A 4N53A 1YQ2A 3PJQA 4BK5A 3GBWA 3GDBA 2ZGKA 2GNMA 3AMQA 4QQPA 5GKAC 1W8OA 5G04L 2WLPA 5AFBA 2G9GA 2RDRA 4Z8BA 1XSQA 3ZXJA 1H9PA 3ZKYA 3O1PA 2C9AA 3FUOA 4MGIE 1DQ2A 4D69A 3NAPB 3H1WA 2WZPP 2WWJA 5C3PA 1LGBA 2D6OX 5KR7A 2BNMA 3FLPA 5A32A 1E57A 1W8TA 5IVBA 2HWB1 3H50A 3LEIA 2MEV1 2QQVA 2VW1A 5A70A 2Y8KA 4BDVB 1OVPA 2XBO2 2Y0OA 4QB6A 4Q8LA 2VOXA 3LDKA 4RQPA 4JVAA 1XPWA 2RS52 2ZX3A 4W4ZA 1QJEA 3SKJE 5J36A 1E5HA 1LOCA 4MGZE 4CUAA 4OQ8A 3G7DA 2W87A 3OUIA 2VC9A 4NWVA 5BUVA 2D97A 1CZTA 1GQHA 2BWCA 3U11A 4LA2A 4V2WA 3CMGA 4UFKA 5JR7B 3I2FA 1DLCA 2A71A 3P3PA 2WNUC 5T55A 1MS5A 4FFFA 1RJ7A 1BEV3 2TUNA 4IEWA 4KWLA 2WBKA 2XLFA 4B1MA 4LK7A 3J7NA 4RHV3 4BH9A 4CU7A 1RMU1 2ZEZA 4P5HA 2HBTA 3DYPA 1GV9A 4FBFA 2RMU2 2BFUS 2R073 2ZS6B 3J8F1 1TEIA 1HQWA 2GC1A 3VBOA 2DURA 4GMP0 2UWCA 4IQPA 4YVWB 1ASJ1 2CGNA 3BN6A 3POWA 5LRSA 5T5JA 1T6GC 2H6CA 3VBSC 1C8NA 3PIJA 4RGAA 2DWRA 4IV3C 4RR3A 2YBPA 1O3SA 3TB0A 5L7OA 2XBO1 2GAUA 2ZHKA 1GWLA 4JGYB 1WBFA 4GMP3 4LJHA 4W6WA 4A6OA 3I7DA 1Q8PA
chains in the Genus database with same CATH topology
3VDCA 3VD3A 5G05L 3CIHA 4QX0A 1CX1A 3HN3A 2X09A 3IAQA 3SKVA 4P02B 2QQLA 5LA0A 4KMQA 3T08A 2EICA 4DXRA 3BGAA 2W1WA 5HXMA 3ABZA 3MUY1 1O8SA 4QDRA 4QDSA 3VD9A 2BGPA 4W50A 4FI9A 3DYOA 2WO1A 3K4AA 3VDAA 1L7RA 2DCKA 3OEAA 4DEQA 3NRUA 2VZ3A 4YPJA 3VD7A 2WAOA 3UNPA 2HYXA 3SEEA 3WQBA 5DMYA 3I3DA 3CZJA 1KGYA 1UYYA 4XUTA 5I0DA 2C9KA 4PF1A 4TXWA 3HNMA 1UX7A 1JI6A 3OGRA 5IYYA 2V5DA 3A21A 3SEPA 4CU9A 4P5YA 2ZEXA 2QQNA 2E32A 2VO5A 2Y6HA 4GWJA 2DCJA 2Y6GA 2X05A 2VCCA 3CDZB 1W0NA 1K12A 3T0AA 1H6XA 2W94A 4OUEA 3WNLA 2J1EA 4JX0A 1GOFA 2VR4A 2ZXQA 3NJXA 1PMJX 3PUIA 4DUWA 4A44A 5IHRA 3WF3A 3OG2A 1JYNA 3UESA 1WCQA 4XZUG 1I5PA 3FHQA 1JU4A 3C8XA 4LPLA 1PX4A 3K46A 1JZ8A 5DPNA 2Z4FA 5C71A 2YC2A 3NQHA 2J7MA 1L7QA 3T2PA 4JKLA 2W5FA 3ACGA 2VOTA 1T2XA 2WYSA 1F4HA 3ACFA 1UYZA 3ETPA 2VMEA 3ZM8A 1ULPA 2E31A 4QDQA 2VJXA 4PT6A 4UOJA 4QX1A 3HJRA 1CZVA 1GUIA 4GWIA 4XUPA 4A41A 3C7EA 4P00B 4A3ZA 1GNYA 3CKHA 3IAPA 1O59A 1UMIA 1OT5A 2VM9A 4PQQA 5EIYB 2VZOA 3FHAA 5JUVA 1BHGA 4JKKA 3HNYM 2EIDA 3OGSA 1D7PM 3WF1A 4DUVA 1PX3A 3LPGA 3FL7A 2YFZA 3FN9A 1J84A 4OYUA 1ULOA 1J83A 1UY2A 1IQDC 5JXHA 4JKMA 2W92A 2BERA 1US2A 3I2JA 2LW8A 3WNNA 2RJ2A 3WNMA 1UXXX 3VD5A 2W47A 2QQIA 3DYMA 2QQKA 3F2ZA 3MBWA 1GOGA 2W91A 4DUXA 1TG7A 4QPWA 3LE0A 2ID4A 5FUIA 3A23A 4ZXEA 5EJZB 3K4ZA 2WAAA 1JYXA 4LKSA 1NX9A 4KI5M 5A1AA 1JZ6A 3C7HA 2XQXA 2VQUA 2DDUA 2J1TA 2EIBA 3GM8A 1UY0A 4MOAA 4CU6A 4E8CA 1CZSA 2WO2A 2C4XA 1PMHX 5C7GA 2VMDA 3A7QA 3VDBA 2QBXA 4Z2AA 1LNSA 2VZ1A 2VQTA 3LEKA 5LA2A 3T0BA 3WEZA 3WNPA 5DN2A 5LCWL 4P08A 2B9VA 2CDPA 2JDAA 2ORXA 5JXJA 1OF3A 4QAWA 1GMMA 1GOHA 4A42A 3I3EA 2WZEA 2YG0A 4IUGA 3K77A 2J1SA 2V72A 5B4XA 2BGOA 3VD4A 3T2OA 5LA1A 1NKGA 3GGLA 3IB3A 3WNOA 2VMCA 1SDDB 4A4AA 2W3JA 1NUKA 5JMOA 1P8JA 2VZVA 4MADA 2J1VA 5CZKA 3J7HA 1JZ5A 4RYDA 3OB8A 2YB7A 4QB1A 2KD7A 3LEGA 2J1RA 4ET7A 2WZ8A 2W95A 1XC6A 3MV11 1UWWA 2PQSA 4OMDA 3T0DA 4ZZ5A 4LQRA 3WSOA 2V4VA 1SG3A 3I2IA 4UI9L 2XOMA 2VZSA 1JYWA 3WF2A 4DXSA 1K45A 2WN2A 3OGVA 3I2HA 1JZ3A 1W8NA 3LPFA 1UY3A 3HPNA 2E26A 1OH4A 4DEVA 1H6YA 1JZ7A 3MO4A 2ZEWA 3A22A 3WF0A 5IFTA 2WABA 1GU3A 1W9TA 2Y6LA 5IJRA 4L0PA 3U37A 2HLEA 4GZ9A 4ARYA 2W1UA 2OKXA 2QQJA 1SHWB 5IFPA 1F4AA 4XURA 4HG6B 1OF4A 3C7OA 4XUQA 4ZY9A 4ZZ8A 1RYYA 3I2GA 4AG4A 3EYPA 3ECQA 3K75B 5DQ0A 1JYVA 3IDAA 5HPOA 4MGQA 1W99A 4QX3A 2XHNA 4KWUA 1TVGA 3I3BA 2WO3A 4DXTA 3DECA 4TTGA 2J1UA 1O8PA 2E33A 3OEBA 3LQCA 4BJ0A 2B4KA 1CIYA 4ARXA 5B4NA 4CU8A 3MV01 5JXGA 2VZUA 1WKYA 4JHZA 2QQMA 3GXUA 1EUUA 4A45A 2YC4A 2RVAA 3ACHA 2W46A 4M4PA 2BZDA 3JXSA 1UY1A 2VCAA 2WUHA 4OMCA 3IIIA 4M4RA 3W5NA 4BK4A 1W9SA 1K42A 5C70A 3I97A 4D0QA 2VZQA 3C7FA 4XVHA 4XUOA 3CQOA 2LS6A 5J1XA 3EB7A 3WNKA 3P6BA 2XONA 3P1IA 5EJ1B 3HEIA 3MUZ1 3THCA 4CVUA 1US3A 3THDA 1JU3A 1HN1A 2RV9A 2JD9A 2ORZA 2W1SA 3HNBM 4UAPA 1GQPA 2EIEA 2W9XA 4W8JA 3NJVA 3E1F1 2VMFA 1NAEA 3C7GA 4AAXA 2VTFA 4QX2A 3WF4A 1UXZA 2VZRA 4XUNA 1K3IA 5CYYA 1JZ2A 2J1AA 4E8DA 1UY4A 2VCBA 1YQ2A 4BK5A 3GDBA 3ACIA 3K4DA 1W8OA 5G04L 1OD3A 2WDBA 2W1QA 5JXIA 3T09A 4LHSA 2ZEYA 3LEIA 1XNTA 2QQOA 2Y8KA 4BDVB 2JKXA 4QB6A 1MPXA 3NNGA 2VZPA 2WN3A 3D3AA 1EUTA 1XPWA 4W4ZA 3SKJE 2C26A 2L9LA 1UYXA 2WQ8A 4MO3M 4CUAA 2W87A 4MGSA 2VC9A 4D8MA 2VL4A 1CZTA 2Y6KA 5F7UA 3CMGA 3I2FA 1DLCA 1KEXA 4BXSV 3UETA 2BBAA 3OBAA 1W9WA 3W5MA 2WBKA 4OZOA 1DYOA 2YFUA 1JZ4A 2CDOA 2R7EB 4CU7A 2ZEZA 3AC0A 1R64A 3DYPA 5JR2A 2JE8A 3CZUA 1UZ0A 4QB2A 2VZTA 2X10A 3BN6A 1XNAA 1DP0A 4RN5A 3HOBA 4CUBA 1JHJA 3T2QA 3I2KA 2Y6JA 2Y64A 3PUHA 4A6OA 2J22A 4CUCA 1UMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDC A;  3VD3 A;  5G05 L;  3CIH A;  4QX0 A;  1CX1 A;  3HN3 A;  2X09 A;  3IAQ A;  3SKV A;  4P02 B;  2QQL A;  5LA0 A;  4KMQ A;  3T08 A;  2EIC A;  4DXR A;  3BGA A;  2W1W A;  5HXM A;  3ABZ A;  3MUY 1;  1O8S A;  4QDR A;  4QDS A;  3VD9 A;  2BGP A;  4W50 A;  4FI9 A;  3DYO A;  2WO1 A;  3K4A A;  3VDA A;  1L7R A;  2DCK A;  3OEA A;  4DEQ A;  3NRU A;  2VZ3 A;  4YPJ A;  3VD7 A;  2WAO A;  3UNP A;  2HYX A;  3SEE A;  3WQB A;  5DMY A;  3I3D A;  3CZJ A;  1KGY A;  1UYY A;  4XUT A;  5I0D A;  2C9K A;  4PF1 A;  4TXW A;  3HNM A;  1UX7 A;  1JI6 A;  3OGR A;  5IYY A;  2V5D A;  3A21 A;  3SEP A;  4CU9 A;  4P5Y A;  2ZEX A;  2QQN A;  2E32 A;  2VO5 A;  2Y6H A;  4GWJ A;  2DCJ A;  2Y6G A;  2X05 A;  2VCC A;  3CDZ B;  1W0N A;  1K12 A;  3T0A A;  1H6X A;  2W94 A;  4OUE A;  3WNL A;  2J1E A;  4JX0 A;  1GOF A;  2VR4 A;  2ZXQ A;  3NJX A;  1PMJ X;  3PUI A;  4DUW A;  4A44 A;  5IHR A;  3WF3 A;  3OG2 A;  1JYN A;  3UES A;  1WCQ A;  4XZU G;  1I5P A;  3FHQ A;  1JU4 A;  3C8X A;  4LPL A;  1PX4 A;  3K46 A;  1JZ8 A;  5DPN A;  2Z4F A;  5C71 A;  2YC2 A;  3NQH A;  2J7M A;  1L7Q A;  3T2P A;  4JKL A;  2W5F A;  3ACG A;  2VOT A;  1T2X A;  2WYS A;  1F4H A;  3ACF A;  1UYZ A;  3ETP A;  2VME A;  3ZM8 A;  1ULP A;  2E31 A;  4QDQ A;  2VJX A;  4PT6 A;  4UOJ A;  4QX1 A;  3HJR A;  1CZV A;  1GUI A;  4GWI A;  4XUP A;  4A41 A;  3C7E A;  4P00 B;  4A3Z A;  1GNY A;  3CKH A;  3IAP A;  1O59 A;  1UMI A;  1OT5 A;  2VM9 A;  4PQQ A;  5EIY B;  2VZO A;  3FHA A;  5JUV A;  1BHG A;  4JKK A;  3HNY M;  2EID A;  3OGS A;  1D7P M;  3WF1 A;  4DUV A;  1PX3 A;  3LPG A;  3FL7 A;  2YFZ A;  3FN9 A;  1J84 A;  4OYU A;  1ULO A;  1J83 A;  1UY2 A;  1IQD C;  5JXH A;  4JKM A;  2W92 A;  2BER A;  1US2 A;  3I2J A;  2LW8 A;  3WNN A;  2RJ2 A;  3WNM A;  1UXX X;  3VD5 A;  2W47 A;  2QQI A;  3DYM A;  2QQK A;  3F2Z A;  3MBW A;  1GOG A;  2W91 A;  4DUX A;  1TG7 A;  4QPW A;  3LE0 A;  2ID4 A;  5FUI A;  3A23 A;  4ZXE A;  5EJZ B;  3K4Z A;  2WAA A;  1JYX A;  4LKS A;  1NX9 A;  4KI5 M;  5A1A A;  1JZ6 A;  3C7H A;  2XQX A;  2VQU A;  2DDU A;  2J1T A;  2EIB A;  3GM8 A;  1UY0 A;  4MOA A;  4CU6 A;  4E8C A;  1CZS A;  2WO2 A;  2C4X A;  1PMH X;  5C7G A;  2VMD A;  3A7Q