2ZEYA

Family 16 carbohydrate binding module
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
145
structure length
145
Chain Sequence
b'HMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-layer associated multidomain endoglucanase
molecule tags Hydrolase
source organism Thermoanaerobacterium polysaccharolyticum
publication title Molecular Basis for the Selectivity and Specificity of Ligand Recognition by the Family 16 Carbohydrate-binding Modules from Thermoanaerobacterium polysaccharolyticum ManA
pubmed doi rcsb
total genus 30
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2zeyA00
1GMMA 3CZJA 2CDOA 5DQ0A 4LPLA 1GNYA 2EICA 4QB2A 2QQJA 3ECQA 1CZVA 2QQIA 2VZ1A 4DUXA 2W1QA 1UY0A 4RYDA 2VMEA 3CDZB 4LQRA 3LPFA 1GQPA 2BZDA 2YC2A 4TXWA 4FI9A 3OG2A 3SEEA 4CU9A 3EYPA 3K46A 2V5DA 3WSOA 3OGRA 1J83A 4OMDA 1CIYA 1SDDB 4L0PA 1UWWA 4DUVA 3HNBM 2Y6JA 3IAQA 2QQLA 2Y6LA 3I2JA 3C7FA 3J7HA 1L7RA 1NKGA 1UY1A 1DP0A 1KGYA 1UMIA 3T0BA 4JKMA 3UESA 4QX0A 1OD3A 4W50A 2J1SA 3P1IA 4RN5A 1O8PA 1JZ3A 3ACFA 2YFUA 2YFZA 1NAEA 2J22A 2L9LA 3VD3A 5C7GA 2EIDA 4HG6B 3OGVA 3PUIA 3W5MA 4IUGA 5B4XA 1OF3A 4ZZ5A 3WF0A 4PQQA 1ULPA 3WF3A 5HPOA 2VZRA 5IYYA 1UY4A 1US3A 3E1F1 5C71A 4CVUA 4OYUA 4LHSA 4QDSA 2W91A 3OBAA 3MV01 4M4RA 3IB3A 2C4XA 3T0DA 2XQXA 1MPXA 5G04L 1BHGA 2J1EA 4A41A 4QDQA 1W9WA 3K4DA 2VZVA 3WF2A 4CUCA 3HNMA 3AC0A 1JI6A 2VZUA 4DUWA 3BN6A 1K45A 1UX7A 3MV11 1CZSA 4KMQA 2J7MA 2PQSA 1W9SA 2YC4A 2DCKA 5EJ1B 3I2IA 4W4ZA 3LPGA 3I3EA 2WYSA 4ZZ8A 2Y64A 4QX3A 3VD4A 1CZTA 2VJXA 1JHJA 4M4PA 2KD7A 2VQUA 4BDVB 2VMCA 4XUNA 2VMDA 3ACHA 3SKVA 5IFTA 5JXHA 5EJZB 2YG0A 1OH4A 2ORXA 4E8DA 5F7UA 2ORZA 4MO3M 2V72A 3MBWA 3BGAA 3UETA 1JYVA 3K4ZA 3I3DA 4PF1A 2C9KA 2DCJA 1F4HA 2VZSA 2LS6A 2QQKA 4OMCA 2ZEZA 2BBAA 4PT6A 3HOBA 2VO5A 1NUKA 4JHZA 2J1TA 3C8XA 4A4AA 2VZQA 3T0AA 3JXSA 2RV9A 5DMYA 3ETPA 3VDBA 3I2GA 1XNTA 3NRUA 2W5FA 3C7OA 2E32A 3OEAA 3T2OA 3ACGA 4GZ9A 4ARYA 3LE0A 1GOGA 1JU4A 2E33A 4GWIA 3WF1A 3A22A 3DYMA 1PX3A 4UI9L 2VZPA 3DECA 4Z2AA 1IQDC 2VMFA 1TVGA 3WEZA 2QQNA 2XONA 3CIHA 3ZM8A 2J1VA 1EUTA 1D7PM 4CU6A 2VCBA 2VOTA 4A44A 3VD7A 4ARXA 2QQOA 1OT5A 3VD9A 1I5PA 3OGSA 5JXJA 4BJ0A 2WUHA 2W1UA 1W8OA 2JDAA 4LKSA 3F2ZA 3WNPA 4JKKA 2VCCA 3A7QA 1JZ2A 2W47A 4CUAA 4CU7A 3GM8A 4DXTA 2ZEXA 4JX0A 1P8JA 3LEIA 5DN2A 4P08A 4BK5A 3NQHA 1XC6A 3LQCA 4XURA 5IHRA 2VQTA 1LNSA 1PMHX 1TG7A 2X05A 5JXGA 2DDUA 2X10A 1K42A 1JYNA 2W94A 4UOJA 1O8SA 2XOMA 1H6YA 3T2QA 4UAPA 4BXSV 4JKLA 4YPJA 2VR4A 4OUEA 1L7QA 2WO2A 3T2PA 1DYOA 5IFPA 3CMGA 4DEVA 2VZOA 4ET7A 1UMHA 4KI5M 3HNYM 2JE8A 4DEQA 1JZ4A 1OF4A 4P02B 3GGLA 2EIBA 2Y6HA 5DPNA 3I2FA 1W9TA 3WNKA 1EUUA 2BGOA 1JZ8A 2OKXA 2VL4A 2E31A 3K77A 4QX1A 1W99A 3UNPA 4DXSA 5LA1A 3NJXA 1UY3A 1RYYA 2VC9A 5JMOA 3U37A 3FHQA 4A3ZA 2WBKA 2YB7A 4DXRA 1DLCA 1H6XA 3W5NA 3HJRA 1O59A 1UY2A 3A23A 1XNAA 4W8JA 3T09A 4A42A 3ACIA 2ZXQA 3WF4A 3WNNA 3I2KA 3MUY1 1UZ0A 2QQMA 3D3AA 4MOAA 5JR2A 2BGPA 4MADA 3WNLA 5LA0A 3I97A 2RJ2A 2WN2A 1HN1A 4QAWA 3IAPA 1NX9A 4MGSA 3P6BA 2VZTA 3MO4A 2Y8KA 4CUBA 5CZKA 3VDAA 2WN3A 2X09A 3EB7A 2Y6GA 3NNGA 4MGQA 1JYWA 4P5YA 1R64A 1J84A 2VTFA 1GU3A 1ULOA 1CX1A 1K12A 4QPWA 3WNOA 2ZEWA 3WQBA 2Y6KA 1UYYA 5IJRA 3DYOA 4XVHA 1JZ7A 2VZ3A 4XUOA 4A6OA 3ABZA 2QBXA 4QDRA 3OEBA 2WZ8A 3SEPA 2Z4FA 3NJVA 4QX2A 3THCA 4ZXEA 1W0NA 1YQ2A 5LCWL 3HN3A 1WKYA 2ID4A 4ZY9A 1UYXA 2C26A 3LEGA 1GOHA 2W3JA 3DYPA 1F4AA 2R7EB 2LW8A 2WAOA 2WZEA 2WO3A 1PX4A 2WDBA 5J1XA 2ZEYA 3OB8A 1SG3A 2J1RA 4A45A 3HPNA 3MUZ1 1WCQA 5JXIA 2CDPA 4QB1A 5B4NA 4P00B 3FHAA 5I0DA 3A21A 5A1AA 2WQ8A 3C7GA 1UYZA 1XPWA 3PUHA 3HEIA 4XUTA 1GUIA 1UXZA 3GXUA 2JKXA 2B9VA 3FL7A 2W9XA 3K4AA 4KWUA 5CYYA 2W1WA 2W46A 4XUQA 5FUIA 4D8MA 3C7HA 2JD9A 5EIYB 1UXXX 4XZUG 2B4KA 3CKHA 2W1SA 1JZ6A 1JYXA 4TTGA 4BK4A 4AAXA 2J1UA 3C7EA 2BERA 4AG4A 1T2XA 2V4VA 3CQOA 3THDA 1JU3A 5HXMA 4D0QA 3I2HA 2W92A 2W95A 3FN9A 3LEKA 1KEXA 1W8NA 4GWJA 1K3IA 2W87A 5LA2A 3T08A 2WAAA 1US2A 5C70A 1JZ5A 2EIEA 2J1AA 3SKJE 1SHWB 5JUVA 5G05L 2WO1A 4E8CA 4XUPA 2E26A 1PMJX 2HYXA 3CZUA 3I3BA 2XHNA 2WABA 2HLEA 4OZOA 4CU8A 2VM9A 3VD5A 3VDCA 4QB6A 3GDBA 1GOFA 3IIIA 2RVAA 3WNMA 2VCAA 3K75B 3IDAA
chains in the Genus database with same CATH superfamily
1GMMA 1QJEA 2XR4A 2RDNA 2WNEA 3J7MA 4QPYA 2ZGSA 5DQ0A 4DPNA 2RMU3 2R041 4LPLA 2VQAA 3WT3A 1MZEA 4FPCA 1DGLA 4CPBA 1UKRA 2X53S 4TYSA 1CZVA 1PVXA 4RS5B 1DQ1A 3AMNA 4N7IA 2A6XA 2DCTA 1PVC1 3ZPYA 1O4TA 2XKPA 4K7JA 5JOYA 2VMEA 3ALQA 3CDZB 3QH6A 1MR5A 4MH0E 1TNRA 4P9LA 1D0HA 3MEPA 3K46A 3SISA 1R093 1A8DA 1VALA 3K3NA 4YLZA 5JSPA 5EP9A 3MPBA 3RI9A 1LOEA 1BJQA 3SMHA 5JPNB 2JE9A 1CIYA 1SDDB 1PZ7A 4IERA 4BQ3A 1QNWA 3KGLA 1OA2A 4CRQA 3IAQA 1C5IA 1ULGA 5FV3A 5KC6A 4XYXA 1MS8A 5IATA 4NRPA 4OZXA 5FMOS 4QKNA 3PVOA 5FYVA 4BQXA 1QF3A 3J7NA 4FOQA 1VRH3 1CONA 3T0BA 4JKMA 1FI2A 1GV9A 5A6ZA 1QQP1 3SC7X 5DUUA 3VBUC 4IGQA 4GWNA 3UGGA 4W50A 3LA7A 2WA4A 4N53B 3A0NA 4RN5A 1EAH2 3ZFEA 1O8PA 1X8EA 3PU3A 5FZOA 1D2SA 1JZ3A 4KU8A 4FTEA 3POWA 1SBEA 2YFZA 2IWGB 1NAEA 4Q4X2 1DQ0A 2P37A 1HJFA 4PIYA 1PO21 4XIKA 4UWDA 3WCRA 3L2YA 1AXKA 2ETEA 5F32A 4IGOA 1ZZ8A 4QMAA 3WY6A 5IK4A 2VAUA 5L7OB 4CCKA 4UF0B 2P6CA 2YU1A 1S4CA 3H8UA 4I0BA 4UFJA 3WP6A 3WW3A 1OOPB 3PVNA 4PLOA 2GMMA 3DEMA 4EN9B 1ULPA 4L9BA 3D5OA 1FT9A 2VZRA 3OBZA 2JWPA 3EHKA 5FYIA 1E5SA 1HQWA 3ASIA 3E1F1 1SCSA 5FY9A 1EAH3 2DVFA 4CVUA 1W6NA 1VBC2 3BTAA 4OVEA 2Z69A 5FZ4A 5FBZA 3GJAA 5GKAC 5FPUA 3M2MA 4QPGC 5A7WA 3MV01 1SEFA 1V6MA 1POQA 2D97A 1SFNA 3IB3A 3RSJA 4LKEA 3LOIA 1CJDA 4CPBD 4CEWC 5LEJA 1SFYA 2OS2A 3IDBB 3NJYA 3ZIWA 5G04L 1CPMA 2J1EA 3PUAA 4A41A 1C1LA 1GWMA 1TMF3 1W8WA 4HPKA 4QDQA 2R6QA 3K4DA 4LBLA 3UV9A 3VZNA 1HB4A 4IXLA 1LR5A 1A6CA 2BVBA 1JI6A 4FP3A 4XF0A 1J59A 1Y7BA 5FXXA 1TMF1 1W2UA 3ZIXA 2R073 4CP9A 1M4WA 3E5UA 4OHVA 4PJYA 2P3KA 3IT8A 3LF7A 4HN0A 2Q8EA 3RYRA 1W9SA 3BUCA 1O3SA 2XJVA 3HT2A 2JB4A 3KVBA 2BPA2 3LPGA 3I3EA 2HWC1 5KBFA 3BALA 2K2SA 1YYNA 4U36A 3MI8A 4LBQB 1VBB1 2Y64A 2RDRA 2ZGOA 4LIUA 4CXWA 5E89A 1S0JA 4YGEA 1ZREA 1AJKA 4AVAA 4PBPA 3RWNA 4XMIA 4YW1A 4CSWA 1DGWX 1O4ZA 2DVAA 4F83A 5L36A 4CEYB 2H6CA 4XCBA 4J1XA 2D6LX 2VMDA 3NVCA 3RS6A 1REFA 1O5LA 1CESA 5IFTA 5AFEA 3BIEA 2ZACA 1DF0A 2CTVA 3MW2A 4C8DA 1YIPA 5E6HA 3N9LA 2ORXA 4AQ2A 3IN9A 2JDNA 2ZX0A 1UOBA 2I45A 2NMNA 4LEJA 1AHSA 5I0TA 2BW8A 2DUOA 4PCRA 4OFGA 4COZA 4I3GA 3EO6A 4NPMA 2C9KA 5EXOA 2DUQA 3WDXA 1U5XA 5FZIA 4YGDA 2BBAA 3B94A 5FZHA 2A70A 1IQAA 1XB9A 1KS5A 3BCWA 1AX1A 2X5IB 2YMZA 3HOBA 4J6GA 3WV6A 3ZOIA 3OBRA 4BQ5A 4JHZA 4AVVA 3C8XA 3BOPA 4A4AA 4XJWA 5LBFA 1HB2A 1EV11 2CSGA 2IVIB 3N35A 4FBFA 1CAVA 1CPNA 4CUGA 3FUQA 3BPZA 3ETPA 1C8M2 4XEZA 3VDBA 3NRUA 1SZBA 3C7OA 2P5BA 4FPJA 4BQYA 1B09A 2I74A 4GZ9A 2GC3A 1FMD3 2RS33 3DPRB 3H7YA 3H0OA 3VKMA 1COV2 4YFWA 3FJSA 3INAA 2VMGA 3MLLA 1C8NA 3QBQA 5FY5A 3VKLA 3DKWA 2NM1A 3CBNA 4NMIA 2RS51 1GNZA 1PX3A 1WCKA 3PJYA 2VZPA 3DECA 2ZAAA 4IEXA 4IE5A 3VHNA 1JXNA 2YC0A 3R05A 3ZXGA 4ATFA 3UGFA 2CY6A 2XG3A 1NZCA 4XFAA 4E9KA 1V9U1 1AR91 1N3PA 4XPVA 4Q8LA 3C2UA 1W6NB 4Y3OA 2ET7A 3N7KA 3POSA 1EV12 3POGA 2G9GA 5IVVA 3ZM8A 2YZ4A 3WQ0A 2A6WA 2J1VA 1W90A 3KT1A 2B7YA 5HXVA 4IETA 4F7ZA 3PJQA 4LOSA 1D7PM 2XJQA 2WIIB 3ST7A 1CR7A 1DGRN 1WA4A 5TSWA 4ARXA 5J98B 4XBLA 5JXJA 2XVKA 4QQOA 3S30A 2XJPA 2ARCA 1UZYA 3V64A 2WUHA 4IEOA 4LKSA 2EIGA 1OVPA 4N9HA 3WNPA 3A4UA 3ZYIB 2OA2A 3WNXA 2VCCA 5IWFA 5JMCA 4YRDA 2QTWB 1V0AA 5FY0A 4DXTA 4LXLA 2XL7A 3PIGA 4KH9A 5FP8A 1T6GC 2X29A 2ZKNA 2EALA 4XZPA 1ND3B 3NWKA 5DN2A 1BK0A 2ZX4A 4LNVA 4EZ4A 3GZEA 4GIQA 3GF6A 4PLNA 3EBRA 5IHRA 4HT1T 5F6LB 1LNSA 4WZCA 1OPMA 4IEWA 2D3PA 4QWNA 1GZWB 1NXMA 2D5HA 3ETQA 4IEUA 5C8CB 5CU1A 1K42A 2A6VA 2DCYA 2W94A 4E2QA 1O8SA 4N7UA 1LU1A 1GANA 4JCKA 2JG9B 3M3IA 4RHV1 4CCCA 5DG1A 4RQPB 4BB3A 2WO7A 5FLHA 5FPBA 3NL1A 2KXLA 3LAGA 4Q4W3 3LOBA 2NLRA 2B39A 1HQNA 3T2PA 1PK6B 1DYOA 5FZ7A 2JDPA 3L2HA 1UMHA 1NLRA 3RYKA 3M8LA 2JE8A 1O91A 5J36A 2X5IA 2PTMA 1OURA 3J4UH 2WWJA 4E2GA 1LHVA 3RZHA 1JZ4A 4PI2A 1W0PA 2TBVA 5EFUA 2WNVA 3GGLA 4LE3A 1BMV2 4Q0PA 5LEKA 5LBBA 1HW5A 2Y6HA 2Y6FA 2ZGLA 4NUBA 4Y26A 1AYM2 2AC1A 1AUYA 3I2FA 2YY1A 1KXGA 1XJAA 3I59A 4Q29A 2V09A 2RDQA 3SCFA 3VBOB 4KU7A 4CP0A 3B01A 2VL4A 3M70A 4DMIA 4WZFA 4CDUB 3DKQA 3K77A 1CAXA 1Q43A 2F4LA 1DFQA 4XETA 2CGOA 4DXSA 4A6SA 1H8TB 1AR61 1OFSA 1SLLA 1SDWA 4ES9A 4Z8BA 3O1SA 2VC9A 4P9YA 3AVRA 3PVEA 3ZMOA 1ND3A 1ODNA 2C1FA 2ATFA 3LDKA 4O9GA 1G6NA 1XE0A 3BPSA 3A23A 1XNAA 2HKXA 2WT1A 1ZBE2 3RWKX 5FZ8A 2VOXA 2FDHA 2ZXQA 1UZVA 4L92A 4FAHA 3JD73 3WNNA 4FVVA 3MUY1 2P3JA 3RI8A 3VZOA 4JRAA 2QQMA 3RYPA 1VBB3 3D6EA 3D3AA 1AR83 1RUD3 2HWE3 1LULA 3OD4A 5A6XA 5L73A 1PO11 2W52A 5C33A 5JR2A 3SQOA 2WS93 1UIKA 5SV5A 4Q4X3 3I2OA 3I97A 5FY1A 4AGRA 2JDYA 4LT5A 1O3RA 2PELA 3WZ1A 2WN2A 3JUUA 4H14A 1AYM1 4QX5A 5CFCA 3APBA 5FMBA 3KCXA 1G7YA 4Q4Y1 3BOWA 3R4SA 1NX9A 4HFSA 4XQ4A 3WVJA 1Z78A 3I2DA 4XJAA 1OUXA 1GWLA 2Y8KA 3BVCA 5FY8A 4CUBA 2WN3A 3AL5A 5EJ3A 5JZGB 3RZMA 1RUE3 4Y20B 3EB7A 5ACA1 1LESA 3VBUA 5KWRA 4GQ7A 3H1YA 5IUQA 3ZYJB 4MGQA 2XQRA 4P5YA 1VBC3 2WS92 2WZPP 4DIQA 1UN1A 2C5DA 2AYHA 4MGIE 2VTFA 1GU3A 2ZGPA 1CX1A 4XAAA 1I3HA 3WNOA 1IPSA 1S0BA 3VBRB 1SMVA 1QXJA 1VAMA 3ME2A 4NVPA 4UFIA 3AP7A 5IJRA 3THTA 4BIOA 2GN3A 4CE8A 1KJLA 3DCQA 1E57A 1OVSA 2XLAA 4Y33A 2WKKA 2R043 4ATEA 1TE1B 5F9TA 2WZ8A 3OEBA 4HKOA 1JW6A 2OQ6A 5FZAA 1GQHA 3MFAA 4I3PA 3O1RA 3R4DB 2RM22 4IV1C 1DZQA 2VVFA 2PLV1 4ZXEA 1YQ2A 1W0NA 2G9ZA 5LCWL 1RIRA 2FZ2A 1WKYA 3BU0A 1QWRA 3Q8AA 4WM7C 4ZY9A 2LM3A 3E97A 1OUSA 1F4AA 1QY4A 3DYPA 2ZJCA 4B29A 3LD8A 3POEA 3F95A 4LHLA 5JLVA 1VB2A 1MEC1 2D3RA 1H2NA 3H1MA 1YLLA 4QM9A 4ZPIA 2WO3A 2VG9A 3J8F2 1RGSA 3MFCA 4BZ4A 4BXFA 5FKCA 4WVZA 4XHXA 1PMIA 3AL6A 1YHFA 1JUIA 5LZ6A 2WSVA 1S0GA 3H1WA 4IV1B 4GD4A 4Y24A 5ERLA 5F5QA 4A45A 4FPOB 1AYM3 2O1QA 2XPJA 1G9FA 4IV3C 4BIFA 3FC0A 1W2TA 2W68A 1C28A 5KC5A 5B4NA 1LOGA 4RGAA 3S0MA 3VBFA 1MZ6A 2RS12 4A3XA 2HWB1 1YUDA 3JD72 4XILA 2DUPA 1W03A 5FOJB 2JICA 4GAZA 1UYPA 1UYZA 1NZIA 1NT0A 1X33A 2J42A 3PUHA 3UJQA 4LORA 1QXRA 3OUIA 4KL1A 3HIFA 1UXZA 3OSDA 2QDNA 3H3UA 2W9XA 2CV6A 4FSJA 5F3GA 2A3WA 4RR3A 1MZ5A 4XUQA 4W6XA 5FUIA 1BVVA 4D8MA 2Q8OA 4BM8A 4URAA 4OI4A 2B4KA 3IDEA 2BUKA 5GJ6A 4MG2A 2W1SA 1JZ6A 4CXYA 4QGNA 2E7TA 2RE9A 1W05A 3MIBA 2ZHLA 1JYXA 3AYDA 1OLRA 4G4FA 2MEV1 5HI0A 1OOPC 2ZMNA 1D4M3 5GLZA 2V4VA 1RHI2 3THDA 3TN92 1JU3A 1R082 5C5UA 1V00A 4QU2A 1LRHA 5GZDA 3O0XA 4FFGA 3FZ3A 2W95A 4M3CF 4LK7A 1UQXA 5C8CC 3WP5A 2ZGQA 4AWDA 2JG8B 4CP2A 3LEKA 4H7MA 5CAZA 5AFBA 1RUI2 4RGGA 4UT5A 1ZZCA 5ABJB 1LOBA 2UWAA 2W87A 5JSOA 5JZGC 4JV4A 4WM7B 4ORFA 1US2A 