2ZEZA

Family 16 carbohydrate binding module-2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
SNLIVNGTAENGMDGWPDWGYPVSAVPEAAYGGTKGFKLSGGKQAGMGQKVALKPNTTYILGAWGKFTAKPGTYCDVIVQYHLKDANNTYVQNILRFTETDWTYKQVVFTTPDAFGSDPEFVLWKDDASNADFYADNITLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Selectivity and Specificity of Ligand Recognition by the Family 16 Carbohydrate-binding Modules from Thermoanaerobacterium polysaccharolyticum ManA
pubmed doi rcsb
source organism Thermoanaerobacterium polysaccharolyticum
molecule tags Hydrolase
molecule keywords S-layer associated multidomain endoglucanase
total genus 28
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2zezA00
4D8MA 3VDAA 2XHNA 5A1AA 5LA0A 3UESA 2JKXA 4KWUA 4ZXEA 3T2QA 1ULOA 5HPOA 2WAAA 3ACHA 3ACIA 2VCAA 3SKVA 4YPJA 4JKLA 2QQKA 4E8CA 1JU3A 2XOMA 4LQRA 5IFTA 3CKHA 1OF4A 3T08A 3I3DA 4AAXA 1W99A 4UI9L 3FL7A 2VZUA 2YC4A 4JKKA 5EJ1B 1WCQA 5IYYA 2KD7A 3LEKA 4A42A 4PQQA 3I2KA 1TG7A 1W9WA 3IB3A 2VOTA 2LS6A 2ZXQA 5JMOA 3GM8A 2WBKA 4OMCA 3HNBM 5J1XA 2W95A 3WNKA 4W8JA 3T2OA 3CIHA 3I3BA 2J1SA 3GGLA 3IAPA 1TVGA 4ARYA 3NQHA 3CZJA 3HEIA 1PMHX 4DEQA 3THCA 5I0DA 3C7HA 3T0AA 2W92A 2Y6KA 3HPNA 2DDUA 2JE8A 1OH4A 2B4KA 1JZ3A 1JYVA 1PMJX 5CYYA 2J1TA 1W8NA 3MV01 4RYDA 1CZTA 3I3EA 3C7FA 1H6YA 1O8PA 4DEVA 4BJ0A 3I2IA 2VZRA 4BDVB 4QX0A 2WN2A 4GWIA 1T2XA 3HN3A 4XUNA 4L0PA 1CZVA 4QX3A 4P00B 1UYZA 5DN2A 1DP0A 1HN1A 3NJVA 1P8JA 1OT5A 1J83A 4GZ9A 3WNLA 4ZZ8A 3SEPA 3OEBA 3OGSA 2QQLA 2VTFA 4MO3M 5IHRA 3SKJE 1XNAA 3OBAA 4JX0A 4TXWA 2JD9A 3I2FA 5IFPA 1UMIA 2EICA 3U37A 3LE0A 3MO4A 4QB2A 2ORZA 3IDAA 2VCCA 3DECA 2W91A 4OZOA 2Z4FA 3SEEA 2VJXA 1UY4A 1JZ8A 4PF1A 4MADA 4ET7A 2E33A 1L7RA 2Y6JA 3WNMA 1K42A 2VZVA 2DCKA 4CU8A 4DXRA 1US3A 2CDPA 3WF2A 2VM9A 1ULPA 