A;  3VDB A;  2QBX A;  4Z2A A;  1LNS A;  2VZ1 A;  2VQT A;  3LEK A;  5LA2 A;  3T0B A;  3WEZ A;  3WNP A;  5DN2 A;  5LCW L;  4P08 A;  2B9V A;  2CDP A;  2JDA A;  2ORX A;  5JXJ A;  1OF3 A;  4QAW A;  1GMM A;  1GOH A;  4A42 A;  3I3E A;  2WZE A;  2YG0 A;  4IUG A;  3K77 A;  2J1S A;  2V72 A;  5B4X A;  2BGO A;  3VD4 A;  3T2O A;  5LA1 A;  1NKG A;  3GGL A;  3IB3 A;  3WNO A;  2VMC A;  1SDD B;  4A4A A;  2W3J A;  1NUK A;  5JMO A;  1P8J A;  2VZV A;  4MAD A;  2J1V A;  5CZK A;  3J7H A;  1JZ5 A;  4RYD A;  3OB8 A;  2YB7 A;  4QB1 A;  2KD7 A;  3LEG A;  2J1R A;  4ET7 A;  2WZ8 A;  2W95 A;  1XC6 A;  3MV1 1;  1UWW A;  2PQS A;  4OMD A;  3T0D A;  4ZZ5 A;  4LQR A;  3WSO A;  2V4V A;  1SG3 A;  3I2I A;  4UI9 L;  2XOM A;  2VZS A;  1JYW A;  3WF2 A;  4DXS A;  1K45 A;  2WN2 A;  3OGV A;  3I2H A;  1JZ3 A;  1W8N A;  3LPF A;  1UY3 A;  3HPN A;  2E26 A;  1OH4 A;  4DEV A;  1H6Y A;  1JZ7 A;  3MO4 A;  2ZEW A;  3A22 A;  3WF0 A;  5IFT A;  2WAB A;  1GU3 A;  1W9T A;  2Y6L A;  5IJR A;  4L0P A;  3U37 A;  2HLE A;  4GZ9 A;  4ARY A;  2W1U A;  2OKX A;  2QQJ A;  1SHW B;  5IFP A;  1F4A A;  4XUR A;  4HG6 B;  1OF4 A;  3C7O A;  4XUQ A;  4ZY9 A;  4ZZ8 A;  1RYY A;  3I2G A;  4AG4 A;  3EYP A;  3ECQ A;  3K75 B;  5DQ0 A;  1JYV A;  3IDA A;  5HPO A;  4MGQ A;  1W99 A;  4QX3 A;  2XHN A;  4KWU A;  1TVG A;  3I3B A;  2WO3 A;  4DXT A;  3DEC A;  4TTG A;  2J1U A;  1O8P A;  2E33 A;  3OEB A;  3LQC A;  4BJ0 A;  2B4K A;  1CIY A;  4ARX A;  5B4N A;  4CU8 A;  3MV0 1;  5JXG A;  2VZU A;  1WKY A;  4JHZ A;  2QQM A;  3GXU A;  1EUU A;  4A45 A;  2YC4 A;  2RVA A;  3ACH A;  2W46 A;  4M4P A;  2BZD A;  3JXS A;  1UY1 A;  2VCA A;  2WUH A;  4OMC A;  3III A;  4M4R A;  3W5N A;  4BK4 A;  1W9S A;  1K42 A;  5C70 A;  3I97 A;  4D0Q A;  2VZQ A;  3C7F A;  4XVH A;  4XUO A;  3CQO A;  2LS6 A;  5J1X A;  3EB7 A;  3WNK A;  3P6B A;  2XON A;  3P1I A;  5EJ1 B;  3HEI A;  3MUZ 1;  3THC A;  4CVU A;  1US3 A;  3THD A;  1JU3 A;  1HN1 A;  2RV9 A;  2JD9 A;  2ORZ A;  2W1S A;  3HNB M;  4UAP A;  1GQP A;  2EIE A;  2W9X A;  4W8J A;  3NJV A;  3E1F 1;  2VMF A;  1NAE A;  3C7G A;  4AAX A;  2VTF A;  4QX2 A;  3WF4 A;  1UXZ A;  2VZR A;  4XUN A;  1K3I A;  5CYY A;  1JZ2 A;  2J1A A;  4E8D A;  1UY4 A;  2VCB A;  1YQ2 A;  4BK5 A;  3GDB A;  3ACI A;  3K4D A;  1W8O A;  5G04 L;  1OD3 A;  2WDB A;  2W1Q A;  5JXI A;  3T09 A;  4LHS A;  2ZEY A;  3LEI A;  1XNT A;  2QQO A;  2Y8K A;  4BDV B;  2JKX A;  4QB6 A;  1MPX A;  3NNG A;  2VZP A;  2WN3 A;  3D3A A;  1EUT A;  1XPW A;  4W4Z A;  3SKJ E;  2C26 A;  2L9L A;  1UYX A;  2WQ8 A;  4MO3 M;  4CUA A;  2W87 A;  4MGS A;  2VC9 A;  4D8M A;  2VL4 A;  1CZT A;  2Y6K A;  5F7U A;  3CMG A;  3I2F A;  1DLC A;  1KEX A;  4BXS V;  3UET A;  2BBA A;  3OBA A;  1W9W A;  3W5M A;  2WBK A;  4OZO A;  1DYO A;  2YFU A;  1JZ4 A;  2CDO A;  2R7E B;  4CU7 A;  2ZEZ A;  3AC0 A;  1R64 A;  3DYP A;  5JR2 A;  2JE8 A;  3CZU A;  1UZ0 A;  4QB2 A;  2VZT A;  2X10 A;  3BN6 A;  1XNA A;  1DP0 A;  4RN5 A;  3HOB A;  4CUB A;  1JHJ A;  3T2Q A;  3I2K A;  2Y6J A;  2Y64 A;  3PUH A;  4A6O A;  2J22 A;  4CUC A;  1UMH A; 
#chains in the Genus database with same CATH topology
 3MYX A;  4DMI A;  1VB2 A;  1VE0 A;  2V09 A;  5FY4 A;  4M3C E;  4DOU A;  2FDH A;  2I2S A;  3I2O A;  2WFP A;  3M2M A;  1PO1 3;  1WLW A;  1ND2 C;  1QJZ A;  1HRI 3;  3SKV A;  3POE A;  2DU0 A;  4P02 B;  4IE7 A;  2CL2 A;  4IV1 B;  5FZ7 A;  3T2T A;  3AKP A;  2D98 A;  4NMI A;  3HN1 A;  4FTE A;  3UKN A;  1QJU 2;  3H8U A;  2ZGL A;  3S7I A;  3WDW A;  5LA0 A;  3NAP C;  1IGO A;  4LBQ D;  5C4W A;  4AR2 A;  5BNN A;  3DPR A;  4I3P A;  5A3N A;  1SBD A;  4FOY A;  3A0K A;  4QQO A;  3POS A;  4EYU A;  1Y4W A;  2BEO A;  3G6J B;  3J8F 2;  5CKN A;  1F8V A;  3NST A;  4XAB A;  2DFB A;  4L11 A;  1DU3 D;  4FI9 A;  2YPD A;  3PU8 A;  4PDW B;  4UWD A;  4BIF A;  2OX0 A;  3VDA A;  2I45 A;  3OY8 A;  2MNG A;  4ES9 A;  4C8D A;  1J1T A;  4Z92 B;  2UWA A;  3ZDV A;  1RUD 3;  3P5B A;  4AVT A;  1RUG 3;  1S0E A;  4U2A A;  1DGL A;  2VZ3 A;  3O0V A;  4YPJ A;  3ZFE B;  1YI7 A;  1DZR A;  5FYT A;  3TBD A;  3WG2 A;  4BQ3 A;  2XKP A;  4W6X A;  3SEE A;  1N1V A;  5FO8 B;  1VLN A;  2ARB A;  2WZR 2;  3FFZ A;  4Q26 A;  5DMY A;  3A4U A;  1ZZ7 A;  2HEW F;  3PVN A;  1ZZ6 A;  1TQ5 A;  1BBT 2;  3HBK A;  1J59 A;  3MFA A;  2JB8 A;  2WNU B;  5F2S A;  1XYN A;  4TXW A;  3HNM A;  1RUC 1;  4RHV 2;  3VL9 A;  3OGR A;  1LAJ A;  1U5X A;  3AMN A;  4LA3 A;  1AYN 1;  5IK4 A;  5D1I A;  1FOD 1;  3PL0 A;  3F95 A;  3ZXE A;  5BNP C;  4ASK A;  3KVB A;  2QQN A;  1MS4 A;  3U10 A;  3J7L A;  4ISR A;  1MS8 A;  1AX2 A;  2AH2 A;  1AUY A;  4LOS A;  1WMF A;  2WT0 A;  4F83 A;  4C1W A;  1OMI A;  4AI3 A;  3APB A;  1H6X A;  3MDP A;  2W94 A;  3VZO A;  1H8T A;  3OBT A;  1IOA A;  2J1E A;  1OA4 A;  2W08 A;  3WLU A;  2WRA A;  1PGW 1;  1DYP A;  2D3R A;  2WO7 A;  3DPR C;  2GN7 A;  4NHL A;  2AZ5 A;  5EPA A;  3MFC A;  4Q4Y 2;  3UES A;  2Z69 A;  4IV3 B;  1MS1 A;  2ZAA A;  4FVV A;  3MLL A;  1LHW A;  4XZU G;  1I5P A;  4BU2 A;  1JU4 A;  1PX4 A;  2DUP A;  3JZV A;  2A6X A;  4E2Q A;  3R6S A;  1DYK A;  1NZC A;  3HD8 B;  5A7W B;  3ZXD A;  2Q30 A;  4UXA A;  5DAQ A;  3UT0 A;  2P5B A;  1QKQ A;  1KDK A;  2RDN A;  2VBP A;  2FCV A;  1PVC 2;  4MZU A;  5L9R A;  2JKB A;  3UGG A;  4KL1 A;  4DFS A;  4A6S A;  1XYO A;  4FP3 A;  3V64 A;  3TEY A;  1W9Y A;  1X36 A;  3E5X A;  5FR3 A;  1F4H A;  2O1Q A;  3S57 A;  3CF6 E;  1XYP A;  3BU0 A;  1FPN 3;  1SFP A;  1V0A A;  5ANQ A;  4QDQ A;  5T50 A;  1RMU 3;  2VJX A;  3FZ3 A;  3E6B A;  5BNP A;  1NZI A;  4P14 A;  1FMD 2;  4CDQ A;  4QX1 A;  1YO8 A;  2XXZ A;  5SV8 A;  3TAY A;  5A3P A;  1CIW A;  3OPZ A;  1N3P A;  1ND3 C;  4N43 A;  4AXO A;  4E2G A;  4AOC A;  4LO7 A;  4XUP A;  5DG1 A;  4A41 A;  2YXS A;  1YLL A;  3C7E A;  1ONA A;  1O4Y A;  3OPT A;  4IEU A;  4NUB A;  4PDW C;  4B1L A;  5KWR A;  2P6C A;  3K48 A;  4ATE A;  2DFC A;  4D6R A;  1O7F A;  3NV1 A;  3O0W A;  3ON7 A;  1RUE 3;  4R9A A;  4B4P A;  2F4P A;  2VM9 A;  1RTV A;  1C57 A;  1I5Z A;  5EIY B;  3PU3 A;  1BHG A;  3QH7 A;  2BTV C;  4AHZ A;  1MQT A;  3SNM A;  5E89 A;  3DF0 A;  1CPM A;  1D7P M;  5CKM A;  3WF1 A;  3WW3 A;  4XIK A;  1K5M B;  1BMV 2;  3HT1 A;  4P9L A;  4C1X A;  2VBD A;  2XJQ A;  2ZHL A;  5DDJ 1;  3J26 N;  3Q8A A;  5HCB A;  3VLB B;  2P3K A;  1D4V B;  1AR9 2;  3WP3 A;  4XHB A;  1XE7 A;  3WQ1 A;  5LBC A;  3RNS A;  2JE7 A;  5DDJ 3;  4NAO A;  2VTX A;  3NO8 A;  2W92 A;  4BQY A;  1S0C A;  4XHX A;  1US2 A;  4QT6 A;  1PZ8 A;  2HYK A;  2P1B A;  1RUI 1;  3U78 A;  1XQN A;  5JIU A;  4Y4Y A;  2DV9 A;  2LW8 A;  5F6L B;  3WNM A;  4NPL A;  3OSD A;  4FFG A;  5A3T A;  2MEV 2;  3VBF C;  5DAP A;  3VD5 A;  2W47 A;  2QQI A;  1W39 A;  3DYM A;  4QXC A;  3ZIW A;  2Q5T A;  2TEP A;  5FZH A;  1GOG A;  4QPW A;  5I0R A;  1RHI 1;  2QQP A;  3A23 A;  2RHP A;  3TEZ A;  3KSC A;  1COV 3;  3K4Z A;  