1JZ5A 5I93A 3D0JA 1G9BA 3OPZA 5ABJA 1SHWB 3H42B 5BNPA 1LB2A 2WO1A 4E8CA 2DV9A 2HEVF 1AF9A 2ARXA 2UWBA 4XFIA 4XE9A 1D4VB 1IS3A 3I59B 1PMJX 3OY8A 4AXOA 4RFRB 5BV6A 4NIIA 4UYBA 5HBAA 2D40A 2DFBA 3AZWA 2HYXA 1JH5A 2W0XA 3N9NA 4NN0A 4BHPA 3HR9A 4N43C 4FAGA 3CZUA 3RRDA 3I3BA 2XHNA 3USUB 2ZGMA 2WABA 2XH6A 1R081 4CU8A 3VDCA 1UOJA 1BEV1 3VD5A 3CJIA 3GDBA 4GH4B 4YARA 3IIIA 5K7PA 2LROA 1HKDA 2RVAA 3PL0A 4NROA 3NV4A 4DFSA 3AKPA 2E7AA 3JBG2 2WL1A 5FZ9A 2VOKA 4BLIA 4DQAA 1MEC2 5FPLA 1QOSA 2C9AA 4Q1RA 1D2QA 4QB2A 2YBSA 1ONAA 3NNFA 4YVSC 4C0BA 4NHXA 4CEYA 1F9KA 2QQIA 1I6XA 2PHUA 2R1DA 1JUHA 4DUXA 4ZXKA 1OOPA 3ZYPA 3MIEA 1UD1A 1OC1A 1WMDA 3IBMA 1NA1B 4RQPA 2RM21 4XAEA 2BZDA 4ZONA 2ERFA 4FI9A 4TXWA 3SEEA 2OVUA 4YZ5A 4DOUA 4MZUA 5CFCB 2W39A 4B1LA 3WR0A 3WSOA 3OGRA 4OMDA 4TN7A 5FP4A 3HMYA 4NE9A 5FUNA 1NOVA 3K3OA 4L0PA 2DVDA 3FE5A 3RFRA 5C9AB 3J8F1 2Y6JA 2ZTNA 3NKGA 3ZSJA 5JZGA 3ZN6A 4A7KA 2DWRA 4K9SA 2QQLA 2GU9A 3C7FA 3ZN5A 3HN1A 1L7RA 4FXKB 3OJBA 1UY1A 1GICA 1CAWB 4B8EA 3CHXA 1ZA7A 1YWKA 1UF2C 1FOD1 4NHMA 4QX0A 1OD3A 5FPVA 3N9OA 1CVNA 2YDEA 5HCAA 2OW4A 3N7MA 4GA9A 3W21A 4YZ4A 4CP9B 5DZEA 2WYFA 4RGKA 2WZR1 3GZUC 4DB5A 1RHI3 3MIHA 3ZDVA 3ACFA 1YXWA 2WFPA 5L7OA 1UOGA 1RUG3 5K0UA 3ZFFA 2WC2A 5I0SA 4HG6B 5D8AC 2GMEA 4HSLA 5FMCA 4KWJA 4QQPA 2P2KA 3OGVA 1W2AX 3W5MA 3ZFFB 4IUGA 4ASLA 2GALA 1QHDA 1OF3A 1U5IA 5DAVA 4ZZ5A 1CQ9A 1XQNA 4META 3H9AA 3VZLA 3ZDSA 1MS4A 5DG2A 3DN7A 1W28A 2JE7A 3AM2A 1C8M3 1MS0A 1QJY3 1AJOA 4OULA 4Z2WA 4PIXA 1OLQA 1YO8A 5A3MA 4K3UA 4QDSA 2HWE2 5FZMA 3OBAA 2WNUB 1LKNA 2PYTA 5A7NA 5T3NA 1Q8QA 1ZBE1 4AK3A 5FRAA 1QMJA 1W6OB 1MPXA 1F8VA 1FV2A 3AMPA 1BBT3 1BHGA 2AZ5A 2MPFA 2WNVC 3OCPA 2GC0A 4K1ZA 5APAA 2JDUA 1W9WA 1ZBE3 2Q1MA 3BODA 3D0SA 5FFOC 3ZYBA 4J1WA 3AKQA 2HWC2 4FFFA 4AEKA 2VZVA 4CUCA 1RMU2 1LGCA 2ET1A 2E7QA 3CJXA 4D3WA 2AGSA 3R0RA 2VZUA 4D7YA 2AREA 4Z07A 3B00A 4MLOA 1B35C 1OLMA 2VY0A 1SLBA 1H8TA 3AK0A 2LALA 2J7MA 3NJZA 4QHZA 4XHBA 4QD2A 4MHUA 1YRZA 3K51A 1R091 5FP3A 2VBDA 3ZXEA 5A7PA 4CDUC 1RUC2 5EJ1B 3ZSEA 4Z92B 5JOWA 2VUJA 3OTFA 3VZKA 4CDQA 4UFMA 2WYSA 3O7OA 4XDOA 1ND3C 3TRSB 2IXJA 5K0UC 1XNCA 4AFDA 1VAVA 4LLFA 4QHOA 4YM0A 5FZOB 4JZRA 1NQJA 5IT6A 1NCQB 1HN0A 2C0ZA 3PDQA 2GNTA 2OPWA 3U1XA 3U07A 2HWC3 1JHJA 1O7FA 4CXXA 1JYTA 2VQUA 4LO8A 2BWAA 4XUNA 2RG4A 1XBFA 5JIUA 4JRLA 4YW4A 2Y0IA 2YG0A 1KDKA 1XNDA 1MS5A 3NAPB 5LY1A 5LRSA 1N1YA 5CFDC 5F7UA 4DINB 2FDFA 1WW4A 3WG1A 2V72A 1FATA 1QOOA 3MBWA 3VB9A 3BGAA 2XJSA 4AEDA 4PF1A 1NCRB 4QXBA 2R30A 2QQKA 3RZJA 3O1MA 4HMZA 3N7JA 4PT6A 2ZCWA 1S2KA 2WNUA 3EQEA 4NHKA 2OPKA 2VO5A 2IXLA 2PAEA 2AACA 3ZSLA 3LEMA 5FYSA 4Z82A 3LIHA 4P9GA 3VBUB 4HPKB 2OUHA 4JGYA 1EAH1 5I0RA 1H1AA 1NLQA 3KT7A 3I2GA 3VLBB 1XNTA 1H8TC 2W5FA 4XJUA 2V73A 5I8TA 5GALA 2WFF1 2P17A 2R062 1S0FA 4GH4A 4XTMA 4CDUA 5A6QA 1MS1A 1GOGA 4OI1A 3LIGA 3TOJA 4Y1XA 4D94A 3MZHA 1W6PA 4EN8B 2BFUS 2HWF1 1GNHA 2YXSA 1RHI1 1BYHA 3A22A 4IV3B 4X8PA 5LRRA 3ZFEB 3DYMA 1UKGA 1SBDA 3USUA 5HCFA 2XJUA 4Z2AA 2BWCA 2ZZJA 4K1YA 5FCCA 1E5RA 4PDWC 4XIOA 1AX2A 4DO0A 5GLUA 5FZDA 1CIWA 2B45X 1ST8A 5FLIA 2XONA 5H9SA 4Q5OA 1XU2A 4PF5A 5LK5A 1IOAA 4BQ4A 4AYUA 4CCEA 1YFUA 3AKRA 3R4UA 1SBFA 1H30A 2AEZA 5CFDA 3TAYA 2QFEA 1MQTB 2R063 4LBNA 5LB6A 2A71A 3KLSA 1S0EA 2VCBA 1SLIA 2VOTA 3KV6A 2FDIA 4NIDA 5EZWA 2GP5A 3RZKA 5AVAA 2Q8CA 1AZDA 3AVSA 1OT5A 3VD9A 1I5PA 1JBCA 1EPZA 5IW0A 4XXAA 1GZ9A 2W1UA 2R0HA 1RMU3 4LMFA 4NPRA 3DGTA 4URTA 1ODMA 4FPEA 4XDQA 4GKXA 1Y3TA 3WW1A 5F1RA 5A32B 3MW3A 4JGYC 5B2GB 1PVC2 1UU5A 1JZ2A 3VBFC 3H8OA 4CU7A 1WWYA 1G86A 4AI2A 1VBD2 1MQTC 1XYOA 2XBO1 4XBNA 4CDQB 3N3HA 5FXWA 2XVLA 2ZEXA 1YQ8A 4GALA 3RZGA 1RUH1 2D6PA 2SLIA 3KVAA 2Y38A 3LEIA 4P08A 4Q0QA 1HRI3 4ASKA 1CN1A 1ASJ1 2RS52 1SPPA 1TEIA 1BXHA 1R092 2X10A 3D4KA 2DFCA 4FPKA 4M00A 4MXVA 1RUH3 2XUEA 3TBDA 1JYNA 5E1RA 4R9BA 1RJ7A 2XOMA 3LGRA 1H2LA 4PDWA 1IKPA 1H6YA 1A78A 3N9MA 4UAPA 3T2QA 3USSA 3VKNA 4BXSV 3ILRA 1OA3A 1BLZA 2R072 5AC92 4OUEA 5FZ0A 1L7QA 1RJ8A 5F5CA 4P9XA 3B7MA 3NW4A 2P4EA 3PVBB 1RITA 5FYHA 1IG0A 4DEVA 2Y0OA 2VZOA 3ORJA 2BNMA 2O8OA 1QJY2 1NA1A 1N3QA 3URFA 1RUH2 3I49A 4H55A 1N1VA 1YJKA 2E6VA 5HV0A 1T6BX 3M3EA 2VTXA 1L7LA 2EF6A 2A3XA 1RVF3 2YPJA 1H2KA 1LHOA 4P02B 2QCSB 4TSVA 1C8M1 1X9PA 4LO6B 2GNDA 2EIBA 2ZGTA 3R6SA 1Z7S1 4DNYA 2BJSA 4D6SA 1WZXA 1W8ZA 1W9TA 2GNMA 3WNKA 2MHFA 1JZ8A 2B8MA 1UOFA 1SACA 2E53A 3H7JA 4HL0A 2OKXA 3WHUA 1ND2B 1RL3A 2AEYA 4QPIB 4QU1A 4RHV3 1HXS1 4UBHA 3D82A 1AL22 2XGXA 3WW4A 1QJX1 2VPVA 1XYPA 4F8AA 2CGNA 3AP4A 1ULFA 1ASJ2 1H1MA 1IGOA 2GNBA 2R32A 3PLQA 1UU6A 1YNAA 2EAKA 1BEV3 1NCQA 2G1MA 3CF6E 3NNLA 5IVFA 1E5IA 1VE0A 2WLQA 2QDRA 2ZX2A 3FHQA 4JQRA 4AHXA 4DXRA 4EN6B 5JMOA 1LAJA 3HBZA 1FOD3 1H6XA 3OF1A 4CDWC 4B4RA 1GBGA 3FBYA 2D6KA 5IK7A 1F5JA 4W8JA 4M01A 4XBQA 5EYXA 1RXFA 1OPOA 4A42A 4EE2A 2PFWA 3BTYA 2VBBA 3VHPA 5GLTA 3WF4A 3BB6A 1UZ0A 1VIWB 4AVTA 2JG9A 4XF3A 3B9CA 3GJBA 5F5AA 4RQPC 4PDWB 4XF1A 2GP3A 3KQRA 4CCJA 4EWDA 2D6MA 1AR82 1RUD2 5D8AB 4HVRA 3BTXA 2IFRA 3CL1A 4KGQA 1PHMA 3AFGA 3WNLA 1VAKA 1FPN2 5LA0A 5EQUA 2CWSA 4UBGA 1BMV1 2YGMA 4RD7A 3ZXAC 4NIHA 3E5XA 3VKFC 4Q4X1 5CKNA 3RG0A 4OQ8A 1LECA 1JHNA 1GP5A 1K5MA 4D6QA 1IHMA 1JOPA 2A75A 2VMHA 3WQ1A 1AYN2 5FY7A 3IAPA 4NRMA 1Z7S3 3U4XA 3P6BA 1O6UA 1REEA 4YZ3A 5L9BA 1WLDA 3LKJA 3VDAA 2I2SA 3E5QA 3AYEA 4R8HA 2Q0AA 3ZXLA 5FXZA 3GHMA 3GBFA 4JGYB 4CYDA 4FTSA 3ILFA 1CGPA 1R083 2F6BA 4CZSA 3DL3A 1WGPA 1DZRA 1S0IA 4W65A 1ULOA 4HZFA 4KQ7A 2QQWA 1K12A 1WA6X 4QPWA 5JI9A 4GJZA 1HRV1 2ZEWA 2QQUA 1PM7A 1KFUL 3POYA 1TME1 4X6RB 3QOPA 3GNEA 4AVSA 5HCHA 1PIV3 4PBOA 2QUOA 1HRV3 1OI6A 4XUOA 4FPLA 5E8AA 1LGBA 4QDRA 3MLJA 4Q0VA 3E6CC 2Z4FA 1PIV1 3NJVA 1X7NA 5I8YA 1V6IA 1RUF3 3HN3A 4DY5A 4NAOA 1H9PA 3W59A 5FZKA 2C26A 2IVJA 2WFF2 2R7EB 2VNGA 1TQ5A 2VW1A 1Q8VA 1S0DA 2UURA 4XFHA 4M0NA 2LW8A 1RUC3 4RS5C 3WG3A 2WAOA 4W6YA 3TN91 1W6MA 1PIV2 5FPXA 1RUC1 2PN5A 2VQ0A 1SQ4A 3TEZA 2GH8A 5KHIA 1XNBA 2ZEYA 1VBE1 3IPVA 1YIFA 3ZFGC 1DGRA 3ATGA 1SG3A 2J1RA 4YVWB 4CCNA 4FFHA 3MUZ1 1QH7A 5F2SA 5FOBB 4Q0SA 1WCQA 1L3JA 5JXIA 2BYVE 5CKMA 2CDPA 1PO13 3VKOA 2DURA 3AYCA 4C91A 4ZU4A 4LUMA 3SH4A 2FD8A 1PGL1 5GLWA 1SFPA 3HD8B 1RC6A 1SLAA 5LY2A 5D21A 1QKQA 3VBOC 1F35A 1GFF2 3Q9OA 5A7QA 1XPWA 4Y5Z0 3WOGA 5ANNA 4BISA 3GZTB 3N9QA 1YJLA 4QQHA 1V70A 3DXUA 5FJHA 1W06A 4RR3B 4JGZB 1YCIA 2DYCA 1W2NA 1Z0HA 1HJGA 2VUDA 4FQ4A 3T4HB 4BQWA 4AQTA 1LJ7A 2W46A 2RS11 2WZR2 4S2HA 4IEZA 3V0AB 1DCSA 2VNRA 5FY4A 1NY72 1UNBA 1UX6A 4L97A 3LB9A 5FP9A 3CKHA 4EJRA 5EIYB 4Y4RA 4YFZA 5EYYA 4BCUA 3WUDA 3LCPA 4IEQA 4PHZA 2BDRA 1QJU3 3CQOA 5L9VA 1NCRA 3UK9A 1VRH1 4MUVA 2XHKA 1K5JA 5HXMA 2VCMA 1PNFA 3HAGA 4FP2A 4RS5A 2WQ4A 1LOCA 5D1IA 2JB8A 2WNVB 2EXIA 5DDJ2 2RS31 3ZKUA 1QXPA 3FN9A 2Y26A 1Q56A 5J37A 4PIZA 5FZGA 2WNUC 1F31A 2A3YA 1S0CA 1W6MB 1K3IA 2R042 4MHRA 5BNPB 5LA2A 2WAAA 4MXWA 4K6BA 4FPFA 4Y1UA 1DG6A 1RUOA 4UW6A 4XF9A 3LSEA 4YM2A 4MGKE 2V4AA 3ZR5A 2RS32 3AKTA 4FPHA 5FO9B 4GKYA 5DUWA 4MGYE 4Y1YA 3WW2A 4FCAA 2HWD3 5A32A 5JDBA 1W39A 3WDUA 1BZWA 2WT0A 3AP5A 1F15A 3GCXA 1ZVFA 2XL9A 5T5PA 1PGW2 5BNOA 4QB6A 2GH2A 2IXCA 2WINB 5ACA3 3VDDA 3WNMA 2CL2A 4JGZA 2D6OX 3K75B 5DAQA 1ZRDA 1ULCA 2ZGKA 3EXUA 4AI1A 3FHIB 1QJU2 1RUE2 2EXHA 2ENRA 3B3QE 4RA0A 4IEPA 2UU8A 1VRH2 1VLNA 1LEDA 2CGPA 1BQPA 3WLUA 1C1FA 1RVF1 4QXKA 1UY0A 2VTXJ 5JI7A 1NCRC 1GQPA 3B69A 2YC2A 2D93A 4CU9A 4XMAA 4SBVA 3U75A 4IESA 1AXZA 3KCYA 5C9AA 1J83A 5J96B 4JTOA 4C0HA 4N43B 3POIA 1HB3A 3N7LA 1EPWA 1ZA4A 1ENSA 2FCUA 2IXIA 2R16A 3GZAA 4DUVA 4BH9A 3HNBM 4QGMA 5CG8A 4Y20A 3OGJA 4EV0A 1WMEA 2MEV3 2Y6LA 3O1TA 4NWVA 3OBTA 5IK8A 1KGYA 3M1HA 3UESA 1MS3A 4N9IA 4MVTA 3WDYA 3DUIA 1BKZA 4KNCA 2HJIA 3M7AA 5KXEA 4AI0A 1U0AA 4AL9A 4HXCA 3HWJA 1VR3A 3LA2A 3POBA 1CAXB 1WCUA 2JKBA 3OPWA 4LKFA 3O1PA 2Z42A 2J22A 3VD3A 2VVDA 1X9TA 3NV3A 4A7ZA 2RHPA 4HSJA 3JBG1 3AXEA 2MEV2 4FOYA 2OX0A 3PUIA 1ND2C 4QPIC 4XW3A 3RJRA 1F2NA 5B4XA 1TMF2 2ADEA 2BBVA 3H3LA 3KV4A 4YW5A 3NAPC 2HWF2 4C1XA 5FPAA 5CKQA 3ZYGA 4NR1A 1OXCA 4TLFA 3WF3A 5K8SA 1ULDA 5JOZA 2ZHNA 3FLPA 5IYYA 5KR7A 1UY4A 3RPQA 1H4GA 5C71A 1RUNA 4P9IA 2OIIA 1JS9A 2IFWA 1XOYA 4LHSA 4WBBA 5K9YA 5H9PA 3AZYA 5KHHA 3VBSA 3LA3A 4Q4W2 4AFMA 4YNIA 3U0ZA 3KT4A 4Q27A 2C4XA 4D6RA 4A7YA 3T0DA 2VE1A 5ANQA 4LTAA 4B7EA 4MXWB 3RMXA 2Y33A 1D4M1 2JIJA 3I3QA 5HCBA 3H8RA 2FDKA 4Y1VA 3WF2A 3JU9A 4AHWA 3AC0A 5KHKA 1TME2 1D0GA 3H50A 1GZTA 1URXA 3NV1A 3BN6A 4IE0A 4KG8A 4M3CB 4S2DA 1UX7A 3MV11 1YQ5A 1IG3A 2RM23 4CDXA 3I7DA 2A7AA 4KWKA 4KMQA 1I5ZA 2PQSA 1CAVB 3A0KA 1HX6A 3I2IA 1RTVA 2HWD2 5IK5A 4LKDA 3V65A 5IAVA 1JODA 2BTVC 4ZZ8A 2P1BA 1AYN1 3SITA 1UPIA 2H6BA 4ES8A 4Q4W1 2FDJA 4XFCA 4QX3A 1J1LA 3VD4A 1W6QB 5K4LA 1PGSA 1J3RA 1OSGA 5C6CA 1CZTA 2VJXA 4LO5B 1EP0A 2VGDA 3HQUA 1GKBA 3P3NA 5BNNC 2BGCA 1AYN3 5IVEA 2KD7A 4FOVA 1LEMA 1UZZA 1W6QA 3WHTA 1PGW1 3RGBA 4BDVB 2VMCA 3NAPA 3WDWA 3SKVA 2HBUA 4LJHA 1GSLA 2JG9C 5FWJA 5EJZB 3AP6A 2TNFA 3PURA 5F3IA 2C6SA 2QKDA 2W2IA 1RUJ3 3N36A 4HANA 2XDVA 5DDJ3 5BXXA 3WDTA 4AOCA 4E8DA 5CISA 4MO3M 4F3JA 4XF4A 2DBNA 3UETA 2VBPA 1JYVA 1VMJA 4ZKTB 3K4ZA 2VZSA 5DUXA 3Q8FA 4NPLA 2UYAA 1ZRCA 3VBSB 3GALA 5BNNB 1GWKA 3UKVA 5KXCA 4K8FA 1GLHA 2XJTA 3AMQA 3GYDA 1YI9A 1UCXA 2VUAA 3P3PA 1NUKA 2WJSA 4JHTA 2J1TA 3ZN4A 3OD0A 1S2EA 5A33B 4QM8A 4XTPA 4LBJA 2XLGA 3T0AA 3JXSA 2EA7A 2RV9A 2EXKA 3X29B 5DMYA 2PMWB 1XXNA 4CDXC 3QLQA 3I3MA 2R49A 4OI2A 1VBE3 4QXHA 4AI9A 1PM4A 2JEMA 5JR7B 1LHUA 2E32A 3OEAA 3ACGA 3KD4A 3ZFGB 3LE0A 4LO4B 3Q8BA 3WP3A 1JU4A 2E33A 2P34A 1VPHA 3AMMA 3WCSA 1GQGA 2YYOA 4NJ4A 4UI9L 4BWOA 3AKSA 3UKNA 4MGTA 1NQDA 3OYWA 4LO7A 3W58A 2WZR3 1GZCA 4P14A 5EHDA 1IQDC 5FYMA 1N1SA 5FYTA 4E2SA 2VMFA 4LA3A 1TVGA 2QQNA 4AI3A 1J3PA 3S7IA 1WBFA 2EVXA 3CIHA 1XE8A 3TEYA 2NP0A 1DZTA 1OKQA 3WQ7A 2VH9A 2HWB3 2ZGRA 5AC91 1KDMA 4BE3A 1LODA 1R1A3 1FAYA 2BP6A 1A8MA 2BNOA 1DLLA 3ZFEC 4CU6A 5T52A 4BQ2A 2GAUA 1VBA2 4X6QB 1VBD1 2ZKLA 2Z2SB 4G3YC 3VD7A 4Q8KA 3Q8CA 2NN8A 3OGSA 5T50A 4QX7A 3PUQA 4CCOA 4R9CA 2TEPA 4L99A 5GZGA 3VZJA 3T1LA 2VXJA 3DV8A 4IGPA 4OHZA 3THPA 3F2ZA 3IMNA 5FZCA 3UL2A 4YVWC 4JKKA 1YEWA 4O61A 4CTEA 3A7QA 4WM7A 2Q1FA 1WBLA 3ZYHA 2Y60A 4CUAA 1PVC3 3T3YA 2BVVA 2PHDA 3WG2A 2WWSA 3VBOA 1W3VA 3T2TA 3FFQA 3O0VA 5K0UB 2Q1ZB 3HBKA 1AL0G 5FZ1A 1XE7A 2RMU1 3M3CA 2PLV3 4ZS3A 4BK5A 4XURA 2VQTA 3WINE 1PMHX 1FPN3 1TG7A 2E51A 2CNAA 1AXYA 2WWUA 4CEWA 1RB8G 4YG0A 3G6JB 2DDUA 4BMBA 2A5ZA 2HWF3 3IZOA 5C4WA 2HWD1 3VUOA 1W6PB 3I8TA 2Y34A 4OUSA 4S2FA 3C3VA 4AW7A 3SNMA 3JQWA 2DTWA 4IL7A 4Y22A 3NMBA 5F2WA 3DF0A 5AVPA 1FMD1 3PMEA 3N9PA 3WXPA 2YUEA 2HBTA 2WO2A 1VBA3 2O14A 4U2AA 2XVGA 