2ZEYA

Family 16 carbohydrate binding module
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
145
structure length
145
Chain Sequence
HMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Selectivity and Specificity of Ligand Recognition by the Family 16 Carbohydrate-binding Modules from Thermoanaerobacterium polysaccharolyticum ManA
pubmed doi rcsb
source organism Thermoanaerobacterium polysaccharolyticum
molecule tags Hydrolase
molecule keywords S-layer associated multidomain endoglucanase
total genus 30
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2zeyA00
2BGPA 1UY4A 2Y6JA 1WCQA 4ARXA 5B4XA 3THDA 2WUHA 2YC2A 1JI6A 5JMOA 4E8CA 2W9XA 1GMMA 2BBAA 1O59A 1UYYA 2WDBA 2ZEYA 1UY1A 1DP0A 1JZ7A 1UXZA 3BN6A 3LEKA 2VL4A 4QAWA 3K4ZA 2ZEZA 3OGSA 3CMGA 3OB8A 2J1SA 3GGLA 1BHGA 2VZUA 3BGAA 1XC6A 4IUGA 5DMYA 3VD3A 3WF1A 4OYUA 5G05L 2JDAA 4AG4A 2X10A 2C26A 3I97A 2QBXA 2WBKA 3ETPA 4JHZA 3A7QA 1T2XA 1SDDB 4JKKA 2C9KA 3SKJE 2VZQA 4GZ9A 3IIIA 1D7PM 4W8JA 5G04L 2J1TA 3CZJA 2YC4A 1PMHX 1PX3A 2V5DA 1UYXA 3ACGA 3DYOA 4P00B 3VDAA 4A6OA 3GM8A 1RYYA 4P5YA 3T2PA 4E8DA 2W87A 1JZ3A 2CDOA 4CU7A 2Y6GA 3IAPA 5HXMA 3WNPA 3UNPA 4W50A 4QX2A 2X05A 4DUXA 1EUTA 1JZ5A 3ZM8A 1XPWA 3J7HA 4KWUA 4W4ZA 3C7GA 1W9SA 2JE8A 4KI5M 3ACIA 3GXUA 3OEAA 3K46A 2VMDA 5EJZB 4HG6B 1R64A 2BGOA 1UY3A 1CZTA 3DECA 1K42A 2L9LA 1JZ6A 4MGSA 4P08A 4AAXA 1JYWA 4M4PA 2R7EB 4A45A 1L7QA 3OBAA 3MBWA 2Y6HA 4QB6A 3PUHA 5JXGA 2VJXA 2B9VA 4OMCA 3WF0A 4CUBA 3THCA 2X09A 1CIYA 4XUNA 1PX4A 2QQNA 2XQXA 1W99A 1MPXA 3E1F1 1NKGA 4QB1A 3VD4A 3LE0A 1GOHA 5DPNA 3WF4A 4ZZ5A 2VC9A 1W9WA 3CDZB 4XVHA 3HNMA 2WN2A 3I3BA 1NX9A 3VDCA 1J83A 4TXWA 4CU6A 3WQBA 2VZVA 2HLEA 2W5FA 3T2OA 5DQ0A 2QQJA 4PQQA 3ABZA 4ET7A 4CVUA 4UOJA 1GNYA 2VQUA 3C8XA 2VZOA 2XHNA 2YG0A 5C71A 5I0DA 1OF3A 3NQHA 4BXSV 2E32A 2VTFA 3ACFA 3C7OA 2DDUA 5IFPA 2E33A 2VZPA 2WO3A 2WQ8A 3K75B 5F7UA 4XZUG 1GQPA 3SEPA 3OG2A 1I5PA 2W47A 3W5NA 4DXSA 5LA0A 2BERA 2WO2A 1JZ4A 2JKXA 3GDBA 4JKLA 3NNGA 1W9TA 2W1UA 4JX0A 4DEQA 3OEBA 1L7RA 1J84A 2ZXQA 2C4XA 2ZEXA 1JU3A 1ULPA 3IAQA 2Z4FA 2WN3A 2QQLA 2W95A 3FHQA 4OMDA 4A3ZA 3WNNA 2W46A 4FI9A 1H6XA 3MUY1 2EICA 3AC0A 4MADA 2WAAA 1GU3A 3HOBA 3CZUA 3HJRA 3I3EA 3A21A 3K4DA 4XURA 1UMIA 5IYYA 3MV01 4YPJA 1EUUA 4LHSA 1K45A 4DEVA 3WNOA 5DN2A 4CU9A 4TTGA 4A41A 2RVAA 5LA1A 2CDPA 3HEIA 4BK5A 3K77A 2J1VA 3F2ZA 3I2HA 3VD7A 1UYZA 5JXIA 2VR4A 1UX7A 1O8PA 3P1IA 3HPNA 3WEZA 3T0AA 2WYSA 4XUPA 3I2JA 3DYPA 3HN3A 4MGQA 2VZ3A 1GOGA 4RYDA 2WZ8A 3T08A 1TVGA 2EIDA 1KGYA 3A23A 2YB7A 2DCJA 4XUTA 4XUQA 3DYMA 2VCCA 2E31A 5A1AA 3CQOA 5JUVA 2W1WA 3P6BA 4JKMA 1W8OA 3T09A 3WSOA 3NJVA 4QX1A 3ACHA 1OH4A 3NJXA 3CKHA 4LKSA 5JXHA 1JYVA 2J1EA 2VMCA 4DXRA 4ZXEA 1UWWA 5CZKA 2XOMA 1HN1A 3FL7A 4QX0A 3I2GA 3VDBA 2J22A 4D8MA 5B4NA 3IB3A 2V4VA 1UZ0A 2ZEWA 3MV11 2WABA 4KMQA 2ID4A 4ZY9A 2VZRA 4PT6A 3I3DA 5IHRA 4QX3A 1PMJX 3C7HA 2KD7A 2J7MA 2RV9A 2Y6LA 1GOFA 1WKYA 2YFZA 3HNBM 4MOAA 1XNAA 2Y6KA 5J1XA 3LEGA 3C7FA 2WO1A 5CYYA 1DLCA 1JYXA 2W1QA 4UI9L 1DYOA 1OF4A 5IFTA 1JU4A 3PUIA 3NRUA 2PQSA 5EIYB 3UESA 3D3AA 5IJRA 3JXSA 3OGRA 3T0DA 1CZVA 4XUOA 2VM9A 1US2A 3WNLA 4LQRA 4QDRA 3T0BA 4CUAA 1LNSA 2E26A 1XNTA 4P02B 3VD5A 2QQMA 3VD9A 2B4KA 2W91A 3I2FA 1H6YA 1O8SA 4GWIA 4OUEA 4BJ0A 4BK4A 3EYPA 2V72A 1ULOA 5C70A 2JD9A 3HNYM 1JZ8A 3C7EA 1SG3A 3T2QA 3OGVA 3LEIA 4CUCA 2VO5A 4M4RA 3FN9A 5FUIA 2EIEA 3EB7A 4QPWA 2LW8A 4A4AA 1CX1A 2ORXA 1W0NA 5LA2A 3WF2A 4QDSA 3WF3A 4Z2AA 2VMFA 3I2IA 1K3IA 1US3A 4A44A 2BZDA 2W92A 1K12A 2W3JA 5EJ1B 2VCAA 3LQCA 2HYXA 1JZ2A 4DXTA 3IDAA 1UXXX 1NUKA 3W5MA 3I2KA 4DUVA 2Y64A 2J1AA 5JXJA 1YQ2A 2YFUA 3A22A 3UETA 2EIBA 2VZ1A 4MO3M 2XONA 3CIHA 2WZEA 4PF1A 2ORZA 4GWJA 2QQIA 3K4AA 2VQTA 2W1SA 4QDQA 3U37A 3FHAA 1F4HA 5HPOA 2QQKA 1CZSA 4DUWA 2J1UA 2VMEA 4OZOA 5LCWL 1GUIA 1NAEA 1UY2A 2VCBA 1JHJA 2VZSA 1IQDC 2QQOA 2VZTA 2DCKA 3LPFA 1UMHA 2RJ2A 4D0QA 3WNMA 1UY0A 1P8JA 1OD3A 1OT5A 3WNKA 1SHWB 5C7GA 3MO4A 3SKVA 2W94A 3ECQA 4A42A 4LPLA 4ZZ8A 4CU8A 1F4AA 2WAOA 2VOTA 4BDVB 1JYNA 4L0PA 4QB2A 4ARYA 1KEXA 4UAPA 2LS6A 5JR2A 1TG7A 3LPGA 3SEEA 3MUZ1 2OKXA 2J1RA 4RN5A 2Y8KA 1W8NA
chains in the Genus database with same CATH superfamily
3AZZA 2ZGOA 3KVBA 1UY4A 3ZFGC 4MX3A 3JU9A 2HBUA 2PYTA 4Y5TA 3DCQA 3THDA 2WUHA 2VNGA 4D7TA 2ZMKA 1K5MA 4Q8LA 3ZDVA 4JTNA 3H1WA 3ZYIB 3TNQA 2VCMA 3OPWA 5KXBA 1SPPB 1GMMA 4A3XA 2ZJCA 4H3WA 3M3OA 4QQHA 3SITA 3HVDA 5F6KA 3I7DA 4XACA 5FKBA 5GLWA 5LWBA 4CCLA 2CV6A 5KHJA 4AK3A 4IEXA 2NZ9A 1VRH3 2VU9A 3AZYA 5AFBA 3O1SA 3K4ZA 3OCPA 1POV3 4YVWC 1A8DA 4OHVA 5DUUA 3ZYGA 2IXCA 1BHGA 1ZBE1 5HV0A 4IE7A 5H9RA 1XC6A 3SNMA 5DMYA 4P5HA 4XJWA 1J3PA 3PUQA 4EWAA 3ILRA 3ZKUA 4XABA 5CFCB 3ELNA 3POFA 3R4DB 2X10A 1QQP3 1NLQA 1QJY2 3MPPG 1VBE1 3FJSA 3RMYA 1RIRA 2FHRA 1QOOA 2P4EA 1A78A 2OYZA 2IXLA 3VLBB 1T2XA 5CBLA 2XUEA 1GQGA 3SKJE 4IGOA 5C9AB 1S0DA 4FQ4A 4PI2A 1L3JA 3CZJA 2YC4A 3ACLA 2XHKA 4N9IA 1OFSA 1PX3A 4P00B 2D6PA 4YZ1A 5FZBA 1WLCA 2GC0A 1HRI1 3BPSA 1JZ3A 4CU7A 1MVQA 1H2MA 2R062 3ZXGA 2Y6GA 1URXA 2JG9C 4B4PA 4JGZA 3TAYA 2P5BA 5FPUA 2HWB2 1B35B 1QJZA 5I0SA 3CHXA 2BOJA 2CHHA 2HWE2 3TB0A 4EYUA 1FAYA 3ZM8A 3WVJA 4XQDA 5CU1A 4C8DA 4KWUA 5JWPA 1D0HA 5F9TA 1CWPA 1W9SA 3K48A 4OHXA 1BK0A 1OLRA 4KI5M 3UGFA 5C9AA 3TEXA 1ZRDA 4FTBA 1OXCA 4OULA 5B2GB 3GXUA 3K46A 4Q4W3 4HG6B 1RMU2 2VPVA 2LROA 2WA3A 3FE5A 5IK4A 4LK7A 4LO7A 4P9XA 3FZ3A 1JXNA 1AX0A 1AYM3 2CY6A 4MGSA 5I0RA 4P9WA 1G9BA 2MEV3 3U4XA 3CF6E 4YM2A 5IUQA 2CSGA 1V00A 2JWPA 2GDFA 3T3YA 1YFWA 3RS6A 3VHNA 4D7SA 3PUHA 3J7MA 1DQ6A 1OVSA 4XJUA 4Q0UA 3H9AA 1VAMA 1S0BA 2VOVA 2NM1A 3ZO0B 4CUBA 3E6BA 3CBNA 1TMF2 3GNEA 2MPFA 4WM8C 4NPMA 4XUNA 5FRAA 1PX4A 5FZ8A 3WDVA 4EN6B 1W99A 3POIA 1MPXA 4QQOA 1J1TA 1MZ5A 5JVVA 5FUPA 5T5PA 1HB3A 4JDNA 4RQPA 2R0HA 4CEWC 4GQ7A 2XJUA 2VC9A 1PIV1 1ENSA 2RR12 3CDZB 3L9JT 1Q3EA 4LXLA 3H1MA 3S5QA 1KS4A 4MXVA 2D93A 4HANA 1O4TA 3WP4A 5DUWA 1DYKA 4XW3A 2E7TA 1YI9A 2RS32 4KH9A 4PI0A 5E88A 3ZXKA 1VMHA 4UFMA 4XCAA 1PO12 2QQJA 1W04A 4QU1A 3BI3A 1GNYA 2VQUA 4MYEA 2ZACA 1NY72 3C8XA 2ADDA 3VBUC 2XHNA 2YG0A 4D6QA 4DS0A 4QHBA 2VD7A 5FZ6A 2PTMA 3TEZA 1V9U2 2TUNA 3ACFA 3QD6A 4LUKA 1SQ4A 1VBC1 3BPZA 2BNOA 1N47A 1GQPA 1UW8A 1HRI2 1AR81 1SZBA 3NV4A 5FUNA 2K0GA 4I3GA 3R4UA 5A3WA 4BQ5A 3CU7A 5JZGB 4DXSA 1AYN1 1UNBA 2ZHNA 4QGNA 1H1AA 1T6BX 3TYJA 2JKXA 4GB33 1YIFA 2P6HA 5D21A 2LUWA 1MS8A 3NNGA 1R1A3 5EZWA 5FPZA 1WW7A 1RUG2 1W9TA 2R072 3ORJA 4Z1VA 5TSWA 5BYNA 3BOWA 2W1UA 4JX0A 4RGGA 1GZ9A 4P9IA 4GJZA 3OEBA 1L7RA 3EJKA 1Q8SA 4TSVA 1W6NA 3SCFA 3WQ7A 3DV8A 2WYFA 3VKFC 3NAPB 5HCFA 1AL22 2XQRA 2ZEXA 2PHTA 3LCPA 1F31A 2OXBA 3NW4A 2YC0A 3RDIA 1CD3G 1VAKA 2FCVA 3MIHA 4OMDA 4Y3OA 4AEJA 2FDHA 3ZFEA 2BGCA 1YHFA 1CAVB 1WMEA 5F2WA 2V4AA 5C3PA 4LT5A 2JDUA 4PIXA 1IQAA 4YZ3A 1S4CA 2EICA 4FPOB 4HK9A 2NPIA 2WAAA 4MADA 5J98B 3WG1A 3HOBA 3MIBA 2WQ4A 4Z82A 3B94A 3H8UA 1VBB3 4YW5A 1AR63 3K4DA 4FPLA 3POWA 4S2FA 5KWRA 5FV3A 4R52A 1UMIA 2N7GA 5T55A 2HH9A 2IFWA 1K5MB 3H42B 1IG0A 3B01A 3DKWA 3T4VA 3IPVB 2R6QA 2WFF3 4LA3A 2W68A 2JDKA 2RVAA 3R6SA 3AZXA 2R1DA 3FMGA 1W8FA 4BK5A 2VH9A 5FY1A 1S2EA 5FZMA 2ZMLA 1QF3A 5E8AA 5GLVA 5IVCA 1QJU1 1UYZA 1VRH1 1MZEA 3NWKA 3B7MA 3VD7A 5IAXA 3PUAA 1UX7A 1O4YA 3P1IA 4BCUA 2X5IC 5FOBB 1W2OA 3HPNA 1ZBE3 1XRUA 3JQXA 1JODA 1IG3A 4HVQA 5FPXA 2P6CA 1H9WA 1TME1 5EV7A 3T0AA 5BNPB 3ZSLA 1Y7BA 2YMZA 5AC93 3RPQA 1QGLA 1XNBA 4Y24A 1TEIA 2A70A 1YLLA 4CP0A 1FI2A 3O12A 4RYDA 5FZIA 2WZ8A 2BFUS 5FYVA 5LBBA 1Q8QA 4N43B 1KGYA 2PLV1 5F39A 3ZIXA 3OOXA 1RITA 2DYCA 5GLTA 4AVSA 3VV1A 2GMEA 3PVNA 2IVIB 4XUTA 4J1WA 4K7JA 2AEZA 1RMU3 5C4WB 3H8OA 2XR4A 1LRHA 3PJYA 5FZ7A 5CADA 2VCCA 3O1RA 3KB5A 4GB32 4HVRA 1KJRA 2W1WA 5BPXA 3USUA 1SBDA 3IKWA 5DAXA 5L36A 4QX1A 5DDJ1 3Q8FA 4YVWA 4OHZA 4M3CB 3PTYA 1PNGA 3NNLA 2Y60A 3NJXA 4XQWA 3OUHA 4QMAA 1SCRA 1LHUA 1B35C 2VMCA 4YSFA 4ZXEA 4YW6A 4C0BA 1LOFA 4GMP0 2RDSA 1UWWA 3RZMA 5CZKA 2XOMA 5FZEA 1BVVA 1ZA4A 1F5FA 3K2OA 2XG3A 5K4LA 3QH7A 3SMHA 3UJQA 4CDUA 1HRV1 1QHDA 3I2GA 3VN4A 3JB4C 2JDPA 2UY9A 4D8MA 2P3IA 4MLOA 1UN1A 5IVEA 4OFGA 3MV11 4BIOA 2VVEA 4NAMA 1W6PB 1A34A 3KHCA 5FTTC 5FLJA 1NA1C 3I3DA 4Q1PA 1W6MB 5IHRA 5JAXA 2WR9A 1UZZA 4P9YA 4HPKA 2RM23 3Q8BA 4C90A 4LBQB 3PUSA 4W65A 5A6QA 3ZSEA 1GWKA 4D69A 2FMYA 2Q4SA 3VBHC 3HNBM 4Y22A 5GZFA 1KFUL 2Y6KA 3LEGA 2OQ7A 4DO0A 2PFWA 2DBNA 2WO1A 3UGGA 2PHUA 3HD8B 4S2HA 2BOIA 3P3PA 4UI9L 4X8NA 4WVMA 5C3SA 2RJKA 1RVF1 1JU4A 2P34A 3PUIA 4HLTA 1OHFA 4DINB 4LBOA 1SLIA 4IE6A 2FQPA 3PVOA 3ZMOA 3VDDB 2DWRA 3F95A 4W6WA 5K9YA 3VKMA 5IWFA 2ZCWA 1IS4A 1WLTA 3T0DA 5EP9A 1WGPA 1CN1A 2V73A 2VM9A 3HBZA 4DRVA 4RS5B 1LKNA 4AI0A 4QDRA 1CAUB 4YW4A 1GZTA 3ES1A 1MS0A 3VKLA 5JSPA 2CTVA 1KRIA 1W90A 4Q2FA 1LNSA 2E26A 3T4HB 2HYKA 1R083 3VBOA 1UCXA 3BIWE 5CEHA 5CIRA 4EN0A 4LBQA 4OUEA 5FZGA 1QDCA 4GWIA 5HCHA 1Z7S3 2XBO1 4YVSC 4Y1XA 3VZMA 4UFLA 3A0NA 4LKDA 4O65A 1WWYA 2UYBA 4QPYA 3RG0A 2GALA 2JICA 2K9ZA 3OUIA 1SG3A 3OGGA 3U4SA 5SV8A 4AL9A 1N1TA 3O0WA 4ZXKA 2C24A 2OVUA 3WZ1A 3EB7A 4LKFA 4CEYA 1V6MA 4P9LA 1JYTA 1DF0A 2TNFA 2WWSA 4IEYA 4E4HA 1IS3A 2C1FA 1W0NA 2ORXA 2PHFA 2C9AA 2YU1A 1O4ZA 3R05A 4UT5A 4OVEA 4Z2AA 3S57A 3JQWA 3I2IA 3KD4A 1HRV2 3M3IA 1RUJ3 2W92A 5ISLA 2XLAA 2ZBJA 1T6GC 2W3JA 1HB4A 4QPGC 2BYVE 4X8PA 3THTA 4AR2A 2RS52 2P17A 2VNVA 4FPKA 4ASKA 2RR13 5L9RA 3IDAA 1AR92 1VBC2 2G4IA 4DNYA 4E9KA 5FZ0A 4BM8A 1N1SA 3I2KA 3ST7A 3ON7A 3C3VA 1OQEA 5JXJA 4Q1RA 2KM2A 2YFUA 2HWC1 1AR61 1LHVA 4CCKA 3VL9A 4IV3B 4YVSA 5KXCA 1W3VA 1DBNA 5FYTA 4L92A 1EPZA 1WBLA 3WDYA 3ZYJB 2Q5TA 2VUCA 3R4SA 4XPVA 1SEFA 1K5MC 3AB0A 1ASJ2 2VQ0A 3PHMA 4BQYA 3MF6A 1NCRA 1QXJA 2W1SA 1X8MA 4XDOA 3RI9A 1ZZBA 2HWB3 1WMDA 2JECA 1JOJA 2VXJA 4QDQA 2YY1A 2YDEA 3LEMA 3U1XA 3U37A 1VIWB 3FHAA 1DZQA 1F4HA 5FO9B 1SPPA 5FYBA 3PIGA 5HPOA 4WVMB 2WC2A 4FXKB 2A6VA 3QCWA 4WVVA 1YEWA 1DQ4A 1QJEA 1QWRA 2YHJA 2J1UA 4KWKA 4B4QA 4YZ5A 2XMLA 3QOPA 1GUIA 1WBFA 1WCDJ 3LWCA 1PNFA 2X5IB 1O3RA 4CDQC 2VZSA 4K1YA 5EHDA 2QQOA 5A70A 4KG8A 1ZZ6A 2DCKA 1UMHA 3MZHA 1GFF2 1IOAA 2XJVA 2VBBA 4C1XA 5BNPC 3WP6A 4AE2A 1ULFA 5GZGA 3WNMA 5J3UA 1E5IA 3I54A 1KS5A 1LODA 1PO23 4ATFA 1SLAA 5JSOA 1D0GA 2KR2A 2D44A 1OT5A 2GP3A 2JG9B 3WNKA 4LITA 1MS4A 1NLRA 3FLPA 3MDPA 3RWNA 4FPHA 4AFMA 1SHWB 5C7GA 3MO4A 3AX4A 3ECQA 3POJA 3VZJA 1W2TA 3UKVA 4KL1A 2WZPP 3OBTA 4LPLA 3IMNA 2WZR2 1IKPA 1CAVA 2Y33A 1PZ8A 3ZFEB 2WS91 5L9BA 3FWEA 4QB2A 2JDZA 4AI9A 3ITQA 2PA7A 2ZZQA 3V65A 1NXD1 1NZCA 1UU4A 1JUHA 1YQ8A 1YQCA 1TG7A 3AJYA 4LULA 3ZX7A 5FWEA 3PJQA 4UWDA 1JTZX 4M3CF 2BW8A 2MEV1 5LY1A 5F1RA 2OQ6A 2P1BA 4LOSA 3FUOA 1KDMA 1QOTA 2E7QA 