2A3W A;  4YLZ A;  1LOG A;  4QPY A;  1NE6 A;  1AXK A;  3C7H A;  2ZGR A;  4P9I A;  2PLV 3;  4Q2F A;  5FZE A;  1IS4 A;  4ES8 A;  5FZL A;  3EMR A;  1COV 1;  2FBE A;  1OOP C;  2JDU A;  4AVC A;  1SLL A;  3HWJ A;  1VBA 2;  5ERL A;  4AYU A;  2J1T A;  3VBS A;  4E8C A;  4RS5 B;  4XBQ A;  1LJ7 A;  1POV 1;  1ODN A;  3QBQ A;  5HBA A;  2VMD A;  2IXH A;  2ZGS A;  3IDB B;  2QBX A;  3VDB A;  3M3I A;  1H2L A;  1XXN A;  5FXV A;  4NHK A;  2VZ1 A;  3LEK A;  5LA2 A;  4LEJ A;  3BKZ A;  5T3N A;  5FPV A;  1CAX B;  5FY9 A;  4IET A;  5T52 A;  2IXJ A;  4PLN A;  1H1I A;  4FPH A;  4WM7 A;  3B93 A;  4I0B A;  1QHD A;  1GP4 A;  2RDS A;  1O91 A;  4Q0U A;  2CDP A;  2JDA A;  2ORX A;  5F3E A;  5FZD A;  4A7K A;  5FPA A;  5GZD A;  2Q1F A;  5LEK A;  3I3E A;  4IV1 A;  2ZCW A;  1SCR A;  1LR5 A;  4GKY A;  1QIQ A;  4EZH A;  1S0B A;  3B69 A;  4Q29 A;  1FYU A;  5J98 B;  4QM9 A;  2QZ3 A;  4DPN A;  3SCH A;  1WD3 A;  1O3T A;  3WNO A;  4TSV A;  2XL7 A;  1H8V A;  2W3J A;  1NA1 B;  1UOJ A;  2HWF 3;  3S5A A;  2VZV A;  2V4A A;  4MAD A;  3NJY A;  4LKD A;  2YU2 A;  5CZK A;  2ZGT A;  5K0U C;  1OD5 A;  2VMI A;  2IUW A;  3J7H A;  1JZ5 A;  3PJY A;  2XBO 3;  3RJ2 X;  4G9S B;  3PVO A;  1RUJ 3;  5FY7 A;  3U4S A;  2Q8E A;  2VG9 A;  4QB1 A;  1JBC A;  2J1R A;  2K9Z A;  4ET7 A;  3JB8 A;  3BVC A;  3PIG A;  3PHM A;  4NHY A;  3SIS A;  2YBS A;  3DV8 A;  3UK9 A;  1G9C A;  2KM2 A;  3T0D A;  5CFC A;  1FX5 A;  5FZC A;  2B42 B;  2IWG B;  3I2I A;  3ALQ A;  1XRU A;  3BIW E;  2DVB A;  1ULG A;  3AZX A;  4UI9 L;  2C1F A;  1JYW A;  1EV1 3;  2P6H A;  2RR1 3;  2YV8 A;  5F8P A;  4Q1R A;  3WF2 A;  1R09 2;  4JDO A;  4DXS A;  1W2A X;  3BPZ A;  2WC2 A;  3DGT A;  1PO2 1;  2OPW A;  1ZZ8 A;  3Q8F A;  4FOQ A;  1Z7S 1;  4Y3O A;  3WOG A;  4PIX A;  1U5Y A;  2R06 2;  1ODM A;  2VQA A;  1H6Y A;  1VBE 3;  1GZC A;  3A22 A;  1LOB A;  3QCW A;  4AQS A;  1LEC A;  1CD3 G;  4MVT A;  2WAB A;  3SCG A;  1W9T A;  4Q4V 1;  3AZY A;  4ARY A;  2PLV 2;  3POY A;  2OKX A;  5L19 A;  2QQJ A;  1SHW B;  3RI8 A;  1F4A A;  4C0H A;  4F8A A;  4HG6 B;  4AWD A;  4LOR A;  1D4M 2;  1XNB A;  2HWE 2;  5JVV A;  5JDB A;  1Y7B A;  3VBH A;  2EXI A;  3PME A;  2GC2 A;  4DY5 A;  5L9V A;  1ZRE A;  1A34 A;  1F31 A;  1B35 C;  3WW1 A;  4CEW B;  1DIW A;  4Q4W 3;  1S2E A;  4YSF A;  2W0X A;  4MXV A;  2ZAC A;  1VBC 2;  3E6C C;  1S0I A;  5DQ0 A;  3THP A;  3IDA A;  2Y34 A;  4EN0 A;  4FFH A;  5JSP A;  4EWA A;  4MGQ A;  1AL2 1;  1X7N A;  1AR7 2;  5BNN B;  1V6I A;  4OHX A;  2WO3 A;  3ZOI A;  4CDX C;  4FPY A;  1HX6 A;  3I3M A;  3SH5 A;  2VXR A;  1W2O A;  5EYY A;  3SC7 X;  1FOD 3;  2Z79 A;  3OEB A;  5CFD C;  2UYA A;  1OQE A;  3QH6 A;  1G8W A;  4MH0 E;  1XOY A;  2Z5W A;  3HVD A;  1HRV 3;  4PIZ A;  3SH3 A;  3IDC B;  4E4H A;  5JXG A;  4MHR A;  3VV1 A;  5EQU A;  4EWD A;  3M3C A;  2BFU L;  5FZ4 A;  2QQM A;  4HMZ A;  4QKF A;  1NCR A;  4FFI A;  3GXU A;  3L2Y A;  4XDO A;  2HWD 2;  2OPK A;  4M3C A;  3RYR A;  1MS3 A;  4YW1 A;  2JIG A;  1DQ0 A;  2GU9 A;  4DQA A;  2KXL A;  5KXE A;  1OC1 A;  3S7E A;  3VN4 A;  3AMP A;  5LA9 A;  5FPZ A;  4Y24 A;  4AHW A;  3W5N A;  5FXZ A;  4BK4 A;  1PK6 C;  5IK5 A;  1RUG 2;  4HVO A;  4LIU A;  5FYB A;  4AFM A;  3OUJ A;  5E88 A;  3M8L A;  3KGZ A;  2D7F A;  1DQ1 A;  2R1D A;  2LS6 A;  4MGY E;  3WDY A;  4CE8 A;  4OUS A;  4JQR A;  3VBO B;  4AEJ A;  5E1R A;  5J1X A;  1CWP A;  1SFY A;  1KDM A;  4BME A;  5JOY A;  1ASJ 3;  2GAL A;  3P1I A;  3VHN A;  1OH3 A;  2WLQ A;  5CKQ A;  4BCU A;  1G9A A;  4HET A;  1W8H A;  3MPP G;  4CDX A;  3KT7 A;  3IDE A;  2VOV A;  3OD0 A;  4KWJ A;  5EJ3 A;  1HN1 A;  1V6N A;  3V0B B;  3POI A;  5L7O C;  2R04 3;  3WDV A;  2ORZ A;  2LUW A;  2W1S A;  3VBU A;  3NNF A;  3ITQ A;  4Q0Q A;  1RED A;  2AUY A;  3RGB A;  3HNB M;  2A7A A;  3MIB A;  4UAP A;  3VKF C;  4XF3 A;  5F2W A;  2W9X A;  1PZ9 A;  1W8F A;  1GFF 2;  3MIH A;  4RD7 A;  5CAD A;  3IM0 A;  1N3O A;  3E1F 1;  4N8M A;  3B3Q E;  4BE3 A;  1S55 A;  1QY4 A;  1SBF A;  1V9U 1;  1A8D A;  3GBG A;  5ABJ C;  2D93 A;  4I2O A;  3WP4 A;  1MR5 A;  1ND2 A;  4UBG A;  3H3L A;  4B3N A;  1LGN A;  4Q4X 1;  1V6O A;  4QX2 A;  4XAC A;  1UPS A;  3GHN A;  1H30 A;  2VZR A;  4KU8 A;  2VVF A;  4XUN A;  3BB6 A;  1GLH A;  1LTE A;  4HLT A;  5A33 A;  1KD7 A;  2A5Z A;  5BNN C;  1PVC 3;  4CDX B;  1RIR A;  1S1A A;  2F6B A;  3RI9 A;  2VCB A;  4MGK E;  1OKQ A;  4ORF A;  2JEC A;  2WS9 1;  3KHB A;  4KG8 A;  3I8T A;  1BK0 A;  1W2N A;  1RUE 2;  4RSU A;  2VUC A;  2AAC A;  1OUX A;  5K8S A;  1BBT 1;  1Q8V A;  3RSJ A;  3T09 A;  3KQR A;  2VXJ A;  3Q9O A;  4LBN A;  5C8C A;  2GME A;  1ZZ9 A;  2R49 A;  4U36 A;  1PM7 A;  1LED A;  2QQO A;  2D3P A;  1Y9G A;  2JKX A;  1Q56 A;  3WDX A;  1JUH A;  1HW5 A;  3BOD A;  1LOD A;  2I74 A;  4M3C F;  1HDK A;  1UZZ A;  3GZT B;  1UNB A;  4UW6 A;  3VDD C;  2VBB A;  4NRM A;  4JRL A;  2Q4S A;  4PHZ A;  1UYX A;  2WQ8 A;  4MO3 M;  2JG9 B;  4J1W A;  4Y4R A;  4MSV A;  3B00 A;  5FBZ A;  3ATG A;  3ST7 A;  2VL4 A;  4XJW A;  4UFM A;  4CEY B;  3OTF A;  2P34 A;  1LHV A;  4W6Y A;  4XCB A;  1UU4 A;  1WA6 X;  3PUA A;  2ZZQ A;  3WXP A;  3UET A;  4YFZ A;  4PBO A;  2DTW A;  1W9W A;  1YQ8 A;  1RUF 3;  2HKX A;  2WJS A;  2OQ7 A;  4OZO A;  4Y1U A;  4HKW A;  1ZNP A;  4GJZ A;  1RHI 3;  1VBD 2;  1YI9 A;  1JZ4 A;  4O61 A;  3ZXG A;  3DKW A;  1W6N B;  5FO7 B;  1R64 A;  3NW4 A;  2E7Q A;  3KCY A;  4PF5 A;  3URF A;  5LY1 A;  1SPP B;  1V6K A;  3KMH A;  5FZ6 A;  5KBF A;  3CZU A;  2UWB A;  4IE0 A;  1KRI A;  2HEY F;  1M06 G;  3DKQ A;  2WNV B;  1W2T A;  4MUV A;  1C3H A;  3AYA A;  4FPE A;  4RN5 A;  1XU1 A;  3JD7 1;  4CUB A;  3W58 A;  4XJA A;  5F5C A;  4BQ1 A;  5IW0 A;  4QX7 A;  1TZO A;  3I3Q A;  2HWB 2;  1DCS A;  1H0B A;  1WMX A;  2J22 A;  2B45 X;  4PLM A;  4CUC A;  1UMH A;  4ARX A;  2WT2 A;  3TYJ A;  3DEM A;  3Q8C A;  1HXS 1;  4P9J A;  5JPN B;  2R30 A;  3KV4 A;  1PO1 2;  4JC1 A;  2X09 A;  2YU1 A;  4QX0 A;  3IAQ A;  4V2V A;  4YGB A;  2ATF A;  5T5O A;  4DS0 A;  4IEZ A;  4BB3 A;  5JZG A;  1OVS A;  2RMU 1;  3IIA A;  3MGU A;  4QKD A;  1MQT B;  1J3P A;  1HJF A;  4FCA A;  5FP7 A;  5T54 A;  5IT6 A;  2ARA A;  3GZU C;  4XF9 A;  3KD4 A;  4KMQ A;  2O8O A;  5FP9 A;  3BAL A;  3FUQ A;  4BWO A;  1TNF A;  5LK5 A;  5F3G A;  2NYY A;  1NLR A;  4QHZ A;  4AAP A;  2ZGP A;  2W1W A;  3J4U H;  4IGP A;  3USS A;  4E4S A;  4Y5Z 0;  3BTX A;  3VD9 A;  1AJO A;  2BGP A;  2A73 B;  3FBY A;  1O3R A;  4XFG A;  3T4H B;  1L7R A;  3JD7 2;  2SLI A;  3AZZ A;  5M0T A;  1BVV A;  2R16 A;  2VUA A;  4DEQ A;  1BZW A;  2OZ6 A;  3NAP A;  4IE4 A;  3WP5 A;  3VBR A;  4LBO A;  2OS2 A;  2VUJ A;  1VBC 1;  4NIG A;  5FO9 B;  5LW9 A;  3VD7 A;  4A7Z A;  1QF3 A;  2HYX A;  3POJ A;  2NMN A;  2GMP A;  4H2A A;  4XFA A;  1JOP A;  4K21 A;  3ZXA C;  1JN2 P;  4AGR A;  3I3D A;  3KV6 A;  3QLQ A;  4HK8 A;  1KGY A;  1ALY A;  4XFH A;  4XUT