3K75B 3NRUA 2VZ1A 1UWWA 5IJRA 2J1VA 3C8XA 4FI9A 2VMEA 1K45A 2VQUA 2BGPA 1DYOA 2VZSA 2RJ2A 3A23A 3JXSA 5DQ0A 5C7GA 3FHQA 2YFUA 3WQBA 1SG3A 1W9TA 5C71A 3AC0A 4P5YA 4E8DA 1W8OA 5C70A 2EIDA 1UYXA 3EB7A 2W1QA 3HNMA 5JR2A 2Y6GA 3LEGA 3T0DA 2QQNA 4MOAA 2ZEXA 5DMYA 5JXHA 1JZ2A 4Z2AA 2QQMA 4XUPA 4IUGA 4LKSA 3VD7A 2J1RA 3D3AA 3LPFA 4LPLA 2VC9A 5B4XA 4A6OA 1K12A 4A3ZA 3FHAA 4XUOA 2Y8KA 2WUHA 3NJXA 3ACGA 2WAOA 3I97A 3MV11 1UY0A 2DCJA 2XONA 4OUEA 1H6XA 2V5DA 2VZPA 2ID4A 1UYYA 2OKXA 2VMCA 2QBXA 4A45A 1XC6A 1CIYA 1XPWA 1W0NA 3HOBA 5DPNA 3MUZ1 1MPXA 4JHZA 4W4ZA 1NX9A 5B4NA 1DLCA 3GDBA 3OB8A 3UETA 2VO5A 2E26A 4ZY9A 1UXZA 2VMDA 2VZQA 3C7OA 3K77A 1GQPA 3I2JA 1GNYA 1CX1A 2BZDA 3VD9A 3CDZB 1UXXX 5FUIA 3PUHA 1F4HA 2WDBA 3OGRA 2J22A 4QX2A 3T2PA 1K3IA 3FN9A 1KGYA 2EIEA 2RVAA 2QQOA 2JDAA 2YFZA 2W3JA 1GU3A 3A7QA 3LEIA 3LPGA 2J1UA 1J84A 5LA1A 2YC2A 4BXSV 1JYWA 1GOHA 2VCBA 2WN3A 1XNTA 3ACFA 2E32A 1GUIA 5JUVA 2WYSA 3GXUA 4A4AA 4JKMA 4ARXA 3ECQA 5G04L 4HG6B 1CZSA 2PQSA 2VZTA 3J7HA 1LNSA 5LA2A 4A44A 4CU7A 4OYUA 3BGAA 1F4AA 2HYXA 3EYPA 4CVUA 2VQTA 2C26A 2X09A 1JZ5A 1EUUA 3UNPA 1UX7A 3DYOA 4M4PA 2R7EB 3OG2A 1D7PM 2WZ8A 4OMDA 1GOGA 2W1SA 4XUQA 1UY1A 5EIYB 3VDBA 3ZM8A 4QAWA 5CZKA 4AG4A 1UY3A 3I2HA 3OGVA 4TTGA 1SHWB 2C9KA 3WF0A 4RN5A 3VD4A 3IAQA 2ZEYA 1O59A 1SDDB 2QQJA 4MGSA 4QX1A 4QB1A 1BHGA 5JXIA 2W1UA 4BK4A 2Y6HA 1NAEA 2WO1A 2Y6LA 1JI6A 2W5FA 4CU6A 2VZ3A 3K4AA 2W9XA 1R64A 2LW8A 4GWJA 4M4RA 2VMFA 4ZZ5A 4QB6A 4CUCA 3IIIA 1JHJA 1YQ2A 1PX4A 3P1IA 4UAPA 4P02B 1EUTA 4LHSA 1W9SA 2VZOA 3BN6A 3T0BA 2V72A 3K4ZA 4KI5M 5F7UA 4QDRA 4MGQA 5LCWL 2E31A 1UMHA 3WEZA 3HNYM 2RV9A 3HJRA 3K4DA 1JU4A 5G05L 2YG0A 3CZUA 1JYNA 2C4XA 4P08A 2W87A 1US2A 2ORXA 2Y64A 4UOJA 3VDCA 3C7EA 1UZ0A 2BGOA 3E1F1 3F2ZA 2BERA 1JZ7A 3K46A 3WSOA 