3ZYPA 5A3TA 1N3QA 4Q5OA 3K3OA 5EJ3A 3USUB 4FOYA 4GKXA 5LB6A 4JGYA 4LO4B 3UYJA 4WV8A 2BGPA 1BMV2 1SFYA 3W20A 4AVVA 1EAH3 4LA2A 5B4XA 2YC2A 1BBT1 1JI6A 3H50A 3O0VA 5FYCA 3EBRA 4XFCA 4AHWA 5GLUA 2WWUA 1NZIA 4YG3A 5CKMA 1RB8G 1H8TC 1LHOA 1DQ5A 1NA1B 2WDBA 3ZXLA 2JD4A 3FLTA 5LK7B 3N9NA 3U14A 4NIGA 4LUMA 3BN6A 3LEKA 2SLIA 4FPJA 2JE9A 1MZ6A 3GBFA 4QAWA 4L11A 4CYDA 2WQZC 4CEWB 3GCXA 1AR72 3OGSA 4YZ4A 1OI6A 3VBHB 4J25A 4LBMA 4SBVA 5T52A 2VZUA 4YLZA 3BGAA 5GM0A 3RYRA 2EXIA 1OOPC 3VD3A 3WF1A 1SFPA 3B9IA 2WIIB 3K51A 1TMF3 3KGZA 1ND2A 2AREA 2JDAA 3NJZA 1RVF2 1E5RA 2W2IA 3OJBA 1QH6A 2C26A 5HXVA 2PHWA 1E57A 1Y9MA 3IDBB 3LFIA 4UW3A 4J6GA 2DV9A 4Z92B 1UOFA 4QPGA 5FP4A 4A2UA 2X53S 4IE5A 2C9KA 4TWTA 3B69A 3RI8A 3WW2A 4AXOA 3VBUB 1AR93 2BUKA 3IIIA 1BKZA 2WJSA 3J8F3 4W8JA 3VDDC 1VMFA 2J1TA 1DIWA 4LEJA 4B4RA 4A6OA 4R9DA 2G9FA 2HKXA 1R093 2CDOA 2ZGRA 3KCXA 4CCDA 3MICA 3OBRA 2JIGA 2QZ3A 4RS5C 1S0FA 1RUD1 1IS5A 5HXMA 1HB1A 4K6BA 4YW3A 1CIWA 3BVCA 4GULA 2D98A 5FQ0B 3WQ1A 5FP8A 4CP9B 4EZ4A 3AKTA 4WM7A 1OKQA 1VBA2 2W0XA 4IE4A 4W4ZA 3RYPA 4V2VA 1M06G 3VBUA 2G1MA 4YVSB 3ACIA 4NAOA 1YFYA 3O1MA 2TBVA 3NAPA 2ZGTA 5EJZB 3NMBA 4HXCA 1C8M1 2VVDA 4Q4Y2 1FOD2 3D4KA 1UY3A 3MI8A 4URAA 5SV5A 1CZTA 2JDHA 4DFSA 1XB9A 5J36A 1HB2A 4BIFA 1JZ6A 3TWIA 2XL7A 4QM9A 4Z8BA 1W2AX 4I0BA 1Z7S2 2C5DA 1C57A 1S2BA 1HX6A 4X6RB 1JYWA 3BU7A 3WDTA 1W6MA 3WCSA 1FPN2 5JZGA 2R7EB 4A45A 1DGWA 5FZFA 4QQLA 1LOBA 2ZGMA 1J58A 1H0BA 2Q30A 2Y34A 4FFIA 2NQYA 2VJXA 5F3GA 5KHKA 2XLGA 4V2WA 4OMCA 4RGKA 4BHPA 3WF0A 1WMFA 3THCA 3UKNA 1W8HA 4DXZA 1KXGA 1V0AA 1CIYA 1W05A 3PU8A 4YW2A 4GXLA 4AVAA 1W0OA 2Q1FA 4F8AA 2RMU2 1IS6A 3E1F1 1RUI1 4QB1A 2NMNA 3LE0A 4ZZ5A 1RJ8A 2R16A 3M2MA 4OUSA 4XF0A 1W9WA 4QKNA 1QJX3 4IV3C 2D5FA 1S0GA 2WNEA 2E6VA 2WN2A 3AMQA 1W0PA 2ZMNA 3U11A 2Q1MA 3GJBA 3VL8A 2WNUB 1OQ1A 3TNPB 4DIQA 4CU6A 4DY5A 2W5FA 1PGL2 3T2OA 2QDRA 2HJIA 1DZRA 4NIDA 4PQQA 2WZR1 1OA3A 2IUWA 3ABZA 3GF6A 1EV12 2ZX4A 3MLJA 3O14A 4UOJA 3EHKA 4NMIA 1PHMA 5FMOS 1D4VB 3TEYA 2OX0A 4N8MA 1BZWA 1XOYA 2A6WA 2B9UA 2QNKA 2DU0A 1RMU1 4FOQA 1RJ7A 1I5ZA 2VTFA 3BODA 3KT1A 3C7OA 2DDUA 5LATA 2DFBA 4CDWB 1WA6X 1REDA 3VZOA 3K75B 5C3RA 2DVFA 3KM5A 1WUVA 1U5IA 5C4WC 1CQ9A 4BMEA 2XWBB 3JD72 1VBD1 4QQPA 1SBFA 5E16A 2VW0A 4G9SB 2AACA 5C8CC 2ARBA 3RZZA 2W47A 3ZXJA 1MACA 2QFEA 3W5NA 2JEMA 5FBJA 3WCRA 5LA0A 4BLIA 1DZTA 5J7MA 3HN1A 2HWE1 4PCRA 4HBNA 4QPIB 1JZ4A 5FMBA 1VMJA 1NT0A 1AR83 1Y4WA 3U78A 3GDBA 3MFAA 4D94A 1KITA 2IXJA 3HAGA 4JKLA 3I3QA 3HQXA 3WINE 3E5QA 4R8HA 3A0KA 4NPRA 4DEQA 2UYAA 2VUAA 3H0OA 4Y33A 1J84A 3AZWA 5H9PA 3GHMA 4IEUA 5FPLA 4CCEA 1AHSA 1HXS1 1I3HA 2G19A 2C4XA 1JU3A 4FT8A 1ULPA 4FPCA 1GQHA 5FIXA 3ZFEC 2QQLA 2A6YA 2OUHA 2VECA 3RMXA 2RS31 3JCIA 4NHMA 5A7WA 4A3ZA 5L7OA 5A7NA 3H3ZA 1JYIA 3WNNA 1LGNA 1B35A 5A3LA 2NP0A 3VHRA 5C3OA 1H6XA 3MUY1 3WQ0A 1ZZ7A 5A7SA 2OS2A 5AFEA 1GU3A 2RS13 3KS7A 2A6XA 2WINB 4AHYA 2C6SA 2VW1A 3HJRA 3V64A 3MLKA 3POBA 4LLOA 5APAA 3H3LA 5HV4A 4IV3A 1BBT3 3MGUA 1WZXA 1EUUA 1K45A 2Z5WA 4DEVA 5FP7A 4KQ7A 1DQ0A 5BUVA 5JMCA 3WG2A 3KCYA 2TEPA 5LA1A 4ZONA 1XXNA 2CDPA 1RC6A 1W03A 3UK9A 1NQJA 3WX5A 1H8TB 1ST8A 4F3JA 2VOXA 3F2ZA 3VGIA 3I2HA 3MW2A 1YQ5A 2VVFA 5JXIA 1AR71 2K46A 2VR4A 2EIGA 4OHWA 4WZFA 3W58A 5JOZA 3WG3A 1C1FA 5D2AA 1C5HA 2DCYA 3T1MA 3WEZA 1COV1 2BU9A 2XWJB 3S7IA 3AMPA 3EMRA 3MHZA 3SISA 5CVRA 5JLVA 5KBFA 1QQP1 1HQLA 3WG4A 4F83A 4MHUA 4XUPA 4KBBA 2XB6C 1CESA 1SFNA 3I2JA 1CX4A 1OOPB 3HT1A 3DYPA 1IPSA 2GC3A 2ZX1A 3AYEA 1RUG1 2R071 1GOGA 4QXCA 4B3NA 2JB4A 1VBB2 3IN9A 1QEXA 4AQTA 3J9SA 2WNVB 5A7QA 5IATA 2D3PA 1RUF2 3BOPA 5AC91 3V0BB 1LOGA 4I30A 2E63A 1W6QB 4XUQA 2JG9A 1HRI3 4GKYA 3N9LA 3WDWA 4O9GA 1YFXA 3LFMA 5D8AB 5JUVA 3KLSA 5J09A 5J96B 3AMNA 4Z2WA 4XFFA 2DFCA 3S5AA 3P6BA 5IK5A 4JKMA 4PDWA 2SBAA 3N9MA 2G9GA 1N1VA 1OUSA 1EY2A 1GICA 3NJVA 2ENRA 4Z07A 1BEV2 4H14A 1MQTB 5JR7B 5JI7A 3RSJA 5JSRA 3O7OA 4MH0E 4XC9A 2F6BA 2J1EA 3POYA 2HWF3 3LA3A 1YUDA 4Q0QA 1RUJ1 1XBFA 4JQTA 2Z69A 2RHPA 2FCUA 2PMWB 4L99A 4F7ZA 2J22A 3LIGA 1AYM1 5B4NA 5JOXA 1UZ0A 3JBG2 3AP7A 2WABA 2XDVA 4KMQA 3WP3A 4I2OA 4ZU5A 2RR11 2VZRA 4XHBA 1HRV3 2VMGA 5KXEA 3OY8B 5FPBA 1ZA7A 1H1MA 3OD4A 3PU3A 3NJYA 3ZIWA 2JX9A 1S0JA 3DUIA 2ZABA 1PMJX 1RHI3 3DGTA 2XJQA 3VHOA 2YGLA 2ZHMA 4NUBA 3ZMNA 4BQ4A 2KD7A 3ILNA 2RV9A 2JB8A 3NKGA 1FMD1 3DN7A 4L9BA 4B1MA 4FAHA 2WFF2 1UU6A 2XJRA 4Q4W2 4HPKB 4CPBA 5GLZA 1HQNA 3WT3A 1XYNA 4YRDA 4NN0A 1GZCA 1RXFA 1S2KA 3C7FA 4KU7A 1ENRA 5FP9A 4A7KA 2CGPA 5CYYA 2O0OA 3ZOIA 2W1QA 1JHNA 1H8VA 1FV3A 1L7LA 1RUI3 2JXAA 1LU1A 4NWVA 1DYOA 4S2GA 5C8WA 1MVEA 5IFTA 2GNTA 3KCCA 1F5JA 1QJX1 2A3XA 2WSUA 2OIIA 5FXVA 2UWCA 4XHXA 4RL7A 5EIYB 4A7ZA 4HK8A 3VBFC 4XFGA 1ODNA 1QOSA 4LLFA 1TME2 4ASMB 5A3NA 1U5ZA 1RVF3 2EXJA 4Y5SA 1CZVA 2A7AA 2BRTA 4YGBA 3U75A 1ULCA 4CDQB 3WNLA 1SLCA 4LQRA 5F6LB 1IHMA 1HV1A 1FT9A 4OHYA 2OW4A 3I49A 3T0BA 4YM1A 3KV9A 1GBGA 1XNTA 3KMHA 4P02B 3ZN4A 2QQMA 2FDKA 4OUMA 3VD9A 4XETA 5T5OA 3E6CC 3RGBA 2RM22 1UOJA 2W91A 4BJ0A 3EYPA 4IE0A 2PXJA 2ZGUA 1ULOA 2P3JA 2JD9A 1JBCA 3HNYM 1C4RA 4CDWC 1G6NA 2ARXA 2AC1A 3PVEA 5A33B 3C2UA 4JDOA 4KU8A 2WS93 1PO13 3KZ4C 5FZHA 5LY2A 2VO5A 1XQNA 4R4ZA 5FUIA 4AHZA 3WV6A 4QPWA 5FAXA 3VDDA 4LIUA 2WO7A 1XE8A 2LW8A 3NL1A 4Q4Y1 4UW5A 3WF2A 5LA2A 4O9EA 2BQPA 3WF3A 1FYUA 1ULEA 4SLIA 4AHXA 4O61A 4A44A 2BZDA 3IMMA 1HXS3 3QH6A 4YFZA 2PHRA 2GH8A 2QKDA 4CP1A 1EAH1 1WCUA 3LQCA 4XIKA 1CPNA 4EQVA 2VMHA 1W6OA 3OYWA 4ZKTB 4DXTA 3HT2A 2B5HA 1NUKA 4RA0A 1ZM1A 2A3YA 2WFPA 2RS11 1W8UA 3A22A 4XBLA 2JG8A 2VZ1A 4JQRA 4L8QA 5LBEA 4MO3M 3U10A 2EF6A 5GKAC 3S6PA 1DU3D 3CLPA 1RUI2 2A71A 3ZR6A 3R0RA 1OFNA 2WFF1 2XONA 2ETEA 3AP5A 3GHNA 3RVHA 3U07A 3ZXEA 1H30A 1AL0G 4FPEA 3AYAA 4K9SA 1UU5A 4GWJA 2WWJA 2QQIA 4MGYE 2HBTA 2YGMA 2R0FA 4QX8A 1PVC2 3NKTA 1WMXA 5CG9A 1JUIA 2XGXA 2VW2A 2BDRA 4YWAA 1YC61 3UGHA 3FLRA 1C5IA 5A3OA 3BTYA 1FV2A 3AP9A 1TME3 1GYKA 2IWGB 4KG0A 4GALA 1COV3 5JOWA 1ZREA 3TRSB 2HWB1 5LCWL 2QCSB 4RSUA 2ZKLA 3LOBA 2VCBA 2XJTA 2Q1ZB 4AQSA 5IVBA 3LD8A 2BNNA 3BU0A 4FTSA 2VZTA 3LPFA 3ROUA 5FZLA 2F17A 5I8SA 5CFDB 2ZHLA 5LBCA 4N53A 2RJ2A 4D0QA 4NE9A 2YROA 1YIPA 2OA2A 1YI7A 1D2QA 2XLFA 3AKQA 4R9AA 4UW6A 5EYYA 3O1VA 1OD3A 1ENQA 4Y20A 3SH3A 4Q4X2 5ANQA 3MW3A 4NO4A 5A80A 3SXWA 2HWD2 4K8RB 1PGW2 2WNVC 5ABJA 4XFHA 2FMDA 3SKVA 4A42A 1V6IA 1G9DA 1MS3A 4WM7B 2WA4A 1S55A 2XH6A 2UWAA 3WNXA 1CAXA 4OCTA 5D8AC 4CU8A 5FXZA 2VOTA 5DAVA 2D7FA 1JYNA 4KBZA 4L0PA 4AQ6A 1DG6A 3EO6A 2WT2A 3UV9A 3S0MA 1FX5A 1KEXA 3SQOA 3M4FA 2YPJA 1OH3A 1VBE2 2W08A 4UAPA 4AEKA 1G9CA 4MHRA 1UD1A 5BY5A 4IEWA 4DZGA 5ACA1 4HN0A 2UY8A 1OVPA 2NLRA 2XPJA 2CWMA 3S7EA 2J1RA 2PAMA 3BCWA 5IT6A 3MFCA 2Y8KA 4HN1A 4RFT0 3NV3A 1DDLA 3LDBA 2A3WA 2ET7A 3H7YA 4I02A 5FLIA 2ZGPA 2HEVF 2Y6JA 2GC2A 3RZLA 3AKPA 2Q0AA 1UAIA 4Q4V2 2Y38A 2ZGKA 3SHRA 4ARXA 1CGPA 4P14A 2UURA 3WUDA 3PIJA 2WKKA 5JMOA 4UFJA 1W2UA 4QX5A 3T1LA 4UXAA 4ISRA 5F8PA 5FYUA 1RHI1 1RGSA 3WDUA 3QBQA 4I09A 4GAZA 4OI0A 4XF4A 1O59A 3NO8A 3NNMA 5DG2A 1UY1A 1DP0A 1FMD2 1GV9A 1NE4A 1NCRB 3AL6A 4MG2A 3OPTA 5T50A 2JKBA 4IERA 1HN0A 3JZVA 4PLOA 4YGCA 4CXXA 2ZEZA 3NSTA 1F2NA 2BV4A 4WZCA 2J1SA 5H9SA 4ZS3A 3GGLA 2GAUA 4DPNA 1DQ1A 5A33A 5IVYA 3GBGA 4IUGA 2ZOEB 4JAAA 1QQP2 2WNUC 4CXYA 3AXDA 1S0CA 1O7FA 2VOKA 3N7LA 4FFGA 4IGPA 1RUH3 4AG4A 3M8LA 5HBAA 3N35A 2WRAA 3ENRA 5FREA 1AYM2 1FXZA 1JS9A 3O1UA 4FP2A 2YPDA 1Y3TA 4P9JA 2CNAA 3A7QA 1SDDB 4HVOA 4JKKA 1TMF1 1XE7A 4LO5B 3GJAA 3LA7A 4Q4V3 5ANNA 3CNAA 2R042 4GZ9A 3URFA 1D7PM 3WP5A 3OUJA 2GH2A 4QD2A 5G04L 3WW1A 2VTXJ 2HWD3 3VBFB 1R092 1PMHX 1VBD3 3DYOA 4RD7A 4Y5Z0 4E27A 3PMEA 4QT6A 1STMA 1RYYA 4P5YA 4E8DA 1ND2C 1EP0A 1LHWA 3AL5A 2PAEA 1CR7A 1ZZ9A 4BLJA 2LRPA 2DVDA 1HIXA 3J8F1 1OA4A 1OA2A 2IVJA 2XBO3 2HWE3 4LIVA 5I91A 5C8CB 3UNPA 4EN7B 4W50A 1JH5A 3NVCA 4FPYA 4QX2A 2YV8A 4B7EA 4BE3A 2X05A 2RS51 5FY4A 1JZ5A 1PVXA 1XPWA 1V9U3 4A6SA 4N7IA 4JV4A 4QPIC 5F5AA 3N9QA 2BVBA 3C7GA 4YGEA 2Q8OA 4G4FA 4HSLA 4AGGA 2P3YA 2Y0IA 2GNBA 3D5OA 1XNDA 2VMDA 5F32A 2QJVA 1F35A 1OLME 4A7YA 4YGDA 1R64A 1HJGA 1LOFC 4C1WA 5A7PA 2CU5A 1CJDA 1ZZCA 2GSYA 2BGOA 2RE9A 4LTAA 3VBOB 2RS33 2JDYA 3RYKA 3AMMA 4AYUA 1CVNA 5EWSA 4G3YC 1ZRRA 4O7XA 2L9LA 4EWEA 1K42A 2PHXA 4Q29A 5FPVA 5GALA 1AR82 4N9HA 4P08A 2RG4A 1OC1A 4FO9A 5FY9A 2QQVA 3N9PA 3M7AA 1PM7A 4PBPA 4XTMA 5F2SA 5EYXA 2D6OX 2Y6HA 4QB6A 4DY3A 5FMOL 5JXGA 1PVC3 1LOEA 1BVP1 4DB5A 1VAVA 1RUF3 5BXXA 2B9VA 2R063 1TNRA 1V6LA 3GALA 1SDWA 4OZXA 1TQ5A 4WVZA 3VBSA 1RHI2 5C5UA 2ZGNA 2VBDA 2CWSA 2FDFA 5J48A 2XQXA 2A75A 1S1AA 1TZOA 3BYWA 1NKGA 5FY5A 2Q8DA 3VD4A 1AR73 1FNYA 1GOHA 2YBPA 3MYXA 5DPNA 3WF4A 4AFBA 4HT1T 2B46X 3RZGA 4GH4B 4V1PA 5F5QA 5CB7A 4AFCA 3I3BA 5CG8A 4FP3A 1ZRCA 5LRRA 3VDCA 3AVSA 1J83A 4RR3B 4LMFA 1VLNA 5T3NA 4AW7A 3USSA 2VZVA 2R043 1KJLA 1NLSA 4MGZE 5DQ0A 1QU0A 4TZDA 3ZKYA 2XXZA 1QMJA 3AP4A 3VBHA 1W3XA 4XAAA 4UFHA 1OPOA 1LEMA 4MXWB 1VPHA 5C71A 2DVGA 5DUXA 4TLGA 1QNWA 4J1XA 5I0DA 1OF3A 2ZX0A 2YUEA 3NQHA 4AGRA 4BXSV 4HKWA 4W6XA 4AWDA 1SLLA 1J59A 5FYIA 2ATFA 2VNOA 2WZR3 1NOVA 2GNMA 2E33A 2VZPA 1PO21 2WQ8A 3AYCA 3BTAA 5F7UA 4ES8A 1LB2A 3MW4A 4NIHA 4CEYB 3FX3A 3CJIC 2RMU3 1KFXL 1Y9GA 2XVLA 5CFDC 4LBKA 2XL9A 4QKFA 2GP5A 4Y20B 4BQWA 1QJY3 2LTNA 4FVVA 1YO8A 2BERA 4NIIA 2DCZA 1ACCA 4PIYA 3NV2A 1G9FA 3N3HA 4XF9A 1MQTC 1O6UA 1UZVA 1WCKA 2DVBA 4MGIE 4XQ4A 1DLLA 2ARAA 4L2NA 5K7PA 2O1QA 2OUJA 2VOWA 5EXOA 4N90A 3RWKX 4YZ2A 5C33A 1SACA 5DXDA 2EXKA 1XU2A 3LIHA 5GZDA 3B3QE 4RS5A 1O3SA 3WOGA 2Z4FA 2WN3A 2W95A 5ACA3 3I2DA 1JMUB 2CYFA 4IESA 2W46A 3D0JA 4CZSA 2K2SA 5JIAA 1X50A 1H9PA 3AC0A 3B02A 3UKTA 1RUNA 1YRZA 3RJ2X 3VZKA 3CZUA 3I3EA 3P3NA 1RTVA 3CJXA 4IV1B 4RHV1 1VJ2A 5FJHA 1KD7A 4XZPA 2CAUA 4FPGA 1PGW1 1GZWA 4LHSA 3TN93 3MIEA 2RDRA 1FOD3 3WNOA 5JCTA 1UQXA 5L7OC 1MQTA 4A41A 1MS9A 2IC1A 3OYWB 3VBRB 3HEIA 3PDQA 4YW1A 4D6SA 3K77A 4JGYC 4M00A 1BK1A 2X5IA 3RQ0A 5D8AA 1C8NA 3ILFA 1NCRC 1O8PA 1VBD2 2FBEA 1SBEA 3NNFA 1GZWB 3OTFA 2BP6A 1VB2A 5FMDA 2X8KA 5FZOA 5FYZA 4DQAA 4YG0A 3RZHA 1O91A 1AYN2 2A1XA 1X7NA 2E7AA 2WYSA 4OLLA 3ZLIA 2H6BA 3I59B 1VRBA 4MGKE 2IFRA 1DHKB 2FDGA 1EV11 3KGLA 1TNFA 4QWNA 2CAVA 2HEWF 1OUXA 1LULA 2EIDA 4FFHA 1B09A 2Y0OA 1MS1A 3A23A 1UKRA 1Z0HA 2HEYF 5IW0A 1X82A 1YXWA 4Q4V1 3LDKA 2DCJA 2E51A 1KDKA 4CDUB 1AJOA 3HWJA 2IZWA 1OURA 5FXXA 1R091 3AFKA 2HWD1 3JBG3 4GA9A 4YNIA 1W8ZA 4Y1UA 3KT7A 1RUG3 2R073 3DYMA 2E31A 1YNAA 4GMP1 3CQOA 5FK8A 1RUD3 3WXPA 5A1AA 5FXWA 5BNNB 1X33A 2FCTA 1UF2C 3P5BA 4N53B 1RUE3 4M3CA 1PO11 2PHLA 4M0HA 1FPN1 3T09A 4I3PA 5FO7B 1SLTA 4Q0SA 4Q26A 3APBA 3DKQA 1OH4A 4ONUA 3OBZA 1E5SA 5JXHA 