1WD4A 5IFPA 5JPMB 3CMGA 1C57A 3KV9A 2VW2A 5T54A 4ET7A 4FO9A 4KI5M 3FX3A 3S6PA 1QJZA 1PO22 2OZJA 3HNYM 3IM0A 4XJ8A 1VBC1 5FDBA 4YSFA 2CU5A 2PHLA 3KZ4C 4YM3A 2BQPA 3GCWA 3ROUA 4YM1A 1C4RA 5FWEA 3CJIC 4K21A 1COV3 4AEDB 5HV4A 3S5AA 1IS4A 3AYAA 3JD71 1CAUB 2QJVA 2GDFA 3KSCA 4I09A 5FZ6A 4AR2A 4RSUA 4YW7A 1R1ZA 4YVWA 2R061 1VB4A 3KF5A 2ZBJA 5KHGA 3NO8A 1SLCA 4GULA 2E31A 3RDIA 3ZN6B 2DTYA 4COVA 2QZ2A 3UNPA 1BBT1 1WLWA 4FOWA 4EWAA 4XC9A 4JC1A 5F3EA 2XKOA 5LA1A 4CDXB 3ZMNA 4K8RB 3O1OA 5CIRA 4R52A 5KXDA 4LHKA 3AXDA 2BOIA 4FT8A 4EROA 2A1XA 1DYPA 5A7OA 3OUJA 4FPGA 4A3ZA 2B46X 1DLCA 4UXAA 3W5NA 3VGIA 1PZ9A 1UY2A 4JGZC 4PQ9A 2DVGA 2XJRA 4LITA 5C4WC 4I0AA 4CEWB 3T09A 4Q1PA 3G7DA 5FYYA 2WFF3 1QNYA 3QH7A 1EV13 1DQ4A 2CHHA 2ZGNA 4Q4V2 1LU2A 4E27A 1H9WA 1YFYA 2UY8A 5FYCA 1OQEA 1Y9GA 1GP6A 2LUWA 3ZSMA 3FBMA 5FYZA 5FXVA 3IKWA 4MOAA 4QQ2A 4R9AA 2XUMA 2IXKA 4D7SA 5JVVA 1RUJ2 4QT6A 4MADA 5L7OC 3TEWA 4TZDA 1AR72 3ZFFC 1WCSA 2WA3A 3AJYA 4FTBA 3U78A 1HN1A 2B5HA 2ARBA 1EY2A 4H7LA 3V0BB 2QVSB 4YGBA 1ZM1A 4P9JA 1REDA 2YPDA 4AEJA 1PNGA 4MGSA 3B93A 2VZTA 1N3OA 2A6YA 3MO4A 5EWSA 5FK8A 1C5HA 4DY3A 5CZKA 4CEYC 2K0GA 3V0BA 2ARAA 1CAUA 2QQVA 2VOVA 3AMHA 3NNGA 1JYWA 1OBNA 4NHYA 1R64A 3TB0A 4JAAA 2PHTA 2VOWA 4YW6A 1IPKA 2NZ9A 5FZEA 1ZBA2 1V6KA 3OYWB 2Y6KA 4HKLA 3WQBA 3ZYRA 1X8MA 1ZX5A 4TWTA 1UYYA 3DYOA 4QHBA 2CAUA 2ZOEB 1DYKA 1TME3 3ES4A 3SEPA 4IE4A 5DUVA 2DVBA 4HVOA 5FP7A 1WD3A 3THCA 1FNZA 1KITA 4Q4Y2 4UF0A 5L9RA 4E4DX 3KMHA 5L19A 2ID4A 1DQ6A 1WW5A 1UYXA 5GZEA 3LEGA 4M0HA 4MX3A 2GZWA 1X82A 4BU2A 5T5LA 3U4SA 1DU3D 2WZEA 3MGUA 3RJ2X 2R071 4UW5A 2IUWA 4CDQC 3JQXA 5BYNA 4AVCA 4AFCA 5DZGA 5D8AA 1G9DA 3K2OA 5A7WB 5DDJ1 3AX4A 3ZSKA 2RR13 5DAPA 1JTZX 4AE2A 4M3CA 4AAPA 5LW9A 4XFBA 1ULEA 1AL21 2TUNA 3FLTA 1COV1 1V9U3 5JIAA 1H1IA 5CA6A 1W9YA 2H0VA 3MPPG 4CA9A 1Y4WA 4N53A 1ZZ9A 2WS91 4N8MA 1Z7S2 1U12A 4V2WA 3ZVXA 3J26N 4Y5TA 5J09A 3VBRA 4XXPA 3VV1A 1ENXA 5JCTA 2XBO2 1VBB2 3CU7A 3ZO0B 1AR93 1Q8PA 3HEIA 3VBHA 4QQLA 1GUIA 4XUTA 3ZXKA 4AI8A 2X5IC 3GXUA 3AZXA 2B9VA 5LBEA 3SCGA 2NPIA 3KV5A 2PQQA 3E6BA 3PNAA 1IKQA 2RDSA 5CBLA 4YYOA 5EV7A 3ON7A 2W1WA 1OD5A 4PLMA 4WVWA 3NNMA 3B9IA 4SLIA 2JD9A 2P3YA 3KGZA 4HKWA 4XZUG 1I9RA 5FBJA 1LHNA 1PK6C 4NHLA 1WW7A 2RS13 4YZ1A 5LBCA 1ALYA 4TTGA 4BK4A 1WCDJ 4RHV2 2J1UA 3C7EA 2BERA 5BPXA 4AAXA 1T2XA 5IVJA 4YWAA 1ASJ3 5A3NA 1FMD2 4FFIA 4GWMA 3IIAA 2I07B 5GZCA 1HQLA 1OFNA 1QQP3 3UKTA 1POV3 5GM0A 5BY5A 3MF9A 1O3TA 2W92A 5LWBA 3BYWA 4MSVA 2MNGA 2PHXA 5A80A 2ZHKA 1TZOA 5IVBA 4D7TA 3SLIA 1KEXA 3UYJA 4ASMB 4QPGB 4RFT0 3UT0A 1RINA 2VUCA 1KJRA 1HV1A 1W8HA 3K48A 1RUF1 4OLLA 5C70A 1QEXA 2EIEA 3GBGA 3OOXA 4IW3A 4AFAA 4UFHA 2J1AA 5F39A 3SKJE 4XOGA 5JUVA 1OKOA 1JN2P 1MEC3 5GZFA 2C24A 3AB0A 1AR92 4XUPA 2DF7A 2HEWF 4XQWA 1KFXL 2RJLA 2E26A 1VJ2A 2EXJA 3L9JT 1KS4A 3TN93 4DRRA 3VBRC 1GZWA 2WSUA 5FREA 4GMP3 1BBT2 2E9QA 2JXAA 4DS0A 1RUI3 4C90A 2OZ6A 3KB5A 3U14A 4NRQA 3WP4A 1ZBA3 1KRIA 1GOFA 3WUCA 3MDPA 1RXGA 4NAMA 4ZHNA 1V6LA 3MIFA 2VCAA 3B02A 2AUYA 1RUI1 4LIVA 3CZJA 5T5OA 2RR12 4YZ2A 1CWPA 2CDOA 1HB1A 4AF9A 2FDGA 1FYUA 2VD7A 1PK6A 4XFFA 1GNYA 2EICA 2EAAA 4UW3A 2QQJA 3ECQA 4FPYA 4QKFA 2D3SA 1DQ5A 2YROA 2VZ1A 3LFMA 2W1QA 3MF6A 4H3WA 2IZWA 2PAKA 2Q30A 2AH2A 3AFKA 4RYDA 5C3OA 1IZ3A 2VU9A 5DZFA 1LHWA 4LQRA 3LPFA 4GH4C 4LOTA 2FBEA 3OG2A 2QZ3A 4AQSA 3EYPA 1JYIA 4GMP0 5A3PA 5ISLA 2V5DA 1HXS2 1NXD1 1RUG2 1V6JA 1ZRRA 1JOJA 4BQ1A 2ZA9A 3QCWA 2XXZA 1W2OA 5JOXA 3POFA 1UWWA 4J25A 5C3RA 1W6OA 3OUHA 2H0BA 3I2JA 2DU1A 3J7HA 1MACA 2GN7A 4BPZA 1NKGA 4IV1A 4R4ZA 2D5FA 4WM8B 1DQ2A 1UMZA 1DP0A 1UMIA 4PI0A 4JDMA 4YW3A 3N4MA 3QACA 2BEOA 2HWE1 1IS5A 3WX5A 4LHNA 1SCRA 1PO23 4DRVA 4E4ZA 2J1SA 5SV8A 2UWCA 3P1IA 2GC2A 4XJ9A 4YG6A 1SLTA 1Y9MA 2WNOA 1QH6A 2GC1A 2YFUA 1POV0 1G9CA 5C7GA 2L9LA 5DABA 2SBAA 3CLPA 2EIDA 3KF3A 4LBOA 4XACA 2GMPA 5CFCC 1AR81 1RUD1 1ZBA1 1ENRA 2XB6C 1Q3EA 2BRTA 4AGVA 3ZXDA 4Q0UA 1MS9A 4DZGA 5BNOB 3FLRA 4GB31 2VULA 2D7FA 2OQ7A 3ZR6A 3WF0A 4PQQA 1LCLA 1XNKA 4YW2A 5HPOA 1W8UA 1D4M2 3HVDA 5C3SA 3S5QA 1FNYA 1US3A 2WLPA 2ZMKA 2HYKA 4HETA 1WUVA 1RMU1 4OYUA 4FQZA 2W91A 2O8QA 4COWA 4M4RA 1ENQA 1F5FA 3AP9A 2E63A 2ES3A 1NCQC 2XQXA 5GLVA 3ZXFA 1AR62 2G19A 3AZZA 3MICA 3EJKA 5FYBA 2JDMA 4DXZA 2ZABA 3NV2A 5J48A 1O3QA 4QKBA 4IE7A 4S2GA 3HNMA 3J7LA 4IE6A 4UFLA 3TYJA 5KHJA 1X50A 1IPJA 3MHZA 4DUWA 4NWWA 5I8SA 1K45A 1K5MB 2G9FA 4X8NA 1H4HA 3FFZA 3VHRA 3T30A 1GR3A 2VECA 1CZSA 1BEV2 5A3WA 1TNFA 3EMRA 4H2AA 1AR71 1YQCA 1MZFA 2YC4A 1SPPB 3ZX7A 5DXDA 2DCKA 4IDZA 4BA6A 2JDHA 2VVEA 4W6WA 2VNVA 1Q8SA 1UW8A 4W4ZA 4B4QA 1HDKA 5J7MA 5C3QA 3ENRA 1OH3A 3IWZA 1CX4A 2R1BA 3O5SA 3O0WA 3V0AA 1NG0A 4HOOA 2LTNA 2RS53 4COYA 2RJKA 4L2NA 3WD5A 2LRPA 1CJPA 3JBG3 1N47A 5J3UA 4M4PA 1QGLA 3BIWE 4IV3A 3TWIA 4AQ6A 4AEMA 5JAXA 2FZ1A 1PGL2 1GP4A 5LA9A 2VW0A 3ACHA 5JXHA 3RZZA 1EYBA 5IAXA 4AGGA 5FIXA 5FMOL 4KWLA 1OH4A 1PO12 2JIGA 1RUG1 4OCTA 4HN1A 1VMFA 4EZHA 2ORZA 1MVEA 2JD4A 2D44A 3ACLA 2QE3A 1WW6A 4KBZA 1OHFA 5A3LA 2FCVA 3MLKA 1AX0A 1YQ6A 3I3DA 2DCJA 1F4HA 2Q8DA 1Y43B 2LS6A 1RVF2 3OGGA 1HXS3 2ZEZA 4JDOA 4OMCA 3VL8A 5F37A 1O4YA 1V6OA 1S2BA 3RNSA 2WR9A 4RR3C 4WM8A 4O65A 1W3XA 4BYYA 4LE4A 4GXLA 3M3QA 5LATA 3VBFB 3D8CA 2VZQA 2HEYF 3SCHA 1STMA 4YVSA 2FMYA 2KA3A 5I91A 2PLV2 2A73B 3BKZA 1WLTA 3ILNA 1VBE2 1CAWA 3T2OA 4OHYA 3SH3A 2Q5TA 4HLTA 4XFGA 3SXWA 4ARYA 5C8CA 1GYKA 2PA7A 4JVAA 4GWIA 2AENA 3WF1A 5JSRA 1UO9A 1QU0A 4I0WB 1K5MC 1UAIA 4ZU7A 4EN7B 5A1LA 2WQZC 2KM2A 2XWJB 4HVQA 2B42B 1A3KA 1ZNPA 5F6KA 4WV8A 5ABJC 1NYWA 3WDVA 3WEZA 5BNPC 2NYYA 4BMEA 4OHXA 5M0TA 3JCIA 1QJFA 1H0BA 2ZS6B 1X36A 3U11A 1C3HA 1HV0A 1R1A2 1HRI1 5KXBA 1VRBA 3VHOA 1OQ1A 2HWB2 4QGLA 4N43A 4QXCA 1AVBA 1EUTA 5T55A 5CG9A 4EWEA 1U5YA 4A44A 5D2AA 2K46A 4AVBA 4B4PA 2UY9A 4MGZE 2QQOA 1QOTA 3T1MA 5FJKA 3ZLIA 1UU4A 5I0UA 2WRAA 4BJ0A 1W8OA 3LFIA 4UFKA 1POV1 2JDAA 3MW4A 4R4XA 4YGCA 4ISQA 1ZRIA 4N53C 2FMDA 2W47A 1W04A 5IVYA 3BI3A 4N90A 4P5HA 3DPRA 3GM8A 3KQ4B 4LBQA 3KHBA 5C3PA 3RZLA 1Q8OA 4JX0A 5FYUA 1QJU1 2JDZA 3TEXA 2PHFA 1P8JA 1QQP2 2BV4A 3VBHC 4V2VA 1XC6A 3LQCA 3LWCA 3NQHA 2VXRA 2X05A 1G9AA 1MVQA 2A6ZA 5JXGA 3ZFGA 1JOBA 4Y22B 4BOWA 2BOJA 3IDCB 3MIGA 3KS7A 4UOJA 1ACCA 1W8FA 3RVHA 5CNAA 3ITQA 4GMP1 2BNNA 1S1AA 4OQ9A 4TLGA 4JKLA 2VNOA 2Z79A 5A7SA 2ZX1A 3ZXJA 4YPJA 2BU9A 3CEWA 2VR4A 4I02A 5CFDB 1M06G 1B35A 1QDOA 1YFWA 2ZMLA 3OPTA 4Y1ZA 3LDBA 1FXZA 2K9ZA 2PHRA 5FUPA 5FZBA 4ZU5A 4Q4V1 3TNQA 4Y5SA 2XBO3 2WT2A 4A2UA 4ISRA 4EN0A 3IPVB 2JX9A 4QPGA 2OYZA 2RR11 3HQRA 4IQPA 4MYEA 4DEQA 3TNPB 4XABA 1OF4A 2ZX3A 2BFUL 1BCXA 2HH9A 1BVP1 2CWMA 3GBWA 2GSYA 3V56A 5A1FA 1NLSA 3E6DA 4YVSB 4CP1A 1UL9A 5DPNA 3VN4A 1H2MA 2YBKA 3GHNA 2YU2A 1KD7A 2KR2A 2N7GA 1EUUA 2BGOA 3PMSA 5A70A 2YHJA 3KCCA 4OUMA 4XQDA 4AHZA 5AC93 4NIGA 4P9WA 1UZWA 4O9EA 4QX1A 1YFXA 3NSTA 3DPRC 1W99A 2UYBA 1S55A 3W20A 2B9UA 4MV2A 3NJXA 1UY3A 4ITCA 4B7KA 1RYYA 4OHWA 4KGGA 4AEDC 1OLME 3OY8B 1UIJA 3CO2A 2YGLA 3PUSA 3U37A 1QJY1 2JECA 2WBKA 2YB7A 5CADA 4CCDA 3I54A 3VBHB 3HJRA 1O59A 5LASA 4D69A 1ZYBA 2ZHMA 2ILMA 2OUJA 3CJIB 4CCLA 1ZZ6A 2DCZA 5A6YA 3ACIA 1OA4A 1Y9QA 3M3OA 5ACA2 2P3IA 5IVCA 1FV3A 1PZ8A 3I2KA 5FZ3A 3H8XA 2DBIA 1ZZBA 2D6NA 5LK7B 2VMIA 4R9DA 2JG8C 5FLJA 5DAXA 5T5JA 1LENA 4QKDA 3IMMA 3FWEA 4M3CE 1QJX2 5FK7A 3FUOA 5FPZA 3ZKYA 3AZVA 2BGPA 2OXBA 2OT7A 4K20A 4GB32 5BNOC 2XWBB 4JQTA 4QX8A 4KBBA 1HRI2 3T4VA 2RJ2A 3KHCA 3VDDC 3ES1A 3PU8A 3JZVA 4QAWA 4LK6A 2O0OA 5FKBA 4INDA 5FTTC 1ND2A 4QPIA 3LSDA 1HRV2 3MIDA 4WVMB 3VZMA 4HK8A 1W0OA 4AHYA 4XJZA 1VMHA 2P6HA 2X09A 1LGNA 1RUJ1 3B5LB 4E4HA 2W08A 2Y6GA 2XLFA 2R0FA 1RUF2 3UJOA 1JYCA 1QIQA 2ZZQA 4ONUA 1H8VA 1DIWA 1J84A 1E5HA 3LDRA 1DHKB 3VBSC 4Y4YA 4EQVA 1XU1A 3KM5A 3QD6A 4EYUA 5FQ0A 2Z5WA 3VDDB 1APNA 5C9AC 3RQ0A 1YI7A 3RMYA 2CAVA 4LBKA 5FQ0B 4L8QA 4XVHA 3O1VA 4ZS2A 2VZ3A 4I01A 4A6OA 5F5IA 3ABZA 2QBXA 1JZ7A 3I4IA 4CCMA 1XRUA 2IC1A 1B35B 4QX2A 2ZGUA 4O7XA 3VL9A 3DXTA 2QNKA 1J58A 1WMXA 1XSRA 1DGWA 2FHRA 1HIXA 4BLJA 4G9SB 5CEHA 1GOHA 1LOFA 2W3JA 3LZZA 5EPAA 3BU7A 1O5UA 2JG8A 1W8TA 4IEVA 2D43A 4GJYA 2QQPA 2G4IA 1PX4A 4K40A 5F3CA 2WDBA 3NNJA 4V1PA 2XMLA 3Q8EA 5A3OA 1NE4A 1ZZ7A 5BUVA 1A34A 3WG4A 5J1XA 3U10A 3OB8A 5F8PA 3JB8A 1V9U2 3HPNA 4LBQD 4WVVA 1BK1A 3PHMA 1NE6A 4C1WA 5BNNA 2AR6A 5FR3A 4AZZA 3ELNA 3CNAA 5JWPA 1WLCA 4NIAA 4QB1A 5E16A 4P00B 5DAWA 3FHAA 5I0DA 3H3ZA 5A33A 3A21A 5A1AA 4B1MA 2F17A 2ZAHA 2JJ6A 1OQDA 2WQ8A 3C7GA 1QDCA 3PIJA 2V5YA 4I2OA 1FX5A 4XDPA 2YV8A 1VBD3 2FCTA 1J1TA 2F4PA 3O14A 5H9QA 2ZPXA 5CB7A 4Z1VA 4HBNA 5C4WB 3FL7A 2JKXA 3NKTA 1FOD2 3BTZA 3HQXA 1JMUB 1AR63 2PAMA 4AFBA 1U5ZA 3K4AA 4GB33 4KWUA 3M4FA 5CYYA 5C5TA 4RL7A 5C8WA 1J3QA 3S57A 2JDKA 5BNQA 4LULA 1XYNA 3C7HA 1CD3G 1UXXX 2Q4SA 1V6NA 5FMDA 1XSQA 2D98A 1UPSA 4IEYA 3JB4C 5FZFA 4Q26A 3AJZA 3HT1A 3PTRB 4L11A 1MQTA 1KQRA 3FMGA 4AG4A 4FXGB 4UW4A 4OI0A 1OMIA 1FPN1 1Q5OA 2FQPA 1LOFC 2RMU2 4NOTA 3S7EA 1G8WA 4Q2FA 3SH5A 3SHRA 4B3NA 1QJX3 4D0QA 3J9SA 2X8KA 3I2HA 3W9AA 1NY71 1WMFA 5H9RA 1ZRFA 5CVRA 4LLOA 4WVMA 4WM8C 2IXHA 1W8NA 1YC61 2CYFA 2YBPA 2PHWA 3J8F3 3PTYA 4GWJA 1RUE1 4HONA 2JENA 4CDWA 1DDLA 3T08A 1DBNA 4KG0A 1R1A1 2PXJA 4I30A 1AL23 3POJA 1IS6A 4NO4A 4Q4V3 3P5BA 4YG3A 3O12A 3O1UA 4CDWB 4Q4Y3 5G05L 4LBMA 4HK9A 4LUKA 1VBA1 3UGHA 5FO8B 2NQYA 5A3TA 4LR4A 2NMOA 3ZPOA 5A3UA 1N1TA 2ADDA 1VP6A 1LOAA 4LA2A 4JDNA 1I1EA 1NA1C 3KWVA 2HLEA 4OZOA 4JTNA 2DU0A 5E88A 2VM9A 5FO7B 1LTEA 1AR73 3MYXA 1HLCA 4XCAA 5FAXA 4COUA 1W9FA 4E4SA 5FZLA 3ZYFA 3IDAA
chains in the Genus database with same CATH topology