A;  2XWB B;  2GNT A;  4CA9 A;  4HPK A;  2C9K A;  3NNJ A;  1XB9 A;  5IYY A;  4CU9 A;  3A21 A;  1E5I A;  4I02 A;  5FAX A;  2VO5 A;  4HOO A;  2XWJ B;  2DCJ A;  2Y6G A;  3CDZ B;  3JB4 C;  1LOA A;  5BY5 A;  1K12 A;  3T0A A;  2WFF 1;  5AVA A;  1A6C A;  3WNL A;  3D82 A;  1F5F A;  1U12 A;  3KLS A;  4OUE A;  1GQG A;  5CU1 A;  1QNY A;  4JX0 A;  3THT A;  1GOF A;  2ZXQ A;  4GH4 B;  4WM7 C;  5A7P A;  3NJX A;  1LEN A;  5DUU A;  2D6M A;  3PUI A;  4LE4 A;  4RGK A;  5KXD A;  3VBS B;  1J1L A;  5IHR A;  1ZRD A;  4F7Z A;  4LLO A;  1JYN A;  1Q8Q A;  2FD8 A;  3LOB A;  3GHM A;  3ZYG A;  1NCQ B;  4P9X A;  4OI0 A;  4LHL A;  3FHQ A;  4Q4W 1;  4ZS2 A;  1NT0 A;  4QWN A;  1W3V A;  4IE6 A;  2C6S A;  3K51 A;  1JZ8 A;  5DPN A;  3LFM A;  3N7M A;  3ZPO A;  5LWB A;  1FOD 2;  3J8F 3;  1QEX A;  4IE5 A;  4YZ2 A;  4UF0 A;  5FFO C;  3KCX A;  2Q0A A;  2Y38 A;  3PVE A;  1ZRF A;  5D8A A;  2FDK A;  1VAV A;  2W5F A;  2EF6 A;  3JBG 2;  2VOT A;  4UW3 A;  5FYI A;  2JDY A;  1T2X A;  2WYS A;  1NE4 A;  3ZN5 A;  4CCO A;  3C2U A;  4XQ4 A;  3ZN6 B;  4DZG A;  4XTP A;  3M7A A;  4QXB A;  3H8X A;  3FC0 A;  1G9F A;  1H8T B;  3KB5 A;  1CON A;  3R05 A;  1OUS A;  4QPI A;  1ULP A;  4HKL A;  3ZLI A;  4CP2 A;  4PT6 A;  4GIQ A;  3ZSL A;  2JDM A;  2RM2 2;  2HWD 3;  4UOJ A;  1BVP 1;  4WZF A;  3HJR A;  1RIN A;  1MS0 A;  2CWS A;  4OI4 A;  4YZ4 A;  3SH4 A;  1SLI A;  2P37 A;  1HLC A;  2RS1 1;  3HR9 A;  4MX3 A;  4A3Z A;  5F5Q A;  1YIP A;  1GNY A;  3IAP A;  3JU9 A;  3JD7 3;  4I0W B;  5H9R A;  2OYZ A;  3RZJ A;  1OT5 A;  2FDG A;  2GN3 A;  2BP6 A;  3GCW A;  3WZ1 A;  4R8H A;  2G4I A;  2VZO A;  3IMM A;  4A2U A;  5CG9 A;  4QU2 A;  1I6X A;  5K0U B;  4JKK A;  5FY5 A;  3DN7 A;  1L7L A;  1ASJ 2;  3E97 A;  1GWK A;  1PX3 A;  3BPS A;  2GC3 A;  3OCP A;  5JSO A;  1S2K A;  1CAW A;  1JUI A;  3FL7 A;  1VAM A;  4Z82 A;  3UGH A;  2NQY A;  1PO2 3;  4FP2 A;  3B94 A;  4CDU B;  3FN9 A;  1J84 A;  4URT A;  3ROU A;  2VD7 A;  1Z7S 3;  4D6Q A;  3JBG 1;  4CP0 A;  5BNP B;  4I3G A;  3USU A;  4NR1 A;  1IQD C;  1EAH 2;  1HV0 A;  2JG8 C;  2VVD A;  4JKM A;  5LBE A;  4DB5 A;  3VBH B;  4CYD A;  1OFN A;  3POG A;  3WHU A;  1ACC A;  3BI3 A;  3I2J A;  3HQU A;  1H2K A;  3H3Z A;  4LMF A;  3WNN A;  1C28 A;  1W28 A;  2B7Y A;  1RXG A;  3VL8 A;  3LWC A;  2BPA 2;  1H9W A;  4H14 A;  2QQK A;  3SCF A;  5KHH A;  5HCA A;  3ZFG C;  4PBP A;  1RVF 3;  2WNO A;  4O9G A;  1BMV 1;  5FUI A;  1SLB A;  2D40 A;  5FYV A;  2YHJ A;  1SPP A;  3WHT A;  3MZH A;  5EJZ B;  2FDI A;  1RC6 A;  4ITC A;  2WAA A;  3RYP A;  3LF7 A;  1JYX A;  1BK1 A;  3K3N A;  4LKS A;  4KI5 M;  4QKB A;  1JZ6 A;  4GUL A;  1JTZ X;  1XND A;  2HWC 3;  1S4C A;  5IAT A;  3AK0 A;  3WUD A;  1R1Z A;  2Q8O A;  3B01 A;  1UY0 A;  4MOA A;  2GNB A;  1Q8O A;  1QJU 3;  2C5D A;  3LA2 A;  4LUM A;  2JWP A;  2WNE A;  2ARE A;  3OYW B;  1PMH X;  3AL5 A;  4O9E A;  4I09 A;  4XFB A;  1B35 B;  4BQ4 A;  1DGW X;  1LNS A;  2ETE A;  3ME2 A;  1UU5 A;  1UPI A;  4B7E A;  3S0M A;  3H7J A;  5DXD A;  1OLM E;  5FPB A;  5A7W A;  2J42 A;  5EXO A;  5BXX A;  1VMF A;  4IND A;  1VRH 1;  1Z78 A;  5EFU A;  3NKT A;  4P08 A;  5D8A B;  2B9V A;  2DUQ A;  1AR6 1;  1NCR C;  1HB2 A;  4YW5 A;  1GOH A;  1VBB 2;  4Z1V A;  1OPO A;  1RUC 2;  4RHV 1;  3KGL A;  2YG0 A;  3WCS A;  3W21 A;  1WW4 A;  5F3I A;  1UIJ A;  1XNK A;  1TME 1;  1UU6 A;  5FZB A;  3UKV A;  2BDR A;  2IXL A;  5FK7 A;  2QE3 A;  3ZYJ B;  2ARC A;  3KV5 A;  5C33 A;  3OPW A;  3WG1 A;  4UFL A;  1ST8 A;  3H3U A;  4HZF A;  2WWS A;  4XDP A;  3ZO0 B;  4AI2 A;  1HIX A;  2VMC A;  1SDD B;  3WQ0 A;  3ZFG A;  5JMO A;  1CR7 A;  2Y0I A;  3AVR A;  5C9A A;  2ZML A;  3HIF A;  3AMM A;  5JAX A;  4GB3 3;  4FSJ A;  2VE1 A;  4NJ4 A;  5I0T A;  1OBN A;  4ISQ A;  1VBE 2;  1K5M C;  1CAV A;  1O4T A;  1YFW A;  2R06 3;  4Q4Y 1;  3SHR A;  2KD7 A;  3W59 A;  3TWI A;  3GYD A;  4Y33 A;  4COY A;  1JOD A;  4EE2 A;  1SLT A;  1VMJ A;  4FPK A;  4HN0 A;  1OA2 A;  1TMF 2;  3BCW A;  4ZZ5 A;  5FIX A;  3WSO A;  4AGG A;  4NRQ A;  4CXY A;  1W04 A;  1SG3 A;  1D4M 3;  4E4D X;  3O1R A;  2XGX A;  4CP1 A;  4AED A;  2PXJ A;  4N9H A;  4GKX A;  1HV1 A;  5IVF A;  4HT1 T;  5IVV A;  4GAZ A;  4TYS A;  4ONU A;  1SLA A;  1POV 0;  3O1T A;  4IDZ A;  4HON A;  3VBF B;  3OGV A;  1VIW B;  3C3V A;  3I2H A;  4P9Y A;  3X29 B;  1WLT A;  3LPF A;  4CSW A;  5J7M A;  1RVF 2;  4P9G A;  2HWC 1;  5I0S A;  1V6J A;  2RJK A;  2WQZ C;  5IFT A;  1AVB A;  4ZU7 A;  1GU3 A;  4LKF A;  1UOF A;  2BUK A;  4L0P A;  5IJR A;  5LRR A;  3SLI A;  2W1U A;  1YNA A;  1QJX 1;  2IFR A;  3VZK A;  2WR9 A;  2PYT A;  2WS9 2;  4RL7 A;  3ZYB A;  3GJA A;  1QNW A;  1IQA A;  2B9U A;  1ULC A;  5E16 A;  4CP9 B;  4WVM A;  4J25 A;  1GZW B;  4HXC A;  5FMD A;  5IK7 A;  4ZZ8 A;  4HFS A;  1RYY A;  4CTE A;  1PGW 2;  1VBC 3;  4DXZ A;  3I2G A;  2HWB 3;  2ARX A;  3J7M A;  2PQQ A;  3R4D B;  5A7O A;  2ET7 A;  2JDZ A;  3VZJ A;  4AG4 A;  3EYP A;  3ZIX A;  3ZYP A;  4K20 A;  2RDQ A;  5FP4 A;  3V0A A;  4Y22 A;  1PNG A;  1BBT 3;  1W99 A;  2AYH A;  2ZPX A;  3POF A;  4QX3 A;  3RS6 A;  3I3B A;  2AGS A;  1N1Y A;  4NVP A;  3RG0 A;  5D8A C;  3DEC A;  4HN1 A;  2J1U A;  3D6E A;  3VHP A;  5J37 A;  1JOB A;  4AEK A;  1FNZ A;  1ZBA 3;  1RL3 A;  3KT4 A;  3MPB A;  1NXD 1;  2PLV 1;  4BJ0 A;  1HRV 2;  3ZSJ A;  4LE3 A;  5EV7 A;  1S0F A;  5H9P A;  5I93 A;  4K1Y A;  1VAK A;  4XJ9 A;  3TN9 2;  1N1S A;  3U14 A;  3VKM A;  3NV2 A;  1QQP 2;  2VZU A;  1F2N A;  1WKY A;  1YJK A;  1RVF 1;  4Y1X A;  2HJI A;  4YGC A;  1CJP A;  1H1A A;  1BEV 2;  1SBE A;  2JXA A;  2MEV 3;  5FDB A;  2A1X A;  1EYB A;  1R09 3;  4XET A;  4A45 A;  1H1M A;  3OOX A;  3DL3 A;  1SQ4 A;  2E7T A;  1QJX 2;  5AVP A;  2BOJ A;  4M4P A;  2WSU A;  2VNO A;  3E5U A;  3JXS A;  4GAL A;  2WUH A;  3O1V A;  5F3C A;  3AYE A;  1SMV A;  2JX9 A;  3MIE A;  3III A;  1I9R A;  3ZYH A;  1W9S A;  1ZM1 A;  3CO2 A;  5FP8 A;  2A3Y A;  2JIJ A;  3VZM A;  1M4W A;  4D7Y A;  2RE9 A;  4D0Q A;  2VZQ A;  3RMX A;  5FLH A;  4LUL A;  4OI1 A;  4JGY A;  2QTW B;  5LB6 A;  5LBB A;  4FPC A;  4FTS A;  1VBA 1;  2WL1 A;  3AP4 A;  1YFU A;  4E27 A;  2FDF A;  3MW4 A;  4XC9 A;  3H1Y A;  4GJY A;  1E5R A;  2VOK A;  3LA7 A;  4AHY A;  2B46 X;  3WIN E;  3LIH A;  4CVU A;  1MAC A;  2G1M A;  2ENR A;  2OVU A;  1AR7 1;  1JU3 A;  1MEC 3;  1ULD A;  3U4X A;  4EN9 B;  1PO1 1;  1W6M A;  4N53 C;  1LUL A;  2YBK A;  4XMA A;  5FMO L;  4FTB A;  2BBV A;  3N3H A;  4AED B;  2YPJ A;  4PI2 A;  2CAU A;  3T1M A;  2OW4 A;  3JBG 3;  5DUX A;  4NID A;  2WNV C;  3IN9 A;  2A6W A;  5LBF A;  1W6Q B;  2ZAH A;  1WLC A;  3LB9 A;  5GJ6 A;  4AI8 A;  4C0B A;  5KHK A;  1RUD 2;  4LBM A;  4B7K A;  1NAE A;  2UYB A;  1X8E A;  4WM8 A;  4BLI A;  3AM2 A;  4XJU A;  1Q3E A;  3ZN4 A;  5BNQ A;  4DY3 A;  4QQH A;  2VCM A;  2EXK A;  4YM2 A;  3KF3 A;  4AAX A;  1G7Y A;  1UXZ A;  3EHK A;  5I0U A;  