4XMAA 5C4WA 1V70A 5IAVA 5ACA2 4H55A 4XF1A 1HN1A 4XOGA 1C8M3 3FL7A 3GYDA 4QX0A 1WW4A 1AXYA 2D3RA 3IDEA 3ZN6B 4U2AA 1HJFA 1R1ZA 1D2SA 1GR3A 4CXWA 3Q8AA 4XF3A 1POV0 2HWF1 2PQQA 4R4XA 2ZEWA 3A4UA 1CAWB 3N7JA 5FBZA 5DZGA 3SCGA 3UL2A 2FD8A 5A7WB 5FY7A 2OZJA 3V0AA 3J26N 5I0UA 1CONA 4PT6A 2P3KA 4W6YA 2XKOA 4Y4YA 1VP6A 2AEYA 1ZYBA 4GIQA 5F3IA 1ZBA3 2R1BA 5BV6A 4AFAA 1X9TA 4GD4A 5DAQA 2AR6A 1NG0A 1FNZA 1PZ9A 2J7MA 1IPKA 4YM3A 1UZWA 1WD3A 3J8F2 4ZS2A 1O3QA 2AENA 1JOBA 3FBYA 1WKYA 4LORA 5D1IA 4E2QA 5DAPA 3VBRA 5DUVA 5KC5A 2KA3A 1MR5A 1RL3A 1HKDA 4LNVA 5C3QA 1RXGA 1CAUA 5J1XA 2XVKA 3M3CA 4Q4X3 5KHIA 1FMD3 1POV1 1AZDA 1SLBA 4K3UA 5FYHA 5DDJ2 4CCMA 4COVA 1BEV1 4QU2A 5F5CA 1OF4A 4COUA 1AX2A 2ZX3A 4CP9A 2D5HA 3I4IA 4TLFA 4YYOA 5FZAA 3VBSB 4ZU7A 2QQPA 4AOCA 5FK7A 1ND3C 4NHLA 3I8TA 1U0AA 1VBE3 4Y4RA 1NE6A 3RFRA 5FO8B 5FPAA 2YBSA 3D3AA 4LO8A 5IJRA 3UESA 4UBHA 4IEQA 3LB9A 1UO9A 2R041 2VG9A 5JOYA 1G8WA 1GLHA 3SC7X 1UYPA 5FYMA 4E2GA 1RUC1 2ARCA 3ZFFB 1V6JA 1H4HA 2ADEA 3KF3A 2RJLA 1AF9A 3M70A 3ASIA 1NCQC 1S0IA 1O5UA 3VD5A 4OQ8A 4PDWB 5FDBA 5F3CA 1F15A 3W21A 3I2FA 1A6CA 1H6YA 4BK4A 5T5LA 5T5JA 1RUE2 1ODMA 5C70A 4NJ4A 4NROA 1JZ8A 4PLMA 1UPIA 1WLDA 2RMU1 4IGQA 2A73B 2D6KA 4XFIA 5FMCA 1JYCA 3T2QA 4CCNA 3OGVA 1KQRA 4WM7C 2G9ZA 5DAWA 4LBLA 4CEYC 1AXKA 3CJIB 4XDPA 2VBPA 4M4RA 4AVBA 3FN9A 3RNSA 2BTVC 4CA9A 4CUCA 2EIEA 1HW5A 3D82A 3DPRC 4XDQA 5I8YA 3INAA 1ULGA 4IL7A 1GP5A 2O14A 4ZU4A 4PLNA 5IK7A 1OMIA 2VMIA 1YFUA 4UF0A 4Q0VA 4A4AA 3I3MA 3FC0A 4XBNA 4WVWA 1I1EA 3CL1A 5FZ1A 5KHGA 1LGCA 3M3EA 4XJZA 5ERLA 2LM3A 4EWDA 3LAGA 4JDMA 2YXSA 2ZX2A 3AFGA 4QKDA 2WNOA 4HKLA 4MXWA 1PM4A 5GJ6A 3VBFA 4LBNA 1IZ3A 1EYBA 1LGBA 3GZTB 3SLIA 1PZ7A 2GU9A 4EZHA 2QZ2A 4ZHNA 4QM8A 2HYXA 4NR1A 3DPRA 5JIUA 5JI9A 4COYA 1UXXX 4XJAA 5BNOC 3HIFA 1R082 1WLWA 4LE4A 4DUVA 4GH4A 2AH2A 1REEA 2J1AA 2RDNA 5CFCA 1W39A 1YQ2A 5M0TA 3UETA 3D8CA 4ISQA 5L19A 4RQPB 3E5UA 4RGAA 4C91A 4NRMA 1WW6A 3TN91 3CIHA 4PF1A 4S2DA 4N43A 3E6DA 4BPZA 4UFKA 3KT4A 3UJOA 3LOIA 1LU2A 1AL23 5FQ0A 4FPFA 3G7DA 3K4AA 5KXDA 2VQTA 5FOJB 1UZYA 3RRDA 2V09A 5L7OB 4XJ8A 2CL2A 3WUCA 2H6CA 1LAJA 4HL0A 4BQ1A 4JGZC 3VBRC 5FY8A 1ZZ8A 2D6NA 2NN8A 2VMEA 5FZCA 1DGWX 5K0UC 1UY2A 3WW4A 1JHJA 2ILMA 3QLQA 3B93A 1IGOA 2WLPA 1I9RA 1LR5A 1QNYA 2E53A 1OBNA 1PMIA 3IDCB 2Z2SB 4M3CE 4CP2A 2Q8CA 2Q8EA 4AVTA 5F37A 1UY0A 3L2HA 4Y1YA 3WLUA 1PIV2 4EE2A 1VBC3 1ND2B 1XNCA 4YG6A 3JUUA 4ES9A 3FBMA 5IVJA 3GCWA 3FUQA 5LZ6A 1M4WA 2ZS6B 3JBG1 4JRAA 1I6XA 5A1FA 2UU8A 3AKRA 1O5LA 3DEMA 4Q0PA 4GMP3 2W94A 3SH4A 4BA6A 4IETA 3EXUA 1LEDA 1Q8PA 1AYN3 2OPWA 1CAWA 3J4UH 4LBJA 5A32B 2J42A 1W8WA 2R32A 4ZZ8A 1AJKA 1ZBE2 1VE0A 1XSQA 2ES3A 5LEKA 5BNNC 3S30A 5E89A 4HOOA 4BDVB 4N53C 1NA1A 3E97A 4I01A 5GZCA 4ARYA 1HQWA 2MNGA 1MEC3 2LS6A 4K1ZA 3JB8A 3AVRA 4LHKA 3PL0A 3VBOC 1GNZA 1GKBA 3LPGA 1GNHA 2OKXA 1UOBA 4AFDA 4I0WB 4LE3A 5CFDA 4LK6A 1XE0A 1GP6A 3AP6A 1LENA 1W8NA 4EROA 4TYSA 1CX1A 2MHFA 4BWOA 5KHHA 4COWA 3POEA 3KF5A 3W9AA 3AMHA 5F3EA 1CJPA 3HQUA 2R061 1C1LA 1WCQA 4K20A 4LHNA 5AC92 1DGLA 1LECA 2DUOA 4XXPA 5FZ9A 3ZXAC 4E8CA 2W9XA 2BBAA 4INDA 3WY6A 3BIEA 1UYYA 1Z78A 2ZEYA 5A7OA 2PN5A 1C8M2 2IXHA 1JZ7A 3ZYRA 1UXZA 1W06A 4MV2A 2AGSA 2VY0A 2VL4A 4EN8B 3NNJA 1DFQA 1UOGA 4FOWA 4NHKA 4ORFA 3IWZA 3CMGA 5BNQA 3OB8A 4PIZA 3KV4A 1HV0A 4AQ2A 3KQRA 3O5SA 1HDKA 1N1YA 4GH4C 4OI4A 1F8VA 4CCOA 4OYUA 3BALA 4JCKA 2P37A 5G05L 2XUMA 4OQ9A 4RR3C 2C0ZA 2WSVA 4CDXB 5GZEA 4QQ2A 3I97A 2QBXA 1QXRA 2BVVA 2XJSA 1RUD2 2WBKA 3IM0A 2DF7A 3VHPA 2ZGSA 3H7JA 4BQ3A 3ETPA 4JHZA 1W6OB 3BKZA 4QGMA 2B45X 4BQ2A 2V5YA 1C3HA 3OF1A 5LW9A 1VBA1 2PHDA 1ZVFA 2I2SA 2VZQA 1SMVA 1RUH1 4DMIA 2E9QA 3POGA 1ND3B 4JVAA 4I0AA 3ACGA 2V5DA 5CKNA 1UYXA 3VDAA 3WR0A 4XTPA 3GM8A 3T2PA 4AI1A 2W87A 3GZAA 1QJY1 2JENA 3IAPA 3QACA 1OKOA 4META 5K0UA 5JDBA 3WNPA 1CAXB 4CDWA 1LJ7A 4XJ9A 5F5IA 2BNMA 4E4DX 4QXBA 4CCCA 5AVAA 1NCQB 1BYHA 4DUXA 1EUTA 3KHBA 4PDWC 2W39A 3GZEA 3J7HA 1EPWA 3IZOA 1BBT2 5ABJB 1REFA 2JE8A 5LK5A 1H2LA 1U12A 1X36A 5CA6A 4D7YA 1UMZA 3OEAA 3GZUC 4XFAA 3ZXDA 5HCAA 2PLV2 4UFIA 4JC1A 5AVPA 4Q4Y3 4MSVA 5CAZA 1V9U1 1XNKA 2GMMA 1XJAA 3BTXA 1ZX5A 1QDOA 3DECA 4KGQA 3DPRB 4IEVA 5C6CA 4OI2A 3JD71 5IVFA 3KV6A 1WA4A 2OT7A 4BB3A 4MUVA 4AAXA 2QE3A 2DCTA 4D3WA 2UWBA 4M4PA 3V56A 4LOTA 1FATA 1L7QA 1MS5A 3OBAA 4CEWA 4QHOA 1BJQA 2WS92 3HMYA 3MBWA 4HETA 4HMZA 1PK6C 1GWMA 1QJU2 1IKQA 3PVBB 5DZEA 3LDRA 4PF5A 2D6LX 2RM21 1FOD1 4IV1C 3ZN6A 2KXLA 4UF0B 4NHXA 4AEDC 3FFQA 3VZLA 1APNA 4Q27A 2X09A 1V6OA 2VTXA 2B7YA 2D3SA 3CEWA 3CJIA 1PGL1 2QQNA 1W9YA 2EAAA 1MZFA 2A6ZA 2FDJA 3WW3A 1OSGA 5HI0A 4QGLA 2NYYA 1BMV1 3WHUA 4JGYB 4C0HA 4YVWB 2D97A 5LBFA 4K21A 3WDXA 4XVHA 3HNMA 1A8MA 1PK6A 1CPMA 3MIDA 4RQPC 3RZKA 2W52A 2EVXA 1XYOA 1NX9A 3PURA 2BPA2 1LOAA 4TXWA 1GSLA 5CFCC 1YJLA 4H2AA 3WQBA 2ET1A 3O1OA 2HLEA 3AK0A 2JG8C 3AZVA 4BH9A 1EV13 2DBIA 3H8XA 1OD5A 1Q8VA 4H7LA 2FDIA 2QTWB 4ET7A 4CVUA 3AM2A 2WL1A 1AVBA 2A5ZA 2VZOA 5C9AC 5FFOC 3I2OA 1NCQA 5FZ3A 2E32A 3T2TA 1VR3A 3I59A 4XFBA 5I8TA 4GWNA 4CDUC 5K0UB 3DXTA 3PTRB 5IFPA 2XKPA 1R081 2WO3A 3VB9A 5FYSA 5BNPA 4XZUG 1RUE1 4KGGA 1QJFA 1RUJ2 4XBQA 3SEPA 4GB31 2B8MA 1Z7S1 3OG2A 3Q8EA 1I5PA 1UPSA 4CRQA 3OD0A 1D4M1 1LCLA 3RZJA 3O1TA 2ZZJA 3WD5A 1ND3A 2VULA 3TOJA 2WO2A 1Y43B 4E4SA 4QXHA 2OZ6A 5FZKA 2QVSB 3N7MA 2VE1A 4Y1VA 3B9CA 2B42B 3ES4A 3IPVA 3PNAA 1RINA 4CDXA 4AI8A 4K40A 1H4GA 4DRRA 3M3QA 5DG1A 3K3NA 2B39A 2ZXQA 1Q8OA 4ITCA 1NXMA 4IV1A 3Q9OA 1BCXA 1MEC1 3OGJA 3IAQA 2F4PA 1AX1A 3FHQA 3UT0A 1N3OA 1VBB1 1BQPA 1LOCA 2JJ6A 4M01A 3J7LA 1QIQA 2QUOA 1X8EA 1ZBA1 4CUGA 3GBWA 5LRSA 4N7UA 4FI9A 4HONA 2DUQA 4IW3A 1OOPA 2ZGQA 2JIJA 2Z42A 1W28A 2BFUL 4IEOA 3ZR5A 2GMPA 2GNDA 3A21A 3G6JB 4XURA 4PHZA 5EQUA 3SH5A 3T30A 3THPA 4AGVA 5A1LA 1E5HA 2ZTNA 2ZHKA 5IYYA 3MV01 4YPJA 4H7MA 4MZUA 1ZNPA 4XAEA 4FXGB 3ZSMA 4HSJA 4AEMA 4EJRA 3V0AB 3ATGA 4QX7A 1WCSA 4WM8B 5DN2A 4CU9A 4YARA 4TTGA 4PJYA 3IIAA 5H9QA 5A3MA 5EPAA 4RHV3 1DGRN 1BEV3 1UX6A 1QKQA 1JN2P 2VGDA 2DTYA 2J1VA 3ZPOA 2EA7A 2QDNA 4EN9B 4D6RA 2DTWA 2YBKA 1WD4A 5BNNA 4NRQA 4WBBA 1LESA 1IPJA 1PIV3 3VBSC 2O8OA 5JPNB 1AXZA 2JDMA 3FHIB 2BEOA 2VQAA 3KV5A 1OQDA 3VUOA 2XBO2 3OY8A 3MPBA 4XMIA 3OSDA 3ZYBA 2DURA 1PGSA 4QKBA 1ASJ3 3H1YA 4UYBA 3HN3A 4MGQA 2VZ3A 3L2YA 3LA2A 4CTEA 3PLQA 2DUPA 1TVGA 3T08A 1U5YA 3ZFFC 5E6HA 4IQPA 1VBA3 4LHLA 3HR9A 1V6KA 1ULDA 2YB7A 4NRPA 5J37A 3MLLA 1HXS2 5KR7A 4Q8KA 1GP4A 1LTEA 3IBMA 5FJKA 3AKSA 4U36A 1XU1A 3VZNA 3BUCA 1NQDA 2Y6FA 5JZGC 3ALQA 5IK8A 1W8OA 2JE7A 4XILA 5L73A 2BWCA 2RS53 3WSOA 5A3PA 3LF7A 3N4MA 4E2SA 3ACHA 1TE1B 4GWMA 4NVPA 3ZPYA 3ZSJA 2R30A 3ZFFA 5LEJA 4LO6B 3CKHA 2ZKNA 4KWLA 4LKSA 1JYVA 4DXRA 2FZ2A 2I45A 1J3RA 1FPN3 4MVTA 3TBDA 1YCIA 1R1A1 3V0BA 2VUJA 3NAPC 3ZDSA 4QXKA 2WNVA 5ABJC 1QXPA 4M0NA 5FYYA 3ZFGB 1O3TA 3VDBA 2PAKA 3IB3A 4JZRA 1DCSA 2V4VA 3MIFA 1K5JA 1UIJA 5CKQA 4COZA 2PELA 4E4ZA 4IDZA 1YJKA 2ID4A 3JD73 4ZY9A 1A3KA 3AYDA 5A3UA 5A6ZA 3PMSA 2FZ1A 1X9PA 4XCBA 2ZGLA 3KQ4B 5T54A 4X6QB 1ALYA 1COV2 2LALA 4QX3A 1PVC1 3DL3A 4HKOA 3LKJA 4Y22B 4AZZA 4BU2A 5I0TA 3C7HA 1W6NB 5BNOB 4IEZA 1RUF1 2P2KA 2HWC2 3U0ZA 4BYYA 4RHV2 1QJX2 4FTEA 1WW5A 2Y6LA 3N7KA 5JPMB 2YU2A 1GOFA 5I93A 1H8TA 4YFWA 1G9AA 1NYWA 1QY4A 2YFZA 4B8EA 1PK6B 2Z79A 3B5LB 4B7KA 4MOAA 1XNAA 2OPKA 4XE9A 5FR3A 2DU1A 3FFZA 2R49A 4LJHA 3NV1A 4WM8A 4HFSA 4AEDB 1GWLA 4ATEA 1H2NA 3LGRA 4CDQA 1DLCA 1JYXA 1PO22 2QQWA 3ZN5A 4OI1A 2NMOA 1Q5OA 2I74A 4YM0A 3LSDA 4CE8A 5C8CA 3NRUA 4JHTA 1QJU3 4JGZB 2PQSA 1D4M2 1W9FA 3DXUA 4JTOA 4Q4X1 5IVVA 3MF9A 1JW6A 1OLMA 1XYPA 1BLZA 3N36A 3JXSA 3OGRA 1POQA 4LBQD 1AR62 5LASA 2D40A 4XUOA 1RUH2 1US2A 3ME2A 5E1RA 4N43C 1AR91 4ASLA 4XIOA 4BZ4A 2AYHA 1OLQA 2JG8B 4CUAA 2Y26A 2BWAA 4NOTA 2DVAA 4DOUA 4MGTA 4FFFA 4RR3A 2PLV3 4K8FA 1YQ6A 2B4KA 5CNAA 3WHTA 5CISA 2H0VA 1RUC3 1O8SA 3ZYHA 2V72A 5FCCA 4GJYA 3W59A 4CSWA 4QPIA 1LHNA 1W2NA 1YYNA 3C7EA 1SCSA 4HZFA 3LEIA 1D4M3 4CCJA 2WT1A 4NIAA 3J7NA 3O0XA 4Q4W1 1EAH2 1JOPA 5FWJA 3POSA 1GANA 5DDJ3 2XJPA 3KWVA 2GN3A 4NPLA 5A6XA 1J1LA 4QDSA 5FZDA 1DYPA 4FAGA 4JRLA 1Q43A 2RS12 4IXLA 3ZYFA 2VMFA 3ZVXA 1K3IA 1US3A 1ONAA 2GZWA 2D43A 3ETQA 4BQXA 3TEWA 2ZAAA 5KC6A 1K12A 1S0EA 1MEC2 3SCHA 2D6MA 5EJ1B 4AVCA 4NHYA 1VB4A 4XXAA 4FSJA 1ZRIA 2VCAA 1V6NA 4TN7A 2HWC3 4B29A 4AF9A 2GN7A 1JZ2A 1ZBA2 1H2KA 5DABA 3MIGA 5C5TA 1RUC2 2WNUA 1UL9A 2EAKA 2O8QA 3OPZA 4FQZA 4XEZA 3X29B 3H3UA 4UW4A 3W5MA 2EXHA 1U5XA 2Y64A 1F9KA 4NWWA 4URTA 3H8RA 4L97A 4BMBA 2F4LA 3BTZA 2EIBA 4BXFA 3Q8CA 1W6QA 2VNRA 4EV0A 2RDQA 1OPMA 2WLQA 2MEV2 2WZEA 3IT8A 1Y9QA 1W6PA 3O1PA 5L9VA 2ORZA 3RJRA 1RUOA 4RFRB 1C28A 3D0SA 3EQEA 3LSEA 3ZSKA 1UKGA 5FLHA 1VRH2 3VKOA 4FOVA 1QH7A 4XYXA 3ZXFA 4LKEA 5FY0A 2QQKA 4CDXC 3KSCA 1AL21 1N3PA 2IXIA 1CZSA 2QQUA 4LR4A 4DUWA 4OZOA 1AUYA 4PBOA 4AEDA 1YWKA 1NAEA 5DZFA 2I07B 2ZAHA 1IQDC 1BXHA 1ASJ1 5LA9A 4QHZA 4R9BA 2BJSA 3E5XA 5FP3A 1ZRFA 1DQ2A 3AXEA 4KWJA 1W8TA 1ENXA 4BISA 1R1A2 1P8JA 4FCAA 1J3QA 5A6YA 5BNOA 4IEPA 2X29A 2AUYA 5HCBA 2ZPXA 3LZZA 1Q56A 2HWF2 2XVGA 5K8SA 4Y1ZA 2VUDA 2BBVA 3BB6A 3MEPA 2VAUA 3VKNA 2YZ4A 3DF0A 3CO2A 5FZ4A 1VALA 2JDNA 4P9GA 4AI3A 4PQ9A 3TN92 2ERFA 2H0BA 5A32A 1F4AA 1NY71 2WAOA 2WT0A 2ZA9A 3ZFGA 1UIKA 3M1HA 4UBGA 2IXKA 1G7YA 4ZPIA 2YYOA 4AAPA 3B00A 3D6EA 5FZOB 5JR2A 2AZ5A 4B1LA 3HQRA 4R9CA 3SEEA 3MUZ1 1HLCA 2GC1A 3AJZA 3HBKA 4Y26A 3KVAA 1G86A 3N9OA 2CGOA 4AI2A 4BOWA 4YW7A 4RN5A 5EFUA 4KNCA 2EALA 4QPGB 5FKCA 1H1IA 1DGRA 4CPBD 2VXRA 4FBFA 1XSRA 2CGNA
chains in the Genus database with same CATH topology