1GMMA 3CZJA 2CDOA 5DQ0A 4LPLA 1GNYA 2EICA 4QB2A 2QQJA 3ECQA 1CZVA 2QQIA 2VZ1A 4DUXA 2W1QA 1UY0A 4RYDA 2VMEA 3CDZB 4LQRA 3LPFA 1GQPA 2BZDA 2YC2A 4TXWA 4FI9A 3OG2A 3SEEA 4CU9A 3EYPA 3K46A 2V5DA 3WSOA 3OGRA 1J83A 4OMDA 1CIYA 1SDDB 4L0PA 1UWWA 4DUVA 3HNBM 2Y6JA 3IAQA 2QQLA 2Y6LA 3I2JA 3C7FA 3J7HA 1L7RA 1NKGA 1UY1A 1DP0A 1KGYA 1UMIA 3T0BA 4JKMA 3UESA 4QX0A 1OD3A 4W50A 2J1SA 3P1IA 4RN5A 1O8PA 1JZ3A 3ACFA 2YFUA 2YFZA 1NAEA 2J22A 2L9LA 3VD3A 5C7GA 2EIDA 4HG6B 3OGVA 3PUIA 3W5MA 4IUGA 5B4XA 1OF3A 4ZZ5A 3WF0A 4PQQA 1ULPA 3WF3A 5HPOA 2VZRA 5IYYA 1UY4A 1US3A 3E1F1 5C71A 4CVUA 4OYUA 4LHSA 4QDSA 2W91A 3OBAA 3MV01 4M4RA 3IB3A 2C4XA 3T0DA 2XQXA 1MPXA 5G04L 1BHGA 2J1EA 4A41A 4QDQA 1W9WA 3K4DA 2VZVA 3WF2A 4CUCA 3HNMA 3AC0A 1JI6A 2VZUA 4DUWA 3BN6A 1K45A 1UX7A 3MV11 1CZSA 4KMQA 2J7MA 2PQSA 1W9SA 2YC4A 2DCKA 5EJ1B 3I2IA 4W4ZA 3LPGA 3I3EA 2WYSA 4ZZ8A 2Y64A 4QX3A 3VD4A 1CZTA 2VJXA 1JHJA 4M4PA 2KD7A 2VQUA 4BDVB 2VMCA 4XUNA 2VMDA 3ACHA 3SKVA 5IFTA 5JXHA 5EJZB 2YG0A 1OH4A 2ORXA 4E8DA 5F7UA 2ORZA 4MO3M 2V72A 3MBWA 3BGAA 3UETA 1JYVA 3K4ZA 3I3DA 4PF1A 2C9KA 2DCJA 1F4HA 2VZSA 2LS6A 2QQKA 4OMCA 2ZEZA 2BBAA 4PT6A 3HOBA 2VO5A 1NUKA 4JHZA 2J1TA 3C8XA 4A4AA 2VZQA 3T0AA 3JXSA 2RV9A 5DMYA 3ETPA 3VDBA 3I2GA 1XNTA 3NRUA 2W5FA 3C7OA 2E32A 3OEAA 3T2OA 3ACGA 4GZ9A 4ARYA 3LE0A 1GOGA 1JU4A 2E33A 4GWIA 3WF1A 3A22A 3DYMA 1PX3A 4UI9L 2VZPA 3DECA 4Z2AA 1IQDC 2VMFA 1TVGA 3WEZA 2QQNA 2XONA 3CIHA 3ZM8A 2J1VA 1EUTA 1D7PM 4CU6A 2VCBA 2VOTA 4A44A 3VD7A 4ARXA 2QQOA 1OT5A 3VD9A 1I5PA 3OGSA 5JXJA 4BJ0A 2WUHA 2W1UA 1W8OA 2JDAA 4LKSA 3F2ZA 3WNPA 4JKKA 2VCCA 3A7QA 1JZ2A 2W47A 4CUAA 4CU7A 3GM8A 4DXTA 2ZEXA 4JX0A 1P8JA 3LEIA 5DN2A 4P08A 4BK5A 3NQHA 1XC6A 3LQCA 4XURA 5IHRA 2VQTA 1LNSA 1PMHX 1TG7A 2X05A 5JXGA 2DDUA 2X10A 1K42A 1JYNA 2W94A 4UOJA 1O8SA 2XOMA 1H6YA 3T2QA 4UAPA 4BXSV 4JKLA 4YPJA 2VR4A 4OUEA 1L7QA 2WO2A 3T2PA 1DYOA 5IFPA 3CMGA 4DEVA 2VZOA 4ET7A 1UMHA 4KI5M 3HNYM 2JE8A 4DEQA 1JZ4A 1OF4A 4P02B 3GGLA 2EIBA 2Y6HA 5DPNA 3I2FA 1W9TA 3WNKA 1EUUA 2BGOA 1JZ8A 2OKXA 2VL4A 2E31A 3K77A 4QX1A 1W99A 3UNPA 4DXSA 5LA1A 3NJXA 1UY3A 1RYYA 2VC9A 5JMOA 3U37A 3FHQA 4A3ZA 2WBKA 2YB7A 4DXRA 1DLCA 1H6XA 3W5NA 3HJRA 1O59A 1UY2A 3A23A 1XNAA 4W8JA 3T09A 4A42A 3ACIA 2ZXQA 3WF4A 3WNNA 3I2KA 3MUY1 1UZ0A 2QQMA 3D3AA 4MOAA 5JR2A 2BGPA 4MADA 3WNLA 5LA0A 3I97A 2RJ2A 2WN2A 1HN1A 4QAWA 3IAPA 1NX9A 4MGSA 3P6BA 2VZTA 3MO4A 2Y8KA 4CUBA 5CZKA 3VDAA 2WN3A 2X09A 3EB7A 2Y6GA 3NNGA 4MGQA 1JYWA 4P5YA 1R64A 1J84A 2VTFA 1GU3A 1ULOA 1CX1A 1K12A 4QPWA 3WNOA 2ZEWA 3WQBA 2Y6KA 1UYYA 5IJRA 3DYOA 4XVHA 1JZ7A 2VZ3A 4XUOA 4A6OA 3ABZA 2QBXA 4QDRA 3OEBA 2WZ8A 3SEPA 2Z4FA 3NJVA 4QX2A 3THCA 4ZXEA 1W0NA 1YQ2A 5LCWL 3HN3A 1WKYA 2ID4A 4ZY9A 1UYXA 2C26A 3LEGA 1GOHA 2W3JA 3DYPA 1F4AA 2R7EB 2LW8A 2WAOA 2WZEA 2WO3A 1PX4A 2WDBA 5J1XA 2ZEYA 3OB8A 1SG3A 2J1RA 4A45A 3HPNA 3MUZ1 1WCQA 5JXIA 2CDPA 4QB1A 5B4NA 4P00B 3FHAA 5I0DA 3A21A 5A1AA 2WQ8A 3C7GA 1UYZA 1XPWA 3PUHA 3HEIA 4XUTA 1GUIA 1UXZA 3GXUA 2JKXA 2B9VA 3FL7A 2W9XA 3K4AA 4KWUA 5CYYA 2W1WA 2W46A 4XUQA 5FUIA 4D8MA 3C7HA 2JD9A 5EIYB 1UXXX 4XZUG 2B4KA 3CKHA 2W1SA 1JZ6A 1JYXA 4TTGA 4BK4A 4AAXA 2J1UA 3C7EA 2BERA 4AG4A 1T2XA 2V4VA 3CQOA 3THDA 1JU3A 5HXMA 4D0QA 3I2HA 2W92A 2W95A 3FN9A 3LEKA 1KEXA 1W8NA 4GWJA 1K3IA 2W87A 5LA2A 3T08A 2WAAA 1US2A 5C70A 1JZ5A 2EIEA 2J1AA 3SKJE 1SHWB 5JUVA 5G05L 2WO1A 4E8CA 4XUPA 2E26A 1PMJX 2HYXA 3CZUA 3I3BA 2XHNA 2WABA 2HLEA 4OZOA 4CU8A 2VM9A 3VD5A 3VDCA 4QB6A 3GDBA 1GOFA 3IIIA 2RVAA 3WNMA 2VCAA 3K75B 3IDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMM A;  3CZJ A;  2CDO A;  5DQ0 A;  4LPL A;  1GNY A;  2EIC A;  4QB2 A;  2QQJ A;  3ECQ A;  1CZV A;  2QQI A;  2VZ1 A;  4DUX A;  2W1Q A;  1UY0 A;  4RYD A;  2VME A;  3CDZ B;  4LQR A;  3LPF A;  1GQP A;  2BZD A;  2YC2 A;  4TXW A;  4FI9 A;  3OG2 A;  3SEE A;  4CU9 A;  3EYP A;  3K46 A;  2V5D A;  3WSO A;  3OGR A;  1J83 A;  4OMD A;  1CIY A;  1SDD B;  4L0P A;  1UWW A;  4DUV A;  3HNB M;  2Y6J A;  3IAQ A;  2QQL A;  2Y6L A;  3I2J A;  3C7F A;  3J7H A;  1L7R A;  1NKG A;  1UY1 A;  1DP0 A;  1KGY A;  1UMI A;  3T0B A;  4JKM A;  3UES A;  4QX0 A;  1OD3 A;  4W50 A;  2J1S A;  3P1I A;  4RN5 A;  1O8P A;  1JZ3 A;  3ACF A;  2YFU A;  2YFZ A;  1NAE A;  2J22 A;  2L9L A;  3VD3 A;  5C7G A;  2EID A;  4HG6 B;  3OGV A;  3PUI A;  3W5M A;  4IUG A;  5B4X A;  1OF3 A;  4ZZ5 A;  3WF0 A;  4PQQ A;  1ULP A;  3WF3 A;  5HPO A;  2VZR A;  5IYY A;  1UY4 A;  1US3 A;  3E1F 1;  5C71 A;  4CVU A;  4OYU A;  4LHS A;  4QDS A;  2W91 A;  3OBA A;  3MV0 1;  4M4R A;  3IB3 A;  2C4X A;  3T0D A;  2XQX A;  1MPX A;  5G04 L;  1BHG A;  2J1E A;  4A41 A;  4QDQ A;  1W9W A;  3K4D A;  2VZV A;  3WF2 A;  4CUC A;  3HNM A;  3AC0 A;  1JI6 A;  2VZU A;  4DUW A;  3BN6 A;  1K45 A;  1UX7 A;  3MV1 1;  1CZS A;  4KMQ A;  2J7M A;  2PQS A;  1W9S A;  2YC4 A;  2DCK A;  5EJ1 B;  3I2I A;  4W4Z A;  3LPG A;  3I3E A;  2WYS A;  4ZZ8 A;  2Y64 A;  4QX3 A;  3VD4 A;  1CZT A;  2VJX A;  1JHJ A;  4M4P A;  2KD7 A;  2VQU A;  4BDV B;  2VMC A;  4XUN A;  2VMD A;  3ACH A;  3SKV A;  5IFT A;  5JXH A;  5EJZ B;  2YG0 A;  1OH4 A;  2ORX A;  4E8D A;  5F7U A;  2ORZ A;  4MO3 M;  2V72 A;  3MBW A;  3BGA A;  3UET A;  1JYV A;  3K4Z A;  3I3D A;  4PF1 A;  2C9K A;  2DCJ A;  1F4H A;  2VZS A;  2LS6 A;  2QQK A;  4OMC A;  2ZEZ A;  2BBA A;  4PT6 A;  3HOB A;  2VO5 A;  1NUK A;  4JHZ A;  2J1T A;  3C8X A;  4A4A A;  2VZQ A;  3T0A A;  3JXS A;  2RV9 A;  5DMY A;  3ETP A;  3VDB A;  3I2G A;  1XNT A;  3NRU A;  2W5F A;  3C7O A;  2E32 A;  3OEA A;  3T2O A;  3ACG A;  4GZ9 A;  4ARY A;  3LE0 A;  1GOG A;  1JU4 A;  2E33 A;  4GWI A;  3WF1 A;  3A22 A;  3DYM A;  1PX3 A;  4UI9 L;  2VZP A;  3DEC A;  4Z2A A;  1IQD C;  2VMF A;  1TVG A;  3WEZ A;  2QQN A;  2XON A;  3CIH A;  3ZM8 A;  2J1V A;  1EUT A;  1D7P M;  4CU6 A;  2VCB A;  2VOT A;  4A44 A;  3VD7 A;  4ARX A;  2QQO A;  1OT5 A;  3VD9 A;  1I5P A;  3OGS A;  5JXJ A;  4BJ0 A;  2WUH A;  2W1U A;  1W8O A;  2JDA A;  4LKS A;  3F2Z A;  3WNP A;  4JKK A;  2VCC A;  3A7Q A;  1JZ2 A;  2W47 A;  4CUA A;  4CU7 A;  3GM8 A;  4DXT A;  2ZEX A;  4JX0 A;  1P8J A;  3LEI A;  5DN2 A;  4P08 A;  4BK5 A;  3NQH A;  1XC6 A;  3LQC A;  4XUR A;  5IHR A;  2VQT A;  1LNS A;  1PMH X;  1TG7 A;  2X05 A;  5JXG A;  2DDU A;  2X10 A;  1K42 A;  1JYN A;  2W94 A;  4UOJ A;  1O8S A;  2XOM A;  1H6Y A;  3T2Q A;  4UAP A;  4BXS V;  4JKL A;  4YPJ A;  2VR4 A;  4OUE A;  1L7Q A;  2WO2 A;  3T2P A;  1DYO A;  5IFP A;  3CMG A;  4DEV A;  2VZO A;  4ET7 A;  1UMH A;  4KI5 M;  3HNY M;  2JE8 A;  4DEQ A;  1JZ4 A;  1OF4 A;  4P02 B;  3GGL A;  2EIB A;  2Y6H A;  5DPN A;  3I2F A;  1W9T A;  3WNK A;  1EUU A;  2BGO A;  1JZ8 A;  2OKX A;  2VL4 A;  2E31 A;  3K77 A;  4QX1 A;  1W99 A;  3UNP A;  4DXS A;  5LA1 A;  3NJX A;  1UY3 A;  1RYY A;  2VC9 A;  5JMO A;  3U37 A;  3FHQ A;  4A3Z A;  2WBK A;  2YB7 A;  4DXR A;  1DLC A;  1H6X A;  3W5N A;  3HJR A;  1O59 A;  1UY2 A;  3A23 A;  1XNA A;  4W8J A;  3T09 A;  4A42 A;  3ACI A;  2ZXQ A;  3WF4 A;  3WNN A;  3I2K A;  3MUY 1;  1UZ0 A;  2QQM A;  3D3A A;  4MOA A;  5JR2 A;  2BGP A;  4MAD A;  3WNL A;  5LA0 A;  3I97 A;  2RJ2 A;  2WN2 A;  1HN1 A;  4QAW A;  3IAP A;  1NX9 A;  4MGS A;  3P6B A;  2VZT A;  3MO4 A;  2Y8K A;  4CUB A;  5CZK A;  3VDA A;  2WN3 A;  2X09 A;  3EB7 A;  2Y6G A;  3NNG A;  4MGQ A;  1JYW A;  4P5Y A;  1R64 A;  1J84 A;  2VTF A;  1GU3 A;  1ULO A;  1CX1 A;  1K12 A;  4QPW A;  3WNO A;  2ZEW A;  3WQB A;  2Y6K A;  1UYY A;  5IJR A;  3DYO A;  4XVH A;  1JZ7 A;  2VZ3 A;  4XUO A;  4A6O A;  3ABZ A;  2QBX A;  4QDR A;  3OEB A;  2WZ8 A;  3SEP A;  2Z4F A;  3NJV A;  4QX2 A;  3THC A;  4ZXE A;  1W0N A;  1YQ2 A;  5LCW L;  3HN3 A;  1WKY A;  2ID4 A;  4ZY9 A;  1UYX A;  2C26 A;  3LEG A;  1GOH A;  2W3J A;  3DYP A;  1F4A A;  2R7E B;  2LW8 A;  2WAO A;  2WZE A;  2WO3 A;  1PX4 A;  2WDB A;  5J1X A;  2ZEY A;  3OB8 A;  1SG3 A;  2J1R A;  4A45 A;  3HPN A;  3MUZ 1;  1WCQ A;  5JXI A;  2CDP A;  4QB1 A;  5B4N A;  4P00 B;  3FHA A;  5I0D A;  3A21 A;  5A1A A;  2WQ8 A;  3C7G A;  1UYZ A;  1XPW A;  3PUH A;  3HEI A;  4XUT A;  1GUI A;  1UXZ A;  3GXU A;  2JKX A;  2B9V A;  3FL7 A;  2W9X A;  3K4A A;  4KWU A;  5CYY A;  2W1W A;  2W46 A;  4XUQ A;  5FUI A;  4D8M A;  3C7H A;  2JD9 A;  5EIY B;  1UXX X;  4XZU G;  2B4K A;  3CKH A;  2W1S A;  1JZ6 A;  1JYX A;  4TTG A;  4BK4 A;  4AAX A;  2J1U A;  3C7E A;  2BER A;  4AG4 A;  1T2X A;  2V4V A;  3CQO A;  3THD A;  1JU3 A;  5HXM A;  4D0Q A;  3I2H A;  2W92 A;  2W95 A;  3FN9 A;  3LEK A;  1KEX A;  1W8N A;  4GWJ A;  1K3I A;  2W87 A;  5LA2 A;  3T08 A;  2WAA A;  1US2 A;  5C70 A;  1JZ5 A;  2EIE A;  2J1A A;  3SKJ E;  1SHW B;  5JUV A;  5G05 L;  2WO1 A;  4E8C A;  4XUP A;  2E26 A;  1PMJ X;  2HYX A;  3CZU A;  3I3B A;  2XHN A;  2WAB A;  2HLE A;  4OZO A;  4CU8 A;  2VM9 A;  3VD5 A;  3VDC A;  4QB6 A;  3GDB A;  1GOF A;  3III A;  2RVA A;  3WNM A;  2VCA A;  3K75 B;  3IDA A; 
#chains in the Genus database with same CATH topology
 1GMM A;  1QJE A;  2XR4 A;  2RDN A;  2WNE A;  3J7M A;  4QPY A;  2ZGS A;  5DQ0 A;  4DPN A;  2RMU 3;  2R04 1;  4LPL A;  2VQA A;  3WT3 A;  1MZE A;  4FPC A;  1DGL A;  4CPB A;  1UKR A;  2X53 S;  4TYS A;  1CZV A;  1PVX A;  4RS5 B;  1DQ1 A;  3AMN A;  4N7I A;  2A6X A;  2DCT A;  1PVC 1;  3ZPY A;  1O4T A;  2XKP A;  4K7J A;  5JOY A;  2VME A;  3ALQ A;  3CDZ B;  3QH6 A;  1MR5 A;  4MH0 E;  1TNR A;  4P9L A;  1D0H A;  3MEP A;  3K46 A;  3SIS A;  1R09 3;  1A8D A;  1VAL A;  3K3N A;  4YLZ A;  5JSP A;  5EP9 A;  3MPB A;  3RI9 A;  1LOE A;  1BJQ A;  3SMH A;  5JPN B;  2JE9 A;  1CIY A;  1SDD B;  1PZ7 A;  4IER A;  4BQ3 A;  1QNW A;  3KGL A;  1OA2 A;  4CRQ A;  3IAQ A;  1C5I A;  1ULG A;  5FV3 A;  5KC6 A;  4XYX A;  1MS8 A;  5IAT A;  4NRP A;  4OZX A;  5FMO S;  4QKN A;  3PVO A;  5FYV A;  4BQX A;  1QF3 A;  3J7N A;  4FOQ A;  1VRH 3;  1CON A;  3T0B A;  4JKM A;  1FI2 A;  1GV9 A;  5A6Z A;  1QQP 1;  3SC7 X;  5DUU A;  3VBU C;  4IGQ A;  4GWN A;  3UGG A;  4W50 A;  3LA7 A;  2WA4 A;  4N53 B;  3A0N A;  4RN5 A;  1EAH 2;  3ZFE A;  1O8P A;  1X8E A;  3PU3 A;  5FZO A;  1D2S A;  1JZ3 A;  4KU8 A;  4FTE A;  3POW A;  1SBE A;  2YFZ A;  2IWG B;  1NAE A;  4Q4X 2;  1DQ0 A;  2P37 A;  1HJF A;  4PIY A;  1PO2 1;  4XIK A;  4UWD A;  3WCR A;  3L2Y A;  1AXK A;  2ETE A;  5F32 A;  4IGO A;  1ZZ8 A;  4QMA A;  3WY6 A;  5IK4 A;  2VAU A;  5L7O B;  4CCK A;  4UF0 B;  2P6C A;  2YU1 A;  1S4C A;  3H8U A;  4I0B A;  4UFJ A;  3WP6 A;  3WW3 A;  1OOP B;  3PVN A;  4PLO A;  2GMM A;  3DEM A;  4EN9 B;  1ULP A;  4L9B A;  3D5O A;  1FT9 A;  2VZR A;  3OBZ A;  2JWP A;  3EHK A;  5FYI A;  1E5S A;  1HQW A;  3ASI A;  3E1F 1;  1SCS A;  5FY9 A;  1EAH 3;  2DVF A;  4CVU A;  1W6N A;  1VBC 2;  3BTA A;  4OVE A;  2Z69 A;  5FZ4 A;  5FBZ A;  3GJA A;  5GKA C;  5FPU A;  3M2M A;  4QPG C;  5A7W A;  3MV0 1;  1SEF A;  1V6M A;  1POQ A;  2D97 A;  1SFN A;  3IB3 A;  3RSJ A;  4LKE A;  3LOI A;  1CJD A;  4CPB D;  4CEW C;  5LEJ A;  1SFY A;  2OS2 A;  3IDB B;  3NJY A;  3ZIW A;  5G04 L;  1CPM A;  2J1E A;  3PUA A;  4A41 A;  1C1L A;  1GWM A;  1TMF 3;  1W8W A;  4HPK A;  4QDQ A;  2R6Q A;  3K4D A;  4LBL A;  3UV9 A;  3VZN A;  1HB4 A;  4IXL A;  1LR5 A;  1A6C A;  2BVB A;  1JI6 A;  4FP3 A;  4XF0 A;  1J59 A;  1Y7B A;  5FXX A;  1TMF 1;  1W2U A;  3ZIX A;  2R07 3;  4CP9 A;  1M4W A;  3E5U A;  4OHV A;  4PJY A;  2P3K A;  3IT8 A;  3LF7 A;  4HN0 A;  2Q8E A;  3RYR A;  1W9S A;  3BUC A;  1O3S A;  2XJV A;  3HT2 A;  2JB4 A;  3KVB A;  2BPA 2;  3LPG A;  3I3E A;  2HWC 1;  5KBF A;  3BAL A;  2K2S A;  1YYN A;  4U36 A;  3MI8 A;  4LBQ B;  1VBB 1;  2Y64 A;  2RDR A;  2ZGO A;  4LIU A;  4CXW A;  5E89 A;  1S0J A;  4YGE A;  1ZRE A;  1AJK