3MF6 A;  2BNN A;  4E4Z A;  2RM2 3;  1RUJ 2;  4FT8 A;  2GC0 A;  1IS3 A;  5CYY A;  1S0G A;  5A7Q A;  4GXL A;  1RUN A;  2PFW A;  1WME A;  3AJY A;  1C1F A;  1VR3 A;  1RUG 1;  4E8D A;  5JSR A;  1UZY A;  1UY4 A;  2GMM A;  2RS1 3;  4V1P A;  4DNY A;  3WCR A;  1AYN 2;  3ES1 A;  5FPX A;  1D2S A;  5AC9 1;  2EVX A;  5B2G B;  3K4D A;  1UO9 A;  4IV1 C;  5J96 B;  2WDB A;  5F5A A;  1QQP 3;  4C90 A;  5K4L A;  5HV4 A;  1APN A;  3R4S A;  1RUI 3;  4HPK B;  2E6V A;  1AJK A;  4Y22 B;  1A78 A;  1YFY A;  5KC6 A;  2JE9 A;  4CP9 A;  1ZRC A;  2D44 A;  4XAE A;  2N7G A;  3OD4 A;  4LHS A;  4OUM A;  2XHK A;  1V6L A;  2ZEY A;  1XNT A;  2E53 A;  5FYZ A;  3NNG A;  2VZP A;  5FZO B;  4WVW A;  2WN3 A;  3LA3 A;  3MEP A;  2OXB A;  4EN8 B;  4EZ4 A;  4LO5 B;  4LO8 A;  2ADD A;  2C26 A;  2L9L A;  2Z42 A;  1YFX A;  3GBF A;  3WR0 A;  1PK6 B;  2XDV A;  2G9Z A;  2NN8 A;  5T5P A;  4MGS A;  1QH6 A;  2IC1 A;  2Z2S B;  1JYI A;  1E5S A;  1VBA 3;  5F7U A;  1ZRI A;  2Q1M A;  3ORJ A;  4Y26 A;  5IWF A;  3CU7 A;  1KEX A;  4BXS V;  4YG6 A;  4Q4X 2;  2BBA A;  1WW5 A;  1CPN A;  1RUH 2;  3VDD A;  2AC1 A;  4Q4W 2;  3VKL A;  2JJ6 A;  1VBB 1;  4AGV A;  5LK7 B;  3B5L B;  4CPB D;  3N9Q A;  1KJR A;  3TEW A;  3CL1 A;  2YFU A;  5DUW A;  2CGP A;  3LIG A;  4IEP A;  1N47 A;  3AC0 A;  4QPG B;  5IVJ A;  4RGG A;  2IVJ A;  3BOP A;  3U1X A;  4XIL A;  3E5Q A;  3MIG A;  2DVD A;  4YAR A;  5JR2 A;  1OFS A;  2JE8 A;  5F37 A;  3I2D A;  4QB2 A;  1KXG A;  2VZT A;  4AED C;  1JHN A;  2R07 1;  1PVX A;  4RQP B;  3NWK A;  4UF0 B;  4YW4 A;  5A7N A;  5CIR A;  3DPR B;  3HOB A;  3NL1 A;  1FPN 2;  2X53 S;  5FUP A;  5A6Y A;  3PMS A;  1IHM A;  2RS3 2;  1JHJ A;  5A3U A;  3KVA A;  4CPB A;  2WSV A;  2Y6J A;  1X33 A;  3IPV B;  1WW7 A;  5C8W A;  5LAS A;  5FZA A;  5GLU A;  4Q0V A;  1B35 A;  4QXK A;  3M1H A;  4S2H A;  1YQ5 A;  1BJQ A;  1LHU A;  4L92 A;  1YHF A;  5G05 L;  5FZF A;  2VUL A;  3CIH A;  3VGI A;  2MPF A;  3HQX A;  3N36 A;  3AP5 A;  2PEL A;  1CX1 A;  3HN3 A;  4DRR A;  2KR2 A;  5DZE A;  4CDQ B;  1X9P A;  5AC9 3;  3KHC A;  5C6C A;  2PHF A;  4Q1P A;  1J58 A;  1UMZ A;  4Y5S A;  5DAV A;  1R08 2;  1DQ6 A;  5FCC A;  5CFD A;  3VBU B;  1N1T A;  4WBB A;  1RUH 1;  2VOW A;  1Q8S A;  1X9T A;  3FJS A;  1WCS A;  3D0J A;  2YMZ A;  2PHR A;  1RUI 2;  1HB3 A;  2GZW A;  5FK8 A;  4GD4 A;  3MW3 A;  2JDH A;  4YW3 A;  5I8S A;  4GWM A;  1NY7 1;  3N35 A;  1G9B A;  1OSG A;  4K7J A;  3T08 A;  2EIC A;  4CCD A;  3BGA A;  3ABZ A;  5DAB A;  4P9W A;  4LUK A;  2IXI A;  3MUY 1;  4QDR A;  4QDS A;  5C9A B;  1ZYB A;  3OJB A;  4N9I A;  1X82 A;  1HXS 2;  2R07 2;  3AXD A;  4WVV A;  2PAM A;  1X50 A;  5A7S A;  3ELN A;  3O1U A;  2XJP A;  3OEA A;  5BYN A;  5BNO C;  1C5I A;  4XBN A;  4FOV A;  1SCS A;  3NRU A;  2DCT A;  1U0A A;  3IKW A;  3OUH A;  5CVR A;  4TWT A;  1SZB A;  3TEX A;  3TOJ A;  4JRA A;  1W0O A;  4S2G A;  2BYV E;  4GQ7 A;  4KU7 A;  3PTR B;  2JG8 A;  3WG4 A;  3RVH A;  3UNP A;  2X5I A;  3FLR A;  4Q0P A;  3WQB A;  3HQR A;  5C5U A;  4CRQ A;  2YRO A;  3CZJ A;  4PLO A;  2ZKL A;  2P3J A;  1ZA7 A;  3NJZ A;  4IL7 A;  2XVK A;  3WNX A;  5I0D A;  1OHF A;  3Q8B A;  4WV8 A;  4CDW C;  3SEP A;  4LIT A;  5C4W B;  2JIC A;  2XKO A;  4P5Y A;  2ERF A;  2XJS A;  2E32 A;  5FZ9 A;  2Y6H A;  2PHL A;  4GWJ A;  2D3S A;  4I0A A;  3OGJ A;  5IAX A;  1AL2 3;  1UZW A;  2VEC A;  2VCC A;  5ACA 3;  2PHU A;  2ZGU A;  1A8M A;  4YM0 A;  3EXU A;  2GSY A;  2QQW A;  4AQ6 A;  5FJH A;  1NY7 2;  2VR4 A;  1PMJ X;  2FZ1 A;  4BIS A;  5A6Q A;  1PK6 A;  2A3X A;  3IZO A;  4BM8 A;  4KH9 A;  4Q27 A;  3OG2 A;  1DBN A;  2DF7 A;  2RS3 3;  5JWP A;  3T3Y A;  2CTV A;  1VRH 2;  5IVY A;  1OQ1 A;  2FDJ A;  5J09 A;  2DVF A;  2RS5 1;  3C8X A;  4LPL A;  1S2B A;  1YXW A;  3K46 A;  4GA9 A;  5BNO A;  1AF9 A;  1AX1 A;  3IBM A;  3POB A;  4UFJ A;  5C71 A;  1TE1 B;  2WNV A;  1FT9 A;  1NOV A;  3ACL A;  3NQH A;  2XVG A;  3T2P A;  3H1M A;  4JKL A;  3ACG A;  4NE9 A;  5FLJ A;  4UYB A;  5F1R A;  4XDQ A;  3TN9 3;  1ND2 B;  2UY9 A;  4K9S A;  2HWF 1;  4B4R A;  3LCP A;  1OLQ A;  2VNG A;  3B9I A;  4CCC A;  4C91 A;  2BNO A;  4LHN A;  1MQT C;  1V70 A;  1SAC A;  3LOI A;  4UT5 A;  4B4Q A;  1PNF A;  4MV2 A;  1IKP A;  5FOJ B;  1CAV B;  2O14 A;  2QKD A;  1MVE A;  4OUL A;  1SLC A;  2BVB A;  2VME A;  4XFF A;  2QZ2 A;  4CDW A;  2W2I A;  4K6B A;  2OZJ A;  4XF0 A;  4OQ9 A;  4COZ A;  2QDN A;  2DCY A;  2K0G A;  2V5Y A;  2LM3 A;  3SQO A;  3PUQ A;  3O0X A;  4NPM A;  1O6U A;  5ABJ A;  3IPV A;  4QKN A;  1CZV A;  1EP0 A;  1NCR B;  1GUI A;  1BLZ A;  3ILN A;  1PIV 1;  5C9A C;  1MEC 1;  3LDR A;  2OT7 A;  3WDT A;  5JCT A;  4BPZ A;  1TMF 1;  1AL0 G;  2R06 1;  4P00 B;  2XUM A;  4MHU A;  2R04 2;  1KFX L;  4Q8K A;  2WFF 2;  5A6Z A;  5J48 A;  3AKS A;  3CKH A;  5H9Q A;  2YYO A;  1QU0 A;  4KGQ A;  4QPI C;  4RA0 A;  5C3Q A;  4MET A;  1O59 A;  2F17 A;  2ZX1 A;  1TMF 3;  1W6O A;  5FXW A;  2XLA A;  1VJ2 A;  4PQQ A;  4FXG B;  5JZG B;  3FHA A;  1HRI 1;  2P2K A;  5FZ0 A;  2ZMK A;  1RUJ 1;  4YFW A;  3ZSK A;  1QOT A;  1ENX A;  1WCD J;  3EBR A;  4IES A;  1MZE A;  1V9U 3;  3LPG A;  3AFK A;  1GSL A;  1W06 A;  2NZ9 A;  4OVE A;  4ZS3 A;  3RFR A;  3WW4 A;  2YFZ A;  2ZGO A;  5ANN A;  3UL2 A;  3GJB A;  4LR4 A;  5ACA 1;  1J83 A;  3N9O A;  4WVM B;  5JXH A;  2W68 A;  1C8M 3;  2BER A;  2QUO A;  4AVS A;  2D6L X;  3MLK A;  1EV1 1;  2RR1 1;  3WX5 A;  3N9L A;  4AK3 A;  1I3H A;  3LAG A;  1MVQ A;  5FYY A;  3WDU A;  4J1X A;  3VKN A;  2ET1 A;  1DGR N;  1YRZ A;  2H0V A;  1AR8 2;  3GZA A;  4AI0 A;  4WM7 B;  2DBN A;  1FV2 A;  2LAL A;  2QJV A;  3LD8 A;  4YVS B;  5APA A;  5FZG A;  5GZC A;  1VRH 3;  1WCU A;  2ES3 A;  4UFH A;  2W91 A;  2DUO A;  3BOW A;  4FAG A;  1MEC 2;  1OKO A;  2ID4 A;  4NOT A;  1JXN A;  3OBZ A;  3QAC A;  4Q4V 3;  5JIA A;  1UCX A;  4AI9 A;  5EP9 A;  1Y9Q A;  4O65 A;  4CEW A;  1GBG A;  5FQ0 A;  1NX9 A;  3HT2 A;  3J9S A;  5KHG A;  1WUV A;  1VBB 3;  2PHX A;  4QGL A;  2QCS B;  3VZN A;  1XNC A;  2VQU A;  1WWY A;  3WY6 A;  1QJY 2;  2VTX J;  3WP6 A;  1BQP A;  3CJI C;  3QD6 A;  3JUU A;  4XJZ A;  1BYH A;  5T5L A;  2EIB A;  3GM8 A;  1AHS A;  2F4L A;  3USU B;  5CIS A;  4QGN A;  1CZS A;  5GM0 A;  2XLG A;  1XE8 A;  4I01 A;  4JHT A;  2VMG A;  4K1Z A;  5FKB A;  4Z2A A;  3AB0 A;  4YW6 A;  2UUR A;  2VQT A;  1LU1 A;  3R4U A;  1V00 A;  4Q4Y 3;  1RB8 G;  4LO4 B;  4AHX A;  5LCW L;  2V73 A;  1RUF 2;  3B9C A;  2A6Z A;  4YW2 A;  4TLF A;  4OHZ A;  5CFC C;  2D6K A;  3ES4 A;  3W9A A;  4B8E A;  3Q8E A;  4A42 A;  5KHJ A;  3N4M A;  4CCM A;  3K77 A;  2J1S A;  4GWN A;  5FY1 A;  5B4X A;  1DGW A;  4DRV A;  3BIE A;  2XUE A;  4XQW A;  3T2O A;  1GWM A;  2PN5 A;  3B7M A;  5FRA A;  1NKG A;  2CSG A;  5LA1 A;  4FPL A;  4QU1 A;  4GMP 1;  4LTA A;  4OFG A;  2O0O A;  4A4A A;  4LO6 B;  5JZG C;  2HWE 3;  4Y20 A;  1UD1 A;  4W65 A;  5L36 A;  2J1V A;  