2BGPA 1UY4A 2Y6JA 1WCQA 4ARXA 5B4XA 3THDA 2WUHA 2YC2A 1JI6A 5JMOA 4E8CA 2W9XA 1GMMA 2BBAA 1O59A 1UYYA 2WDBA 2ZEYA 1UY1A 1DP0A 1JZ7A 1UXZA 3BN6A 3LEKA 2VL4A 4QAWA 3K4ZA 2ZEZA 3OGSA 3CMGA 3OB8A 2J1SA 3GGLA 1BHGA 2VZUA 3BGAA 1XC6A 4IUGA 5DMYA 3VD3A 3WF1A 4OYUA 5G05L 2JDAA 4AG4A 2X10A 2C26A 3I97A 2QBXA 2WBKA 3ETPA 4JHZA 3A7QA 1T2XA 1SDDB 4JKKA 2C9KA 3SKJE 2VZQA 4GZ9A 3IIIA 1D7PM 4W8JA 5G04L 2J1TA 3CZJA 2YC4A 1PMHX 1PX3A 2V5DA 1UYXA 3ACGA 3DYOA 4P00B 3VDAA 4A6OA 3GM8A 1RYYA 4P5YA 3T2PA 4E8DA 2W87A 1JZ3A 2CDOA 4CU7A 2Y6GA 3IAPA 5HXMA 3WNPA 3UNPA 4W50A 4QX2A 2X05A 4DUXA 1EUTA 1JZ5A 3ZM8A 1XPWA 3J7HA 4KWUA 4W4ZA 3C7GA 1W9SA 2JE8A 4KI5M 3ACIA 3GXUA 3OEAA 3K46A 2VMDA 5EJZB 4HG6B 1R64A 2BGOA 1UY3A 1CZTA 3DECA 1K42A 2L9LA 1JZ6A 4MGSA 4P08A 4AAXA 1JYWA 4M4PA 2R7EB 4A45A 1L7QA 3OBAA 3MBWA 2Y6HA 4QB6A 3PUHA 5JXGA 2VJXA 2B9VA 4OMCA 3WF0A 4CUBA 3THCA 2X09A 1CIYA 4XUNA 1PX4A 2QQNA 2XQXA 1W99A 1MPXA 3E1F1 1NKGA 4QB1A 3VD4A 3LE0A 1GOHA 5DPNA 3WF4A 4ZZ5A 2VC9A 1W9WA 3CDZB 4XVHA 3HNMA 2WN2A 3I3BA 1NX9A 3VDCA 1J83A 4TXWA 4CU6A 3WQBA 2VZVA 2HLEA 2W5FA 3T2OA 5DQ0A 2QQJA 4PQQA 3ABZA 4ET7A 4CVUA 4UOJA 1GNYA 2VQUA 3C8XA 2VZOA 2XHNA 2YG0A 5C71A 5I0DA 1OF3A 3NQHA 4BXSV 2E32A 2VTFA 3ACFA 3C7OA 2DDUA 5IFPA 2E33A 2VZPA 2WO3A 2WQ8A 3K75B 5F7UA 4XZUG 1GQPA 3SEPA 3OG2A 1I5PA 2W47A 3W5NA 4DXSA 5LA0A 2BERA 2WO2A 1JZ4A 2JKXA 3GDBA 4JKLA 3NNGA 1W9TA 2W1UA 4JX0A 4DEQA 3OEBA 1L7RA 1J84A 2ZXQA 2C4XA 2ZEXA 1JU3A 1ULPA 3IAQA 2Z4FA 2WN3A 2QQLA 2W95A 3FHQA 4OMDA 4A3ZA 3WNNA 2W46A 4FI9A 1H6XA 3MUY1 2EICA 3AC0A 4MADA 2WAAA 1GU3A 3HOBA 3CZUA 3HJRA 3I3EA 3A21A 3K4DA 4XURA 1UMIA 5IYYA 3MV01 4YPJA 1EUUA 4LHSA 1K45A 4DEVA 3WNOA 5DN2A 4CU9A 4TTGA 4A41A 2RVAA 5LA1A 2CDPA 3HEIA 4BK5A 3K77A 2J1VA 3F2ZA 3I2HA 3VD7A 1UYZA 5JXIA 2VR4A 1UX7A 1O8PA 3P1IA 3HPNA 3WEZA 3T0AA 2WYSA 4XUPA 3I2JA 3DYPA 3HN3A 4MGQA 2VZ3A 1GOGA 4RYDA 2WZ8A 3T08A 1TVGA 2EIDA 1KGYA 3A23A 2YB7A 2DCJA 4XUTA 4XUQA 3DYMA 2VCCA 2E31A 5A1AA 3CQOA 5JUVA 2W1WA 3P6BA 4JKMA 1W8OA 3T09A 3WSOA 3NJVA 4QX1A 3ACHA 1OH4A 3NJXA 3CKHA 4LKSA 5JXHA 1JYVA 2J1EA 2VMCA 4DXRA 4ZXEA 1UWWA 5CZKA 2XOMA 1HN1A 3FL7A 4QX0A 3I2GA 3VDBA 2J22A 4D8MA 5B4NA 3IB3A 2V4VA 1UZ0A 2ZEWA 3MV11 2WABA 4KMQA 2ID4A 4ZY9A 2VZRA 4PT6A 3I3DA 5IHRA 4QX3A 1PMJX 3C7HA 2KD7A 2J7MA 2RV9A 2Y6LA 1GOFA 1WKYA 2YFZA 3HNBM 4MOAA 1XNAA 2Y6KA 5J1XA 3LEGA 3C7FA 2WO1A 5CYYA 1DLCA 1JYXA 2W1QA 4UI9L 1DYOA 1OF4A 5IFTA 1JU4A 3PUIA 3NRUA 2PQSA 5EIYB 3UESA 3D3AA 5IJRA 3JXSA 3OGRA 3T0DA 1CZVA 4XUOA 2VM9A 1US2A 3WNLA 4LQRA 4QDRA 3T0BA 4CUAA 1LNSA 2E26A 1XNTA 4P02B 3VD5A 2QQMA 3VD9A 2B4KA 2W91A 3I2FA 1H6YA 1O8SA 4GWIA 4OUEA 4BJ0A 4BK4A 3EYPA 2V72A 1ULOA 5C70A 2JD9A 3HNYM 1JZ8A 3C7EA 1SG3A 3T2QA 3OGVA 3LEIA 4CUCA 2VO5A 4M4RA 3FN9A 5FUIA 2EIEA 3EB7A 4QPWA 2LW8A 4A4AA 1CX1A 2ORXA 1W0NA 5LA2A 3WF2A 4QDSA 3WF3A 4Z2AA 2VMFA 3I2IA 1K3IA 1US3A 4A44A 2BZDA 2W92A 1K12A 2W3JA 5EJ1B 2VCAA 3LQCA 2HYXA 1JZ2A 4DXTA 3IDAA 1UXXX 1NUKA 3W5MA 3I2KA 4DUVA 2Y64A 2J1AA 5JXJA 1YQ2A 2YFUA 3A22A 3UETA 2EIBA 2VZ1A 4MO3M 2XONA 3CIHA 2WZEA 4PF1A 2ORZA 4GWJA 2QQIA 3K4AA 2VQTA 2W1SA 4QDQA 3U37A 3FHAA 1F4HA 5HPOA 2QQKA 1CZSA 4DUWA 2J1UA 2VMEA 4OZOA 5LCWL 1GUIA 1NAEA 1UY2A 2VCBA 1JHJA 2VZSA 1IQDC 2QQOA 2VZTA 2DCKA 3LPFA 1UMHA 2RJ2A 4D0QA 3WNMA 1UY0A 1P8JA 1OD3A 1OT5A 3WNKA 1SHWB 5C7GA 3MO4A 3SKVA 2W94A 3ECQA 4A42A 4LPLA 4ZZ8A 4CU8A 1F4AA 2WAOA 2VOTA 4BDVB 1JYNA 4L0PA 4QB2A 4ARYA 1KEXA 4UAPA 2LS6A 5JR2A 1TG7A 3LPGA 3SEEA 3MUZ1 2OKXA 2J1RA 4RN5A 2Y8KA 1W8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGP A;  1UY4 A;  2Y6J A;  1WCQ A;  4ARX A;  5B4X A;  3THD A;  2WUH A;  2YC2 A;  1JI6 A;  5JMO A;  4E8C A;  2W9X A;  1GMM A;  2BBA A;  1O59 A;  1UYY A;  2WDB A;  2ZEY A;  1UY1 A;  1DP0 A;  1JZ7 A;  1UXZ A;  3BN6 A;  3LEK A;  2VL4 A;  4QAW A;  3K4Z A;  2ZEZ A;  3OGS A;  3CMG A;  3OB8 A;  2J1S A;  3GGL A;  1BHG A;  2VZU A;  3BGA A;  1XC6 A;  4IUG A;  5DMY A;  3VD3 A;  3WF1 A;  4OYU A;  5G05 L;  2JDA A;  4AG4 A;  2X10 A;  2C26 A;  3I97 A;  2QBX A;  2WBK A;  3ETP A;  4JHZ A;  3A7Q A;  1T2X A;  1SDD B;  4JKK A;  2C9K A;  3SKJ E;  2VZQ A;  4GZ9 A;  3III A;  1D7P M;  4W8J A;  5G04 L;  2J1T A;  3CZJ A;  2YC4 A;  1PMH X;  1PX3 A;  2V5D A;  1UYX A;  3ACG A;  3DYO A;  4P00 B;  3VDA A;  4A6O A;  3GM8 A;  1RYY A;  4P5Y A;  3T2P A;  4E8D A;  2W87 A;  1JZ3 A;  2CDO A;  4CU7 A;  2Y6G A;  3IAP A;  5HXM A;  3WNP A;  3UNP A;  4W50 A;  4QX2 A;  2X05 A;  4DUX A;  1EUT A;  1JZ5 A;  3ZM8 A;  1XPW A;  3J7H A;  4KWU A;  4W4Z A;  3C7G A;  1W9S A;  2JE8 A;  4KI5 M;  3ACI A;  3GXU A;  3OEA A;  3K46 A;  2VMD A;  5EJZ B;  4HG6 B;  1R64 A;  2BGO A;  1UY3 A;  1CZT A;  3DEC A;  1K42 A;  2L9L A;  1JZ6 A;  4MGS A;  4P08 A;  4AAX A;  1JYW A;  4M4P A;  2R7E B;  4A45 A;  1L7Q A;  3OBA A;  3MBW A;  2Y6H A;  4QB6 A;  3PUH A;  5JXG A;  2VJX A;  2B9V A;  4OMC A;  3WF0 A;  4CUB A;  3THC A;  2X09 A;  1CIY A;  4XUN A;  1PX4 A;  2QQN A;  2XQX A;  1W99 A;  1MPX A;  3E1F 1;  1NKG A;  4QB1 A;  3VD4 A;  3LE0 A;  1GOH A;  5DPN A;  3WF4 A;  4ZZ5 A;  2VC9 A;  1W9W A;  3CDZ B;  4XVH A;  3HNM A;  2WN2 A;  3I3B A;  1NX9 A;  3VDC A;  1J83 A;  4TXW A;  4CU6 A;  3WQB A;  2VZV A;  2HLE A;  2W5F A;  3T2O A;  5DQ0 A;  2QQJ A;  4PQQ A;  3ABZ A;  4ET7 A;  4CVU A;  4UOJ A;  1GNY A;  2VQU A;  3C8X A;  2VZO A;  2XHN A;  2YG0 A;  5C71 A;  5I0D A;  1OF3 A;  3NQH A;  4BXS V;  2E32 A;  2VTF A;  3ACF A;  3C7O A;  2DDU A;  5IFP A;  2E33 A;  2VZP A;  2WO3 A;  2WQ8 A;  3K75 B;  5F7U A;  4XZU G;  1GQP A;  3SEP A;  3OG2 A;  1I5P A;  2W47 A;  3W5N A;  4DXS A;  5LA0 A;  2BER A;  2WO2 A;  1JZ4 A;  2JKX A;  3GDB A;  4JKL A;  3NNG A;  1W9T A;  2W1U A;  4JX0 A;  4DEQ A;  3OEB A;  1L7R A;  1J84 A;  2ZXQ A;  2C4X A;  2ZEX A;  1JU3 A;  1ULP A;  3IAQ A;  2Z4F A;  2WN3 A;  2QQL A;  2W95 A;  3FHQ A;  4OMD A;  4A3Z A;  3WNN A;  2W46 A;  4FI9 A;  1H6X A;  3MUY 1;  2EIC A;  3AC0 A;  4MAD A;  2WAA A;  1GU3 A;  3HOB A;  3CZU A;  3HJR A;  3I3E A;  3A21 A;  3K4D A;  4XUR A;  1UMI A;  5IYY A;  3MV0 1;  4YPJ A;  1EUU A;  4LHS A;  1K45 A;  4DEV A;  3WNO A;  5DN2 A;  4CU9 A;  4TTG A;  4A41 A;  2RVA A;  5LA1 A;  2CDP A;  3HEI A;  4BK5 A;  3K77 A;  2J1V A;  3F2Z A;  3I2H A;  3VD7 A;  1UYZ A;  5JXI A;  2VR4 A;  1UX7 A;  1O8P A;  3P1I A;  3HPN A;  3WEZ A;  3T0A A;  2WYS A;  4XUP A;  3I2J A;  3DYP A;  3HN3 A;  4MGQ A;  2VZ3 A;  1GOG A;  4RYD A;  2WZ8 A;  3T08 A;  1TVG A;  2EID A;  1KGY A;  3A23 A;  2YB7 A;  2DCJ A;  4XUT A;  4XUQ A;  3DYM A;  2VCC A;  2E31 A;  5A1A A;  3CQO A;  5JUV A;  2W1W A;  3P6B A;  4JKM A;  1W8O A;  3T09 A;  3WSO A;  3NJV A;  4QX1 A;  3ACH A;  1OH4 A;  3NJX A;  3CKH A;  4LKS A;  5JXH A;  1JYV A;  2J1E A;  2VMC A;  4DXR A;  4ZXE A;  1UWW A;  5CZK A;  2XOM A;  1HN1 A;  3FL7 A;  4QX0 A;  3I2G A;  3VDB A;  2J22 A;  4D8M A;  5B4N A;  3IB3 A;  2V4V A;  1UZ0 A;  2ZEW A;  3MV1 1;  2WAB A;  4KMQ A;  2ID4 A;  4ZY9 A;  2VZR A;  4PT6 A;  3I3D A;  5IHR A;  4QX3 A;  1PMJ X;  3C7H A;  2KD7 A;  2J7M A;  2RV9 A;  2Y6L A;  1GOF A;  1WKY A;  2YFZ A;  3HNB M;  4MOA A;  1XNA A;  2Y6K A;  5J1X A;  3LEG A;  3C7F A;  2WO1 A;  5CYY A;  1DLC A;  1JYX A;  2W1Q A;  4UI9 L;  1DYO A;  1OF4 A;  5IFT A;  1JU4 A;  3PUI A;  3NRU A;  2PQS A;  5EIY B;  3UES A;  3D3A A;  5IJR A;  3JXS A;  3OGR A;  3T0D A;  1CZV A;  4XUO A;  2VM9 A;  1US2 A;  3WNL A;  4LQR A;  4QDR A;  3T0B A;  4CUA A;  1LNS A;  2E26 A;  1XNT A;  4P02 B;  3VD5 A;  2QQM A;  3VD9 A;  2B4K A;  2W91 A;  3I2F A;  1H6Y A;  1O8S A;  4GWI A;  4OUE A;  4BJ0 A;  4BK4 A;  3EYP A;  2V72 A;  1ULO A;  5C70 A;  2JD9 A;  3HNY M;  1JZ8 A;  3C7E A;  1SG3 A;  3T2Q A;  3OGV A;  3LEI A;  4CUC A;  2VO5 A;  4M4R A;  3FN9 A;  5FUI A;  2EIE A;  3EB7 A;  4QPW A;  2LW8 A;  4A4A A;  1CX1 A;  2ORX A;  1W0N A;  5LA2 A;  3WF2 A;  4QDS A;  3WF3 A;  4Z2A A;  2VMF A;  3I2I A;  1K3I A;  1US3 A;  4A44 A;  2BZD A;  2W92 A;  1K12 A;  2W3J A;  5EJ1 B;  2VCA A;  3LQC A;  2HYX A;  1JZ2 A;  4DXT A;  3IDA A;  1UXX X;  1NUK A;  3W5M A;  3I2K A;  4DUV A;  2Y64 A;  2J1A A;  5JXJ A;  1YQ2 A;  2YFU A;  3A22 A;  3UET A;  2EIB A;  2VZ1 A;  4MO3 M;  2XON A;  3CIH A;  2WZE A;  4PF1 A;  2ORZ A;  4GWJ A;  2QQI A;  3K4A A;  2VQT A;  2W1S A;  4QDQ A;  3U37 A;  3FHA A;  1F4H A;  5HPO A;  2QQK A;  1CZS A;  4DUW A;  2J1U A;  2VME A;  4OZO A;  5LCW L;  1GUI A;  1NAE A;  1UY2 A;  2VCB A;  1JHJ A;  2VZS A;  1IQD C;  2QQO A;  2VZT A;  2DCK A;  3LPF A;  1UMH A;  2RJ2 A;  4D0Q A;  3WNM A;  1UY0 A;  1P8J A;  1OD3 A;  1OT5 A;  3WNK A;  1SHW B;  5C7G A;  3MO4 A;  3SKV A;  2W94 A;  3ECQ A;  4A42 A;  4LPL A;  4ZZ8 A;  4CU8 A;  1F4A A;  2WAO A;  2VOT A;  4BDV B;  1JYN A;  4L0P A;  4QB2 A;  4ARY A;  1KEX A;  4UAP A;  2LS6 A;  5JR2 A;  1TG7 A;  3LPG A;  3SEE A;  3MUZ 1;  2OKX A;  2J1R A;  4RN5 A;  2Y8K A;  1W8N A; 
#chains in the Genus database with same CATH topology
 3AZZ A;  2ZGO A;  3KVB A;  1UY4 A;  3ZFG C;  4MX3 A;  3JU9 A;  2HBU A;  2PYT A;  4Y5T A;  3DCQ A;  3THD A;  2WUH A;  2VNG A;  4D7T A;  2ZMK A;  1K5M A;  4Q8L A;  3ZDV A;  4JTN A;  3H1W A;  3ZYI B;  3TNQ A;  2VCM A;  3OPW A;  5KXB A;  1SPP B;  1GMM A;  4A3X A;  2ZJC A;  4H3W A;  3M3O A;  4QQH A;  3SIT A;  3HVD A;  5F6K A;  3I7D A;  4XAC A;  5FKB A;  5GLW A;  5LWB A;  4CCL A;  2CV6 A;  5KHJ A;  4AK3 A;  4IEX A;  2NZ9 A;  1VRH 3;  2VU9 A;  3AZY A;  5AFB A;  3O1S A;  3K4Z A;  3OCP A;  1POV 3;  4YVW C;  1A8D A;  4OHV A;  5DUU A;  3ZYG A;  2IXC A;  1BHG A;  1ZBE 1;  5HV0 A;  4IE7 A;  5H9R A;  1XC6 A;  3SNM A;  5DMY A;  4P5H A;  4XJW A;  1J3P A;  3PUQ A;  4EWA A;  3ILR A;  3ZKU A;  4XAB A;  5CFC B;  3ELN A;  3POF A;  3R4D B;  2X10 A;  1QQP 3;  1NLQ A;  1QJY 2;  3MPP G;  1VBE 1;  3FJS A;  3RMY A;  1RIR A;  2FHR A;  1QOO A;  2P4E A;  1A78 A;  2OYZ A;  2IXL A;  3VLB B;  1T2X A;  5CBL A;  2XUE A;  1GQG A;  3SKJ E;  4IGO A;  5C9A B;  1S0D A;  4FQ4 A;  4PI2 A;  1L3J A;  3CZJ A;  2YC4 A;  3ACL A;  2XHK A;  4N9I A;  1OFS A;  1PX3 A;  4P00 B;  2D6P A;  4YZ1 A;  5FZB A;  1WLC A;  2GC0 A;  1HRI 1;  3BPS A;  1JZ3 A;  4CU7 A;  1MVQ A;  1H2M A;  2R06 2;  3ZXG A;  2Y6G A;  1URX A;  2JG9 C;  4B4P A;  4JGZ A;  3TAY A;  2P5B A;  5FPU A;  2HWB 2;  1B35 B;  1QJZ A;  5I0S A;  3CHX A;  2BOJ A;  2CHH A;  2HWE 2;  3TB0 A;  4EYU A;  1FAY A;  3ZM8 A;  3WVJ A;  4XQD A;  5CU1 A;  4C8D A;  4KWU A;  5JWP A;  1D0H A;  5F9T A;  1CWP A;  1W9S A;  3K48 A;  4OHX A;  1BK0 A;  1OLR A;  4KI5 M;  3UGF A;  5C9A A;  3TEX A;  1ZRD A;  4FTB A;  1OXC A;  4OUL A;  5B2G B;  3GXU A;  3K46 A;  4Q4W 3;  4HG6 B;  1RMU 2;  2VPV A;  2LRO A;  2WA3 A;  3FE5 A;  5IK4 A;  4LK7 A;  4LO7 A;  4P9X A;  3FZ3 A;  1JXN A;  1AX0 A;  1AYM 3;  2CY6 A;  4MGS A;  5I0R A;  4P9W A;  1G9B A;  2MEV 3;  3U4X A;  3CF6 E;  4YM2 A;  5IUQ A;  2CSG A;  1V00 A;  2JWP A;  2GDF A;  3T3Y A;  1YFW A;  3RS6 A;  3VHN A;  4D7S A;  3PUH A;  3J7M A;  1DQ6 A;  1OVS A;  4XJU A;  4Q0U A;  3H9A A;  1VAM A;  1S0B A;  2VOV A;  2NM1 A;  3ZO0 B;  4CUB A;  3E6B A;  3CBN A;  1TMF 2;  3GNE A;  2MPF A;  4WM8 C;  4NPM A;  4XUN A;  5FRA A;  1PX4 A;  5FZ8 A;  3WDV A;  4EN6 B;  1W99 A;  3POI A;  1MPX A;  4QQO A;  1J1T A;  1MZ5 A;  5JVV A;  5FUP A;  5T5P A;  1HB3 A;  4JDN A;  4RQP A;  2R0H A;  4CEW C;  4GQ7 A;  2XJU A;  2VC9 A;  1PIV 1;  1ENS A;  2RR1 2;  3CDZ B;  3L9J T;  1Q3E A;  4LXL A;  3H1M A;  3S5Q A;  1KS4 A;  4MXV A;  2D93 A;  4HAN A;  1O4T A;  3WP4 A;  5DUW A;  1DYK A;  4XW3 A;  2E7T A;  1YI9 A;  2RS3 2;  4KH9 A;  4PI0 A;  5E88 A;  3ZXK A;  1VMH A;  4UFM A;  4XCA A;  1PO1 2;  2QQJ A;  1W04 