A;  4AVA A;  4PBP A;  3RWN A;  4XMI A;  4YW1 A;  4CSW A;  1DGW X;  1O4Z A;  2DVA A;  4F83 A;  5L36 A;  4CEY B;  2H6C A;  4XCB A;  4J1X A;  2D6L X;  2VMD A;  3NVC A;  3RS6 A;  1REF A;  1O5L A;  1CES A;  5IFT A;  5AFE A;  3BIE A;  2ZAC A;  1DF0 A;  2CTV A;  3MW2 A;  4C8D A;  1YIP A;  5E6H A;  3N9L A;  2ORX A;  4AQ2 A;  3IN9 A;  2JDN A;  2ZX0 A;  1UOB A;  2I45 A;  2NMN A;  4LEJ A;  1AHS A;  5I0T A;  2BW8 A;  2DUO A;  4PCR A;  4OFG A;  4COZ A;  4I3G A;  3EO6 A;  4NPM A;  2C9K A;  5EXO A;  2DUQ A;  3WDX A;  1U5X A;  5FZI A;  4YGD A;  2BBA A;  3B94 A;  5FZH A;  2A70 A;  1IQA A;  1XB9 A;  1KS5 A;  3BCW A;  1AX1 A;  2X5I B;  2YMZ A;  3HOB A;  4J6G A;  3WV6 A;  3ZOI A;  3OBR A;  4BQ5 A;  4JHZ A;  4AVV A;  3C8X A;  3BOP A;  4A4A A;  4XJW A;  5LBF A;  1HB2 A;  1EV1 1;  2CSG A;  2IVI B;  3N35 A;  4FBF A;  1CAV A;  1CPN A;  4CUG A;  3FUQ A;  3BPZ A;  3ETP A;  1C8M 2;  4XEZ A;  3VDB A;  3NRU A;  1SZB A;  3C7O A;  2P5B A;  4FPJ A;  4BQY A;  1B09 A;  2I74 A;  4GZ9 A;  2GC3 A;  1FMD 3;  2RS3 3;  3DPR B;  3H7Y A;  3H0O A;  3VKM A;  1COV 2;  4YFW A;  3FJS A;  3INA A;  2VMG A;  3MLL A;  1C8N A;  3QBQ A;  5FY5 A;  3VKL A;  3DKW A;  2NM1 A;  3CBN A;  4NMI A;  2RS5 1;  1GNZ A;  1PX3 A;  1WCK A;  3PJY A;  2VZP A;  3DEC A;  2ZAA A;  4IEX A;  4IE5 A;  3VHN A;  1JXN A;  2YC0 A;  3R05 A;  3ZXG A;  4ATF A;  3UGF A;  2CY6 A;  2XG3 A;  1NZC A;  4XFA A;  4E9K A;  1V9U 1;  1AR9 1;  1N3P A;  4XPV A;  4Q8L A;  3C2U A;  1W6N B;  4Y3O A;  2ET7 A;  3N7K A;  3POS A;  1EV1 2;  3POG A;  2G9G A;  5IVV A;  3ZM8 A;  2YZ4 A;  3WQ0 A;  2A6W A;  2J1V A;  1W90 A;  3KT1 A;  2B7Y A;  5HXV A;  4IET A;  4F7Z A;  3PJQ A;  4LOS A;  1D7P M;  2XJQ A;  2WII B;  3ST7 A;  1CR7 A;  1DGR N;  1WA4 A;  5TSW A;  4ARX A;  5J98 B;  4XBL A;  5JXJ A;  2XVK A;  4QQO A;  3S30 A;  2XJP A;  2ARC A;  1UZY A;  3V64 A;  2WUH A;  4IEO A;  4LKS A;  2EIG A;  1OVP A;  4N9H A;  3WNP A;  3A4U A;  3ZYI B;  2OA2 A;  3WNX A;  2VCC A;  5IWF A;  5JMC A;  4YRD A;  2QTW B;  1V0A A;  5FY0 A;  4DXT A;  4LXL A;  2XL7 A;  3PIG A;  4KH9 A;  5FP8 A;  1T6G C;  2X29 A;  2ZKN A;  2EAL A;  4XZP A;  1ND3 B;  3NWK A;  5DN2 A;  1BK0 A;  2ZX4 A;  4LNV A;  4EZ4 A;  3GZE A;  4GIQ A;  3GF6 A;  4PLN A;  3EBR A;  5IHR A;  4HT1 T;  5F6L B;  1LNS A;  4WZC A;  1OPM A;  4IEW A;  2D3P A;  4QWN A;  1GZW B;  1NXM A;  2D5H A;  3ETQ A;  4IEU A;  5C8C B;  5CU1 A;  1K42 A;  2A6V A;  2DCY A;  2W94 A;  4E2Q A;  1O8S A;  4N7U A;  1LU1 A;  1GAN A;  4JCK A;  2JG9 B;  3M3I A;  4RHV 1;  4CCC A;  5DG1 A;  4RQP B;  4BB3 A;  2WO7 A;  5FLH A;  5FPB A;  3NL1 A;  2KXL A;  3LAG A;  4Q4W 3;  3LOB A;  2NLR A;  2B39 A;  1HQN A;  3T2P A;  1PK6 B;  1DYO A;  5FZ7 A;  2JDP A;  3L2H A;  1UMH A;  1NLR A;  3RYK A;  3M8L A;  2JE8 A;  1O91 A;  5J36 A;  2X5I A;  2PTM A;  1OUR A;  3J4U H;  2WWJ A;  4E2G A;  1LHV A;  3RZH A;  1JZ4 A;  4PI2 A;  1W0P A;  2TBV A;  5EFU A;  2WNV A;  3GGL A;  4LE3 A;  1BMV 2;  4Q0P A;  5LEK A;  5LBB A;  1HW5 A;  2Y6H A;  2Y6F A;  2ZGL A;  4NUB A;  4Y26 A;  1AYM 2;  2AC1 A;  1AUY A;  3I2F A;  2YY1 A;  1KXG A;  1XJA A;  3I59 A;  4Q29 A;  2V09 A;  2RDQ A;  3SCF A;  3VBO B;  4KU7 A;  4CP0 A;  3B01 A;  2VL4 A;  3M70 A;  4DMI A;  4WZF A;  4CDU B;  3DKQ A;  3K77 A;  1CAX A;  1Q43 A;  2F4L A;  1DFQ A;  4XET A;  2CGO A;  4DXS A;  4A6S A;  1H8T B;  1AR6 1;  1OFS A;  1SLL A;  1SDW A;  4ES9 A;  4Z8B A;  3O1S A;  2VC9 A;  4P9Y A;  3AVR A;  3PVE A;  3ZMO A;  1ND3 A;  1ODN A;  2C1F A;  2ATF A;  3LDK A;  4O9G A;  1G6N A;  1XE0 A;  3BPS A;  3A23 A;  1XNA A;  2HKX A;  2WT1 A;  1ZBE 2;  3RWK X;  5FZ8 A;  2VOX A;  2FDH A;  2ZXQ A;  1UZV A;  4L92 A;  4FAH A;  3JD7 3;  3WNN A;  4FVV A;  3MUY 1;  2P3J A;  3RI8 A;  3VZO A;  4JRA A;  2QQM A;  3RYP A;  1VBB 3;  3D6E A;  3D3A A;  1AR8 3;  1RUD 3;  2HWE 3;  1LUL A;  3OD4 A;  5A6X A;  5L73 A;  1PO1 1;  2W52 A;  5C33 A;  5JR2 A;  3SQO A;  2WS9 3;  1UIK A;  5SV5 A;  4Q4X 3;  3I2O A;  3I97 A;  5FY1 A;  4AGR A;  2JDY A;  4LT5 A;  1O3R A;  2PEL A;  3WZ1 A;  2WN2 A;  3JUU A;  4H14 A;  1AYM 1;  4QX5 A;  5CFC A;  3APB A;  5FMB A;  3KCX A;  1G7Y A;  4Q4Y 1;  3BOW A;  3R4S A;  1NX9 A;  4HFS A;  4XQ4 A;  3WVJ A;  1Z78 A;  3I2D A;  4XJA A;  1OUX A;  1GWL A;  2Y8K A;  3BVC A;  5FY8 A;  4CUB A;  2WN3 A;  3AL5 A;  5EJ3 A;  5JZG B;  3RZM A;  1RUE 3;  4Y20 B;  3EB7 A;  5ACA 1;  1LES A;  3VBU A;  5KWR A;  4GQ7 A;  3H1Y A;  5IUQ A;  3ZYJ B;  4MGQ A;  2XQR A;  4P5Y A;  1VBC 3;  2WS9 2;  2WZP P;  4DIQ A;  1UN1 A;  2C5D A;  2AYH A;  4MGI E;  2VTF A;  1GU3 A;  2ZGP A;  1CX1 A;  4XAA A;  1I3H A;  3WNO A;  1IPS A;  1S0B A;  3VBR B;  1SMV A;  1QXJ A;  1VAM A;  3ME2 A;  4NVP A;  4UFI A;  3AP7 A;  5IJR A;  3THT A;  4BIO A;  2GN3 A;  4CE8 A;  1KJL A;  3DCQ A;  1E57 A;  1OVS A;  2XLA A;  4Y33 A;  2WKK A;  2R04 3;  4ATE A;  1TE1 B;  5F9T A;  2WZ8 A;  3OEB A;  4HKO A;  1JW6 A;  2OQ6 A;  5FZA A;  1GQH A;  3MFA A;  4I3P A;  3O1R A;  3R4D B;  2RM2 2;  4IV1 C;  1DZQ A;  2VVF A;  2PLV 1;  4ZXE A;  1YQ2 A;  1W0N A;  2G9Z A;  5LCW L;  1RIR A;  2FZ2 A;  1WKY A;  3BU0 A;  1QWR A;  3Q8A A;  4WM7 C;  4ZY9 A;  2LM3 A;  3E97 A;  1OUS A;  1F4A A;  1QY4 A;  3DYP A;  2ZJC A;  4B29 A;  3LD8 A;  3POE A;  3F95 A;  4LHL A;  5JLV A;  1VB2 A;  1MEC 1;  2D3R A;  1H2N A;  3H1M A;  1YLL A;  4QM9 A;  4ZPI A;  2WO3 A;  2VG9 A;  3J8F 2;  1RGS A;  3MFC A;  4BZ4 A;  4BXF A;  5FKC A;  4WVZ A;  4XHX A;  1PMI A;  3AL6 A;  1YHF A;  1JUI A;  5LZ6 A;  2WSV A;  1S0G A;  3H1W A;  4IV1 B;  4GD4 A;  4Y24 A;  5ERL A;  5F5Q A;  4A45 A;  4FPO B;  1AYM 3;  2O1Q A;  2XPJ A;  1G9F A;  4IV3 C;  4BIF A;  3FC0 A;  1W2T A;  2W68 A;  1C28 A;  5KC5 A;  5B4N A;  1LOG A;  4RGA A;  3S0M A;  3VBF A;  1MZ6 A;  2RS1 2;  4A3X A;  2HWB 1;  1YUD A;  3JD7 2;  4XIL A;  2DUP A;  1W03 A;  5FOJ B;  2JIC A;  4GAZ A;  1UYP A;  1UYZ A;  1NZI A;  1NT0 A;  1X33 A;  2J42 A;  3PUH A;  3UJQ A;  4LOR A;  1QXR A;  3OUI A;  4KL1 A;  3HIF A;  1UXZ A;  3OSD A;  2QDN A;  3H3U A;  2W9X A;  2CV6 A;  4FSJ A;  5F3G A;  2A3W A;  4RR3 A;  1MZ5 A;  4XUQ A;  4W6X A;  5FUI A;  1BVV A;  4D8M A;  2Q8O A;  4BM8 A;  4URA A;  4OI4 A;  2B4K A;  3IDE A;  2BUK A;  5GJ6 A;  4MG2 A;  2W1S A;  1JZ6 A;  4CXY A;  4QGN A;  2E7T A;  2RE9 A;  1W05 A;  3MIB A;  2ZHL A;  1JYX A;  3AYD A;  1OLR A;  4G4F A;  2MEV 1;  5HI0 A;  1OOP C;  2ZMN A;  1D4M 3;  5GLZ A;  2V4V A;  1RHI 2;  3THD A;  3TN9 2;  1JU3 A;  1R08 2;  5C5U A;  1V00 A;  4QU2 A;  1LRH A;  5GZD A;  3O0X A;  4FFG A;  3FZ3 A;  2W95 A;  4M3C F;  4LK7 A;  1UQX A;  5C8C C;  3WP5 A;  2ZGQ A;  4AWD A;  2JG8 B;  4CP2 A;  3LEK A;  4H7M A;  5CAZ A;  5AFB A;  1RUI 2;  4RGG A;  4UT5 A;  1ZZC A;  5ABJ B;  1LOB A;  2UWA A;  2W87 A;  5JSO A;  5JZG C;  4JV4 A;  4WM7 B;  4ORF A;  1US2 A;  1JZ5 A;  5I93 A;  3D0J A;  1G9B A;  3OPZ A;  5ABJ A;  1SHW B;  3H42 B;  5BNP A;  1LB2 A;  2WO1 A;  4E8C A;  2DV9 A;  2HEV F;  1AF9 A;  2ARX A;  2UWB A;  4XFI A;  4XE9 A;  1D4V B;  1IS3 A;  3I59 B;  1PMJ X;  3OY8 A;  4AXO A;  4RFR B;  5BV6 A;  4NII A;  4UYB A;  5HBA A;  2D40 A;  2DFB A;  3AZW A;  2HYX A;  1JH5 A;  2W0X A;  3N9N A;  4NN0 A;  4BHP A;  3HR9 A;  4N43 C;  4FAG A;  3CZU A;  3RRD A;  3I3B A;  2XHN A;  3USU B;  2ZGM A;  2WAB A;  2XH6 A;  1R08 1;  4CU8 A;  3VDC A;  1UOJ A;  1BEV 1;  3VD5 A;  3CJI A;  3GDB A;  4GH4 B;  4YAR A;  3III A;  5K7P A;  2LRO A;  1HKD A;  2RVA A;  3PL0 A;  4NRO A;  3NV4 A;  4DFS A;  3AKP A;  2E7A A;  3JBG 2;  2WL1 A;  5FZ9 A;  2VOK A;  4BLI A;  4DQA A;  1MEC 2;  5FPL A;  1QOS A;  2C9A A;  4Q1R A;  1D2Q A;  4QB2 A;  2YBS A;  1ONA A;  3NNF A;  4YVS C;  4C0B A;  4NHX A;  4CEY A;  1F9K A;  2QQI A;  1I6X A;  2PHU A;  2R1D A;  1JUH A;  4DUX A;  4ZXK A;  1OOP A;  3ZYP A;  3MIE A;  1UD1 A;  1OC1 A;  1WMD A;  3IBM A;  1NA1 B;  4RQP A;  2RM2 1;  4XAE A;  2BZD A;  4ZON A;  2ERF A;  4FI9 A;  4TXW A;  3SEE A;  2OVU A;  4YZ5 A;  4DOU A;  4MZU A;  5CFC B;  2W39 A;  4B1L A;  3WR0 A;  3WSO A;  3OGR A;  4OMD A;  4TN7 A;  5FP4 A;  3HMY A;  4NE9 A;  5FUN A;  1NOV A;  3K3O A;  4L0P A;  2DVD A;  3FE5 A;  3RFR A;  5C9A B;  3J8F 1;  2Y6J A;  2ZTN A;  3NKG A;  3ZSJ A;  5JZG A;  3ZN6 A;  4A7K A;  2DWR A;  4K9S A;  2QQL A;  2GU9 A;  3C7F A;  3ZN5 A;  3HN1 A;  1L7R A;  4FXK B;  3OJB A;  1UY1 A;  1GIC A;  1CAW B;  4B8E A;  3CHX A;  1ZA7 A;  1YWK A;  1UF2 C;  1FOD 1;  4NHM A;  4QX0 A;  1OD3 A;  5FPV A;  3N9O A;  1CVN A;  2YDE A;  5HCA A;  2OW4 A;  3N7M A;  4GA9 A;  3W21 A;  4YZ4 A;  4CP9 B;  5DZE A;  2WYF A;  4RGK A;  2WZR 1;  3GZU C;  4DB5 A;  1RHI 3;  3MIH A;  3ZDV A;  3ACF A;  1YXW A;  2WFP A;  5L7O A;  1UOG A;  1RUG 3;  5K0U A;  3ZFF A;  2WC2 A;  5I0S A;  4HG6 B;  5D8A C;  2GME A;  4HSL A;  5FMC A;  4KWJ A;  4QQP A;  2P2K A;  3OGV A;  1W2A X;  3W5M A;  3ZFF B;  4IUG A;  4ASL A;  2GAL A;  1QHD A;  1OF3 A;  1U5I A;  5DAV A;  4ZZ5 A;  1CQ9 A;  1XQN A;  4MET A;  3H9A A;  3VZL A;  3ZDS A;  1MS4 A;  5DG2 A;  3DN7 A;  1W28 A;  2JE7 A;  3AM2 A;  1C8M 3;  1MS0 A;  1QJY 3;  1AJO A;  4OUL A;  4Z2W A;  4PIX A;  1OLQ A;  1YO8 A;  5A3M A;  4K3U A;  4QDS A;  2HWE 2;  5FZM A;  3OBA A;  2WNU B;  1LKN A;  2PYT A;  5A7N A;  5T3N A;  1Q8Q A;  1ZBE 1;  4AK3 A;  5FRA A;  1QMJ A;  1W6O B;  1MPX A;  1F8V A;  1FV2 A;  3AMP A;  1BBT 3;  1BHG A;  2AZ5 A;  2MPF A;  2WNV C;  3OCP A;  2GC0 A;  4K1Z A;  5APA A;  2JDU A;  1W9W A;  1ZBE 3;  2Q1M A;  3BOD A;  3D0S A;  5FFO C;  3ZYB A;  4J1W A;  3AKQ A;  2HWC 2;  4FFF A;  4AEK A;  2VZV A;  4CUC A;  1RMU 2;  1LGC A;  2ET1 A;  2E7Q A;  3CJX A;  4D3W A;  2AGS A;  3R0R A;  2VZU A;  4D7Y A;  2ARE A;  4Z07 A;  3B00 A;  4MLO A;  1B35 C;  1OLM A;  2VY0 A;  1SLB A;  1H8T A;  3AK0 A;  2LAL A;  2J7M A;  3NJZ A;  4QHZ A;  4XHB A;  4QD2 A;  4MHU A;  1YRZ A;  3K51 A;  1R09 1;  5FP3 A;  2VBD A;  3ZXE A;  5A7P A;  4CDU C;  1RUC 2;  5EJ1 B;  3ZSE A;  4Z92 B;  5JOW A;  2VUJ A;  3OTF A;  3VZK A;  4CDQ A;  4UFM A;  2WYS A;  3O7O A;  4XDO A;  1ND3 C;  3TRS B;  2IXJ A;  5K0U C;  1XNC A;  4AFD A;  1VAV A;  4LLF A;  4QHO A;  4YM0 A;  5FZO B;  4JZR A;  1NQJ A;  5IT6 A;  1NCQ B;  1HN0 A;  2C0Z A;  3PDQ A;  2GNT A;  2OPW A;  3U1X A;  3U07 A;  2HWC 3;  1JHJ A;  1O7F A;  4CXX A;  1JYT A;  2VQU A;  4LO8 A;  2BWA A;  4XUN A;  2RG4 A;  1XBF A;  5JIU A;  4JRL A;  4YW4 A;  2Y0I A;  2YG0 A;  1KDK A;  1XND A;  1MS5 A;  3NAP B;  5LY1 A;  5LRS A;  1N1Y A;  5CFD C;  5F7U A;  4DIN B;  2FDF A;  1WW4 A;  3WG1 A;  2V72 A;  1FAT A;  1QOO A;  3MBW A;  3VB9 A;  3BGA A;  2XJS A;  4AED