4M0H A;  3VKO A;  1W6M B;  3AKQ A;  3M3Q A;  3V65 A;  3ZN6 A;  1AXZ A;  5EHD A;  1V9U 2;  4AVB A;  1GNH A;  3D8C A;  4KBB A;  1PVC 1;  2YB7 A;  4XXP A;  1UF2 C;  1OXC A;  3LEG A;  4L8Q A;  5A80 A;  3ZVX A;  1R08 1;  3EJK A;  1PZ7 A;  2WZ8 A;  4COV A;  4B29 A;  2UU8 A;  1XC6 A;  2CAV A;  1AR6 2;  3RZZ A;  3ENR A;  4FOW A;  3RZM A;  2Q8D A;  1F5J A;  4LQR A;  4J6G A;  1AX0 A;  4KG0 A;  4BLJ A;  4CCN A;  4AFD A;  3L2H A;  2V4V A;  4YZ1 A;  3LSE A;  5E6H A;  2NM1 A;  1FI2 A;  5FJK A;  3QOP A;  1LHN A;  2XJU A;  4SBV A;  4EJR A;  4FPJ A;  2D5H A;  1UW8 A;  1ZBE 1;  2Q1Z B;  1JW6 A;  4KBZ A;  4NRP A;  4ZON A;  1PGL 1;  4XXA A;  1W8N A;  1UY3 A;  3AJZ A;  1G6N A;  1OH4 A;  1D2Q A;  5L7O B;  1JZ7 A;  1D0H A;  5C3R A;  2ZEW A;  3AYC A;  4RFR B;  5FKC A;  4X8P A;  5FWE A;  3W20 A;  1LU2 A;  4H3W A;  4D6S A;  2WS9 3;  3PUS A;  1IS6 A;  3U37 A;  1UQX A;  3AVS A;  1STM A;  2HLE A;  5CA6 A;  3U0Z A;  1YCI A;  2RM2 1;  4AVA A;  3I4I A;  4NII A;  2E9Q A;  5AC9 2;  4XUR A;  2FMY A;  1H2N A;  4FPO B;  1NQJ A;  2R6Q A;  3AZW A;  3AKR A;  5EYX A;  4WVZ A;  2JEN A;  5JOW A;  3S30 A;  1Q43 A;  1OF4 A;  1NCQ A;  3C7O A;  3IWZ A;  4LNV A;  2W39 A;  4RS5 C;  4YG0 A;  4YYO A;  3WVJ A;  1UX6 A;  3ZYI B;  1UKG A;  1CES A;  3CHX A;  1GP6 A;  2BU9 A;  1W0P A;  5A1F A;  2XR4 A;  3ECQ A;  3K75 B;  4AF9 A;  3H9A A;  4DO0 A;  2BWA A;  1JYV A;  3N7L A;  5FZ1 A;  4CCJ A;  5CG8 A;  1MZF A;  5GLW A;  1JYC A;  4GB3 2;  1TVG A;  3NNL A;  4DXT A;  4SLI A;  1ZZB A;  3RQ0 A;  1A3K A;  4TTG A;  4TN7 A;  1O8P A;  3I49 A;  4CCE A;  5TSW A;  4XQD A;  5IK8 A;  2Y60 A;  5A6X A;  1CIY A;  5FZO A;  3T30 A;  5C3S A;  5B4N A;  4JDM A;  2OUH A;  4CU8 A;  2DYC A;  3MIF A;  1R1A 1;  2ZGM A;  5FWJ A;  5DAW A;  2C0Z A;  4CUG A;  5GLV A;  2TBV A;  3I59 B;  4AE2 A;  1F9K A;  4M01 A;  5F6K A;  3INA A;  4Z07 A;  1G9D A;  3ZX7 A;  4BQ2 A;  4Q5O A;  4FPF A;  4N43 B;  2X29 A;  1EUU A;  3WG3 A;  1JMU B;  1G86 A;  2E51 A;  4D7T A;  2EAL A;  1COV 2;  4I30 A;  3WQ7 A;  1DHK B;  2W46 A;  5HV0 A;  4R9B A;  2BZD A;  1UY1 A;  2VCA A;  3K3O A;  4OMC A;  3VDD B;  3KV9 A;  3LSD A;  1W2U A;  1AR6 3;  4JV4 A;  4HK9 A;  1K42 A;  5JMC A;  1QOS A;  1VPH A;  5C70 A;  3I97 A;  3SMH A;  2PHD A;  3PVB B;  4QPG A;  4XVH A;  4CEY C;  4UW5 A;  5KXB A;  2ZAB A;  1HQN A;  4H7M A;  5FY0 A;  2YZ4 A;  3TNP B;  3RZL A;  3IMN A;  3LFI A;  3TN9 1;  3EB7 A;  4UFI A;  2A75 A;  3VZL A;  2BJS A;  2AEN A;  2XON A;  4IGO A;  3ZSE A;  4IXL A;  5FZI A;  3HEI A;  1ENR A;  3MUZ 1;  1IPS A;  1O3Q A;  5FMC A;  4NAM A;  4BIO A;  2FCU A;  3I59 A;  1US3 A;  2IXC A;  1VRB A;  1W8Z A;  1VMH A;  4PI0 A;  4X8N A;  3THD A;  3ZDS A;  4CZS A;  1U5I A;  1FV3 A;  5E8A A;  4XOG A;  4COU A;  2RS5 3;  2JD9 A;  1LEM A;  5GZE A;  5JOX A;  3SIT A;  5LZ6 A;  2A70 A;  4IEV A;  2G9F A;  5FZ3 A;  2CWM A;  5FUN A;  4A3X A;  4OCT A;  4OZX A;  2WZR 1;  2X8K A;  1ZVF A;  3NKG A;  3NJV A;  3UKT A;  3OGG A;  1IS5 A;  1ZZC A;  2ZX4 A;  2VVE A;  5A32 B;  4OLL A;  4XJ8 A;  2VMF A;  3U75 A;  5FTT C;  5FMB A;  4AZZ A;  1PMI A;  1KIT A;  1QJF A;  3C7G A;  1MZ5 A;  5D21 A;  4L9B A;  4MXW B;  4YGE A;  4CEW C;  2IVI B;  4PDW A;  2FCT A;  4FPG A;  1QH7 A;  4M00 A;  1KS5 A;  3WF4 A;  4CXX A;  5KHI A;  4H7L A;  1FNY A;  2XML A;  1W6P B;  4LT5 A;  1DQ4 A;  3LEM A;  1QJX 3;  4AFB A;  1TNR A;  4HSL A;  4ASM B;  1JZ2 A;  5JOZ A;  3VBR B;  2K46 A;  1VBE 1;  3D4K A;  2UY8 A;  3OYW A;  3M3E A;  1S0J A;  1FXZ A;  1YQ6 A;  3VBU C;  3ACI A;  1N3Q A;  2CU5 A;  1OD3 A;  4NO4 A;  1DZT A;  1ZBE 3;  2FZ2 A;  1RUD 1;  4XTM A;  1CVN A;  2W1Q A;  4OHV A;  4QQL A;  4XFC A;  4FXK B;  4ZPI A;  3GNE A;  5A1L A;  3V0A B;  2ADE A;  5FV3 A;  5C3O A;  2HEV F;  4AQ2 A;  5JXI A;  3FWE A;  5FMO S;  1H4G A;  2EXJ A;  4KGG A;  5IAV A;  4N43 C;  1ENS A;  5DG2 A;  3UYJ A;  1RMU 2;  1C5H A;  2PAK A;  3T4V A;  1MPX A;  2WFF 3;  1XSR A;  2I07 B;  3D3A A;  3N9N A;  5CB7 A;  1CAW B;  2DCZ A;  1EUT A;  3SXW A;  2HWC 2;  4LLF A;  5A33 B;  3I54 A;  5DUV A;  4N7U A;  4AFA A;  4EN7 B;  1ZBA 1;  4D8M A;  4ZXK A;  3ZFE C;  3JQX A;  4IGQ A;  5FBJ A;  1AR8 3;  2EIG A;  3ZFF A;  2Y6K A;  4AL9 A;  1YJL A;  3M4F A;  3B02 A;  2EA7 A;  2CNA A;  2LTN A;  3VBO C;  1Z0H A;  4AQT A;  5J3U A;  2CY6 A;  1JH5 A;  1QJU 1;  3AL6 A;  1RUF 1;  4H55 A;  2E7A A;  2ZX2 A;  3OBA A;  3D5O A;  4ERO A;  5CEH A;  1AYM 1;  1RXF A;  4NHX A;  5FYS A;  4LIV A;  3W5M A;  4YM1 A;  1OUR A;  1OLR A;  1DYO A;  4KQ7 A;  1H2M A;  2XVL A;  5AFE A;  2OII A;  1WD4 A;  2CDO A;  2R7E B;  3ILF A;  4IV3 A;  4RR3 C;  1O4Z A;  3LDB A;  3ZSM A;  5C8C C;  4FO9 A;  2GP3 A;  2Y26 A;  3O1S A;  2P17 A;  1UZ0 A;  3UJO A;  1R08 3;  3WUC A;  4ZKT B;  1EPW A;  5F39 A;  4LBL A;  4GH4 C;  2X10 A;  2RS1 2;  4NRO A;  1QDO A;  1QGL A;  1XNA A;  5FOB B;  1DP0 A;  2VH9 A;  2W52 A;  1HN0 A;  1GNZ A;  2JG9 A;  1UKR A;  4CCK A;  1HRV 1;  3FX3 A;  1DZQ A;  1ZX5 A;  4QHB A;  3T2Q A;  3PLQ A;  2VY0 A;  3I2K A;  4QXH A;  3RYK A;  2HH9 A;  4X6R B;  4QMA A;  3UGF A;  4URA A;  5ABJ B;  2NP0 A;  1H4H A;  2Y64 A;  1MS9 A;  2P4E A;  3PUH A;  2JEM A;  1V6M A;  2YUE A;  5A3L A;  4LOT A;  3OY8 B;  4DIN B;  3VDC A;  1BEV 1;  3ZYR A;  3MF9 A;  1W9F A;  3VD3 A;  3WW2 A;  2NMO A;  5CNA A;  3O14 A;  4BZ4 A;  4NIA A;  1DG6 A;  2RMU 3;  4XZP A;  2H6B A;  1UAI A;  2IXK A;  3AFG A;  3ZFE A;  3DUI A;  4BA6 A;  5I8Y A;  2PAE A;  4QX5 A;  1XE0 A;  1UL9 A;  1ZBE 2;  1QXP A;  4D3W A;  1AYM 2;  2JDP A;  1EAH 1;  2ZHM A;  1HRI 2;  4YNI A;  1MZ6 A;  5DZF A;  3LKJ A;  3RRD A;  3K2O A;  2ZGN A;  1SFN A;  1WCK A;  2PHW A;  4YZ3 A;  4YVW A;  2QQL A;  3PUR A;  3ZXF A;  3RZH A;  1KFU L;  3OBR A;  5I8T A;  3O7O A;  3GZE A;  4DXR A;  4WM8 B;  5HXM A;  1CAU A;  1ND3 B;  4R9D A;  3ZR6 A;  1O8S A;  4N7I A;  1QDC A;  2XH6 A;  4W50 A;  5ISL A;  2SBA A;  4A7Y A;  2GP5 A;  3DYO A;  3KZ4 C;  5EWS A;  3WD5 A;  2WO1 A;  3K4A A;  4O7X A;  3FMG A;  2DCK A;  2ZGQ A;  1RUO A;  4GH4 A;  2D6P A;  4M0N A;  4MLO A;  5BV6 A;  4DIQ A;  2QDR A;  3N7J A;  3M3O A;  2R0F A;  2JG9 C;  1C4R A;  1NLS A;  3KS7 A;  1GAN A;  1C1L A;  4HKO A;  4EN6 B;  2JB4 A;  3LGR A;  4BOW A;  2WAO A;  1UOB A;  4COW A;  1QQP 1;  2PHT A;  2YGL A;  2YDE A;  3MHZ A;  3S6P A;  1ULF A;  1R1A 3;  3AMH A;  4XW3 A;  1UYY A;  1QMJ A;  4ATF A;  2VNR A;  1W05 A;  2BOI A;  2DTY A;  5CBL A;  1FAT A;  5KXC A;  1I1E A;  4EQV A;  4PF1 A;  3RMY A;  3PNA A;  2A6V A;  1BXH A;  1UX7 A;  4CDU C;  1JI6 A;  2ZJC A;  1GZT A;  1DF0 A;  2V5D A;  2VMH A;  2VPV A;  1Y9M A;  3DCQ A;  2XJR A;  2JDK A;  5FPL A;  2ZEX A;  4Q4V 2;  2P3Y A;  5C8C B;  3VBH C;  1Y3T A;  2X05 A;  4JQT A;  1W0N A;  2FMD A;  3AYD A;  3AZV A;  1QJY 3;  4S2D A;  1UOG A;  1LOF A;  4Y1V A;  1YWK A;  5JLV A;  1B09 A;  4RQP C;  4XFI A;  4KNC