A;  4QU1 A;  3BI3 A;  1GNY A;  2VQU A;  4MYE A;  2ZAC A;  1NY7 2;  3C8X A;  2ADD A;  3VBU C;  2XHN A;  2YG0 A;  4D6Q A;  4DS0 A;  4QHB A;  2VD7 A;  5FZ6 A;  2PTM A;  3TEZ A;  1V9U 2;  2TUN A;  3ACF A;  3QD6 A;  4LUK A;  1SQ4 A;  1VBC 1;  3BPZ A;  2BNO A;  1N47 A;  1GQP A;  1UW8 A;  1HRI 2;  1AR8 1;  1SZB A;  3NV4 A;  5FUN A;  2K0G A;  4I3G A;  3R4U A;  5A3W A;  4BQ5 A;  3CU7 A;  5JZG B;  4DXS A;  1AYN 1;  1UNB A;  2ZHN A;  4QGN A;  1H1A A;  1T6B X;  3TYJ A;  2JKX A;  4GB3 3;  1YIF A;  2P6H A;  5D21 A;  2LUW A;  1MS8 A;  3NNG A;  1R1A 3;  5EZW A;  5FPZ A;  1WW7 A;  1RUG 2;  1W9T A;  2R07 2;  3ORJ A;  4Z1V A;  5TSW A;  5BYN A;  3BOW A;  2W1U A;  4JX0 A;  4RGG A;  1GZ9 A;  4P9I A;  4GJZ A;  3OEB A;  1L7R A;  3EJK A;  1Q8S A;  4TSV A;  1W6N A;  3SCF A;  3WQ7 A;  3DV8 A;  2WYF A;  3VKF C;  3NAP B;  5HCF A;  1AL2 2;  2XQR A;  2ZEX A;  2PHT A;  3LCP A;  1F31 A;  2OXB A;  3NW4 A;  2YC0 A;  3RDI A;  1CD3 G;  1VAK A;  2FCV A;  3MIH A;  4OMD A;  4Y3O A;  4AEJ A;  2FDH A;  3ZFE A;  2BGC A;  1YHF A;  1CAV B;  1WME A;  5F2W A;  2V4A A;  5C3P A;  4LT5 A;  2JDU A;  4PIX A;  1IQA A;  4YZ3 A;  1S4C A;  2EIC A;  4FPO B;  4HK9 A;  2NPI A;  2WAA A;  4MAD A;  5J98 B;  3WG1 A;  3HOB A;  3MIB A;  2WQ4 A;  4Z82 A;  3B94 A;  3H8U A;  1VBB 3;  4YW5 A;  1AR6 3;  3K4D A;  4FPL A;  3POW A;  4S2F A;  5KWR A;  5FV3 A;  4R52 A;  1UMI A;  2N7G A;  5T55 A;  2HH9 A;  2IFW A;  1K5M B;  3H42 B;  1IG0 A;  3B01 A;  3DKW A;  3T4V A;  3IPV B;  2R6Q A;  2WFF 3;  4LA3 A;  2W68 A;  2JDK A;  2RVA A;  3R6S A;  3AZX A;  2R1D A;  3FMG A;  1W8F A;  4BK5 A;  2VH9 A;  5FY1 A;  1S2E A;  5FZM A;  2ZML A;  1QF3 A;  5E8A A;  5GLV A;  5IVC A;  1QJU 1;  1UYZ A;  1VRH 1;  1MZE A;  3NWK A;  3B7M A;  3VD7 A;  5IAX A;  3PUA A;  1UX7 A;  1O4Y A;  3P1I A;  4BCU A;  2X5I C;  5FOB B;  1W2O A;  3HPN A;  1ZBE 3;  1XRU A;  3JQX A;  1JOD A;  1IG3 A;  4HVQ A;  5FPX A;  2P6C A;  1H9W A;  1TME 1;  5EV7 A;  3T0A A;  5BNP B;  3ZSL A;  1Y7B A;  2YMZ A;  5AC9 3;  3RPQ A;  1QGL A;  1XNB A;  4Y24 A;  1TEI A;  2A70 A;  1YLL A;  4CP0 A;  1FI2 A;  3O12 A;  4RYD A;  5FZI A;  2WZ8 A;  2BFU S;  5FYV A;  5LBB A;  1Q8Q A;  4N43 B;  1KGY A;  2PLV 1;  5F39 A;  3ZIX A;  3OOX A;  1RIT A;  2DYC A;  5GLT A;  4AVS A;  3VV1 A;  2GME A;  3PVN A;  2IVI B;  4XUT A;  4J1W A;  4K7J A;  2AEZ A;  1RMU 3;  5C4W B;  3H8O A;  2XR4 A;  1LRH A;  3PJY A;  5FZ7 A;  5CAD A;  2VCC A;  3O1R A;  3KB5 A;  4GB3 2;  4HVR A;  1KJR A;  2W1W A;  5BPX A;  3USU A;  1SBD A;  3IKW A;  5DAX A;  5L36 A;  4QX1 A;  5DDJ 1;  3Q8F A;  4YVW A;  4OHZ A;  4M3C B;  3PTY A;  1PNG A;  3NNL A;  2Y60 A;  3NJX A;  4XQW A;  3OUH A;  4QMA A;  1SCR A;  1LHU A;  1B35 C;  2VMC A;  4YSF A;  4ZXE A;  4YW6 A;  4C0B A;  1LOF A;  4GMP 0;  2RDS A;  1UWW A;  3RZM A;  5CZK A;  2XOM A;  5FZE A;  1BVV A;  1ZA4 A;  1F5F A;  3K2O A;  2XG3 A;  5K4L A;  3QH7 A;  3SMH A;  3UJQ A;  4CDU A;  1HRV 1;  1QHD A;  3I2G A;  3VN4 A;  3JB4 C;  2JDP A;  2UY9 A;  4D8M A;  2P3I A;  4MLO A;  1UN1 A;  5IVE A;  4OFG A;  3MV1 1;  4BIO A;  2VVE A;  4NAM A;  1W6P B;  1A34 A;  3KHC A;  5FTT C;  5FLJ A;  1NA1 C;  3I3D A;  4Q1P A;  1W6M B;  5IHR A;  5JAX A;  2WR9 A;  1UZZ A;  4P9Y A;  4HPK A;  2RM2 3;  3Q8B A;  4C90 A;  4LBQ B;  3PUS A;  4W65 A;  5A6Q A;  3ZSE A;  1GWK A;  4D69 A;  2FMY A;  2Q4S A;  3VBH C;  3HNB M;  4Y22 A;  5GZF A;  1KFU L;  2Y6K A;  3LEG A;  2OQ7 A;  4DO0 A;  2PFW A;  2DBN A;  2WO1 A;  3UGG A;  2PHU A;  3HD8 B;  4S2H A;  2BOI A;  3P3P A;  4UI9 L;  4X8N A;  4WVM A;  5C3S A;  2RJK A;  1RVF 1;  1JU4 A;  2P34 A;  3PUI A;  4HLT A;  1OHF A;  4DIN B;  4LBO A;  1SLI A;  4IE6 A;  2FQP A;  3PVO A;  3ZMO A;  3VDD B;  2DWR A;  3F95 A;  4W6W A;  5K9Y A;  3VKM A;  5IWF A;  2ZCW A;  1IS4 A;  1WLT A;  3T0D A;  5EP9 A;  1WGP A;  1CN1 A;  2V73 A;  2VM9 A;  3HBZ A;  4DRV A;  4RS5 B;  1LKN A;  4AI0 A;  4QDR A;  1CAU B;  4YW4 A;  1GZT A;  3ES1 A;  1MS0 A;  3VKL A;  5JSP A;  2CTV A;  1KRI A;  1W90 A;  4Q2F A;  1LNS A;  2E26 A;  3T4H B;  2HYK A;  1R08 3;  3VBO A;  1UCX A;  3BIW E;  5CEH A;  5CIR A;  4EN0 A;  4LBQ A;  4OUE A;  5FZG A;  1QDC A;  4GWI A;  5HCH A;  1Z7S 3;  2XBO 1;  4YVS C;  4Y1X A;  3VZM A;  4UFL A;  3A0N A;  4LKD A;  4O65 A;  1WWY A;  2UYB A;  4QPY A;  3RG0 A;  2GAL A;  2JIC A;  2K9Z A;  3OUI A;  1SG3 A;  3OGG A;  3U4S A;  5SV8 A;  4AL9 A;  1N1T A;  3O0W A;  4ZXK A;  2C24 A;  2OVU A;  3WZ1 A;  3EB7 A;  4LKF A;  4CEY A;  1V6M A;  4P9L A;  1JYT A;  1DF0 A;  2TNF A;  2WWS A;  4IEY A;  4E4H A;  1IS3 A;  2C1F A;  1W0N A;  2ORX A;  2PHF A;  2C9A A;  2YU1 A;  1O4Z A;  3R05 A;  4UT5 A;  4OVE A;  4Z2A A;  3S57 A;  3JQW A;  3I2I A;  3KD4 A;  1HRV 2;  3M3I A;  1RUJ 3;  2W92 A;  5ISL A;  2XLA A;  2ZBJ A;  1T6G C;  2W3J A;  1HB4 A;  4QPG C;  2BYV E;  4X8P A;  3THT A;  4AR2 A;  2RS5 2;  2P17 A;  2VNV A;  4FPK A;  4ASK A;  2RR1 3;  5L9R A;  3IDA A;  1AR9 2;  1VBC 2;  2G4I A;  4DNY A;  4E9K A;  5FZ0 A;  4BM8 A;  1N1S A;  3I2K A;  3ST7 A;  3ON7 A;  3C3V A;  1OQE A;  5JXJ A;  4Q1R A;  2KM2 A;  2YFU A;  2HWC 1;  1AR6 1;  1LHV A;  4CCK A;  3VL9 A;  4IV3 B;  4YVS A;  5KXC A;  1W3V A;  1DBN A;  5FYT A;  4L92 A;  1EPZ A;  1WBL A;  3WDY A;  3ZYJ B;  2Q5T A;  2VUC A;  3R4S A;  4XPV A;  1SEF A;  1K5M C;  3AB0 A;  1ASJ 2;  2VQ0 A;  3PHM A;  4BQY A;  3MF6 A;  1NCR A;  1QXJ A;  2W1S A;  1X8M A;  4XDO A;  3RI9 A;  1ZZB A;  2HWB 3;  1WMD A;  2JEC A;  1JOJ A;  2VXJ A;  4QDQ A;  2YY1 A;  2YDE A;  3LEM A;  3U1X A;  3U37 A;  1VIW B;  3FHA A;  1DZQ A;  1F4H A;  5FO9 B;  1SPP A;  5FYB A;  3PIG A;  5HPO A;  4WVM B;  2WC2 A;  4FXK B;  2A6V A;  3QCW A;  4WVV A;  1YEW A;  1DQ4 A;  1QJE A;  1QWR A;  2YHJ A;  2J1U A;  4KWK A;  4B4Q A;  4YZ5 A;  2XML A;  3QOP A;  1GUI A;  1WBF A;  1WCD J;  3LWC A;  1PNF A;  2X5I B;  1O3R A;  4CDQ C;  2VZS A;  4K1Y A;  5EHD A;  2QQO A;  5A70 A;  4KG8 A;  1ZZ6 A;  2DCK A;  1UMH A;  3MZH A;  1GFF 2;  1IOA A;  2XJV A;  2VBB A;  4C1X A;  5BNP C;  3WP6 A;  4AE2 A;  1ULF A;  5GZG A;  3WNM A;  5J3U A;  1E5I A;  3I54 A;  1KS5 A;  1LOD A;  1PO2 3;  4ATF A;  1SLA A;  5JSO A;  1D0G A;  2KR2 A;  2D44 A;  1OT5 A;  2GP3 A;  2JG9 B;  3WNK A;  4LIT A;  1MS4 A;  1NLR A;  3FLP A;  3MDP A;  3RWN A;  4FPH A;  4AFM A;  1SHW B;  5C7G A;  3MO4 A;  3AX4 A;  3ECQ A;  3POJ A;  3VZJ A;  1W2T A;  3UKV A;  4KL1 A;  2WZP P;  3OBT A;  4LPL A;  3IMN A;  2WZR 2;  1IKP A;  1CAV A;  2Y33 A;  1PZ8 A;  3ZFE B;  2WS9 1;  5L9B A;  3FWE A;  4QB2 A;  2JDZ A;  4AI9 A;  3ITQ A;  2PA7 A;  2ZZQ A;  3V65 A;  1NXD 1;  1NZC A;  1UU4 A;  1JUH A;  1YQ8 A;  1YQC A;  1TG7 A;  3AJY A;  4LUL A;  3ZX7 A;  5FWE A;  3PJQ A;  4UWD A;  1JTZ X;  4M3C F;  2BW8 A;  2MEV 1;  5LY1 A;  5F1R A;  2OQ6 A;  2P1B A;  4LOS A;  3FUO A;  1KDM A;  1QOT A;  2E7Q A;  3ZYP A;  5A3T A;  1N3Q A;  4Q5O A;  3K3O A;  5EJ3 A;  3USU B;  4FOY A;  4GKX A;  5LB6 A;  4JGY A;  4LO4 B;  3UYJ A;  4WV8 A;  2BGP A;  1BMV 2;  1SFY A;  3W20 A;  4AVV A;  1EAH 3;  4LA2 A;  5B4X A;  2YC2 A;  1BBT 1;  1JI6 A;  3H50 A;  3O0V A;  5FYC A;  3EBR A;  4XFC A;  4AHW A;  5GLU A;  2WWU A;  1NZI A;  4YG3 A;  5CKM A;  1RB8 G;  1H8T C;  1LHO A;  1DQ5 A;  1NA1 B;  2WDB A;  3ZXL A;  2JD4 A;  3FLT A;  5LK7 B;  3N9N A;  3U14 A;  4NIG A;  4LUM A;  3BN6 A;  3LEK A;  2SLI A;  4FPJ A;  2JE9 A;  1MZ6 A;  3GBF A;  4QAW A;  4L11 A;  4CYD A;  2WQZ C;  4CEW B;  3GCX A;  1AR7 2;  3OGS A;  4YZ4 A;  1OI6 A;  3VBH B;  4J25 A;  4LBM A;  4SBV A;  5T52 A;  2VZU A;  4YLZ A;  3BGA A;  5GM0 A;  3RYR A;  2EXI A;  1OOP C;  3VD3 A;  3WF1 A;  1SFP A;  3B9I A;  2WII B;  3K51 A;  1TMF 3;  3KGZ A;  1ND2 A;  2ARE A;  2JDA A;  3NJZ A;  1RVF 2;  1E5R A;  2W2I A;  3OJB A;  1QH6 A;  2C26 A;  5HXV A;  2PHW A;  1E57 A;  1Y9M A;  3IDB B;  3LFI A;  4UW3 A;  4J6G A;  2DV9 A;  4Z92 B;  1UOF A;  4QPG A;  5FP4 A;  4A2U A;  2X53 S;  4IE5 A;  2C9K A;  4TWT A;  3B69 A;  3RI8 A;  3WW2 A;  4AXO A;  3VBU B;  1AR9 3;  2BUK A;  3III A;  1BKZ A;  2WJS A;  3J8F 3;  4W8J A;  3VDD C;  1VMF A;  2J1T A;  1DIW A;  4LEJ A;  4B4R A;  4A6O A;  4R9D A;  2G9F A;  2HKX A;  1R09 3;  2CDO A;  2ZGR A;  3KCX A;  4CCD A;  3MIC A;  3OBR A;  2JIG A;  2QZ3 A;  4RS5 C;  1S0F A;  1RUD 1;  1IS5 A;  5HXM A;  1HB1 A;  4K6B A;  4YW3 A;  1CIW A;  3BVC A;  4GUL A;  2D98 A;  5FQ0 B;  3WQ1 A;  5FP8 A;  4CP9 B;  4EZ4 A;  3AKT A;  4WM7 A;  1OKQ A;  1VBA 2;  2W0X A;  4IE4 A;  4W4Z A;  3RYP A;  4V2V A;  1M06 G;  3VBU A;  2G1M A;  4YVS B;  3ACI A;  4NAO A;  1YFY A;  3O1M A;  2TBV A;  3NAP A;  2ZGT A;  5EJZ B;  3NMB A;  4HXC A;  1C8M 1;  2VVD A;  4Q4Y 2;  1FOD 2;  3D4K A;  1UY3 A;  3MI8 A;  4URA A;  5SV5 A;  1CZT A;  2JDH A;  4DFS A;  1XB9 A;  5J36 A;  1HB2 A;  4BIF A;  1JZ6 A;  3TWI A;  2XL7 A;  4QM9 A;  4Z8B A;  1W2A X;  4I0B A;  1Z7S 2;  2C5D A;  1C57 A;  1S2B A;  1HX6 A;  4X6R B;  1JYW A;  3BU7 A;  3WDT A;  1W6M A;  3WCS A;  1FPN 2;  5JZG A;  2R7E B;  4A45 A;  1DGW A;  5FZF A;  4QQL A;  1LOB A;  2ZGM A;  1J58 A;  1H0B A;  2Q30 A;  2Y34 A;  4FFI A;  2NQY A;  2VJX A;  5F3G A;  5KHK A;  2XLG A;  4V2W A;  4OMC A;  4RGK A;  4BHP A;  3WF0 A;  1WMF A;  3THC A;  3UKN A;  1W8H A;  4DXZ A;  1KXG A;  1V0A A;  1CIY A;  1W05 A;  3PU8 A;  4YW2 A;  4GXL A;  4AVA A;  1W0O A;  2Q1F A;  4F8A A;  2RMU 2;  1IS6 A;  3E1F 1;  1RUI 1;  4QB1 A;  2NMN A;  3LE0 A;  4ZZ5 A;  1RJ8 A;  2R16 A;  3M2M A;  4OUS A;  4XF0 A;  1W9W A;  4QKN A;  1QJX 3;  4IV3 C;  2D5F A;  1S0G A;  2WNE A;  2E6V A;  2WN2 A;  3AMQ A;  1W0P A;  2ZMN A;  3U11 A;  2Q1M A;  3GJB A;  3VL8 A;  2WNU B;  1OQ1 A;  3TNP B;  4DIQ A;  4CU6 A;  4DY5 A;  2W5F A;  1PGL 2;  3T2O A;  2QDR A;  2HJI A;  1DZR A;  4NID A;  4PQQ A;  2WZR 1;  1OA3 A;  2IUW A;  3ABZ A;  3GF6 A;  1EV1 2;  2ZX4 A;  3MLJ A;  3O14 A;  4UOJ A;  3EHK A;  4NMI A;  1PHM A;  5FMO S;  1D4V B;  3TEY A;  2OX0 A;  4N8M A;  1BZW A;  1XOY A;  2A6W A;  2B9U A;  2QNK A;  2DU0 A;  1RMU 1;  4FOQ A;  1RJ7 A;  1I5Z A;  2VTF A;  3BOD A;  3KT1 A;  3C7O A;  2DDU A;  5LAT A;  2DFB A;  4CDW B;  1WA6 X;  1RED A;  3VZO A;  3K75 B;  5C3R A;  2DVF A;  3KM5 A;  1WUV A;  1U5I A;  5C4W C;  1CQ9 A;  4BME A;  2XWB B;  3JD7 2;  1VBD 1;  4QQP A;  1SBF A;  5E16 A;  2VW0 A;  4G9S B;  2AAC A;  5C8C C;  2ARB A;  3RZZ A;  2W47 A;  3ZXJ A;  1MAC A;  2QFE A;  3W5N A;  2JEM A;  5FBJ A;  3WCR A;  5LA0 A;  4BLI A;  1DZT A;  5J7M A;  3HN1 A;  2HWE 1;  4PCR A;  4HBN A;  4QPI B;  1JZ4 A;  5FMB A;  1VMJ A;  1NT0 A;  1AR8 3;  1Y4W A;  3U78 A;  3GDB A;  3MFA A;  4D94 