3VD5A 3WF3A 2W47A 4A41A 2WZEA 1NUKA 4DUVA 2VR4A 1GOFA 3DYMA 4XUTA 3WNOA 3ETPA 2YB7A 3WNPA 1IQDC 3WNNA 2W94A 4W50A 1JZ4A 3A21A 3MBWA 2EIBA 1L7QA 1RYYA 4QDSA 2V4VA 4XURA 1OF3A 2B9VA 3OEAA 1KEXA 4DUWA 3NNGA 2VL4A 2WABA 3C7GA 3P6BA 1NKGA 2X10A 1JYXA 4CUAA 1UY2A 3DYPA 2J1AA 2L9LA 1O8SA 3MUY1 2XQXA 2WO2A 1JZ6A 3THDA 2WO3A 4CUBA 4DXSA 4QPWA 4DUXA 2J1EA 4KMQA 4BK5A 3CQOA 4CU9A 4D0QA 3CMGA 3A22A 3PUIA 1GMMA 4DXTA 1WKYA 2BBAA 2W1WA 3LQCA 3WF1A 3VD3A 2CDOA 3WF4A 3W5MA 2QQIA 4PT6A 2ZEZA 4QDQA 2ZEWA 3I2GA 3T09A 5JXJA 4XVHA 5EJZB 1PX3A 2J7MA 3W5NA 1OD3A 5HXMA 5JXGA 2W46A 3ABZA 2HLEA 1I5PA 2WQ8A 4XZUG 2X05A
chains in the Genus database with same CATH superfamily
1MS9A 5DAQA 2D6LX 5J37A 3MGUA 3T1MA 2MEV2 3ROUA 1HXS1 1GR3A 2PHRA 2UYBA 2BWAA 5CIRA 4Y1UA 2Q8EA 4XEZA 3VUOA 3IBMA 4INDA 3CJXA 3UESA 4ZXEA 1KDKA 4OI0A 1RUG2 3T2QA 3WDUA 1MS8A 1MEC1 5JVVA 1W3XA 2A6VA 4CPBA 4DRVA 1SZBA 2LRPA 3KV4A 4BM8A 3BVCA 4U2AA 3KS7A 2AGSA 5CKMA 4BQXA 5BNOB 4LO7A 5EJ3A 2YDEA 1OVPA 3OUHA 1ZYBA 2AZ5A 2EAAA 1V70A 1R082 2NM1A 1R1A3 2IZWA 3OPWA 4IE4A 4YPJA 3H3UA 5SV8A 4OCTA 4J1XA 3TRSB 3H8OA 3UGFA 1POV1 2QQKA 2PXJA 3ON7A 4ZONA 1HRI2 2ZX3A 1Q3EA 4XF9A 3ZFGA 4E8CA 3MFAA 3VZMA 3E6DA 2OW4A 2WYFA 1L3JA 1IG0A 1OFSA 1XJAA 4ZU5A 3LCPA 2AREA 1W99A 1SCRA 2R063 5IVYA 1KFUL 2XWJB 3IDCB 3N9MA 1RUE1 1RUOA 2VNGA 4ZXKA 2HWD3 5L9RA 1I1EA 1O4YA 1VAVA 2OUJA 3RMXA 2V4AA 3I2KA 4ASLA 1PZ7A 3OSDA 4QPYA 5JR7B 2ZXQA 3M2MA 4Y1VA 3GM8A 4XAAA 4KQ7A 5FO9B 2OX0A 1RUI1 3HNBM 4QHOA 4CCJA 2W95A 5C8CA 1LENA 2QFEA 3CIHA 2VD7A 2J1SA 4PLMA 4TN7A 5C4WA 3ELNA 4K1ZA 2P3YA 4FPLA 2XB6C 3B01A 3LOIA 4XHBA 1TVGA 1K5MC 1W9FA 2JB8A 3HEIA 1SBDA 5EWSA 1RHI1 1RUD2 2UWCA 4IGOA 3VKMA 1XE7A 1KQRA 1BKZA 1SLIA 3POEA 4XYXA 2ZPXA 3I3MA 4OQ9A 3ZIWA 3I8TA 1REFA 2A7AA 2W92A 