A;  5LY2 A;  1GIC A;  1UN1 A;  2RJL A;  1CN1 A;  1K5J A;  4FQ4 A;  1IPJ A;  4YW7 A;  4DUW A;  4A44 A;  4EV0 A;  1IKQ A;  1TME 2;  3WF3 A;  5K9Y A;  2D43 A;  1Q5O A;  2K2S A;  2B8M A;  2TNF A;  1IG3 A;  1U5Z A;  1GZW A;  2XPJ A;  1GYK A;  1WCQ A;  3FBM A;  4JGY C;  5F9T A;  4F3J A;  1REE A;  2NPI A;  3RZG A;  3EO6 A;  3T1L A;  3FLT A;  2Z4F A;  3DXU A;  1RUC 3;  5IUQ A;  4YZ5 A;  4HL0 A;  5HCF A;  2VW0 A;  2WNU A;  5C5T A;  1AYN 3;  2YC2 A;  1QXJ A;  2QNK A;  3ETQ A;  4LK6 A;  3CJI B;  4PIY A;  3VHO A;  2ZTN A;  1OI6 A;  5HXV A;  2J7M A;  3O5S A;  1L7Q A;  1O5L A;  3EQE A;  5FLI A;  4FAH A;  1EAH 3;  4LXL A;  3U07 A;  1O5U A;  4YWA A;  3BTA A;  1S0D A;  3NV4 A;  2VAU A;  1PGS A;  2MHF A;  3L9J T;  3O1M A;  4HVQ A;  2AR6 A;  5L9B A;  3HMY A;  1AYM 3;  1PHM A;  5F5I A;  1LCL A;  3ACF A;  5D2A A;  1VBD 1;  1IG0 A;  1UYZ A;  3ETP A;  1D0G A;  3ZM8 A;  3N7K A;  3NVC A;  2HWD 1;  1LRH A;  2E31 A;  1YEW A;  4Q0S A;  1RHI 2;  1NA1 A;  1VBD 3;  4LBQ A;  4MYE A;  4XMI A;  4BHP A;  2XJT A;  4E2S A;  5L73 A;  1AR9 1;  4WM8 C;  1Y43 B;  3LZZ A;  5CFC B;  1DDL A;  4E9K A;  1FMD 3;  4GWI A;  3H8R A;  2E63 A;  1AR7 3;  1D4M 1;  5A3W A;  1LOF C;  5SV5 A;  1NXM A;  4JGZ C;  5DAX A;  1VB4 A;  3AX4 A;  4HSJ A;  4BXF A;  5BNO B;  1F15 A;  1J3R A;  1OPM A;  2B5H A;  3GF6 A;  4CCL A;  2OA2 A;  3R0R A;  1UMI A;  4YM3 A;  4TLG A;  3FHI B;  1YUD A;  1GZ9 A;  2PMW B;  3ZR5 A;  1WW6 A;  2C24 A;  1EY2 A;  1REF A;  4Q4X 3;  1XBF A;  3ZXK A;  5JUV A;  1RUH 3;  1DQ5 A;  1OQD A;  2BRT A;  4D7S A;  5JPM B;  3HNY M;  2EID A;  1WGP A;  1KS4 A;  2EXH A;  2XQR A;  3MIC A;  3OGS A;  4KWK A;  4DUV A;  5FRE A;  4OHY A;  1WLD A;  4OHW A;  1FPN 1;  2JD4 A;  2R0H A;  4LHK A;  5FYC A;  5H9S A;  3GAL A;  3VBF A;  4QM8 A;  1AXY A;  2VW2 A;  4CDW B;  1WA4 A;  4QX8 A;  2D5F A;  4OYU A;  1ULO A;  4IEX A;  5A3O A;  4YGD A;  1UY2 A;  3CNA A;  4RS5 A;  5JI7 A;  3WV6 A;  4AW7 A;  4XBL A;  5C4W C;  1CGP A;  3TRS B;  1HB4 A;  2CV6 A;  2QVS B;  5HCH A;  1LES A;  1W90 A;  3N9M A;  1XJA A;  5EZW A;  5FP3 A;  5A3M A;  2RJ2 A;  1W8U A;  1OOP A;  3BU7 A;  3ZYF A;  1UXX X;  3HAG A;  4XEZ A;  2AEY A;  3MBW A;  1POV 3;  1QOO A;  3F2Z A;  4AEM A;  3DXT A;  4G4F A;  1UIK A;  5FXX A;  4DUX A;  1TG7 A;  3LE0 A;  1NCQ C;  4JTN A;  2CYF A;  3JCI A;  4ZXE A;  2OUJ A;  2ZMN A;  1DFQ A;  5A1A A;  2ZOE B;  4AFC A;  1ZBA 2;  1WZX A;  3KM5 A;  4Y1Z A;  2XQX A;  2QQU A;  4EWE A;  1QXR A;  1WBL A;  2DDU A;  2CGO A;  1JS9 A;  2WA4 A;  4CU6 A;  1BKZ A;  2LRP A;  3MLJ A;  2WO2 A;  4AVV A;  2C4X A;  2FQP A;  5C7G A;  3A7Q A;  2RG4 A;  4LBJ A;  4M3C B;  5IVE A;  3VUO A;  4YG3 A;  1AR8 1;  2PA7 A;  4AI1 A;  1J3Q A;  1DGR A;  1F35 A;  1H8T C;  4PJY A;  4UW4 A;  1PO2 2;  3T0B A;  3WEZ A;  5LEJ A;  4LBK A;  5CAZ A;  3HBZ A;  3WNP A;  2VNV A;  5DN2 A;  1RGS A;  1HB1 A;  1GR3 A;  4BYY A;  4YVS A;  1W8W A;  3MID A;  1ZA4 A;  5JXJ A;  1OF3 A;  1X8M A;  4QAW A;  1YYN A;  5CFD B;  5IVC A;  1GMM A;  3O12 A;  1DLL A;  2WZE A;  2LRO A;  2WA3 A;  4JAA A;  4IUG A;  1IZ3 A;  2ZA9 A;  2V72 A;  3D0S A;  1L3J A;  2BGO A;  2O8Q A;  4JGZ B;  3VD4 A;  2DU1 A;  2A6Y A;  4QPI B;  2GND A;  4XAA A;  3GGL A;  3IB3 A;  3CBN A;  4S2F A;  1R09 1;  2D6N A;  3AKT A;  3JQW A;  5K7P A;  1LOE A;  4Z2W A;  1EPZ A;  1NUK A;  4LBQ B;  1CAU B;  1ND3 A;  1P8J A;  3V0B A;  4CEY A;  2X5I C;  3ZFF B;  4JZR A;  1SEF A;  3AP7 A;  4RYD A;  4NN0 A;  2WII B;  3OB8 A;  4IW3 A;  2BV4 A;  4L2N A;  1YIF A;  1CAX A;  1NG0 A;  1AL2 2;  2KA3 A;  1JYT A;  3ZPY A;  3KWV A;  2QFE A;  1POQ A;  2W95 A;  3MV1 1;  1QWR A;  1UWW A;  1RUE 1;  1W6O B;  4XIO A;  5FYH A;  3H42 B;  2PQS A;  4CXW A;  4OMD A;  1PIV 3;  3NNM A;  2EAK A;  2JG8 B;  3CEW A;  3UV9 A;  4HAN A;  2R32 A;  2R1B A;  4HVR A;  3H8O A;  2H0B A;  2HWE 1;  5FPU A;  1SDW A;  4Y1Y A;  2WWU A;  5FYM A;  2XOM A;  2VZS A;  2WZR 3;  2YY1 A;  3IT8 A;  1ENQ A;  5FZM A;  5GLZ A;  4QQ2 A;  1K45 A;  2PTM A;  2XL9 A;  2WN2 A;  4CDU A;  3CJX A;  2HWF 2;  3CLP A;  3RDI A;  1W03 A;  4YVS C;  4ASL A;  1JZ3 A;  4NWW A;  3HPN A;  4NIH A;  4X6Q B;  3ZFG B;  2E26 A;  1JOJ A;  2XB6 C;  4K40 A;  4DEV A;  3MO4 A;  4N53 B;  4R52 A;  5DDJ 2;  1HJG A;  3WF0 A;  3RZK A;  4MXW A;  4NPR A;  1K5M A;  1ULE A;  2Y6L A;  2IFW A;  1NYW A;  3BYW A;  4PQ9 A;  2VQ0 A;  2EAA A;  2HBU A;  4GZ9 A;  5FYU A;  1LKN A;  2BVV A;  1KJL A;  5IFP A;  4XYX A;  1OOP B;  2ILM A;  1C8M 1;  2GDF A;  3UJQ A;  2B39 A;  1VAL A;  4LKE A;  1OLM A;  4FQZ A;  4XUQ A;  2WYF A;  5GAL A;  4ZY9 A;  1URX A;  3H0O A;  2GH2 A;  2WIN B;  4HBN A;  4XE9 A;  3BUC A;  2Q8C A;  1LGC A;  3S5Q A;  4QD2 A;  2WT1 A;  2WKK A;  4TZD A;  4WZC A;  1PGL 2;  4BQW A;  2XJV A;  2BQP A;  4RFT 0;  5HPO A;  1UZV A;  4Y5T A;  3ZMN A;  2XHN A;  4KWU A;  4ZHN A;  2VU9 A;  1OA3 A;  3M70 A;  3PTY A;  4K3U A;  2ZBJ A;  4XF1 A;  4K8F A;  3VBR C;  5GLT A;  3AP9 A;  5FZ8 A;  3WT3 A;  2E33 A;  2BW8 A;  2VUD A;  3LQC A;  4L99 A;  5FQ0 B;  2B4K A;  2DVG A;  4QHO A;  5HI0 A;  2ZZJ A;  3MV0 1;  1LHO A;  5FY8 A;  5ACA 2;  3N9P A;  5LAT A;  2Y33 A;  4BQ5 A;  4JTO A;  2NLR A;  5F32 A;  3V56 A;  2GH8 A;  1CJD A;  4QGM A;  4JHZ A;  4R4Z A;  3BTZ A;  1CQ9 A;  1LB2 A;  4IER A;  1NA1 C;  3VB9 A;  3KQ4 B;  1W6N A;  4BQX A;  1FAY A;  2YC4 A;  3A0N A;  1UYP A;  2X5I B;  3ZFF C;  2XG3 A;  2OQ6 A;  2RVA A;  1RIT A;  2RS3 1;  3ACH A;  1RJ8 A;  3OF1 A;  4GB3 1;  1C8M 2;  4JGZ A;  1YC6 1;  4YRD A;  1W6Q A;  4ZU5 A;  2YGM A;  1PIV 2;  4M4R A;  1YQC A;  4MG2 A;  4ZU4 A;  1HKD A;  2R04 1;  4BMB A;  1IPK A;  2ZKN A;  3C7F A;  5K0U A;  4XUO A;  3CQO A;  2YC0 A;  3H7Y A;  1QJY 1;  3KF5 A;  2DBI A;  1R1A 2;  2ZHN A;  1TME 3;  1W3X A;  3FFQ A;  3WNK A;  3P6B A;  2Y6F A;  1ZRR A;  1VP6 A;  4R9C A;  1W6P A;  5EJ1 B;  3KCC A;  3BTY A;  4L97 A;  3THC A;  1PM4 A;  1NQD A;  4PCR A;  3ASI A;  4RR3 B;  2WQ4 A;  4Y20 B;  1CX4 A;  4JDN A;  2RV9 A;  4QPG C;  2BGC A;  3AP6 A;  5DZG A;  3VHR A;  3ZXL A;  1AR9 3;  3NMB A;  1HXS 3;  5BPX A;  1BCX A;  2FHR A;  1XU2 A;  2ZX0 A;  3MI8 A;  4R4X A;  2IZW A;  1FMD 1;  2AEZ A;  4IEQ A;  1GQP A;  4YVW C;  2EIE A;  3RPQ A;  5GZG A;  1EV1 2;  2RR1 2;  4W8J A;  4IEY A;  3GCX A;  3E6D A;  4K8R B;  4UBH A;  3CJI A;  3RWN A;  2DVA A;  4OI2 A;  2CHH A;  1T6B X;  3PDQ A;  4G3Y C;  3ILR A;  2G19 A;  3MW2 A;  4NHM A;  2P3I A;  3KT1 A;  3ZMO A;  4IEO A;  3ZKU A;  4N90 A;  4XF4 A;  2VGD A;  3P3N A;  4MGT A;  3AXE A;  3RWK X;  1GKB A;  1GP5 A;  1NLQ A;  5JI9 A;  3TNQ A;  4JCK A;  2VTF A;  4XPV A;  1Z7S 2;  5GZF A;  3RJR A;  4XCA A;  3O1O A;  5FZK A;  1HQL A;  1K3I A;  4CDQ C;  1WMD A;  2J1A A;  1KQR A;  5I91 A;  3NV3 A;  4D94 A;  5KC5 A;  1AZD A;  2JDN A;  3FE5 A;  4N53 A;  1YQ2 A;  3PJQ A;  4BK5 A;  3GBW A;  3GDB A;  2ZGK A;  2GNM A;  