A;  1KIT A;  2IXJ A;  3HAG A;  4JKL A;  3I3Q A;  3HQX A;  3WIN E;  3E5Q A;  4R8H A;  3A0K A;  4NPR A;  4DEQ A;  2UYA A;  2VUA A;  3H0O A;  4Y33 A;  1J84 A;  3AZW A;  5H9P A;  3GHM A;  4IEU A;  5FPL A;  4CCE A;  1AHS A;  1HXS 1;  1I3H A;  2G19 A;  2C4X A;  1JU3 A;  4FT8 A;  1ULP A;  4FPC A;  1GQH A;  5FIX A;  3ZFE C;  2QQL A;  2A6Y A;  2OUH A;  2VEC A;  3RMX A;  2RS3 1;  3JCI A;  4NHM A;  5A7W A;  4A3Z A;  5L7O A;  5A7N A;  3H3Z A;  1JYI A;  3WNN A;  1LGN A;  1B35 A;  5A3L A;  2NP0 A;  3VHR A;  5C3O A;  1H6X A;  3MUY 1;  3WQ0 A;  1ZZ7 A;  5A7S A;  2OS2 A;  5AFE A;  1GU3 A;  2RS1 3;  3KS7 A;  2A6X A;  2WIN B;  4AHY A;  2C6S A;  2VW1 A;  3HJR A;  3V64 A;  3MLK A;  3POB A;  4LLO A;  5APA A;  3H3L A;  5HV4 A;  4IV3 A;  1BBT 3;  3MGU A;  1WZX A;  1EUU A;  1K45 A;  2Z5W A;  4DEV A;  5FP7 A;  4KQ7 A;  1DQ0 A;  5BUV A;  5JMC A;  3WG2 A;  3KCY A;  2TEP A;  5LA1 A;  4ZON A;  1XXN A;  2CDP A;  1RC6 A;  1W03 A;  3UK9 A;  1NQJ A;  3WX5 A;  1H8T B;  1ST8 A;  4F3J A;  2VOX A;  3F2Z A;  3VGI A;  3I2H A;  3MW2 A;  1YQ5 A;  2VVF A;  5JXI A;  1AR7 1;  2K46 A;  2VR4 A;  2EIG A;  4OHW A;  4WZF A;  3W58 A;  5JOZ A;  3WG3 A;  1C1F A;  5D2A A;  1C5H A;  2DCY A;  3T1M A;  3WEZ A;  1COV 1;  2BU9 A;  2XWJ B;  3S7I A;  3AMP A;  3EMR A;  3MHZ A;  3SIS A;  5CVR A;  5JLV A;  5KBF A;  1QQP 1;  1HQL A;  3WG4 A;  4F83 A;  4MHU A;  4XUP A;  4KBB A;  2XB6 C;  1CES A;  1SFN A;  3I2J A;  1CX4 A;  1OOP B;  3HT1 A;  3DYP A;  1IPS A;  2GC3 A;  2ZX1 A;  3AYE A;  1RUG 1;  2R07 1;  1GOG A;  4QXC A;  4B3N A;  2JB4 A;  1VBB 2;  3IN9 A;  1QEX A;  4AQT A;  3J9S A;  2WNV B;  5A7Q A;  5IAT A;  2D3P A;  1RUF 2;  3BOP A;  5AC9 1;  3V0B B;  1LOG A;  4I30 A;  2E63 A;  1W6Q B;  4XUQ A;  2JG9 A;  1HRI 3;  4GKY A;  3N9L A;  3WDW A;  4O9G A;  1YFX A;  3LFM A;  5D8A B;  5JUV A;  3KLS A;  5J09 A;  5J96 B;  3AMN A;  4Z2W A;  4XFF A;  2DFC A;  3S5A A;  3P6B A;  5IK5 A;  4JKM A;  4PDW A;  2SBA A;  3N9M A;  2G9G A;  1N1V A;  1OUS A;  1EY2 A;  1GIC A;  3NJV A;  2ENR A;  4Z07 A;  1BEV 2;  4H14 A;  1MQT B;  5JR7 B;  5JI7 A;  3RSJ A;  5JSR A;  3O7O A;  4MH0 E;  4XC9 A;  2F6B A;  2J1E A;  3POY A;  2HWF 3;  3LA3 A;  1YUD A;  4Q0Q A;  1RUJ 1;  1XBF A;  4JQT A;  2Z69 A;  2RHP A;  2FCU A;  2PMW B;  4L99 A;  4F7Z A;  2J22 A;  3LIG A;  1AYM 1;  5B4N A;  5JOX A;  1UZ0 A;  3JBG 2;  3AP7 A;  2WAB A;  2XDV A;  4KMQ A;  3WP3 A;  4I2O A;  4ZU5 A;  2RR1 1;  2VZR A;  4XHB A;  1HRV 3;  2VMG A;  5KXE A;  3OY8 B;  5FPB A;  1ZA7 A;  1H1M A;  3OD4 A;  3PU3 A;  3NJY A;  3ZIW A;  2JX9 A;  1S0J A;  3DUI A;  2ZAB A;  1PMJ X;  1RHI 3;  3DGT A;  2XJQ A;  3VHO A;  2YGL A;  2ZHM A;  4NUB A;  3ZMN A;  4BQ4 A;  2KD7 A;  3ILN A;  2RV9 A;  2JB8 A;  3NKG A;  1FMD 1;  3DN7 A;  4L9B A;  4B1M A;  4FAH A;  2WFF 2;  1UU6 A;  2XJR A;  4Q4W 2;  4HPK B;  4CPB A;  5GLZ A;  1HQN A;  3WT3 A;  1XYN A;  4YRD A;  4NN0 A;  1GZC A;  1RXF A;  1S2K A;  3C7F A;  4KU7 A;  1ENR A;  5FP9 A;  4A7K A;  2CGP A;  5CYY A;  2O0O A;  3ZOI A;  2W1Q A;  1JHN A;  1H8V A;  1FV3 A;  1L7L A;  1RUI 3;  2JXA A;  1LU1 A;  4NWV A;  1DYO A;  4S2G A;  5C8W A;  1MVE A;  5IFT A;  2GNT A;  3KCC A;  1F5J A;  1QJX 1;  2A3X A;  2WSU A;  2OII A;  5FXV A;  2UWC A;  4XHX A;  4RL7 A;  5EIY B;  4A7Z A;  4HK8 A;  3VBF C;  4XFG A;  1ODN A;  1QOS A;  4LLF A;  1TME 2;  4ASM B;  5A3N A;  1U5Z A;  1RVF 3;  2EXJ A;  4Y5S A;  1CZV A;  2A7A A;  2BRT A;  4YGB A;  3U75 A;  1ULC A;  4CDQ B;  3WNL A;  1SLC A;  4LQR A;  5F6L B;  1IHM A;  1HV1 A;  1FT9 A;  4OHY A;  2OW4 A;  3I49 A;  3T0B A;  4YM1 A;  3KV9 A;  1GBG A;  1XNT A;  3KMH A;  4P02 B;  3ZN4 A;  2QQM A;  2FDK A;  4OUM A;  3VD9 A;  4XET A;  5T5O A;  3E6C C;  3RGB A;  2RM2 2;  1UOJ A;  2W91 A;  4BJ0 A;  3EYP A;  4IE0 A;  2PXJ A;  2ZGU A;  1ULO A;  2P3J A;  2JD9 A;  1JBC A;  3HNY M;  1C4R A;  4CDW C;  1G6N A;  2ARX A;  2AC1 A;  3PVE A;  5A33 B;  3C2U A;  4JDO A;  4KU8 A;  2WS9 3;  1PO1 3;  3KZ4 C;  5FZH A;  5LY2 A;  2VO5 A;  1XQN A;  4R4Z A;  5FUI A;  4AHZ A;  3WV6 A;  4QPW A;  5FAX A;  3VDD A;  4LIU A;  2WO7 A;  1XE8 A;  2LW8 A;  3NL1 A;  4Q4Y 1;  4UW5 A;  3WF2 A;  5LA2 A;  4O9E A;  2BQP A;  3WF3 A;  1FYU A;  1ULE A;  4SLI A;  4AHX A;  4O61 A;  4A44 A;  2BZD A;  3IMM A;  1HXS 3;  3QH6 A;  4YFZ A;  2PHR A;  2GH8 A;  2QKD A;  4CP1 A;  1EAH 1;  1WCU A;  3LQC A;  4XIK A;  1CPN A;  4EQV A;  2VMH A;  1W6O A;  3OYW A;  4ZKT B;  4DXT A;  3HT2 A;  2B5H A;  1NUK A;  4RA0 A;  1ZM1 A;  2A3Y A;  2WFP A;  2RS1 1;  1W8U A;  3A22 A;  4XBL A;  2JG8 A;  2VZ1 A;  4JQR A;  4L8Q A;  5LBE A;  4MO3 M;  3U10 A;  2EF6 A;  5GKA C;  3S6P A;  1DU3 D;  3CLP A;  1RUI 2;  2A71 A;  3ZR6 A;  3R0R A;  1OFN A;  2WFF 1;  2XON A;  2ETE A;  3AP5 A;  3GHN A;  3RVH A;  3U07 A;  3ZXE A;  1H30 A;  1AL0 G;  4FPE A;  3AYA A;  4K9S A;  1UU5 A;  4GWJ A;  2WWJ A;  2QQI A;  4MGY E;  2HBT A;  2YGM A;  2R0F A;  4QX8 A;  1PVC 2;  3NKT A;  1WMX A;  5CG9 A;  1JUI A;  2XGX A;  2VW2 A;  2BDR A;  4YWA A;  1YC6 1;  3UGH A;  3FLR A;  1C5I A;  5A3O A;  3BTY A;  1FV2 A;  3AP9 A;  1TME 3;  1GYK A;  2IWG B;  4KG0 A;  4GAL A;  1COV 3;  5JOW A;  1ZRE A;  3TRS B;  2HWB 1;  5LCW L;  2QCS B;  4RSU A;  2ZKL A;  3LOB A;  2VCB A;  2XJT A;  2Q1Z B;  4AQS A;  5IVB A;  3LD8 A;  2BNN A;  3BU0 A;  4FTS A;  2VZT A;  3LPF A;  3ROU A;  5FZL A;  2F17 A;  5I8S A;  5CFD B;  2ZHL A;  5LBC A;  4N53 A;  2RJ2 A;  4D0Q A;  4NE9 A;  2YRO A;  1YIP A;  2OA2 A;  1YI7 A;  1D2Q A;  2XLF A;  3AKQ A;  4R9A A;  4UW6 A;  5EYY A;  3O1V A;  1OD3 A;  1ENQ A;  4Y20 A;  3SH3 A;  4Q4X 2;  5ANQ A;  3MW3 A;  4NO4 A;  5A80 A;  3SXW A;  2HWD 2;  4K8R B;  1PGW 2;  2WNV C;  5ABJ A;  4XFH A;  2FMD A;  3SKV A;  4A42 A;  1V6I A;  1G9D A;  1MS3 A;  4WM7 B;  2WA4 A;  1S55 A;  2XH6 A;  2UWA A;  3WNX A;  1CAX A;  4OCT A;  5D8A C;  4CU8 A;  5FXZ A;  2VOT A;  5DAV A;  2D7F A;  1JYN A;  4KBZ A;  4L0P A;  4AQ6 A;  1DG6 A;  3EO6 A;  2WT2 A;  3UV9 A;  3S0M A;  1FX5 A;  1KEX A;  3SQO A;  3M4F A;  2YPJ A;  1OH3 A;  1VBE 2;  2W08 A;  4UAP A;  4AEK A;  1G9C A;  4MHR A;  1UD1 A;  5BY5 A;  4IEW A;  4DZG A;  5ACA 1;  4HN0 A;  2UY8 A;  1OVP A;  2NLR A;  2XPJ A;  2CWM A;  3S7E A;  2J1R A;  2PAM A;  3BCW A;  5IT6 A;  3MFC A;  2Y8K A;  4HN1 A;  4RFT 0;  3NV3 A;  1DDL A;  3LDB A;  2A3W A;  2ET7 A;  3H7Y A;  4I02 A;  5FLI A;  2ZGP A;  2HEV F;  2Y6J A;  2GC2 A;  3RZL A;  3AKP A;  2Q0A A;  1UAI A;  4Q4V 2;  2Y38 A;  2ZGK A;  3SHR A;  4ARX A;  1CGP A;  4P14 A;  2UUR A;  3WUD A;  3PIJ A;  2WKK A;  5JMO A;  4UFJ A;  1W2U A;  4QX5 A;  3T1L A;  4UXA A;  4ISR A;  5F8P A;  5FYU A;  1RHI 1;  1RGS A;  3WDU A;  3QBQ A;  4I09 A;  4GAZ A;  4OI0 A;  4XF4 A;  1O59 A;  3NO8 A;  3NNM A;  5DG2 A;  1UY1 A;  1DP0 A;  1FMD 2;  1GV9 A;  1NE4 A;  1NCR B;  3AL6 A;  4MG2 A;  3OPT A;  5T50 A;  2JKB A;  4IER A;  1HN0 A;  3JZV A;  4PLO A;  4YGC A;  4CXX A;  2ZEZ A;  3NST A;  1F2N A;  2BV4 A;  4WZC A;  2J1S A;  5H9S A;  4ZS3 A;  3GGL A;  2GAU A;  4DPN A;  1DQ1 A;  5A33 A;  5IVY A;  3GBG A;  4IUG A;  2ZOE B;  4JAA A;  1QQP 2;  2WNU C;  4CXY A;  3AXD A;  1S0C A;  1O7F A;  2VOK A;  3N7L A;  4FFG A;  4IGP A;  1RUH 3;  4AG4 A;  3M8L A;  5HBA A;  3N35 A;  2WRA A;  3ENR A;  5FRE A;  1AYM 2;  1FXZ A;  1JS9 A;  3O1U A;  4FP2 A;  2YPD A;  1Y3T A;  4P9J A;  2CNA A;  3A7Q A;  1SDD B;  4HVO A;  4JKK A;  1TMF 1;  1XE7 A;  4LO5 B;  3GJA A;  3LA7 A;  4Q4V 3;  5ANN A;  3CNA A;  2R04 2;  4GZ9 A;  3URF A;  1D7P M;  3WP5 A;  3OUJ A;  2GH2 A;  4QD2 A;  5G04 L;  3WW1 A;  2VTX J;  2HWD 3;  3VBF B;  1R09 2;  1PMH X;  1VBD 3;  3DYO A;  4RD7 A;  4Y5Z 0;  4E27 A;  3PME A;  4QT6 A;  1STM A;  1RYY A;  4P5Y A;  4E8D A;  1ND2 C;  1EP0 A;  1LHW A;  3AL5 A;  2PAE A;  1CR7 A;  1ZZ9 A;  4BLJ A;  2LRP A;  2DVD A;  1HIX A;  3J8F 1;  1OA4 A;  1OA2 A;  2IVJ A;  2XBO 3;  2HWE 3;  4LIV A;  5I91 A;  5C8C B;  3UNP A;  4EN7 B;  4W50 A;  1JH5 A;  3NVC A;  4FPY A;  4QX2 A;  2YV8 A;  4B7E A;  4BE3 A;  2X05 A;  2RS5 1;  5FY4 A;  1JZ5 A;  1PVX A;  1XPW A;  1V9U 3;  4A6S A;  4N7I A;  4JV4 A;  4QPI C;  5F5A A;  3N9Q A;  2BVB A;  3C7G A;  4YGE A;  2Q8O A;  4G4F A;  4HSL A;  4AGG A;  2P3Y A;  2Y0I A;  2GNB A;  3D5O A;  1XND A;  2VMD A;  5F32 A;  2QJV A;  1F35 A;  1OLM E;  4A7Y A;  4YGD A;  1R64 A;  1HJG A;  1LOF C;  4C1W A;  5A7P A;  2CU5 A;  1CJD A;  1ZZC A;  2GSY A;  2BGO A;  2RE9 A;  4LTA A;  3VBO B;  2RS3 3;  2JDY A;  3RYK A;  3AMM A;  4AYU A;  1CVN A;  5EWS A;  4G3Y C;  1ZRR A;  4O7X A;  2L9L A;  4EWE A;  1K42 A;  2PHX A;  4Q29 A;  5FPV A;  5GAL A;  1AR8 2;  4N9H A;  4P08 A;  2RG4 A;  1OC1 A;  4FO9 A;  5FY9 A;  2QQV A;  3N9P A;  3M7A A;  1PM7 A;  4PBP A;  4XTM A;  5F2S A;  5EYX A;  2D6O X;  2Y6H A;  4QB6 A;  4DY3 A;  5FMO L;  5JXG A;  1PVC 3;  1LOE A;  1BVP 1;  4DB5 A;  1VAV A;  1RUF 3;  5BXX A;  2B9V A;  2R06 3;  1TNR A;  1V6L A;  3GAL A;  1SDW A;  4OZX A;  1TQ5 A;  4WVZ A;  3VBS A;  1RHI 2;  5C5U A;  2ZGN A;  2VBD A;  2CWS A;  2FDF A;  5J48 A;  2XQX A;  2A75 A;  1S1A A;  1TZO A;  3BYW A;  1NKG A;  5FY5 A;  2Q8D A;  3VD4 A;  1AR7 3;  1FNY A;  1GOH A;  2YBP A;  3MYX A;  5DPN A;  3WF4 A;  4AFB A;  4HT1 T;  2B46 X;  3RZG A;  4GH4 B;  4V1P A;  5F5Q A;  5CB7 A;  4AFC A;  3I3B A;  5CG8 A;  4FP3 A;  1ZRC A;  5LRR A;  3VDC A;  3AVS A;  1J83 A;  4RR3 B;  4LMF A;  1VLN A;  5T3N A;  4AW7 A;  3USS A;  2VZV A;  2R04 3;  1KJL A;  1NLS A;  4MGZ E;  5DQ0 A;  1QU0 A;  4TZD A;  3ZKY A;  2XXZ A;  1QMJ A;  3AP4 A;  3VBH A;  1W3X A;  4XAA A;  4UFH A;  1OPO A;  1LEM A;  4MXW B;  1VPH A;  5C71 A;  2DVG A;  5DUX A;  4TLG A;  1QNW A;  4J1X A;  5I0D A;  1OF3 A;  2ZX0 A;  2YUE A;  3NQH A;  4AGR A;  4BXS V;  4HKW A;  4W6X A;  4AWD A;  1SLL A;  1J59 A;  5FYI A;  2ATF A;  2VNO A;  2WZR 3;  1NOV A;  2GNM A;  2E33 A;  2VZP A;  1PO2 1;  2WQ8 A;  3AYC A;  3BTA A;  5F7U A;  4ES8 A;  1LB2 A;  3MW4 A;  4NIH A;  4CEY B;  3FX3 A;  3CJI C;  2RMU 3;  1KFX L;  1Y9G A;  2XVL A;  5CFD C;  4LBK A;  2XL9 A;  4QKF A;  2GP5 A;  4Y20 B;  4BQW A;  1QJY 3;  2LTN A;  4FVV A;  1YO8 A;  2BER A;  4NII A;  2DCZ A;  1ACC A;  4PIY A;  3NV2 A;  1G9F A;  3N3H A;  4XF9 A;  1MQT C;  1O6U A;  1UZV A;  1WCK A;  2DVB A;  4MGI E;  4XQ4 A;  1DLL A;  2ARA A;  4L2N A;  5K7P A;  2O1Q A;  2OUJ A;  2VOW A;  5EXO A;  4N90 A;  3RWK X;  4YZ2 A;  5C33 A;  1SAC A;  5DXD A;  2EXK A;  1XU2 A;  3LIH A;  5GZD A;  3B3Q E;  4RS5 A;  1O3S A;  3WOG A;  2Z4F A;  2WN3 A;  2W95 A;  5ACA 3;  3I2D A;  1JMU B;  2CYF A;  4IES A;  2W46 A;  3D0J A;  4CZS A;  