5FPLA 1A3KA 2RMU3 5J98B 2Y6KA 4AHYA 5K0UB 1UN1A 2XWBB 2DBIA 2DDUA 2JE8A 4PHZA 5D21A 3JBG1 3MIGA 4IXLA 4PBPA 3KV9A 4YW2A 1BVVA 4RL7A 4YG6A 1ULGA 1VPHA 3VBHC 3ZMNA 3UKNA 1OMIA 4AEDB 1HRI3 2JG8C 4CDWB 5A3UA 3AKSA 2QJVA 2ZTNA 4XTPA 4RYDA 1VAMA 5K0UA 3C7FA 1NYWA 1GNHA 3KT7A 4AGGA 1O8PA 1QGLA 4BJ0A 4B3NA 4AYUA 1SBEA 2P37A 1LOFC 2PHFA 3R4SA 2VZRA 2R043 4LUMA 5ABJA 3WZ1A 5L36A 1IS4A 1RINA 3IIAA 2WN2A 4C1XA 1RVF1 1QIQA 5JSOA 2Y34A 3O1RA 1A8DA 1ND2B 2DWRA 4L0PA 5BNPC 1CZVA 3USUB 3AKRA 3PL0A 3RPQA 3U1XA 3VLBB 2XHKA 5JIAA 2VMHA 1DU3D 2DUPA 1UYZA 1LOCA 1DP0A 4GZ9A 1OT5A 4F8AA 5KR7A 3SEPA 1H1MA 4XOGA 3OGSA 2WRAA 1AYN1 1EAH2 2DFCA 3SKJE 2HWE3 1ACCA 3NVCA 3D6EA 4L99A 3ZIXA 2VTXA 2HKXA 4BB3A 4F3JA 4FPFA 4TXWA 5IWFA 3TN93 2JD9A 4QGMA 3IZOA 3WG3A 5F37A 5FDBA 4CXYA 2ZABA 2D98A 1FYUA 2GC1A 4RR3A 4F83A 3MO4A 4QB2A 2ORZA 3IDAA 2VCCA 4XFHA 1QQP2 1NCQC 3DECA 3PVEA 2ZGKA 1I5ZA 2VBBA 2W91A 5LWBA 3ME2A 2QNKA 2Z4FA 2BRTA 1HV1A 1ZRRA 3H1WA 2YBPA 2VVDA 1SEFA 4KH9A 4LO8A 1R093 4Y5Z0 1GP6A 1RUJ1 5FY7A 1G86A 2JG9A 3OOXA 2VJXA 1W90A 4FPCA 5GLVA 3LA7A 1UY4A 5C8WA 2VG9A 4META 1HB3A 2Q1FA 4GH4A 3ZSKA 2E33A 2NLRA 4FSJA 3EXUA 1RUE3 4ATFA 2RS12 4WVMA 3J8F2 2C6SA 4AI2A 4K9SA 4N9IA 3SC7X 4HN1A 3PIGA 4BQ3A 4M3CE 2VM9A 3NRUA 3ITQA 4LBOA 5I0TA 3NL1A 3L2YA 5EHDA 1UWWA 2ZA9A 3MLLA 3ZN6A 3LAGA 3RYRA 4CP9B 1PIV3 1KJLA 3FUQA 3THPA 4L11A 5C6CA 4YVSC 2TNFA 5E8AA 4XXAA 1K45A 2CWMA 2VE1A 2VQUA 2XJSA 4GJZA 4IETA 2BGPA 4ONUA 2CTVA 4ES8A 3O1SA 1AXYA 1DYOA 3DV8A 3IM0A 3QH6A 1BXHA 2Y33A 3A23A 3JXSA 4Y5TA 1ZX5A 5CB7A 2DTYA 3U75A 4E4HA 1GV9A 2IC1A 2XPJA 5C4WB 2DURA 4P5YA 2F6BA 4E8DA 1CAUB 1FV2A 1C8NA 1TME3 4JQTA 1W0PA 1JOBA 2JIJA 3LD8A 4JHTA 4Z82A 4E2GA 4PI0A 1QXRA 3IMMA 4RHV3 4GD4A 1UYXA 3HNMA 2W1QA 4LJHA 2WSUA 1NE6A 2WS91 3HMYA 4MGZE 