A;  4PF1 A;  1NCR B;  4QXB A;  2R30 A;  2QQK A;  3RZJ A;  3O1M A;  4HMZ A;  3N7J A;  4PT6 A;  2ZCW A;  1S2K A;  2WNU A;  3EQE A;  4NHK A;  2OPK A;  2VO5 A;  2IXL A;  2PAE A;  2AAC A;  3ZSL A;  3LEM A;  5FYS A;  4Z82 A;  3LIH A;  4P9G A;  3VBU B;  4HPK B;  2OUH A;  4JGY A;  1EAH 1;  5I0R A;  1H1A A;  1NLQ A;  3KT7 A;  3I2G A;  3VLB B;  1XNT A;  1H8T C;  2W5F A;  4XJU A;  2V73 A;  5I8T A;  5GAL A;  2WFF 1;  2P17 A;  2R06 2;  1S0F A;  4GH4 A;  4XTM A;  4CDU A;  5A6Q A;  1MS1 A;  1GOG A;  4OI1 A;  3LIG A;  3TOJ A;  4Y1X A;  4D94 A;  3MZH A;  1W6P A;  4EN8 B;  2BFU S;  2HWF 1;  1GNH A;  2YXS A;  1RHI 1;  1BYH A;  3A22 A;  4IV3 B;  4X8P A;  5LRR A;  3ZFE B;  3DYM A;  1UKG A;  1SBD A;  3USU A;  5HCF A;  2XJU A;  4Z2A A;  2BWC A;  2ZZJ A;  4K1Y A;  5FCC A;  1E5R A;  4PDW C;  4XIO A;  1AX2 A;  4DO0 A;  5GLU A;  5FZD A;  1CIW A;  2B45 X;  1ST8 A;  5FLI A;  2XON A;  5H9S A;  4Q5O A;  1XU2 A;  4PF5 A;  5LK5 A;  1IOA A;  4BQ4 A;  4AYU A;  4CCE A;  1YFU A;  3AKR A;  3R4U A;  1SBF A;  1H30 A;  2AEZ A;  5CFD A;  3TAY A;  2QFE A;  1MQT B;  2R06 3;  4LBN A;  5LB6 A;  2A71 A;  3KLS A;  1S0E A;  2VCB A;  1SLI A;  2VOT A;  3KV6 A;  2FDI A;  4NID A;  5EZW A;  2GP5 A;  3RZK A;  5AVA A;  2Q8C A;  1AZD A;  3AVS A;  1OT5 A;  3VD9 A;  1I5P A;  1JBC A;  1EPZ A;  5IW0 A;  4XXA A;  1GZ9 A;  2W1U A;  2R0H A;  1RMU 3;  4LMF A;  4NPR A;  3DGT A;  4URT A;  1ODM A;  4FPE A;  4XDQ A;  4GKX A;  1Y3T A;  3WW1 A;  5F1R A;  5A32 B;  3MW3 A;  4JGY C;  5B2G B;  1PVC 2;  1UU5 A;  1JZ2 A;  3VBF C;  3H8O A;  4CU7 A;  1WWY A;  1G86 A;  4AI2 A;  1VBD 2;  1MQT C;  1XYO A;  2XBO 1;  4XBN A;  4CDQ B;  3N3H A;  5FXW A;  2XVL A;  2ZEX A;  1YQ8 A;  4GAL A;  3RZG A;  1RUH 1;  2D6P A;  2SLI A;  3KVA A;  2Y38 A;  3LEI A;  4P08 A;  4Q0Q A;  1HRI 3;  4ASK A;  1CN1 A;  1ASJ 1;  2RS5 2;  1SPP A;  1TEI A;  1BXH A;  1R09 2;  2X10 A;  3D4K A;  2DFC A;  4FPK A;  4M00 A;  4MXV A;  1RUH 3;  2XUE A;  3TBD A;  1JYN A;  5E1R A;  4R9B A;  1RJ7 A;  2XOM A;  3LGR A;  1H2L A;  4PDW A;  1IKP A;  1H6Y A;  1A78 A;  3N9M A;  4UAP A;  3T2Q A;  3USS A;  3VKN A;  4BXS V;  3ILR A;  1OA3 A;  1BLZ A;  2R07 2;  5AC9 2;  4OUE A;  5FZ0 A;  1L7Q A;  1RJ8 A;  5F5C A;  4P9X A;  3B7M A;  3NW4 A;  2P4E A;  3PVB B;  1RIT A;  5FYH A;  1IG0 A;  4DEV A;  2Y0O A;  2VZO A;  3ORJ A;  2BNM A;  2O8O A;  1QJY 2;  1NA1 A;  1N3Q A;  3URF A;  1RUH 2;  3I49 A;  4H55 A;  1N1V A;  1YJK A;  2E6V A;  5HV0 A;  1T6B X;  3M3E A;  2VTX A;  1L7L A;  2EF6 A;  2A3X A;  1RVF 3;  2YPJ A;  1H2K A;  1LHO A;  4P02 B;  2QCS B;  4TSV A;  1C8M 1;  1X9P A;  4LO6 B;  2GND A;  2EIB A;  2ZGT A;  3R6S A;  1Z7S 1;  4DNY A;  2BJS A;  4D6S A;  1WZX A;  1W8Z A;  1W9T A;  2GNM A;  3WNK A;  2MHF A;  1JZ8 A;  2B8M A;  1UOF A;  1SAC A;  2E53 A;  3H7J A;  4HL0 A;  2OKX A;  3WHU A;  1ND2 B;  1RL3 A;  2AEY A;  4QPI B;  4QU1 A;  4RHV 3;  1HXS 1;  4UBH A;  3D82 A;  1AL2 2;  2XGX A;  3WW4 A;  1QJX 1;  2VPV A;  1XYP A;  4F8A A;  2CGN A;  3AP4 A;  1ULF A;  1ASJ 2;  1H1M A;  1IGO A;  2GNB A;  2R32 A;  3PLQ A;  1UU6 A;  1YNA A;  2EAK A;  1BEV 3;  1NCQ A;  2G1M A;  3CF6 E;  3NNL A;  5IVF A;  1E5I A;  1VE0 A;  2WLQ A;  2QDR A;  2ZX2 A;  3FHQ A;  4JQR A;  4AHX A;  4DXR A;  4EN6 B;  5JMO A;  1LAJ A;  3HBZ A;  1FOD 3;  1H6X A;  3OF1 A;  4CDW C;  4B4R A;  1GBG A;  3FBY A;  2D6K A;  5IK7 A;  1F5J A;  4W8J A;  4M01 A;  4XBQ A;  5EYX A;  1RXF A;  1OPO A;  4A42 A;  4EE2 A;  2PFW A;  3BTY A;  2VBB A;  3VHP A;  5GLT A;  3WF4 A;  3BB6 A;  1UZ0 A;  1VIW B;  4AVT A;  2JG9 A;  4XF3 A;  3B9C A;  3GJB A;  5F5A A;  4RQP C;  4PDW B;  4XF1 A;  2GP3 A;  3KQR A;  4CCJ A;  4EWD A;  2D6M A;  1AR8 2;  1RUD 2;  5D8A B;  4HVR A;  3BTX A;  2IFR A;  3CL1 A;  4KGQ A;  1PHM A;  3AFG A;  3WNL A;  1VAK A;  1FPN 2;  5LA0 A;  5EQU A;  2CWS A;  4UBG A;  1BMV 1;  2YGM A;  4RD7 A;  3ZXA C;  4NIH A;  3E5X A;  3VKF C;  4Q4X 1;  5CKN A;  3RG0 A;  4OQ8 A;  1LEC A;  1JHN A;  1GP5 A;  1K5M A;  4D6Q A;  1IHM A;  1JOP A;  2A75 A;  2VMH A;  3WQ1 A;  1AYN 2;  5FY7 A;  3IAP A;  4NRM A;  1Z7S 3;  3U4X A;  3P6B A;  1O6U A;  1REE A;  4YZ3 A;  5L9B A;  1WLD A;  3LKJ A;  3VDA A;  2I2S A;  3E5Q A;  3AYE A;  4R8H A;  2Q0A A;  3ZXL A;  5FXZ A;  3GHM A;  3GBF A;  4JGY B;  4CYD A;  4FTS A;  3ILF A;  1CGP A;  1R08 3;  2F6B A;  4CZS A;  3DL3 A;  1WGP A;  1DZR A;  1S0I A;  4W65 A;  1ULO A;  4HZF A;  4KQ7 A;  2QQW A;  1K12 A;  1WA6 X;  4QPW A;  5JI9 A;  4GJZ A;  1HRV 1;  2ZEW A;  2QQU A;  1PM7 A;  1KFU L;  3POY A;  1TME 1;  4X6R B;  3QOP A;  3GNE A;  4AVS A;  5HCH A;  1PIV 3;  4PBO A;  2QUO A;  1HRV 3;  1OI6 A;  4XUO A;  4FPL A;  5E8A A;  1LGB A;  4QDR A;  3MLJ A;  4Q0V A;  3E6C C;  2Z4F A;  1PIV 1;  3NJV A;  1X7N A;  5I8Y A;  1V6I A;  1RUF 3;  3HN3 A;  4DY5 A;  4NAO A;  1H9P A;  3W59 A;  5FZK A;  2C26 A;  2IVJ A;  2WFF 2;  2R7E B;  2VNG A;  1TQ5 A;  2VW1 A;  1Q8V A;  1S0D A;  2UUR A;  4XFH A;  4M0N A;  2LW8 A;  1RUC 3;  4RS5 C;  3WG3 A;  2WAO A;  4W6Y A;  3TN9 1;  1W6M A;  1PIV 2;  5FPX A;  1RUC 1;  2PN5 A;  2VQ0 A;  1SQ4 A;  3TEZ A;  2GH8 A;  5KHI A;  1XNB A;  2ZEY A;  1VBE 1;  3IPV A;  1YIF A;  3ZFG C;  1DGR A;  3ATG A;  1SG3 A;  2J1R A;  4YVW B;  4CCN A;  4FFH A;  3MUZ 1;  1QH7 A;  5F2S A;  5FOB B;  4Q0S A;  1WCQ A;  1L3J A;  5JXI A;  2BYV E;  5CKM A;  2CDP A;  1PO1 3;  3VKO A;  2DUR A;  3AYC A;  4C91 A;  4ZU4 A;  4LUM A;  3SH4 A;  2FD8 A;  1PGL 1;  5GLW A;  1SFP A;  3HD8 B;  1RC6 A;  1SLA A;  5LY2 A;  5D21 A;  1QKQ A;  3VBO C;  1F35 A;  1GFF 2;  3Q9O A;  5A7Q A;  1XPW A;  4Y5Z 0;  3WOG A;  5ANN A;  4BIS A;  3GZT B;  3N9Q A;  1YJL A;  4QQH A;  1V70 A;  3DXU A;  5FJH A;  1W06 A;  4RR3 B;  4JGZ B;  1YCI A;  2DYC A;  1W2N A;  1Z0H A;  1HJG A;  2VUD A;  4FQ4 A;  3T4H B;  4BQW A;  4AQT A;  1LJ7 A;  2W46 A;  2RS1 1;  2WZR 2;  4S2H A;  4IEZ A;  3V0A B;  1DCS A;  2VNR A;  5FY4 A;  1NY7 2;  1UNB A;  1UX6 A;  4L97 A;  3LB9 A;  5FP9 A;  3CKH A;  4EJR A;  5EIY B;  4Y4R A;  4YFZ A;  5EYY A;  4BCU A;  3WUD A;  3LCP A;  4IEQ A;  4PHZ A;  2BDR A;  1QJU 3;  3CQO A;  5L9V A;  1NCR A;  3UK9 A;  1VRH 1;  4MUV A;  2XHK A;  1K5J A;  5HXM A;  2VCM A;  1PNF A;  3HAG A;  4FP2 A;  4RS5 A;  2WQ4 A;  1LOC A;  5D1I A;  2JB8 A;  2WNV B;  2EXI A;  5DDJ 2;  2RS3 1;  3ZKU A;  1QXP A;  3FN9 A;  2Y26 A;  1Q56 A;  5J37 A;  4PIZ A;  5FZG A;  2WNU C;  1F31 A;  2A3Y A;  1S0C A;  1W6M B;  1K3I A;  2R04 2;  4MHR A;  5BNP B;  5LA2 A;  2WAA A;  4MXW A;  4K6B A;  4FPF A;  4Y1U A;  1DG6 A;  1RUO A;  4UW6 A;  4XF9 A;  3LSE A;  4YM2 A;  4MGK E;  2V4A A;  3ZR5 A;  2RS3 2;  3AKT A;  4FPH A;  5FO9 B;  4GKY A;  5DUW A;  4MGY E;  4Y1Y A;  3WW2 A;  4FCA A;  2HWD 3;  5A32 A;  5JDB A;  1W39 A;  3WDU A;  1BZW A;  2WT0 A;  3AP5 A;  1F15 A;  3GCX A;  1ZVF A;  2XL9 A;  5T5P A;  1PGW 2;  5BNO A;  4QB6 A;  2GH2 A;  2IXC A;  2WIN B;  5ACA 3;  3VDD A;  3WNM A;  2CL2 A;  4JGZ A;  2D6O X;  3K75 B;  5DAQ A;  1ZRD A;  1ULC A;  2ZGK A;  3EXU A;  4AI1 A;  3FHI B;  1QJU 2;  1RUE 2;  2EXH A;  2ENR A;  3B3Q E;  4RA0 A;  4IEP A;  2UU8 A;  1VRH 2;  1VLN A;  1LED A;  2CGP A;  1BQP A;  3WLU A;  1C1F A;  1RVF 1;  4QXK A;  1UY0 A;  2VTX J;  5JI7 A;  1NCR C;  1GQP A;  3B69 A;  2YC2 A;  2D93 A;  4CU9 A;  4XMA A;  4SBV A;  3U75 A;  4IES A;  1AXZ A;  3KCY A;  5C9A A;  1J83 A;  5J96 B;  4JTO A;  4C0H A;  4N43 B;  3POI A;  1HB3 A;  3N7L A;  1EPW A;  1ZA4 A;  1ENS A;  2FCU A;  2IXI A;  2R16 A;  3GZA A;  4DUV A;  4BH9 A;  3HNB M;  4QGM A;  5CG8 A;  4Y20 A;  3OGJ A;  4EV0 A;  1WME A;  2MEV 3;  2Y6L A;  3O1T A;  4NWV A;  3OBT A;  5IK8 A;  1KGY A;  3M1H A;  3UES A;  1MS3 A;  4N9I A;  4MVT A;  3WDY A;  3DUI A;  1BKZ A;  4KNC A;  2HJI A;  3M7A A;  5KXE A;  4AI0 A;  1U0A A;  4AL9 A;  4HXC A;  3HWJ A;  1VR3 A;  3LA2 A;  3POB A;  1CAX B;  1WCU A;  2JKB A;  3OPW A;  4LKF A;  3O1P A;  2Z42 A;  2J22 A;  3VD3 A;  2VVD A;  1X9T A;  3NV3 A;  4A7Z A;  2RHP A;  4HSJ A;  3JBG 1;  3AXE A;  2MEV 2;  4FOY A;  2OX0 A;  3PUI A;  1ND2 C;  4QPI C;  4XW3 A;  3RJR A;  1F2N A;  5B4X A;  1TMF 2;  2ADE A;  2BBV A;  3H3L A;  3KV4 A;  4YW5 A;  3NAP C;  2HWF 2;  4C1X A;  5FPA A;  5CKQ A;  3ZYG A;  4NR1 A;  1OXC A;  4TLF A;  3WF3 A;  5K8S A;  1ULD A;  5JOZ A;  2ZHN A;  3FLP A;  5IYY A;  5KR7 A;  1UY4 A;  3RPQ A;  1H4G A;  5C71 A;  1RUN A;  4P9I A;  2OII A;  1JS9 A;  2IFW A;  1XOY A;  4LHS A;  4WBB A;  5K9Y A;  5H9P A;  3AZY A;  5KHH A;  3VBS A;  3LA3 A;  4Q4W 2;  4AFM A;  4YNI A;  3U0Z A;  3KT4 A;  4Q27 A;  2C4X A;  4D6R A;  4A7Y A;  3T0D A;  2VE1 A;  5ANQ A;  4LTA A;  4B7E A;  4MXW B;  3RMX A;  2Y33 A;  1D4M 1;  2JIJ A;  3I3Q A;  5HCB A;  3H8R A;  2FDK A;  4Y1V A;  3WF2 A;  3JU9 A;  4AHW A;  3AC0 A;  5KHK A;  1TME 2;  1D0G A;  3H50 A;  1GZT A;  1URX A;  3NV1 A;  3BN6 A;  4IE0 A;  4KG8 A;  4M3C B;  4S2D A;  1UX7 A;  3MV1 1;  1YQ5 A;  1IG3 A;  2RM2 3;  4CDX A;  3I7D A;  2A7A A;  4KWK A;  4KMQ A;  1I5Z A;  2PQS A;  1CAV B;  3A0K A;  1HX6 A;  3I2I A;  1RTV A;  2HWD 2;  5IK5 A;  4LKD A;  3V65 A;  5IAV A;  1JOD A;  2BTV C;  4ZZ8 A;  2P1B A;  1AYN 1;  3SIT A;  1UPI A;  2H6B A;  4ES8 A;  4Q4W 1;  2FDJ A;  4XFC A;  4QX3 A;  1J1L A;  3VD4 A;  1W6Q B;  5K4L A;  1PGS A;  1J3R A;  1OSG A;  5C6C A;  1CZT A;  2VJX A;  4LO5 B;  1EP0 A;  2VGD A;  3HQU A;  1GKB A;  3P3N A;  5BNN C;  2BGC A;  1AYN 3;  5IVE A;  2KD7 A;  4FOV A;  1LEM A;  1UZZ A;  1W6Q A;  3WHT A;  1PGW 1;  3RGB A;  4BDV B;  2VMC A;  3NAP A;  3WDW A;  3SKV A;  2HBU A;  4LJH A;  1GSL A;  2JG9 C;  5FWJ A;  5EJZ B;  3AP6 A;  2TNF A;  3PUR A;  5F3I A;  2C6S A;  2QKD A;  2W2I A;  1RUJ 3;  3N36 A;  4HAN A;  2XDV A;  5DDJ 3;  5BXX A;  3WDT A;  4AOC A;  4E8D A;  5CIS A;  4MO3 M;  4F3J A;  4XF4 A;  2DBN A;  3UET A;  2VBP A;  1JYV A;  1VMJ A;  4ZKT B;  3K4Z A;  2VZS A;  5DUX A;  3Q8F A;  4NPL A;  2UYA A;  1ZRC A;  3VBS B;  3GAL A;  5BNN B;  1GWK A;  3UKV A;  5KXC A;  4K8F A;  1GLH A;  2XJT A;  3AMQ A;  3GYD A;  1YI9 A;  1UCX A;  2VUA A;  3P3P A;  1NUK A;  2WJS A;  4JHT A;  2J1T A;  3ZN4 A;  3OD0 A;  1S2E A;  5A33 B;  4QM8 A;  4XTP A;  4LBJ A;  2XLG A;  3T0A A;  3JXS A;  2EA7 A;  2RV9 A;  2EXK A;  3X29 B;  5DMY A;  2PMW B;  1XXN A;  4CDX C;  3QLQ A;  3I3M A;  2R49 A;  4OI2 A;  1VBE 3;  4QXH A;  4AI9 A;  1PM4 A;  2JEM A;  5JR7 B;  1LHU A;  2E32 A;  3OEA A;  3ACG A;  3KD4 A;  3ZFG B;  3LE0 A;  4LO4 B;  3Q8B A;  3WP3 A;  1JU4 A;  2E33 A;  2P34 A;  1VPH A;  3AMM A;  3WCS A;  1GQG A;  2YYO A;  4NJ4 A;  4UI9 L;  4BWO A;  3AKS A;  3UKN A;  4MGT