2K2S A;  5JIA A;  1X50 A;  1H9P A;  3AC0 A;  3B02 A;  3UKT A;  1RUN A;  1YRZ A;  3RJ2 X;  3VZK A;  3CZU A;  3I3E A;  3P3N A;  1RTV A;  3CJX A;  4IV1 B;  4RHV 1;  1VJ2 A;  5FJH A;  1KD7 A;  4XZP A;  2CAU A;  4FPG A;  1PGW 1;  1GZW A;  4LHS A;  3TN9 3;  3MIE A;  2RDR A;  1FOD 3;  3WNO A;  5JCT A;  1UQX A;  5L7O C;  1MQT A;  4A41 A;  1MS9 A;  2IC1 A;  3OYW B;  3VBR B;  3HEI A;  3PDQ A;  4YW1 A;  4D6S A;  3K77 A;  4JGY C;  4M00 A;  1BK1 A;  2X5I A;  3RQ0 A;  5D8A A;  1C8N A;  3ILF A;  1NCR C;  1O8P A;  1VBD 2;  2FBE A;  1SBE A;  3NNF A;  1GZW B;  3OTF A;  2BP6 A;  1VB2 A;  5FMD A;  2X8K A;  5FZO A;  5FYZ A;  4DQA A;  4YG0 A;  3RZH A;  1O91 A;  1AYN 2;  2A1X A;  1X7N A;  2E7A A;  2WYS A;  4OLL A;  3ZLI A;  2H6B A;  3I59 B;  1VRB A;  4MGK E;  2IFR A;  1DHK B;  2FDG A;  1EV1 1;  3KGL A;  1TNF A;  4QWN A;  2CAV A;  2HEW F;  1OUX A;  1LUL A;  2EID A;  4FFH A;  1B09 A;  2Y0O A;  1MS1 A;  3A23 A;  1UKR A;  1Z0H A;  2HEY F;  5IW0 A;  1X82 A;  1YXW A;  4Q4V 1;  3LDK A;  2DCJ A;  2E51 A;  1KDK A;  4CDU B;  1AJO A;  3HWJ A;  2IZW A;  1OUR A;  5FXX A;  1R09 1;  3AFK A;  2HWD 1;  3JBG 3;  4GA9 A;  4YNI A;  1W8Z A;  4Y1U A;  3KT7 A;  1RUG 3;  2R07 3;  3DYM A;  2E31 A;  1YNA A;  4GMP 1;  3CQO A;  5FK8 A;  1RUD 3;  3WXP A;  5A1A A;  5FXW A;  5BNN B;  1X33 A;  2FCT A;  1UF2 C;  3P5B A;  4N53 B;  1RUE 3;  4M3C A;  1PO1 1;  2PHL A;  4M0H A;  1FPN 1;  3T09 A;  4I3P A;  5FO7 B;  1SLT A;  4Q0S A;  4Q26 A;  3APB A;  3DKQ A;  1OH4 A;  4ONU A;  3OBZ A;  1E5S A;  5JXH A;  4XMA A;  5C4W A;  1V70 A;  5IAV A;  5ACA 2;  4H55 A;  4XF1 A;  1HN1 A;  4XOG A;  1C8M 3;  3FL7 A;  3GYD A;  4QX0 A;  1WW4 A;  1AXY A;  2D3R A;  3IDE A;  3ZN6 B;  4U2A A;  1HJF A;  1R1Z A;  1D2S A;  1GR3 A;  4CXW A;  3Q8A A;  4XF3 A;  1POV 0;  2HWF 1;  2PQQ A;  4R4X A;  2ZEW A;  3A4U A;  1CAW B;  3N7J A;  5FBZ A;  5DZG A;  3SCG A;  3UL2 A;  2FD8 A;  5A7W B;  5FY7 A;  2OZJ A;  3V0A A;  3J26 N;  5I0U A;  1CON A;  4PT6 A;  2P3K A;  4W6Y A;  2XKO A;  4Y4Y A;  1VP6 A;  2AEY A;  1ZYB A;  4GIQ A;  5F3I A;  1ZBA 3;  2R1B A;  5BV6 A;  4AFA A;  1X9T A;  4GD4 A;  5DAQ A;  2AR6 A;  1NG0 A;  1FNZ A;  1PZ9 A;  2J7M A;  1IPK A;  4YM3 A;  1UZW A;  1WD3 A;  3J8F 2;  4ZS2 A;  1O3Q A;  2AEN A;  1JOB A;  3FBY A;  1WKY A;  4LOR A;  5D1I A;  4E2Q A;  5DAP A;  3VBR A;  5DUV A;  5KC5 A;  2KA3 A;  1MR5 A;  1RL3 A;  1HKD A;  4LNV A;  5C3Q A;  1RXG A;  1CAU A;  5J1X A;  2XVK A;  3M3C A;  4Q4X 3;  5KHI A;  1FMD 3;  1POV 1;  1AZD A;  1SLB A;  4K3U A;  5FYH A;  5DDJ 2;  4CCM A;  4COV A;  1BEV 1;  4QU2 A;  5F5C A;  1OF4 A;  4COU A;  1AX2 A;  2ZX3 A;  4CP9 A;  2D5H A;  3I4I A;  4TLF A;  4YYO A;  5FZA A;  3VBS B;  4ZU7 A;  2QQP A;  4AOC A;  5FK7 A;  1ND3 C;  4NHL A;  3I8T A;  1U0A A;  1VBE 3;  4Y4R A;  1NE6 A;  3RFR A;  5FO8 B;  5FPA A;  2YBS A;  3D3A A;  4LO8 A;  5IJR A;  3UES A;  4UBH A;  4IEQ A;  3LB9 A;  1UO9 A;  2R04 1;  2VG9 A;  5JOY A;  1G8W A;  1GLH A;  3SC7 X;  1UYP A;  5FYM A;  4E2G A;  1RUC 1;  2ARC A;  3ZFF B;  1V6J A;  1H4H A;  2ADE A;  3KF3 A;  2RJL A;  1AF9 A;  3M70 A;  3ASI A;  1NCQ C;  1S0I A;  1O5U A;  3VD5 A;  4OQ8 A;  4PDW B;  5FDB A;  5F3C A;  1F15 A;  3W21 A;  3I2F A;  1A6C A;  1H6Y A;  4BK4 A;  5T5L A;  5T5J A;  1RUE 2;  1ODM A;  5C70 A;  4NJ4 A;  4NRO A;  1JZ8 A;  4PLM A;  1UPI A;  1WLD A;  2RMU 1;  4IGQ A;  2A73 B;  2D6K A;  4XFI A;  5FMC A;  1JYC A;  3T2Q A;  4CCN A;  3OGV A;  1KQR A;  4WM7 C;  2G9Z A;  5DAW A;  4LBL A;  4CEY C;  1AXK A;  3CJI B;  4XDP A;  2VBP A;  4M4R A;  4AVB A;  3FN9 A;  3RNS A;  2BTV C;  4CA9 A;  4CUC A;  2EIE A;  1HW5 A;  3D82 A;  3DPR C;  4XDQ A;  5I8Y A;  3INA A;  1ULG A;  4IL7 A;  1GP5 A;  2O14 A;  4ZU4 A;  4PLN A;  5IK7 A;  1OMI A;  2VMI A;  1YFU A;  4UF0 A;  4Q0V A;  4A4A A;  3I3M A;  3FC0 A;  4XBN A;  4WVW A;  1I1E A;  3CL1 A;  5FZ1 A;  5KHG A;  1LGC A;  3M3E A;  4XJZ A;  5ERL A;  2LM3 A;  4EWD A;  3LAG A;  4JDM A;  2YXS A;  2ZX2 A;  3AFG A;  4QKD A;  2WNO A;  4HKL A;  4MXW A;  1PM4 A;  5GJ6 A;  3VBF A;  4LBN A;  1IZ3 A;  1EYB A;  1LGB A;  3GZT B;  3SLI A;  1PZ7 A;  2GU9 A;  4EZH A;  2QZ2 A;  4ZHN A;  4QM8 A;  2HYX A;  4NR1 A;  3DPR A;  5JIU A;  5JI9 A;  4COY A;  1UXX X;  4XJA A;  5BNO C;  3HIF A;  1R08 2;  1WLW A;  4LE4 A;  4DUV A;  4GH4 A;  2AH2 A;  1REE A;  2J1A A;  2RDN A;  5CFC A;  1W39 A;  1YQ2 A;  5M0T A;  3UET A;  3D8C A;  4ISQ A;  5L19 A;  4RQP B;  3E5U A;  4RGA A;  4C91 A;  4NRM A;  1WW6 A;  3TN9 1;  3CIH A;  4PF1 A;  4S2D A;  4N43 A;  3E6D A;  4BPZ A;  4UFK A;  3KT4 A;  3UJO A;  3LOI A;  1LU2 A;  1AL2 3;  5FQ0 A;  4FPF A;  3G7D A;  3K4A A;  5KXD A;  2VQT A;  5FOJ B;  1UZY A;  3RRD A;  2V09 A;  5L7O B;  4XJ8 A;  2CL2 A;  3WUC A;  2H6C A;  1LAJ A;  4HL0 A;  4BQ1 A;  4JGZ C;  3VBR C;  5FY8 A;  1ZZ8 A;  2D6N A;  2NN8 A;  2VME A;  5FZC A;  1DGW X;  5K0U C;  1UY2 A;  3WW4 A;  1JHJ A;  2ILM A;  3QLQ A;  3B93 A;  1IGO A;  2WLP A;  1I9R A;  1LR5 A;  1QNY A;  2E53 A;  1OBN A;  1PMI A;  3IDC B;  2Z2S B;  4M3C E;  4CP2 A;  2Q8C A;  2Q8E A;  4AVT A;  5F37 A;  1UY0 A;  3L2H A;  4Y1Y A;  3WLU A;  1PIV 2;  4EE2 A;  1VBC 3;  1ND2 B;  1XNC A;  4YG6 A;  3JUU A;  4ES9 A;  3FBM A;  5IVJ A;  3GCW A;  3FUQ A;  5LZ6 A;  1M4W A;  2ZS6 B;  3JBG 1;  4JRA A;  1I6X A;  5A1F A;  2UU8 A;  3AKR A;  1O5L A;  3DEM A;  4Q0P A;  4GMP 3;  2W94 A;  3SH4 A;  4BA6 A;  4IET A;  3EXU A;  1LED A;  1Q8P A;  1AYN 3;  2OPW A;  1CAW A;  3J4U H;  4LBJ A;  5A32 B;  2J42 A;  1W8W A;  2R32 A;  4ZZ8 A;  1AJK A;  1ZBE 2;  1VE0 A;  1XSQ A;  2ES3 A;  5LEK A;  5BNN C;  3S30 A;  5E89 A;  4HOO A;  4BDV B;  4N53 C;  1NA1 A;  3E97 A;  4I01 A;  5GZC A;  4ARY A;  1HQW A;  2MNG A;  1MEC 3;  2LS6 A;  4K1Z A;  3JB8 A;  3AVR A;  4LHK A;  3PL0 A;  3VBO C;  1GNZ A;  1GKB A;  3LPG A;  1GNH A;  2OKX A;  1UOB A;  4AFD A;  4I0W B;  4LE3 A;  5CFD A;  4LK6 A;  1XE0 A;  1GP6 A;  3AP6 A;  1LEN A;  1W8N A;  4ERO A;  4TYS A;  1CX1 A;  2MHF A;  4BWO A;  5KHH A;  4COW A;  3POE A;  3KF5 A;  3W9A A;  3AMH A;  5F3E A;  1CJP A;  3HQU A;  2R06 1;  1C1L A;  1WCQ A;  4K20 A;  4LHN A;  5AC9 2;  1DGL A;  1LEC A;  2DUO A;  4XXP A;  5FZ9 A;  3ZXA C;  4E8C A;  2W9X A;  2BBA A;  4IND A;  3WY6 A;  3BIE A;  1UYY A;  1Z78 A;  2ZEY A;  5A7O A;  2PN5 A;  1C8M 2;  2IXH A;  1JZ7 A;  3ZYR A;  1UXZ A;  1W06 A;  4MV2 A;  2AGS A;  2VY0 A;  2VL4 A;  4EN8 B;  3NNJ A;  1DFQ A;  1UOG A;  4FOW A;  4NHK A;  4ORF A;  3IWZ A;  3CMG A;  5BNQ A;  3OB8 A;  4PIZ A;  3KV4 A;  1HV0 A;  4AQ2 A;  3KQR A;  3O5S A;  1HDK A;  1N1Y A;  4GH4 C;  4OI4 A;  1F8V A;  4CCO A;  4OYU A;  3BAL A;  4JCK A;  2P37 A;  5G05 L;  2XUM A;  4OQ9 A;  4RR3 C;  2C0Z A;  2WSV A;  4CDX B;  5GZE A;  4QQ2 A;  3I97 A;  2QBX A;  1QXR A;  2BVV A;  2XJS A;  1RUD 2;  2WBK A;  3IM0 A;  2DF7 A;  3VHP A;  2ZGS A;  3H7J A;  4BQ3 A;  3ETP A;  4JHZ A;  1W6O B;  3BKZ A;  4QGM A;  2B45 X;  4BQ2 A;  2V5Y A;  1C3H A;  3OF1 A;  5LW9 A;  1VBA 1;  2PHD A;  1ZVF A;  2I2S A;  2VZQ A;  1SMV A;  1RUH 1;  4DMI A;  2E9Q A;  3POG A;  1ND3 B;  4JVA A;  4I0A A;  3ACG A;  2V5D A;  5CKN A;  1UYX A;  3VDA A;  3WR0 A;  4XTP A;  3GM8 A;  3T2P A;  4AI1 A;  2W87 A;  3GZA A;  1QJY 1;  2JEN A;  3IAP A;  3QAC A;  1OKO A;  4MET A;  5K0U A;  5JDB A;  3WNP A;  1CAX B;  4CDW A;  1LJ7 A;  4XJ9 A;  5F5I A;  2BNM A;  4E4D X;  4QXB A;  4CCC A;  5AVA A;  1NCQ B;  1BYH A;  4DUX A;  1EUT A;  3KHB A;  4PDW C;  2W39 A;  3GZE A;  3J7H A;  1EPW A;  3IZO A;  1BBT 2;  5ABJ B;  1REF A;  2JE8 A;  5LK5 A;  1H2L A;  1U12 A;  1X36 A;  5CA6 A;  4D7Y A;  1UMZ A;  3OEA A;  3GZU C;  4XFA A;  3ZXD A;  5HCA A;  2PLV 2;  4UFI A;  4JC1 A;  5AVP A;  4Q4Y 3;  4MSV A;  5CAZ A;  1V9U 1;  1XNK A;  2GMM A;  1XJA A;  3BTX A;  1ZX5 A;  1QDO A;  3DEC A;  4KGQ A;  3DPR B;  4IEV A;  5C6C A;  4OI2 A;  3JD7 1;  5IVF A;  3KV6 A;  1WA4 A;  2OT7 A;  4BB3 A;  4MUV A;  4AAX A;  2QE3 A;  2DCT A;  4D3W A;  2UWB A;  4M4P A;  3V56 A;  4LOT A;  1FAT A;  1L7Q A;  1MS5 A;  3OBA A;  4CEW A;  4QHO A;  1BJQ A;  2WS9 2;  3HMY A;  3MBW A;  4HET A;  4HMZ A;  1PK6 C;  1GWM A;  1QJU 2;  1IKQ A;  3PVB B;  5DZE A;  3LDR A;  4PF5 A;  2D6L X;  2RM2 1;  1FOD 1;  4IV1 C;  3ZN6 A;  2KXL A;  4UF0 B;  4NHX A;  4AED C;  3FFQ A;  3VZL A;  1APN A;  4Q27 A;  2X09 A;  1V6O A;  2VTX A;  2B7Y A;  2D3S A;  3CEW A;  3CJI A;  1PGL 1;  2QQN A;  1W9Y A;  2EAA A;  1MZF A;  2A6Z A;  2FDJ A;  3WW3 A;  1OSG A;  5HI0 A;  4QGL A;  2NYY A;  1BMV 1;  3WHU A;  4JGY B;  4C0H A;  4YVW B;  2D97 A;  5LBF A;  4K21 A;  3WDX A;  4XVH A;  3HNM A;  1A8M A;  1PK6 A;  1CPM A;  3MID A;  4RQP C;  3RZK A;  2W52 A;  2EVX A;  1XYO A;  1NX9 A;  3PUR A;  2BPA 2;  1LOA A;  4TXW A;  1GSL A;  5CFC C;  1YJL A;  4H2A A;  3WQB A;  2ET1 A;  3O1O A;  2HLE A;  3AK0 A;  2JG8 C;  3AZV A;  4BH9 A;  1EV1 3;  2DBI A;  3H8X A;  1OD5 A;  1Q8V A;  4H7L A;  2FDI A;  2QTW B;  4ET7 A;  4CVU A;  3AM2 A;  2WL1 A;  1AVB A;  2A5Z A;  2VZO A;  5C9A C;  5FFO C;  3I2O A;  1NCQ A;  5FZ3 A;  2E32 A;  3T2T A;  1VR3 A;  3I59 A;  4XFB A;  5I8T A;  4GWN A;  4CDU C;  5K0U B;  3DXT A;  3PTR B;  5IFP A;  2XKP A;  1R08 1;  2WO3 A;  3VB9 A;  5FYS A;  5BNP A;  4XZU G;  1RUE 1;  4KGG A;  1QJF A;  1RUJ 2;  4XBQ A;  3SEP A;  4GB3 1;  2B8M A;  1Z7S 1;  3OG2 A;  3Q8E A;  1I5P A;  1UPS A;  4CRQ A;  3OD0 A;  1D4M 1;  1LCL A;  3RZJ A;  3O1T A;  2ZZJ A;  3WD5 A;  1ND3 A;  2VUL A;  3TOJ A;  2WO2 A;  1Y43 B;  4E4S A;  4QXH A;  2OZ6 A;  5FZK A;  2QVS B;  3N7M A;  2VE1 A;  4Y1V A;  3B9C A;  2B42 B;  3ES4 A;  3IPV A;  3PNA A;  1RIN A;  4CDX A;  4AI8 A;  4K40 A;  1H4G A;  4DRR A;  3M3Q A;  5DG1 A;  3K3N A;  2B39 A;  2ZXQ A;  1Q8O A;  4ITC A;  1NXM A;  4IV1 A;  3Q9O A;  1BCX A;  1MEC 1;  3OGJ A;  3IAQ A;  2F4P A;  1AX1 A;  3FHQ A;  3UT0 A;  1N3O A;  1VBB 1;  1BQP A;  1LOC A;  2JJ6 A;  4M01 A;  3J7L A;  1QIQ A;  2QUO A;  1X8E A;  1ZBA 1;  4CUG A;  3GBW A;  5LRS A;  4N7U A;  4FI9 A;  4HON A;  2DUQ A;  4IW3 A;  1OOP A;  2ZGQ A;  2JIJ A;  2Z42 A;  1W28 A;  2BFU L;  4IEO A;  3ZR5 A;  2GMP A;  2GND A;  3A21 A;  3G6J B;  4XUR A;  4PHZ A;  5EQU A;  3SH5 A;  3T30 A;  3THP A;  4AGV A;  5A1L A;  1E5H A;  2ZTN A;  2ZHK A;  5IYY A;  3MV0 1;  4YPJ A;  4H7M A;  4MZU A;  1ZNP A;  4XAE A;  4FXG B;  3ZSM A;  4HSJ A;  4AEM A;  4EJR A;  3V0A B;  3ATG A;  4QX7 A;  1WCS A;  4WM8 B;  5DN2 A;  4CU9 A;  4YAR A;  4TTG A;  4PJY A;  3IIA A;  5H9Q A;  5A3M A;  5EPA A;  4RHV 3;  1DGR N;  1BEV 3;  1UX6 A;  1QKQ A;  1JN2 P;  2VGD A;  2DTY A;  2J1V A;  3ZPO A;  