1M06G 1RITA 2IXIA 4MOAA 4K6BA 1VRH3 1CAVA 1VIWB 2DVBA 4UW3A 4CYDA 4Z92B 2IXKA 2FZ2A 1FV3A 4IEPA 4S2HA 4DZGA 1W6OB 2QQMA 4FBFA 4Z2AA 3MFCA 2TUNA 2G9FA 3S6PA 3LPFA 1QJZA 4LPLA 5B4XA 1BBT3 1NXD1 2VQ0A 4CUGA 4FPHA 4OHVA 4A3ZA 2BNMA 5LEKA 1S0JA 3MPPG 3U4XA 2HJIA 3NJXA 1MZ5A 1W8HA 3NSTA 2WAOA 3UGHA 3LOBA 2NPIA 5F5QA 3MV11 2NMOA 1OPMA 2W2IA 2XJTA 3KCCA 3VHRA 1RUNA 1X7NA 3Q8EA 5FZ6A 1W6NA 5DDJ1 4NIIA 5KHGA 1FOD3 1Y9GA 1XYNA 5K8SA 1JYIA 3AXEA 3D82A 2Q30A 2VW0A 2VAUA 1XYOA 1G9CA 3HVDA 4BQ1A 1FXZA 2QZ2A 1UCXA 1YRZA 4BQYA 1EYBA 1GZ9A 4TWTA 1RUH1 2OQ7A 2CGPA 1MPXA 2YXSA 1YIPA 1ZBA3 4FFFA 2OIIA 3MF9A 5FOJB 4P9WA 3ILNA 3EBRA 1C57A 3WCSA 2FDHA 1UXZA 4GWNA 1N1VA 2B7YA 4LLOA 1WBFA 1UQXA 3CNAA 4Q4W3 2HYKA 3K77A 2JENA 3Q8AA 3I2JA 4N7IA 1J58A 3VL9A 4EN0A 5J36A 1CX1A 2GAUA 2DVFA 5FPUA 4QKNA 2DBNA 3ZXKA 1UYPA 3CDZB 1VRH2 1OKQA 1EY2A 4RFT0 2WDBA 3R4UA 1OOPB 4AI3A 1KD7A 5A7OA 2J22A 4QX2A 2WZPP 1FPN2 1EV12 1PZ9A 1XNDA 1KGYA 3A0KA 4MXVA 4R9AA 2QQOA 4OHXA 2GNTA 2BGCA 1TQ5A 4EN7B 1NT0A 2K9ZA 1PIV2 4WM7B 2FCUA 5A70A 2ZAAA 4O9GA 1Y3TA 1ZZ6A 4HPKA 1RUC1 4RR3B 3V65A 5E1RA 3WXPA 4XF0A 1GU3A 1AR81 1VRH1 2A73B 4NHLA 1CPNA 1RUG3 2Y38A 4KWLA 1BVP1 2YGLA 4V2WA 2WN3A 1XNTA 1B09A 1VB2A 1IG3A 4HLTA 5BY5A 1R083 3GXUA 4EN9B 1CESA 3ES4A 4FTSA 3WVJA 1YUDA 1DGRN 2QE3A 1E5RA 4I09A 5FP4A 5FFOC 4LIUA 1SPPB 3CJIC 1FMD2 3ZXEA 4XFCA 4BHPA 5LATA 1S0GA 1XNBA 3O0XA 4TYSA 1LNSA 3Q8CA 3WHUA 4LHLA 3U78A 4CVUA 1NZCA 1NY72 1WCUA 4YVWC 5TSWA 1Y43B 2B5HA 2WA4A 5DDJ2 1JZ5A 3UNPA 1UX7A 5C4WC 4FP2A 2YPDA 4CP9A 2D3PA 2I74A 3I7DA 4DMIA 5BNNB 2C24A 3ACLA 3SH3A 1K5MA 2XJPA 4GWMA 4OZXA 3USSA 1MS0A 4QPIC 2R16A 2E7TA 5D2AA 5HXVA 5C5UA 2BQPA 1KDMA 3MF6A 4DS0A 4XUQA 5T5LA 5JSPA 4NPRA 4DIQA 2ZX2A 4TSVA 2D6PA 1VAKA 4QAWA 5CZKA 1GQGA 2R1DA 2WNVB 2X53S 5LY2A 3VDDA 3UGGA 2CGNA 5FZ9A 2C9KA 4WVVA 5CFCC 4I01A 3ZVXA 3ZXJA 2WLQA 1QH7A 3JCIA 1ZRDA 4ZS3A 2QUOA 1XSRA 2FDJA 5FQ0A 2E51A 2JG8A 2XG3A 3GZAA 5JZGC 3O1UA 5JXIA 4YWAA 4QD2A 1GKBA 2ATFA 3TYJA 1V0AA 1AL21 1PK6C 2Y6HA 2XL7A 1NAEA 2WO1A 4LK7A 4CCOA 2XVGA 1YNAA 1J3PA 4Q4W2 3CO2A 3H3ZA 5ABJC 4ISQA 1F5JA 2VOXA 1IKQA 3H8UA 1VMJA 2W9XA 3MZHA 1VBC1 4J6GA 2OQ6A 3I54A 3V0BA 3NV4A 1W2AX 4NO4A 4NPMA 1VMFA 5FUNA 1W05A 1LRHA 1J3QA 4GMP0 5BNPA 4QB6A 1ASJ2 3VHPA 2V73A 3PVBB 3BU0A 1AR73 1PM7A 2CSGA 3IIIA 1YQ2A 2DCTA 2BYVE 5KXBA 2B8MA 3A4UA 3KM5A 1EUTA 1CAXA 5FYTA 2EXKA 1W8FA 1W9SA 2XJQA 4I3GA 3VKLA 4UBGA 5KXEA 2B45X 3BN6A 3S7IA 4CEYA 4WBBA 4W65A 2R6QA 5GZGA 1W6MB 2LALA 2P6CA 3AP4A 3K4ZA 3U4SA 1C1FA 4OHWA 4X8NA 4WVMB 1UMHA 5FK7A 4P9LA 1RJ8A 3ZXLA 5IAXA 4R4XA 3ZYFA 5FWJA 2FDGA 3WEZA 5BNOC 3KF3A 2RV9A 3SLIA 1ZM1A 2GNMA 2FCVA 3H8RA 1YQ8A 1AR61 2ET7A 1OI6A 3PVNA 4BU2A 1AJOA 5GLZA 1JUIA 4P08A 1AX0A 4E4DX 1NCQA 5A3LA 2E63A 1LGNA 1LCLA 4Q1PA 4AQTA 4Z07A 2ETEA 4UFKA 2D6OX 2BGOA 3MPBA 2ZX4A 1H1IA 1QJU3 3BTYA 2PTMA 2JG9C 1GANA 3ES1A 4YW1A 4BQ4A 3MDPA 1DQ4A 3NNFA 3OPZA 3AZVA 4KBBA 3POSA 1AX2A 4YRDA 5FZEA 5DG1A 5F9TA 1MQTA 2H0BA 3UJOA 5J3UA 2VBDA 1EAH1 3DYMA 3U11A 3RZLA 4MX3A 1J3RA 1S2BA 3NV1A 3AM2A 5FZ8A 1TME2 3WNPA 2YB7A 2MHFA 5FKCA 5LA9A 1FOD1 3PLQA 3KHBA 3CU7A 1FI2A 1IKPA 5DAVA 3VHOA 1Y9MA 3A21A 2ARBA 2FDKA 4CP1A 1LHVA 4IV1B 5IK5A 1W8ZA 1AL0G 1G8WA 5FXZA 4XURA 1RVF2 4Y4RA 4YZ3A 3LDKA 3IN9A 1RUH3 3OEAA 1LKNA 4GQ7A 1IPJA 1KEXA 3TB0A 1QU0A 2YPJA 3DXUA 3WINE 3TEWA 1FMD3 1X36A 2BOIA 4WZCA 2PQQA 1UY2A 3RDIA 4YW6A 5FTTC 4FFGA 3LGRA 3DGTA 3M8LA 4IL7A 1AR71 3MUY1 4K20A 5HCBA 1LJ7A 5JOZA 3V0BB 3JD72 2WO2A 2Y60A 3PUSA 4Q4X3 5C9AA 5JOXA 2IXLA 2RM21 5SV5A 3PTRB 2IVIB 2ZHNA 2DFBA 4DXSA 3AYAA 1LOGA 1ULCA 1ZBE3 