A;  1NQD A;  3OYW A;  4LO7 A;  3W58 A;  2WZR 3;  1GZC A;  4P14 A;  5EHD A;  1IQD C;  5FYM A;  1N1S A;  5FYT A;  4E2S A;  2VMF A;  4LA3 A;  1TVG A;  2QQN A;  4AI3 A;  1J3P A;  3S7I A;  1WBF A;  2EVX A;  3CIH A;  1XE8 A;  3TEY A;  2NP0 A;  1DZT A;  1OKQ A;  3WQ7 A;  2VH9 A;  2HWB 3;  2ZGR A;  5AC9 1;  1KDM A;  4BE3 A;  1LOD A;  1R1A 3;  1FAY A;  2BP6 A;  1A8M A;  2BNO A;  1DLL A;  3ZFE C;  4CU6 A;  5T52 A;  4BQ2 A;  2GAU A;  1VBA 2;  4X6Q B;  1VBD 1;  2ZKL A;  2Z2S B;  4G3Y C;  3VD7 A;  4Q8K A;  3Q8C A;  2NN8 A;  3OGS A;  5T50 A;  4QX7 A;  3PUQ A;  4CCO A;  4R9C A;  2TEP A;  4L99 A;  5GZG A;  3VZJ A;  3T1L A;  2VXJ A;  3DV8 A;  4IGP A;  4OHZ A;  3THP A;  3F2Z A;  3IMN A;  5FZC A;  3UL2 A;  4YVW C;  4JKK A;  1YEW A;  4O61 A;  4CTE A;  3A7Q A;  4WM7 A;  2Q1F A;  1WBL A;  3ZYH A;  2Y60 A;  4CUA A;  1PVC 3;  3T3Y A;  2BVV A;  2PHD A;  3WG2 A;  2WWS A;  3VBO A;  1W3V A;  3T2T A;  3FFQ A;  3O0V A;  5K0U B;  2Q1Z B;  3HBK A;  1AL0 G;  5FZ1 A;  1XE7 A;  2RMU 1;  3M3C A;  2PLV 3;  4ZS3 A;  4BK5 A;  4XUR A;  2VQT A;  3WIN E;  1PMH X;  1FPN 3;  1TG7 A;  2E51 A;  2CNA A;  1AXY A;  2WWU A;  4CEW A;  1RB8 G;  4YG0 A;  3G6J B;  2DDU A;  4BMB A;  2A5Z A;  2HWF 3;  3IZO A;  5C4W A;  2HWD 1;  3VUO A;  1W6P B;  3I8T A;  2Y34 A;  4OUS A;  4S2F A;  3C3V A;  4AW7 A;  3SNM A;  3JQW A;  2DTW A;  4IL7 A;  4Y22 A;  3NMB A;  5F2W A;  3DF0 A;  5AVP A;  1FMD 1;  3PME A;  3N9P A;  3WXP A;  2YUE A;  2HBT A;  2WO2 A;  1VBA 3;  2O14 A;  4U2A A;  2XVG A;  1WD4 A;  5IFP A;  5JPM B;  3CMG A;  1C57 A;  3KV9 A;  2VW2 A;  5T54 A;  4ET7 A;  4FO9 A;  4KI5 M;  3FX3 A;  3S6P A;  1QJZ A;  1PO2 2;  2OZJ A;  3HNY M;  3IM0 A;  4XJ8 A;  1VBC 1;  5FDB A;  4YSF A;  2CU5 A;  2PHL A;  3KZ4 C;  4YM3 A;  2BQP A;  3GCW A;  3ROU A;  4YM1 A;  1C4R A;  5FWE A;  3CJI C;  4K21 A;  1COV 3;  4AED B;  5HV4 A;  3S5A A;  1IS4 A;  3AYA A;  3JD7 1;  1CAU B;  2QJV A;  2GDF A;  3KSC A;  4I09 A;  5FZ6 A;  4AR2 A;  4RSU A;  4YW7 A;  1R1Z A;  4YVW A;  2R06 1;  1VB4 A;  3KF5 A;  2ZBJ A;  5KHG A;  3NO8 A;  1SLC A;  4GUL A;  2E31 A;  3RDI A;  3ZN6 B;  2DTY A;  4COV A;  2QZ2 A;  3UNP A;  1BBT 1;  1WLW A;  4FOW A;  4EWA A;  4XC9 A;  4JC1 A;  5F3E A;  2XKO A;  5LA1 A;  4CDX B;  3ZMN A;  4K8R B;  3O1O A;  5CIR A;  4R52 A;  5KXD A;  4LHK A;  3AXD A;  2BOI A;  4FT8 A;  4ERO A;  2A1X A;  1DYP A;  5A7O A;  3OUJ A;  4FPG A;  4A3Z A;  2B46 X;  1DLC A;  4UXA A;  3W5N A;  3VGI A;  1PZ9 A;  1UY2 A;  4JGZ C;  4PQ9 A;  2DVG A;  2XJR A;  4LIT A;  5C4W C;  4I0A A;  4CEW B;  3T09 A;  4Q1P A;  3G7D A;  5FYY A;  2WFF 3;  1QNY A;  3QH7 A;  1EV1 3;  1DQ4 A;  2CHH A;  2ZGN A;  4Q4V 2;  1LU2 A;  4E27 A;  1H9W A;  1YFY A;  2UY8 A;  5FYC A;  1OQE A;  1Y9G A;  1GP6 A;  2LUW A;  3ZSM A;  3FBM A;  5FYZ A;  5FXV A;  3IKW A;  4MOA A;  4QQ2 A;  4R9A A;  2XUM A;  2IXK A;  4D7S A;  5JVV A;  1RUJ 2;  4QT6 A;  4MAD A;  5L7O C;  3TEW A;  4TZD A;  1AR7 2;  3ZFF C;  1WCS A;  2WA3 A;  3AJY A;  4FTB A;  3U78 A;  1HN1 A;  2B5H A;  2ARB A;  1EY2 A;  4H7L A;  3V0B B;  2QVS B;  4YGB A;  1ZM1 A;  4P9J A;  1RED A;  2YPD A;  4AEJ A;  1PNG A;  4MGS A;  3B93 A;  2VZT A;  1N3O A;  2A6Y A;  3MO4 A;  5EWS A;  5FK8 A;  1C5H A;  4DY3 A;  5CZK A;  4CEY C;  2K0G A;  3V0B A;  2ARA A;  1CAU A;  2QQV A;  2VOV A;  3AMH A;  3NNG A;  1JYW A;  1OBN A;  4NHY A;  1R64 A;  3TB0 A;  4JAA A;  2PHT A;  2VOW A;  4YW6 A;  1IPK A;  2NZ9 A;  5FZE A;  1ZBA 2;  1V6K A;  3OYW B;  2Y6K A;  4HKL A;  3WQB A;  3ZYR A;  1X8M A;  1ZX5 A;  4TWT A;  1UYY A;  3DYO A;  4QHB A;  2CAU A;  2ZOE B;  1DYK A;  1TME 3;  3ES4 A;  3SEP A;  4IE4 A;  5DUV A;  2DVB A;  4HVO A;  5FP7 A;  1WD3 A;  3THC A;  1FNZ A;  1KIT A;  4Q4Y 2;  4UF0 A;  5L9R A;  4E4D X;  3KMH A;  5L19 A;  2ID4 A;  1DQ6 A;  1WW5 A;  1UYX A;  5GZE A;  3LEG A;  4M0H A;  4MX3 A;  2GZW A;  1X82 A;  4BU2 A;  5T5L A;  3U4S A;  1DU3 D;  2WZE A;  3MGU A;  3RJ2 X;  2R07 1;  4UW5 A;  2IUW A;  4CDQ C;  3JQX A;  5BYN A;  4AVC A;  4AFC A;  5DZG A;  5D8A A;  1G9D A;  3K2O A;  5A7W B;  5DDJ 1;  3AX4 A;  3ZSK A;  2RR1 3;  5DAP A;  1JTZ X;  4AE2 A;  4M3C A;  4AAP A;  5LW9 A;  4XFB A;  1ULE A;  1AL2 1;  2TUN A;  3FLT A;  1COV 1;  1V9U 3;  5JIA A;  1H1I A;  5CA6 A;  1W9Y A;  2H0V A;  3MPP G;  4CA9 A;  1Y4W A;  4N53 A;  1ZZ9 A;  2WS9 1;  4N8M A;  1Z7S 2;  1U12 A;  4V2W A;  3ZVX A;  3J26 N;  4Y5T A;  5J09 A;  3VBR A;  4XXP A;  3VV1 A;  1ENX A;  5JCT A;  2XBO 2;  1VBB 2;  3CU7 A;  3ZO0 B;  1AR9 3;  1Q8P A;  3HEI A;  3VBH A;  4QQL A;  1GUI A;  4XUT A;  3ZXK A;  4AI8 A;  2X5I C;  3GXU A;  3AZX A;  2B9V A;  5LBE A;  3SCG A;  2NPI A;  3KV5 A;  2PQQ A;  3E6B A;  3PNA A;  1IKQ A;  2RDS A;  5CBL A;  4YYO A;  5EV7 A;  3ON7 A;  2W1W A;  1OD5 A;  4PLM A;  4WVW A;  3NNM A;  3B9I A;  4SLI A;  2JD9 A;  2P3Y A;  3KGZ A;  4HKW A;  4XZU G;  1I9R A;  5FBJ A;  1LHN A;  1PK6 C;  4NHL A;  1WW7 A;  2RS1 3;  4YZ1 A;  5LBC A;  1ALY A;  4TTG A;  4BK4 A;  1WCD J;  4RHV 2;  2J1U A;  3C7E A;  2BER A;  5BPX A;  4AAX A;  1T2X A;  5IVJ A;  4YWA A;  1ASJ 3;  5A3N A;  1FMD 2;  4FFI A;  4GWM A;  3IIA A;  2I07 B;  5GZC A;  1HQL A;  1OFN A;  1QQP 3;  3UKT A;  1POV 3;  5GM0 A;  5BY5 A;  3MF9 A;  1O3T A;  2W92 A;  5LWB A;  3BYW A;  4MSV A;  2MNG A;  2PHX A;  5A80 A;  2ZHK A;  1TZO A;  5IVB A;  4D7T A;  3SLI A;  1KEX A;  3UYJ A;  4ASM B;  4QPG B;  4RFT 0;  3UT0 A;  1RIN A;  2VUC A;  1KJR A;  1HV1 A;  1W8H A;  3K48 A;  1RUF 1;  4OLL A;  5C70 A;  1QEX A;  2EIE A;  3GBG A;  3OOX A;  4IW3 A;  4AFA A;  4UFH A;  2J1A A;  5F39 A;  3SKJ E;  4XOG A;  5JUV A;  1OKO A;  1JN2 P;  1MEC 3;  5GZF A;  2C24 A;  3AB0 A;  1AR9 2;  4XUP A;  2DF7 A;  2HEW F;  4XQW A;  1KFX L;  2RJL A;  2E26 A;  1VJ2 A;  2EXJ A;  3L9J T;  1KS4 A;  3TN9 3;  4DRR A;  3VBR C;  1GZW A;  2WSU A;  5FRE A;  4GMP 3;  1BBT 2;  2E9Q A;  2JXA A;  4DS0 A;  1RUI 3;  4C90 A;  2OZ6 A;  3KB5 A;  3U14 A;  4NRQ A;  3WP4 A;  1ZBA 3;  1KRI A;  1GOF A;  3WUC A;  3MDP A;  1RXG A;  4NAM A;  4ZHN A;  1V6L A;  3MIF A;  2VCA A;  3B02 A;  2AUY A;  1RUI 1;  4LIV A;  3CZJ A;  5T5O A;  2RR1 2;  4YZ2 A;  1CWP A;  2CDO A;  1HB1 A;  4AF9 A;  2FDG A;  1FYU A;  2VD7 A;  1PK6 A;  4XFF A;  1GNY A;  2EIC A;  2EAA A;  4UW3 A;  2QQJ A;  3ECQ A;  4FPY A;  4QKF A;  2D3S A;  1DQ5 A;  2YRO A;  2VZ1 A;  3LFM A;  2W1Q A;  3MF6 A;  4H3W A;  2IZW A;  2PAK A;  2Q30 A;  2AH2 A;  3AFK A;  4RYD A;  5C3O A;  1IZ3 A;  2VU9 A;  5DZF A;  1LHW A;  4LQR A;  3LPF A;  4GH4 C;  4LOT A;  2FBE A;  3OG2 A;  2QZ3 A;  4AQS A;  3EYP A;  1JYI A;  4GMP 0;  5A3P A;  5ISL A;  2V5D A;  1HXS 2;  1NXD 1;  1RUG 2;  1V6J A;  1ZRR A;  1JOJ A;  4BQ1 A;  2ZA9 A;  3QCW A;  2XXZ A;  1W2O A;  5JOX A;  3POF A;  1UWW A;  4J25 A;  5C3R A;  1W6O A;  3OUH A;  2H0B A;  3I2J A;  2DU1 A;  3J7H A;  1MAC A;  2GN7 A;  4BPZ A;  1NKG A;  4IV1 A;  4R4Z A;  2D5F A;  4WM8 B;  1DQ2 A;  1UMZ A;  1DP0 A;  1UMI A;  4PI0 A;  4JDM A;  4YW3 A;  3N4M A;  3QAC A;  2BEO A;  2HWE 1;  1IS5 A;  3WX5 A;  4LHN A;  1SCR A;  1PO2 3;  4DRV A;  4E4Z A;  2J1S A;  5SV8 A;  2UWC A;  3P1I A;  2GC2 A;  4XJ9 A;  4YG6 A;  1SLT A;  1Y9M A;  2WNO A;  1QH6 A;  2GC1 A;  2YFU A;  1POV 0;  1G9C A;  5C7G A;  2L9L A;  5DAB A;  2SBA A;  3CLP A;  2EID A;  3KF3 A;  4LBO A;  4XAC A;  2GMP A;  5CFC C;  1AR8 1;  1RUD 1;  1ZBA 1;  1ENR A;  2XB6 C;  1Q3E A;  2BRT A;  4AGV A;  3ZXD A;  4Q0U A;  1MS9 A;  4DZG A;  5BNO B;  3FLR A;  4GB3 1;  2VUL A;  2D7F A;  2OQ7 A;  3ZR6 A;  3WF0 A;  4PQQ A;  1LCL A;  1XNK A;  4YW2 A;  5HPO A;  1W8U A;  1D4M 2;  3HVD A;  5C3S A;  3S5Q A;  1FNY A;  1US3 A;  2WLP A;  2ZMK A;  2HYK A;  4HET A;  1WUV A;  1RMU 1;  4OYU A;  4FQZ A;  2W91 A;  2O8Q A;  4COW A;  4M4R A;  1ENQ A;  1F5F A;  3AP9 A;  2E63 A;  2ES3 A;  1NCQ C;  2XQX A;  5GLV A;  3ZXF A;  1AR6 2;  2G19 A;  3AZZ A;  3MIC A;  3EJK A;  5FYB A;  2JDM A;  4DXZ A;  2ZAB A;  3NV2 A;  5J48 A;  1O3Q A;  4QKB A;  4IE7 A;  4S2G A;  3HNM A;  3J7L A;  4IE6 A;  4UFL A;  3TYJ A;  5KHJ A;  1X50 A;  1IPJ A;  3MHZ A;  4DUW A;  4NWW A;  5I8S A;  1K45 A;  1K5M B;  2G9F A;  4X8N A;  1H4H A;  3FFZ A;  3VHR A;  3T30 A;  1GR3 A;  2VEC A;  1CZS A;  1BEV 2;  5A3W A;  1TNF A;  3EMR A;  4H2A A;  1AR7 1;  1YQC A;  1MZF A;  2YC4 A;  1SPP B;  3ZX7 A;  5DXD A;  2DCK A;  4IDZ A;  4BA6 A;  2JDH A;  2VVE A;  4W6W A;  2VNV A;  1Q8S A;  1UW8 A;  4W4Z A;  4B4Q A;  1HDK A;  5J7M A;  5C3Q A;  3ENR A;  1OH3 A;  3IWZ A;  1CX4 A;  2R1B A;  3O5S A;  3O0W A;  3V0A A;  1NG0 A;  4HOO A;  2LTN A;  2RS5 3;  4COY A;  2RJK A;  4L2N A;  3WD5 A;  2LRP A;  1CJP A;  3JBG 3;  1N47 A;  5J3U A;  4M4P A;  1QGL A;  3BIW E;  4IV3 A;  3TWI A;  4AQ6 A;  4AEM A;  5JAX A;  2FZ1 A;  1PGL 2;  1GP4 A;  5LA9 A;  2VW0 A;  3ACH A;  5JXH A;  3RZZ A;  1EYB A;  5IAX A;  4AGG A;  5FIX A;  5FMO L;  4KWL A;  1OH4 A;  1PO1 2;  2JIG A;  1RUG 1;  4OCT A;  4HN1 A;  1VMF A;  4EZH A;  2ORZ A;  1MVE A;  2JD4 A;  2D44 A;  3ACL A;  2QE3 A;  1WW6 A;  4KBZ A;  1OHF A;  5A3L A;  2FCV A;  3MLK A;  1AX0 A;  1YQ6 A;  3I3D A;  2DCJ A;  1F4H A;  2Q8D A;  1Y43 B;  2LS6 A;  1RVF 2;  3OGG A;  1HXS 3;  2ZEZ A;  4JDO A;  4OMC A;  3VL8 A;  5F37 A;  1O4Y A;  1V6O A;  1S2B A;  3RNS A;  2WR9 A;  4RR3 C;  4WM8 A;  4O65 A;  1W3X A;  4BYY A;  4LE4 A;  4GXL A;  3M3Q A;  5LAT A;  3VBF B;  3D8C A;  2VZQ A;  2HEY F;  3SCH A;  1STM A;  4YVS A;  2FMY A;  2KA3 A;  5I91 A;  2PLV 2;  2A73 B;  3BKZ A;  1WLT A;  3ILN A;  1VBE 2;  1CAW A;  3T2O A;  4OHY A;  3SH3 A;  2Q5T A;  4HLT A;  4XFG A;  3SXW A;  4ARY A;  5C8C A;  1GYK A;  2PA7 A;  4JVA A;  4GWI A;  2AEN A;  3WF1 A;  5JSR A;  1UO9 A;  1QU0 A;  4I0W B;  1K5M C;  1UAI A;  4ZU7 A;  4EN7 B;  5A1L A;  2WQZ C;  2KM2 A;  2XWJ B;  4HVQ A;  2B42 B;  1A3K A;  1ZNP A;  5F6K A;  4WV8 A;  5ABJ C;  1NYW A;  3WDV A;  3WEZ A;  5BNP C;  2NYY A;  4BME A;  4OHX A;  5M0T A;  3JCI A;  1QJF A;  1H0B A;  2ZS6 B;  1X36 A;  3U11 A;  1C3H A;  1HV0 A;  1R1A 2;  1HRI 1;  5KXB A;  1VRB A;  3VHO A;  1OQ1 A;  2HWB 2;  4QGL A;  4N43 A;  4QXC A;  1AVB A;  1EUT A;  5T55 A;  5CG9 A;  4EWE A;  1U5Y A;  4A44 A;  5D2A A;  2K46 A;  4AVB A;  4B4P A;  2UY9 A;  4MGZ E;  2QQO A;  1QOT A;  3T1M A;  5FJK A;  3ZLI A;  1UU4 A;  5I0U A;  2WRA A;  4BJ0 A;  1W8O A;  3LFI A;  4UFK A;  1POV 1;  2JDA A;  3MW4 A;  4R4X A;  4YGC A;  4ISQ A;  1ZRI A;  4N53 C;  2FMD A;  2W47 A;  1W04 A;  5IVY A;  3BI3 A;  4N90 A;  4P5H A;  3DPR A;  3GM8 A;  3KQ4 B;  4LBQ A;  3KHB A;  5C3P A;  3RZL A;  1Q8O A;  4JX0 A;  5FYU A;  1QJU 1;  2JDZ A;  3TEX A;  2PHF A;  1P8J A;  1QQP 2;  2BV4 A;  3VBH C;  4V2V A;  1XC6 A;  3LQC A;  3LWC A;  3NQH A;  2VXR A;  2X05 A;  1G9A A;  1MVQ A;  2A6Z A;  5JXG A;  3ZFG A;  1JOB A;  4Y22 B;  4BOW A;  2BOJ A;  3IDC B;  3MIG A;  3KS7 A;  4UOJ A;  1ACC A;  1W8F A;  3RVH A;  5CNA A;  3ITQ A;  4GMP 1;  2BNN A;  1S1A A;  4OQ9 A;  4TLG A;  4JKL A;  2VNO A;  2Z79 A;  5A7S A;  2ZX1 A;  3ZXJ A;  4YPJ A;  2BU9 A;  3CEW A;  2VR4 A;  4I02 A;  5CFD B;  1M06 G;  1B35 A;  1QDO A;  1YFW A;  2ZML A;  3OPT A;  4Y1Z A;  3LDB A;  1FXZ A;  2K9Z A;  2PHR A;  5FUP A;  5FZB A;  4ZU5 A;  4Q4V 1;  3TNQ A;  4Y5S A;  2XBO 3;  2WT2 A;  4A2U A;  4ISR A;  4EN0 A;  3IPV B;  2JX9 A;  4QPG A;  2OYZ A;  2RR1 1;  3HQR A;  4IQP A;  4MYE A;  4DEQ A;  3TNP B;  4XAB A;  1OF4 A;  2ZX3 A;  2BFU L;  1BCX A;  2HH9 A;  1BVP 1;  2CWM A;  3GBW A;  2GSY A;  3V56 A;  5A1F A;  1NLS A;  3E6D A;  4YVS B;  4CP1 A;  1UL9 A;  5DPN A;  3VN4 A;  1H2M A;  2YBK A;  3GHN A;  2YU2 A;  1KD7 A;  2KR2 A;  2N7G A;  1EUU A;  2BGO A;  3PMS A;  5A70 A;  2YHJ A;  3KCC A;  4OUM A;  4XQD A;  4AHZ A;  5AC9 3;  4NIG A;  4P9W A;  1UZW A;  4O9E A;  4QX1 A;  1YFX A;  3NST A;  3DPR C;  1W99 A;  2UYB A;  1S55 A;  3W20 A;  2B9U A;  4MV2 A;  3NJX A;  1UY3 A;  4ITC A;  4B7K A;  1RYY A;  4OHW A;  4KGG A;  4AED C;  1OLM E;  3OY8 B;  1UIJ A;  3CO2 A;  2YGL A;  3PUS A;  3U37 A;  1QJY 1;  2JEC A;  2WBK A;  2YB7 A;  5CAD A;  4CCD A;  3I54 A;  3VBH B;  3HJR A;  1O59 A;  5LAS A;  4D69 A;  1ZYB A;  2ZHM A;  2ILM A;  2OUJ A;  3CJI B;  4CCL A;  1ZZ6 A;  2DCZ A;  5A6Y A;  3ACI A;  1OA4 A;  1Y9Q A;  3M3O A;  5ACA 2;  2P3I A;  5IVC A;  1FV3 A;  1PZ8 A;  3I2K A;  5FZ3 A;  3H8X A;  2DBI A;  1ZZB A;  2D6N A;  5LK7 B;  2VMI A;  4R9D A;  2JG8 C;  5FLJ A;  5DAX A;  5T5J A;  1LEN A;  4QKD A;  3IMM A;  3FWE A;  4M3C E;  1QJX 2;  5FK7 A;  3FUO A;  5FPZ A;  3ZKY A;  3AZV A;  2BGP A;  2OXB A;  2OT7 A;  4K20 A;  4GB3 2;  5BNO C;  2XWB B;  4JQT A;  4QX8 A;  4KBB A;  1HRI 2;  3T4V A;  2RJ2 A;  3KHC A;  3VDD C;  3ES1 A;  3PU8 A;  3JZV A;  4QAW A;  4LK6 A;  2O0O A;  5FKB A;  4IND A;  5FTT C;  1ND2 A;  4QPI A;  3LSD A;  1HRV 2;  3MID A;  4WVM B;  3VZM A;  4HK8 A;  1W0O A;  4AHY A;  4XJZ A;  1VMH A;  2P6H A;  2X09 A;  1LGN A;  1RUJ 1;  3B5L B;  4E4H A;  2W08 A;  2Y6G A;  2XLF A;  2R0F A;  1RUF 2;  3UJO A;  1JYC A;  1QIQ A;  2ZZQ A;  4ONU A;  1H8V A;  1DIW A;  1J84 A;  1E5H A;  3LDR A;  1DHK B;  3VBS C;  4Y4Y A;  4EQV A;  1XU1 A;  3KM5 A;  3QD6 A;  4EYU A;  5FQ0 A;  2Z5W A;  3VDD B;  1APN A;  5C9A C;  3RQ0 A;  1YI7 A;  3RMY A;  2CAV A;  4LBK A;  5FQ0 B;  4L8Q A;  4XVH A;  3O1V A;  4ZS2 A;  2VZ3 A;  4I01 A;  4A6O A;  5F5I A;  3ABZ A;  2QBX A;  1JZ7 A;  3I4I A;  4CCM A;  1XRU A;  2IC1 A;  1B35 B;  4QX2 A;  2ZGU A;  4O7X A;  3VL9 A;  3DXT A;  2QNK A;  1J58 A;  1WMX A;  1XSR A;  1DGW A;  2FHR A;  1HIX A;  4BLJ A;  4G9S B;  5CEH A;  1GOH A;  1LOF A;  2W3J A;  3LZZ A;  5EPA A;  3BU7 A;  1O5U A;  2JG8 A;  1W8T A;  4IEV A;  2D43 A;  4GJY A;  2QQP A;  2G4I A;  1PX4 A;  4K40 A;  5F3C A;  2WDB A;  3NNJ A;  4V1P A;  2XML A;  3Q8E A;  5A3O A;  1NE4 A;  1ZZ7 A;  5BUV A;  1A34 A;  3WG4 A;  5J1X A;  3U10 A;  3OB8 A;  5F8P A;  3JB8 A;  1V9U 2;  3HPN A;  4LBQ D;  4WVV A;  1BK1 A;  3PHM A;  1NE6 A;  4C1W A;  5BNN A;  2AR6 A;  5FR3 A;  4AZZ A;  3ELN A;  3CNA A;  5JWP A;  1WLC A;  4NIA A;  4QB1 A;  5E16 A;  4P00 B;  5DAW A;  3FHA A;  5I0D A;  3H3Z A;  5A33 A;  3A21 A;  5A1A A;  4B1M A;  2F17 A;  2ZAH A;  2JJ6 A;  1OQD A;  2WQ8 A;  3C7G A;  1QDC A;  3PIJ A;  2V5Y A;  4I2O A;  1FX5 A;  4XDP A;  2YV8 A;  1VBD 3;  2FCT A;  1J1T A;  2F4P A;  3O14 A;  5H9Q A;  2ZPX A;  5CB7 A;  4Z1V A;  4HBN A;  5C4W B;  3FL7 A;  2JKX A;  3NKT A;  1FOD 2;  3BTZ A;  3HQX A;  1JMU B;  1AR6 3;  2PAM A;  4AFB A;  1U5Z A;  3K4A A;  4GB3 3;  4KWU A;  3M4F A;  5CYY A;  5C5T A;  4RL7 A;  5C8W A;  1J3Q A;  3S57 A;  2JDK A;  5BNQ A;  4LUL A;  1XYN A;  3C7H A;  1CD3 G;  1UXX X;  2Q4S A;  1V6N A;  5FMD A;  1XSQ A;  2D98 A;  1UPS A;  4IEY A;  3JB4 C;  5FZF A;  4Q26 A;  3AJZ A;  3HT1 A;  3PTR B;  4L11 A;  1MQT A;  1KQR A;  3FMG A;  4AG4 A;  4FXG B;  4UW4 A;  4OI0 A;  1OMI A;  1FPN 1;  1Q5O A;  2FQP A;  1LOF C;  2RMU 2;  4NOT A;  3S7E A;  1G8W A;  4Q2F A;  3SH5 A;  3SHR A;  4B3N A;  1QJX 3;  4D0Q A;  3J9S A;  2X8K A;  3I2H A;  3W9A A;  1NY7 1;  1WMF A;  5H9R A;  1ZRF A;  5CVR A;  4LLO A;  4WVM A;  4WM8 C;  2IXH A;  1W8N A;  1YC6 1;  2CYF A;  2YBP A;  2PHW A;  3J8F 3;  3PTY A;  4GWJ A;  1RUE 1;  4HON A;  2JEN A;  4CDW A;  1DDL A;  3T08 A;  1DBN A;  4KG0 A;  1R1A 1;  2PXJ A;  4I30 A;  1AL2 3;  3POJ A;  1IS6 A;  4NO4 A;  4Q4V 3;  3P5B A;  4YG3 A;  3O12 A;  3O1U A;  4CDW B;  4Q4Y 3;  5G05 L;  4LBM A;  4HK9 A;  4LUK A;  1VBA 1;  3UGH A;  5FO8 B;  2NQY A;  5A3T A;  4LR4 A;  2NMO A;  3ZPO A;  5A3U A;  1N1T A;  2ADD A;  1VP6 A;  1LOA A;  4LA2 A;  4JDN A;  1I1E A;  1NA1 C;  3KWV A;  2HLE A;  4OZO A;  4JTN A;  2DU0 A;  5E88 A;  2VM9 A;  5FO7 B;  1LTE A;  1AR7 3;  3MYX A;  1HLC A;  4XCA A;  5FAX A;  4COU A;  1W9F A;  4E4S A;  5FZL A;  3ZYF A;  3IDA A; 
#chains in the Genus database with same CATH homology
 1GMM A;  3CZJ A;  2CDO A;  5DQ0 A;  4LPL A;  1GNY A;  2EIC A;  4QB2 A;  2QQJ A;  3ECQ A;  1CZV A;  2QQI A;  2VZ1 A;  4DUX A;  2W1Q A;  1UY0 A;  4RYD A;  2VME A;  3CDZ B;  4LQR A;  3LPF A;  1GQP A;  2BZD A;  2YC2 A;  4TXW A;  4FI9 A;  3OG2 A;  3SEE A;  4CU9 A;  3EYP A;  3K46 A;  2V5D A;  3WSO A;  3OGR A;  1J83 A;  4OMD A;  1CIY A;  1SDD B;  4L0P A;  1UWW A;  4DUV A;  3HNB M;  2Y6J A;  3IAQ A;  2QQL A;  2Y6L A;  3I2J A;  3C7F A;  3J7H A;  1L7R A;  1NKG A;  1UY1 A;  1DP0 A;  1KGY A;  1UMI A;  3T0B A;  4JKM A;  3UES A;  4QX0 A;  1OD3 A;  4W50 A;  2J1S A;  3P1I A;  4RN5 A;  1O8P A;  1JZ3 A;  3ACF A;  2YFU A;  2YFZ A;  1NAE A;  2J22 A;  2L9L A;  3VD3 A;  5C7G A;  2EID A;  4HG6 B;  3OGV A;  3PUI A;  3W5M A;  4IUG A;  5B4X A;  1OF3 A;  4ZZ5 A;  3WF0 A;  4PQQ A;  1ULP A;  3WF3 A;  5HPO A;  2VZR A;  5IYY A;  1UY4 A;  1US3 A;  3E1F 1;  5C71 A;  4CVU A;  4OYU A;  4LHS A;  4QDS A;  2W91 A;  3OBA A;  3MV0 1;  4M4R A;  3IB3 A;  2C4X A;  3T0D A;  2XQX A;  1MPX A;  5G04 L;  1BHG A;  2J1E A;  4A41 A;  4QDQ A;  1W9W A;  3K4D A;  2VZV A;  3WF2 A;  4CUC A;  3HNM A;  3AC0 A;  1JI6 A;  2VZU A;  4DUW A;  3BN6 A;  1K45 A;  1UX7 A;  3MV1 1;  1CZS A;  4KMQ A;  2J7M A;  2PQS A;  1W9S A;  2YC4 A;  2DCK A;  5EJ1 B;  3I2I A;  4W4Z A;  3LPG A;  3I3E A;  2WYS A;  4ZZ8 A;  2Y64 A;  4QX3 A;  3VD4 A;  1CZT A;  2VJX A;  1JHJ A;  4M4P A;  2KD7 A;  2VQU A;  4BDV B;  2VMC A;  4XUN A;  2VMD A;  3ACH A;  3SKV A;  5IFT A;  5JXH A;  5EJZ B;  2YG0 A;  1OH4 A;  2ORX A;  4E8D A;  5F7U A;  2ORZ A;  4MO3 M;  2V72 A;  3MBW A;  3BGA A;  3UET A;  1JYV A;  3K4Z A;  3I3D A;  4PF1 A;  2C9K A;  2DCJ A;  1F4H A;  2VZS A;  2LS6 A;  2QQK A;  4OMC A;  2ZEZ A;  2BBA A;  4PT6 A;  3HOB A;  2VO5 A;  1NUK A;  4JHZ A;  2J1T A;  3C8X A;  4A4A A;  2VZQ A;  3T0A A;  3JXS A;  2RV9 A;  5DMY A;  3ETP A;  3VDB A;  3I2G A;  1XNT A;  3NRU A;  2W5F A;  3C7O A;  2E32 A;  3OEA A;  3T2O A;  3ACG A;  4GZ9 A;  4ARY A;  3LE0 A;  1GOG A;  1JU4 A;  2E33 A;  4GWI A;  3WF1 A;  3A22 A;  3DYM A;  1PX3 A;  4UI9 L;  2VZP A;  3DEC A;  4Z2A A;  1IQD C;  2VMF A;  1TVG A;  3WEZ A;  2QQN A;  2XON A;  3CIH A;  3ZM8 A;  2J1V A;  1EUT A;  1D7P M;  4CU6 A;  2VCB A;  2VOT A;  4A44 A;  3VD7 A;  4ARX A;  2QQO A;  1OT5 A;  3VD9 A;  1I5P A;  3OGS A;  5JXJ A;  4BJ0 A;  2WUH A;  2W1U A;  1W8O A;  2JDA A;  4LKS A;  3F2Z A;  3WNP A;  4JKK A;  2VCC A;  3A7Q A;  1JZ2 A;  2W47 A;  4CUA A;  4CU7 A;  3GM8 A;  4DXT A;  2ZEX A;  4JX0 A;  1P8J A;  3LEI A;  5DN2 A;  4P08 A;  4BK5 A;  3NQH A;  1XC6 A;  3LQC A;  4XUR A;  5IHR A;  2VQT A;  1LNS A;  1PMH X;  1TG7 A;  2X05 A;  5JXG A;  2DDU A;  2X10 A;  1K42 A;  1JYN A;  2W94 A;  4UOJ A;  1O8S A;  2XOM A;  1H6Y A;  3T2Q A;  4UAP A;  4BXS V;  4JKL A;  4YPJ A;  2VR4 A;  4OUE A;  1L7Q A;  2WO2 A;  3T2P A;  1DYO A;  5IFP A;  3CMG A;  4DEV A;  2VZO A;  4ET7 A;  1UMH A;  4KI5 M;  3HNY M;  2JE8 A;  4DEQ A;  1JZ4 A;  1OF4 A;  4P02 B;  3GGL A;  2EIB A;  2Y6H A;  5DPN A;  3I2F A;  1W9T A;  3WNK A;  1EUU A;  2BGO A;  1JZ8 A;  2OKX A;  2VL4 A;  2E31 A;  3K77 A;  4QX1 A;  1W99 A;  3UNP A;  4DXS A;  5LA1 A;  3NJX A;  1UY3 A;  1RYY A;  2VC9 A;  5JMO A;  3U37 A;  3FHQ A;  4A3Z A;  2WBK A;  2YB7 A;  4DXR A;  1DLC A;  1H6X A;  3W5N A;  3HJR A;  1O59 A;  1UY2 A;  3A23 A;  1XNA A;  4W8J A;  3T09 A;  4A42 A;  3ACI A;  2ZXQ A;  3WF4 A;  3WNN A;  3I2K A;  3MUY 1;  1UZ0 A;  2QQM A;  3D3A A;  4MOA A;  5JR2 A;  2BGP A;  4MAD A;  3WNL A;  5LA0 A;  3I97 A;  2RJ2 A;  2WN2 A;  1HN1 A;  4QAW A;  3IAP A;  1NX9 A;  4MGS A;  3P6B A;  2VZT A;  3MO4 A;  2Y8K A;  4CUB A;  5CZK A;  3VDA A;  2WN3 A;  2X09 A;  3EB7 A;  2Y6G A;  3NNG A;  4MGQ A;  1JYW A;  4P5Y A;  1R64 A;  1J84 A;  2VTF A;  1GU3 A;  1ULO A;  1CX1 A;  1K12 A;  4QPW A;  3WNO A;  2ZEW A;  3WQB A;  2Y6K A;  1UYY A;  5IJR A;  3DYO A;  4XVH A;  1JZ7 A;  2VZ3 A;  4XUO A;  4A6O A;  3ABZ A;  2QBX A;  4QDR A;  3OEB A;  2WZ8 A;  3SEP A;  2Z4F A;  3NJV A;  4QX2 A;  3THC A;  4ZXE A;  1W0N A;  1YQ2 A;  5LCW L;  3HN3 A;  1WKY A;  2ID4 A;  4ZY9 A;  1UYX A;  2C26 A;  3LEG A;  1GOH A;  2W3J A;  3DYP A;  1F4A A;  2R7E B;  2LW8 A;  2WAO A;  2WZE A;  2WO3 A;  1PX4 A;  2WDB A;  5J1X A;  2ZEY A;  3OB8 A;  1SG3 A;  2J1R A;  4A45 A;  3HPN A;  3MUZ 1;  1WCQ A;  5JXI A;  2CDP A;  4QB1 A;  5B4N A;  4P00 B;  3FHA A;  5I0D A;  3A21 A;  5A1A A;  2WQ8 A;  3C7G A;  1UYZ A;  1XPW A;  3PUH A;  3HEI A;  4XUT A;  1GUI A;  1UXZ A;  3GXU A;  2JKX A;  2B9V A;  3FL7 A;  2W9X A;  3K4A A;  4KWU A;  5CYY A;  2W1W A;  2W46 A;  4XUQ A;  5FUI A;  4D8M A;  3C7H A;  2JD9 A;  5EIY B;  1UXX X;  4XZU G;  2B4K A;  3CKH A;  2W1S A;  1JZ6 A;  1JYX A;  4TTG A;  4BK4 A;  4AAX A;  2J1U A;  3C7E A;  2BER A;  4AG4 A;  1T2X A;  2V4V A;  3CQO A;  3THD A;  1JU3 A;  5HXM A;  4D0Q A;  3I2H A;  2W92 A;  2W95 A;  3FN9 A;  3LEK A;  1KEX A;  1W8N A;  4GWJ A;  1K3I A;  2W87 A;  5LA2 A;  3T08 A;  2WAA A;  1US2 A;  5C70 A;  1JZ5 A;  2EIE A;  2J1A A;  3SKJ E;  1SHW B;  5JUV A;  5G05 L;  2WO1 A;  4E8C A;  4XUP A;  2E26 A;  1PMJ X;  2HYX A;  3CZU A;  3I3B A;  2XHN A;  2WAB A;  2HLE A;  4OZO A;  4CU8 A;  2VM9 A;  3VD5 A;  3VDC A;  4QB6 A;  3GDB A;  1GOF A;  3III A;  2RVA A;  3WNM A;  2VCA A;  3K75 B;  3IDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...