2EA7 A;  2QDN A;  4EN9 B;  4D6R A;  2DTW A;  2YBK A;  1WD4 A;  5BNN A;  4NRQ A;  4WBB A;  1LES A;  1IPJ A;  1PIV 3;  3VBS C;  2O8O A;  5JPN B;  1AXZ A;  2JDM A;  3FHI B;  2BEO A;  2VQA A;  3KV5 A;  1OQD A;  3VUO A;  2XBO 2;  3OY8 A;  3MPB A;  4XMI A;  3OSD A;  3ZYB A;  2DUR A;  1PGS A;  4QKB A;  1ASJ 3;  3H1Y A;  4UYB A;  3HN3 A;  4MGQ A;  2VZ3 A;  3L2Y A;  3LA2 A;  4CTE A;  3PLQ A;  2DUP A;  1TVG A;  3T08 A;  1U5Y A;  3ZFF C;  5E6H A;  4IQP A;  1VBA 3;  4LHL A;  3HR9 A;  1V6K A;  1ULD A;  2YB7 A;  4NRP A;  5J37 A;  3MLL A;  1HXS 2;  5KR7 A;  4Q8K A;  1GP4 A;  1LTE A;  3IBM A;  5FJK A;  3AKS A;  4U36 A;  1XU1 A;  3VZN A;  3BUC A;  1NQD A;  2Y6F A;  5JZG C;  3ALQ A;  5IK8 A;  1W8O A;  2JE7 A;  4XIL A;  5L73 A;  2BWC A;  2RS5 3;  3WSO A;  5A3P A;  3LF7 A;  3N4M A;  4E2S A;  3ACH A;  1TE1 B;  4GWM A;  4NVP A;  3ZPY A;  3ZSJ A;  2R30 A;  3ZFF A;  5LEJ A;  4LO6 B;  3CKH A;  2ZKN A;  4KWL A;  4LKS A;  1JYV A;  4DXR A;  2FZ2 A;  2I45 A;  1J3R A;  1FPN 3;  4MVT A;  3TBD A;  1YCI A;  1R1A 1;  3V0B A;  2VUJ A;  3NAP C;  3ZDS A;  4QXK A;  2WNV A;  5ABJ C;  1QXP A;  4M0N A;  5FYY A;  3ZFG B;  1O3T A;  3VDB A;  2PAK A;  3IB3 A;  4JZR A;  1DCS A;  2V4V A;  3MIF A;  1K5J A;  1UIJ A;  5CKQ A;  4COZ A;  2PEL A;  4E4Z A;  4IDZ A;  1YJK A;  2ID4 A;  3JD7 3;  4ZY9 A;  1A3K A;  3AYD A;  5A3U A;  5A6Z A;  3PMS A;  2FZ1 A;  1X9P A;  4XCB A;  2ZGL A;  3KQ4 B;  5T54 A;  4X6Q B;  1ALY A;  1COV 2;  2LAL A;  4QX3 A;  1PVC 1;  3DL3 A;  4HKO A;  3LKJ A;  4Y22 B;  4AZZ A;  4BU2 A;  5I0T A;  3C7H A;  1W6N B;  5BNO B;  4IEZ A;  1RUF 1;  2P2K A;  2HWC 2;  3U0Z A;  4BYY A;  4RHV 2;  1QJX 2;  4FTE A;  1WW5 A;  2Y6L A;  3N7K A;  5JPM B;  2YU2 A;  1GOF A;  5I93 A;  1H8T A;  4YFW A;  1G9A A;  1NYW A;  1QY4 A;  2YFZ A;  4B8E A;  1PK6 B;  2Z79 A;  3B5L B;  4B7K A;  4MOA A;  1XNA A;  2OPK A;  4XE9 A;  5FR3 A;  2DU1 A;  3FFZ A;  2R49 A;  4LJH A;  3NV1 A;  4WM8 A;  4HFS A;  4AED B;  1GWL A;  4ATE A;  1H2N A;  3LGR A;  4CDQ A;  1DLC A;  1JYX A;  1PO2 2;  2QQW A;  3ZN5 A;  4OI1 A;  2NMO A;  1Q5O A;  2I74 A;  4YM0 A;  3LSD A;  4CE8 A;  5C8C A;  3NRU A;  4JHT A;  1QJU 3;  4JGZ B;  2PQS A;  1D4M 2;  1W9F A;  3DXU A;  4JTO A;  4Q4X 1;  5IVV A;  3MF9 A;  1JW6 A;  1OLM A;  1XYP A;  1BLZ A;  3N36 A;  3JXS A;  3OGR A;  1POQ A;  4LBQ D;  1AR6 2;  5LAS A;  2D40 A;  4XUO A;  1RUH 2;  1US2 A;  3ME2 A;  5E1R A;  4N43 C;  1AR9 1;  4ASL A;  4XIO A;  4BZ4 A;  2AYH A;  1OLQ A;  2JG8 B;  4CUA A;  2Y26 A;  2BWA A;  4NOT A;  2DVA A;  4DOU A;  4MGT A;  4FFF A;  4RR3 A;  2PLV 3;  4K8F A;  1YQ6 A;  2B4K A;  5CNA A;  3WHT A;  5CIS A;  2H0V A;  1RUC 3;  1O8S A;  3ZYH A;  2V72 A;  5FCC A;  4GJY A;  3W59 A;  4CSW A;  4QPI A;  1LHN A;  1W2N A;  1YYN A;  3C7E A;  1SCS A;  4HZF A;  3LEI A;  1D4M 3;  4CCJ A;  2WT1 A;  4NIA A;  3J7N A;  3O0X A;  4Q4W 1;  1EAH 2;  1JOP A;  5FWJ A;  3POS A;  1GAN A;  5DDJ 3;  2XJP A;  3KWV A;  2GN3 A;  4NPL A;  5A6X A;  1J1L A;  4QDS A;  5FZD A;  1DYP A;  4FAG A;  4JRL A;  1Q43 A;  2RS1 2;  4IXL A;  3ZYF A;  2VMF A;  3ZVX A;  1K3I A;  1US3 A;  1ONA A;  2GZW A;  2D43 A;  3ETQ A;  4BQX A;  3TEW A;  2ZAA A;  5KC6 A;  1K12 A;  1S0E A;  1MEC 2;  3SCH A;  2D6M A;  5EJ1 B;  4AVC A;  4NHY A;  1VB4 A;  4XXA A;  4FSJ A;  1ZRI A;  2VCA A;  1V6N A;  4TN7 A;  2HWC 3;  4B29 A;  4AF9 A;  2GN7 A;  1JZ2 A;  1ZBA 2;  1H2K A;  5DAB A;  3MIG A;  5C5T A;  1RUC 2;  2WNU A;  1UL9 A;  2EAK A;  2O8Q A;  3OPZ A;  4FQZ A;  4XEZ A;  3X29 B;  3H3U A;  4UW4 A;  3W5M A;  2EXH A;  1U5X A;  2Y64 A;  1F9K A;  4NWW A;  4URT A;  3H8R A;  4L97 A;  4BMB A;  2F4L A;  3BTZ A;  2EIB A;  4BXF A;  3Q8C A;  1W6Q A;  2VNR A;  4EV0 A;  2RDQ A;  1OPM A;  2WLQ A;  2MEV 2;  2WZE A;  3IT8 A;  1Y9Q A;  1W6P A;  3O1P A;  5L9V A;  2ORZ A;  3RJR A;  1RUO A;  4RFR B;  1C28 A;  3D0S A;  3EQE A;  3LSE A;  3ZSK A;  1UKG A;  5FLH A;  1VRH 2;  3VKO A;  4FOV A;  1QH7 A;  4XYX A;  3ZXF A;  4LKE A;  5FY0 A;  2QQK A;  4CDX C;  3KSC A;  1AL2 1;  1N3P A;  2IXI A;  1CZS A;  2QQU A;  4LR4 A;  4DUW A;  4OZO A;  1AUY A;  4PBO A;  4AED A;  1YWK A;  1NAE A;  5DZF A;  2I07 B;  2ZAH A;  1IQD C;  1BXH A;  1ASJ 1;  5LA9 A;  4QHZ A;  4R9B A;  2BJS A;  3E5X A;  5FP3 A;  1ZRF A;  1DQ2 A;  3AXE A;  4KWJ A;  1W8T A;  1ENX A;  4BIS A;  1R1A 2;  1P8J A;  4FCA A;  1J3Q A;  5A6Y A;  5BNO A;  4IEP A;  2X29 A;  2AUY A;  5HCB A;  2ZPX A;  3LZZ A;  1Q56 A;  2HWF 2;  2XVG A;  5K8S A;  4Y1Z A;  2VUD A;  2BBV A;  3BB6 A;  3MEP A;  2VAU A;  3VKN A;  2YZ4 A;  3DF0 A;  3CO2 A;  5FZ4 A;  1VAL A;  2JDN A;  4P9G A;  4AI3 A;  4PQ9 A;  3TN9 2;  2ERF A;  2H0B A;  5A32 A;  1F4A A;  1NY7 1;  2WAO A;  2WT0 A;  2ZA9 A;  3ZFG A;  1UIK A;  3M1H A;  4UBG A;  2IXK A;  1G7Y A;  4ZPI A;  2YYO A;  4AAP A;  3B00 A;  3D6E A;  5FZO B;  5JR2 A;  2AZ5 A;  4B1L A;  3HQR A;  4R9C A;  3SEE A;  3MUZ 1;  1HLC A;  2GC1 A;  3AJZ A;  3HBK A;  4Y26 A;  3KVA A;  1G86 A;  3N9O A;  2CGO A;  4AI2 A;  4BOW A;  4YW7 A;  4RN5 A;  5EFU A;  4KNC A;  2EAL A;  4QPG B;  5FKC A;  1H1I A;  1DGR A;  4CPB D;  2VXR A;  4FBF A;  1XSR A;  2CGN A; 
#chains in the Genus database with same CATH homology
 2BGP A;  1UY4 A;  2Y6J A;  1WCQ A;  4ARX A;  5B4X A;  3THD A;  2WUH A;  2YC2 A;  1JI6 A;  5JMO A;  4E8C A;  2W9X A;  1GMM A;  2BBA A;  1O59 A;  1UYY A;  2WDB A;  2ZEY A;  1UY1 A;  1DP0 A;  1JZ7 A;  1UXZ A;  3BN6 A;  3LEK A;  2VL4 A;  4QAW A;  3K4Z A;  2ZEZ A;  3OGS A;  3CMG A;  3OB8 A;  2J1S A;  3GGL A;  1BHG A;  2VZU A;  3BGA A;  1XC6 A;  4IUG A;  5DMY A;  3VD3 A;  3WF1 A;  4OYU A;  5G05 L;  2JDA A;  4AG4 A;  2X10 A;  2C26 A;  3I97 A;  2QBX A;  2WBK A;  3ETP A;  4JHZ A;  3A7Q A;  1T2X A;  1SDD B;  4JKK A;  2C9K A;  3SKJ E;  2VZQ A;  4GZ9 A;  3III A;  1D7P M;  4W8J A;  5G04 L;  2J1T A;  3CZJ A;  2YC4 A;  1PMH X;  1PX3 A;  2V5D A;  1UYX A;  3ACG A;  3DYO A;  4P00 B;  3VDA A;  4A6O A;  3GM8 A;  1RYY A;  4P5Y A;  3T2P A;  4E8D A;  2W87 A;  1JZ3 A;  2CDO A;  4CU7 A;  2Y6G A;  3IAP A;  5HXM A;  3WNP A;  3UNP A;  4W50 A;  4QX2 A;  2X05 A;  4DUX A;  1EUT A;  1JZ5 A;  3ZM8 A;  1XPW A;  3J7H A;  4KWU A;  4W4Z A;  3C7G A;  1W9S A;  2JE8 A;  4KI5 M;  3ACI A;  3GXU A;  3OEA A;  3K46 A;  2VMD A;  5EJZ B;  4HG6 B;  1R64 A;  2BGO A;  1UY3 A;  1CZT A;  3DEC A;  1K42 A;  2L9L A;  1JZ6 A;  4MGS A;  4P08 A;  4AAX A;  1JYW A;  4M4P A;  2R7E B;  4A45 A;  1L7Q A;  3OBA A;  3MBW A;  2Y6H A;  4QB6 A;  3PUH A;  5JXG A;  2VJX A;  2B9V A;  4OMC A;  3WF0 A;  4CUB A;  3THC A;  2X09 A;  1CIY A;  4XUN A;  1PX4 A;  2QQN A;  2XQX A;  1W99 A;  1MPX A;  3E1F 1;  1NKG A;  4QB1 A;  3VD4 A;  3LE0 A;  1GOH A;  5DPN A;  3WF4 A;  4ZZ5 A;  2VC9 A;  1W9W A;  3CDZ B;  4XVH A;  3HNM A;  2WN2 A;  3I3B A;  1NX9 A;  3VDC A;  1J83 A;  4TXW A;  4CU6 A;  3WQB A;  2VZV A;  2HLE A;  2W5F A;  3T2O A;  5DQ0 A;  2QQJ A;  4PQQ A;  3ABZ A;  4ET7 A;  4CVU A;  4UOJ A;  1GNY A;  2VQU A;  3C8X A;  2VZO A;  2XHN A;  2YG0 A;  5C71 A;  5I0D A;  1OF3 A;  3NQH A;  4BXS V;  2E32 A;  2VTF A;  3ACF A;  3C7O A;  2DDU A;  5IFP A;  2E33 A;  2VZP A;  2WO3 A;  2WQ8 A;  3K75 B;  5F7U A;  4XZU G;  1GQP A;  3SEP A;  3OG2 A;  1I5P A;  2W47 A;  3W5N A;  4DXS A;  5LA0 A;  2BER A;  2WO2 A;  1JZ4 A;  2JKX A;  3GDB A;  4JKL A;  3NNG A;  1W9T A;  2W1U A;  4JX0 A;  4DEQ A;  3OEB A;  1L7R A;  1J84 A;  2ZXQ A;  2C4X A;  2ZEX A;  1JU3 A;  1ULP A;  3IAQ A;  2Z4F A;  2WN3 A;  2QQL A;  2W95 A;  3FHQ A;  4OMD A;  4A3Z A;  3WNN A;  2W46 A;  4FI9 A;  1H6X A;  3MUY 1;  2EIC A;  3AC0 A;  4MAD A;  2WAA A;  1GU3 A;  3HOB A;  3CZU A;  3HJR A;  3I3E A;  3A21 A;  3K4D A;  4XUR A;  1UMI A;  5IYY A;  3MV0 1;  4YPJ A;  1EUU A;  4LHS A;  1K45 A;  4DEV A;  3WNO A;  5DN2 A;  4CU9 A;  4TTG A;  4A41 A;  2RVA A;  5LA1 A;  2CDP A;  3HEI A;  4BK5 A;  3K77 A;  2J1V A;  3F2Z A;  3I2H A;  3VD7 A;  1UYZ A;  5JXI A;  2VR4 A;  1UX7 A;  1O8P A;  3P1I A;  3HPN A;  3WEZ A;  3T0A A;  2WYS A;  4XUP A;  3I2J A;  3DYP A;  3HN3 A;  4MGQ A;  2VZ3 A;  1GOG A;  4RYD A;  2WZ8 A;  3T08 A;  1TVG A;  2EID A;  1KGY A;  3A23 A;  2YB7 A;  2DCJ A;  4XUT A;  4XUQ A;  3DYM A;  2VCC A;  2E31 A;  5A1A A;  3CQO A;  5JUV A;  2W1W A;  3P6B A;  4JKM A;  1W8O A;  3T09 A;  3WSO A;  3NJV A;  4QX1 A;  3ACH A;  1OH4 A;  3NJX A;  3CKH A;  4LKS A;  5JXH A;  1JYV A;  2J1E A;  2VMC A;  4DXR A;  4ZXE A;  1UWW A;  5CZK A;  2XOM A;  1HN1 A;  3FL7 A;  4QX0 A;  3I2G A;  3VDB A;  2J22 A;  4D8M A;  5B4N A;  3IB3 A;  2V4V A;  1UZ0 A;  2ZEW A;  3MV1 1;  2WAB A;  4KMQ A;  2ID4 A;  4ZY9 A;  2VZR A;  4PT6 A;  3I3D A;  5IHR A;  4QX3 A;  1PMJ X;  3C7H A;  2KD7 A;  2J7M A;  2RV9 A;  2Y6L A;  1GOF A;  1WKY A;  2YFZ A;  3HNB M;  4MOA A;  1XNA A;  2Y6K A;  5J1X A;  3LEG A;  3C7F A;  2WO1 A;  5CYY A;  1DLC A;  1JYX A;  2W1Q A;  4UI9 L;  1DYO A;  1OF4 A;  5IFT A;  1JU4 A;  3PUI A;  3NRU A;  2PQS A;  5EIY B;  3UES A;  3D3A A;  5IJR A;  3JXS A;  3OGR A;  3T0D A;  1CZV A;  4XUO A;  2VM9 A;  1US2 A;  3WNL A;  4LQR A;  4QDR A;  3T0B A;  4CUA A;  1LNS A;  2E26 A;  1XNT A;  4P02 B;  3VD5 A;  2QQM A;  3VD9 A;  2B4K A;  2W91 A;  3I2F A;  1H6Y A;  1O8S A;  4GWI A;  4OUE A;  4BJ0 A;  4BK4 A;  3EYP A;  2V72 A;  1ULO A;  5C70 A;  2JD9 A;  3HNY M;  1JZ8 A;  3C7E A;  1SG3 A;  3T2Q A;  3OGV A;  3LEI A;  4CUC A;  2VO5 A;  4M4R A;  3FN9 A;  5FUI A;  2EIE A;  3EB7 A;  4QPW A;  2LW8 A;  4A4A A;  1CX1 A;  2ORX A;  1W0N A;  5LA2 A;  3WF2 A;  4QDS A;  3WF3 A;  4Z2A A;  2VMF A;  3I2I A;  1K3I A;  1US3 A;  4A44 A;  2BZD A;  2W92 A;  1K12 A;  2W3J A;  5EJ1 B;  2VCA A;  3LQC A;  2HYX A;  1JZ2 A;  4DXT A;  3IDA A;  1UXX X;  1NUK A;  3W5M A;  3I2K A;  4DUV A;  2Y64 A;  2J1A A;  5JXJ A;  1YQ2 A;  2YFU A;  3A22 A;  3UET A;  2EIB A;  2VZ1 A;  4MO3 M;  2XON A;  3CIH A;  2WZE A;  4PF1 A;  2ORZ A;  4GWJ A;  2QQI A;  3K4A A;  2VQT A;  2W1S A;  4QDQ A;  3U37 A;  3FHA A;  1F4H A;  5HPO A;  2QQK A;  1CZS A;  4DUW A;  2J1U A;  2VME A;  4OZO A;  5LCW L;  1GUI A;  1NAE A;  1UY2 A;  2VCB A;  1JHJ A;  2VZS A;  1IQD C;  2QQO A;  2VZT A;  2DCK A;  3LPF A;  1UMH A;  2RJ2 A;  4D0Q A;  3WNM A;  1UY0 A;  1P8J A;  1OD3 A;  1OT5 A;  3WNK A;  1SHW B;  5C7G A;  3MO4 A;  3SKV A;  2W94 A;  3ECQ A;  4A42 A;  4LPL A;  4ZZ8 A;  4CU8 A;  1F4A A;  2WAO A;  2VOT A;  4BDV B;  1JYN A;  4L0P A;  4QB2 A;  4ARY A;  1KEX A;  4UAP A;  2LS6 A;  5JR2 A;  1TG7 A;  3LPG A;  3SEE A;  3MUZ 1;  2OKX A;  2J1R A;  4RN5 A;  2Y8K A;  1W8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...