3AMQ A;  4QQP A;  5GKA C;  1W8O A;  5G04 L;  2WLP A;  5AFB A;  2G9G A;  2RDR A;  4Z8B A;  1XSQ A;  3ZXJ A;  1H9P A;  3ZKY A;  3O1P A;  2C9A A;  3FUO A;  4MGI E;  1DQ2 A;  4D69 A;  3NAP B;  3H1W A;  2WZP P;  2WWJ A;  5C3P A;  1LGB A;  2D6O X;  5KR7 A;  2BNM A;  3FLP A;  5A32 A;  1E57 A;  1W8T A;  5IVB A;  2HWB 1;  3H50 A;  3LEI A;  2MEV 1;  2QQV A;  2VW1 A;  5A70 A;  2Y8K A;  4BDV B;  1OVP A;  2XBO 2;  2Y0O A;  4QB6 A;  4Q8L A;  2VOX A;  3LDK A;  4RQP A;  4JVA A;  1XPW A;  2RS5 2;  2ZX3 A;  4W4Z A;  1QJE A;  3SKJ E;  5J36 A;  1E5H A;  1LOC A;  4MGZ E;  4CUA A;  4OQ8 A;  3G7D A;  2W87 A;  3OUI A;  2VC9 A;  4NWV A;  5BUV A;  2D97 A;  1CZT A;  1GQH A;  2BWC A;  3U11 A;  4LA2 A;  4V2W A;  3CMG A;  4UFK A;  5JR7 B;  3I2F A;  1DLC A;  2A71 A;  3P3P A;  2WNU C;  5T55 A;  1MS5 A;  4FFF A;  1RJ7 A;  1BEV 3;  2TUN A;  4IEW A;  4KWL A;  2WBK A;  2XLF A;  4B1M A;  4LK7 A;  3J7N A;  4RHV 3;  4BH9 A;  4CU7 A;  1RMU 1;  2ZEZ A;  4P5H A;  2HBT A;  3DYP A;  1GV9 A;  4FBF A;  2RMU 2;  2BFU S;  2R07 3;  2ZS6 B;  3J8F 1;  1TEI A;  1HQW A;  2GC1 A;  3VBO A;  2DUR A;  4GMP 0;  2UWC A;  4IQP A;  4YVW B;  1ASJ 1;  2CGN A;  3BN6 A;  3POW A;  5LRS A;  5T5J A;  1T6G C;  2H6C A;  3VBS C;  1C8N A;  3PIJ A;  4RGA A;  2DWR A;  4IV3 C;  4RR3 A;  2YBP A;  1O3S A;  3TB0 A;  5L7O A;  2XBO 1;  2GAU A;  2ZHK A;  1GWL A;  4JGY B;  1WBF A;  4GMP 3;  4LJH A;  4W6W A;  4A6O A;  3I7D A;  1Q8P A; 
#chains in the Genus database with same CATH homology
 3VDC A;  3VD3 A;  5G05 L;  3CIH A;  4QX0 A;  1CX1 A;  3HN3 A;  2X09 A;  3IAQ A;  3SKV A;  4P02 B;  2QQL A;  5LA0 A;  4KMQ A;  3T08 A;  2EIC A;  4DXR A;  3BGA A;  2W1W A;  5HXM A;  3ABZ A;  3MUY 1;  1O8S A;  4QDR A;  4QDS A;  3VD9 A;  2BGP A;  4W50 A;  4FI9 A;  3DYO A;  2WO1 A;  3K4A A;  3VDA A;  1L7R A;  2DCK A;  3OEA A;  4DEQ A;  3NRU A;  2VZ3 A;  4YPJ A;  3VD7 A;  2WAO A;  3UNP A;  2HYX A;  3SEE A;  3WQB A;  5DMY A;  3I3D A;  3CZJ A;  1KGY A;  1UYY A;  4XUT A;  5I0D A;  2C9K A;  4PF1 A;  4TXW A;  3HNM A;  1UX7 A;  1JI6 A;  3OGR A;  5IYY A;  2V5D A;  3A21 A;  3SEP A;  4CU9 A;  4P5Y A;  2ZEX A;  2QQN A;  2E32 A;  2VO5 A;  2Y6H A;  4GWJ A;  2DCJ A;  2Y6G A;  2X05 A;  2VCC A;  3CDZ B;  1W0N A;  1K12 A;  3T0A A;  1H6X A;  2W94 A;  4OUE A;  3WNL A;  2J1E A;  4JX0 A;  1GOF A;  2VR4 A;  2ZXQ A;  3NJX A;  1PMJ X;  3PUI A;  4DUW A;  4A44 A;  5IHR A;  3WF3 A;  3OG2 A;  1JYN A;  3UES A;  1WCQ A;  4XZU G;  1I5P A;  3FHQ A;  1JU4 A;  3C8X A;  4LPL A;  1PX4 A;  3K46 A;  1JZ8 A;  5DPN A;  2Z4F A;  5C71 A;  2YC2 A;  3NQH A;  2J7M A;  1L7Q A;  3T2P A;  4JKL A;  2W5F A;  3ACG A;  2VOT A;  1T2X A;  2WYS A;  1F4H A;  3ACF A;  1UYZ A;  3ETP A;  2VME A;  3ZM8 A;  1ULP A;  2E31 A;  4QDQ A;  2VJX A;  4PT6 A;  4UOJ A;  4QX1 A;  3HJR A;  1CZV A;  1GUI A;  4GWI A;  4XUP A;  4A41 A;  3C7E A;  4P00 B;  4A3Z A;  1GNY A;  3CKH A;  3IAP A;  1O59 A;  1UMI A;  1OT5 A;  2VM9 A;  4PQQ A;  5EIY B;  2VZO A;  3FHA A;  5JUV A;  1BHG A;  4JKK A;  3HNY M;  2EID A;  3OGS A;  1D7P M;  3WF1 A;  4DUV A;  1PX3 A;  3LPG A;  3FL7 A;  2YFZ A;  3FN9 A;  1J84 A;  4OYU A;  1ULO A;  1J83 A;  1UY2 A;  1IQD C;  5JXH A;  4JKM A;  2W92 A;  2BER A;  1US2 A;  3I2J A;  2LW8 A;  3WNN A;  2RJ2 A;  3WNM A;  1UXX X;  3VD5 A;  2W47 A;  2QQI A;  3DYM A;  2QQK A;  3F2Z A;  3MBW A;  1GOG A;  2W91 A;  4DUX A;  1TG7 A;  4QPW A;  3LE0 A;  2ID4 A;  5FUI A;  3A23 A;  4ZXE A;  5EJZ B;  3K4Z A;  2WAA A;  1JYX A;  4LKS A;  1NX9 A;  4KI5 M;  5A1A A;  1JZ6 A;  3C7H A;  2XQX A;  2VQU A;  2DDU A;  2J1T A;  2EIB A;  3GM8 A;  1UY0 A;  4MOA A;  4CU6 A;  4E8C A;  1CZS A;  2WO2 A;  2C4X A;  1PMH X;  5C7G A;  2VMD A;  3A7Q A;  3VDB A;  2QBX A;  4Z2A A;  1LNS A;  2VZ1 A;  2VQT A;  3LEK A;  5LA2 A;  3T0B A;  3WEZ A;  3WNP A;  5DN2 A;  5LCW L;  4P08 A;  2B9V A;  2CDP A;  2JDA A;  2ORX A;  5JXJ A;  1OF3 A;  4QAW A;  1GMM A;  1GOH A;  4A42 A;  3I3E A;  2WZE A;  2YG0 A;  4IUG A;  3K77 A;  2J1S A;  2V72 A;  5B4X A;  2BGO A;  3VD4 A;  3T2O A;  5LA1 A;  1NKG A;  3GGL A;  3IB3 A;  3WNO A;  2VMC A;  1SDD B;  4A4A A;  2W3J A;  1NUK A;  5JMO A;  1P8J A;  2VZV A;  4MAD A;  2J1V A;  5CZK A;  3J7H A;  1JZ5 A;  4RYD A;  3OB8 A;  2YB7 A;  4QB1 A;  2KD7 A;  3LEG A;  2J1R A;  4ET7 A;  2WZ8 A;  2W95 A;  1XC6 A;  3MV1 1;  1UWW A;  2PQS A;  4OMD A;  3T0D A;  4ZZ5 A;  4LQR A;  3WSO A;  2V4V A;  1SG3 A;  3I2I A;  4UI9 L;  2XOM A;  2VZS A;  1JYW A;  3WF2 A;  4DXS A;  1K45 A;  2WN2 A;  3OGV A;  3I2H A;  1JZ3 A;  1W8N A;  3LPF A;  1UY3 A;  3HPN A;  2E26 A;  1OH4 A;  4DEV A;  1H6Y A;  1JZ7 A;  3MO4 A;  2ZEW A;  3A22 A;  3WF0 A;  5IFT A;  2WAB A;  1GU3 A;  1W9T A;  2Y6L A;  5IJR A;  4L0P A;  3U37 A;  2HLE A;  4GZ9 A;  4ARY A;  2W1U A;  2OKX A;  2QQJ A;  1SHW B;  5IFP A;  1F4A A;  4XUR A;  4HG6 B;  1OF4 A;  3C7O A;  4XUQ A;  4ZY9 A;  4ZZ8 A;  1RYY A;  3I2G A;  4AG4 A;  3EYP A;  3ECQ A;  3K75 B;  5DQ0 A;  1JYV A;  3IDA A;  5HPO A;  4MGQ A;  1W99 A;  4QX3 A;  2XHN A;  4KWU A;  1TVG A;  3I3B A;  2WO3 A;  4DXT A;  3DEC A;  4TTG A;  2J1U A;  1O8P A;  2E33 A;  3OEB A;  3LQC A;  4BJ0 A;  2B4K A;  1CIY A;  4ARX A;  5B4N A;  4CU8 A;  3MV0 1;  5JXG A;  2VZU A;  1WKY A;  4JHZ A;  2QQM A;  3GXU A;  1EUU A;  4A45 A;  2YC4 A;  2RVA A;  3ACH A;  2W46 A;  4M4P A;  2BZD A;  3JXS A;  1UY1 A;  2VCA A;  2WUH A;  4OMC A;  3III A;  4M4R A;  3W5N A;  4BK4 A;  1W9S A;  1K42 A;  5C70 A;  3I97 A;  4D0Q A;  2VZQ A;  3C7F A;  4XVH A;  4XUO A;  3CQO A;  2LS6 A;  5J1X A;  3EB7 A;  3WNK A;  3P6B A;  2XON A;  3P1I A;  5EJ1 B;  3HEI A;  3MUZ 1;  3THC A;  4CVU A;  1US3 A;  3THD A;  1JU3 A;  1HN1 A;  2RV9 A;  2JD9 A;  2ORZ A;  2W1S A;  3HNB M;  4UAP A;  1GQP A;  2EIE A;  2W9X A;  4W8J A;  3NJV A;  3E1F 1;  2VMF A;  1NAE A;  3C7G A;  4AAX A;  2VTF A;  4QX2 A;  3WF4 A;  1UXZ A;  2VZR A;  4XUN A;  1K3I A;  5CYY A;  1JZ2 A;  2J1A A;  4E8D A;  1UY4 A;  2VCB A;  1YQ2 A;  4BK5 A;  3GDB A;  3ACI A;  3K4D A;  1W8O A;  5G04 L;  1OD3 A;  2WDB A;  2W1Q A;  5JXI A;  3T09 A;  4LHS A;  2ZEY A;  3LEI A;  1XNT A;  2QQO A;  2Y8K A;  4BDV B;  2JKX A;  4QB6 A;  1MPX A;  3NNG A;  2VZP A;  2WN3 A;  3D3A A;  1EUT A;  1XPW A;  4W4Z A;  3SKJ E;  2C26 A;  2L9L A;  1UYX A;  2WQ8 A;  4MO3 M;  4CUA A;  2W87 A;  4MGS A;  2VC9 A;  4D8M A;  2VL4 A;  1CZT A;  2Y6K A;  5F7U A;  3CMG A;  3I2F A;  1DLC A;  1KEX A;  4BXS V;  3UET A;  2BBA A;  3OBA A;  1W9W A;  3W5M A;  2WBK A;  4OZO A;  1DYO A;  2YFU A;  1JZ4 A;  2CDO A;  2R7E B;  4CU7 A;  2ZEZ A;  3AC0 A;  1R64 A;  3DYP A;  5JR2 A;  2JE8 A;  3CZU A;  1UZ0 A;  4QB2 A;  2VZT A;  2X10 A;  3BN6 A;  1XNA A;  1DP0 A;  4RN5 A;  3HOB A;  4CUB A;  1JHJ A;  3T2Q A;  3I2K A;  2Y6J A;  2Y64 A;  3PUH A;  4A6O A;  2J22 A;  4CUC A;  1UMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...