5FZBA 3JBG2 2RR12 4KMQA 3WDWA 5CA6A 1YHFA 3H42B 4Q4V1 3ZSJA 1UIJA 3CMGA 4OI4A 4D0QA 1YO8A 3PUIA 3OTFA 4JC1A 3VBRB 5C9AB 2NP0A 5IAVA 2FZ1A 2WNUB 3FC0A 1GSLA 4GJYA 3MLKA 1V9U1 4ATEA 2OA2A 1K5MB 1AVBA 1Q8VA 3N35A 1W04A 1DIWA 4NR1A 4Q0UA 2DF7A 2UYAA 4RGAA 2GN3A 3WF4A 3WUCA 1X9TA 2D6MA 4AW7A 2QQIA 2X5IB 1ENXA 2XLFA 5H9PA 5I0SA 5KXCA 4YW7A 1BK0A 3H3LA 5JXJA 3T09A 1V00A 4FQ4A 5FZ0A 3BOPA 1B35B 2J7MA 2AR6A 2NQYA 2LM3A 4MHRA 3S7EA 5CAZA 3W5NA 1QDOA 1OD3A 2DTWA 1RUI2 5E6HA 1KRIA 1WW4A 3ZOIA 5JXGA 2W46A 1G9FA 2OVUA 4KBZA 4LO4B 5APAA 1TME1 5FY5A 1RMU3 4P9IA 3WG2A 1FAYA 2HLEA 4JGYC 2WQ8A 4Q0SA 3JUUA 1S0FA 5IVVA 5B2GB 5JPMB 1RUE2 5BNQA 4EZHA 4JVAA 4NHXA 3Q8FA 4Q4Y2 1NQJA 1WCKA 4FOWA 4CXWA 1XU1A 1LAJA 4J25A 4N53B 2ES3A 4K3UA 4PIYA 4XDPA 1ZBA1 2JKXA 5DZGA 1XRUA 5IT6A 5EP9A 3AJZA 2R062 4Y20A 1KJRA 2GP3A 3NKGA 1JTZX 1TEIA 5GLUA 1PGW1 5FZHA 1PVC1 3L2HA 2CAUA 4GKXA 2ZHLA 1W2TA 4D3WA 2XGXA 3AVRA 1REDA 1V9U2 1X8EA 1DHKB 4CEWC 2BU9A 3UL2A 4LOTA 3ZYIB 1H8TC 1QXPA 4DRRA 1PGL2 4XJ8A 4PDWA 4Q4V2 4COZA 1HX6A 4WM7A 4TLGA 5A80A 4MVTA 2ZX0A 4A3XA 2DCZA 3HR9A 3T08A 4AAXA 4UI9L 5BYNA 4JKKA 4DFSA 5EJ1B 3DPRB 4LNVA 1WCQA 4PIXA 1S0EA 1YIFA 5EYXA 3THTA 2GMEA 4LA3A 4PQQA 5FJKA 3MIFA 2DVAA 1W9WA 5FYVA 4FQZA 1TE1B 2VOTA 4IE7A 5FYCA 5JMOA 1LGCA 1DZTA 3KSCA 4JQRA 4OMCA 3TN91 2R041 5DUUA 5J1XA 3WNKA 4KG0A 4XQ4A 1H9PA 1W06A 3O1OA 3D5OA 4NVPA 3E97A 1N1SA 2HEVF 3POGA 2R0FA 5C3SA 3HIFA 4KGGA 2ZJCA 1AL22 1NLQA 1JODA 3AMNA 3CZJA 1PMHX 2VW1A 3HT1A 5FZ7A 3KVAA 4Y22B 3J26N 3RZHA 3V0AA 3VBOA 3SMHA 5I0DA 4ISRA 2ZHMA 2PAEA 3T0AA 5KWRA 1ODMA 2VNRA 1COV2 1LOEA 2KM2A 5FO8B 4AI8A 2F4PA 4XZPA 1QJEA 4OUSA 2KXLA 1YXWA 2GMMA 2XUEA 4UXAA 2A6YA 1SFPA 3JZVA 4QPIA 5F39A 3VKNA 5CG9A 3MIEA 1S0CA 3MV01 1ZZ8A 5F8PA 2CWSA 1VBA3 4BLJA 4D7TA 4DINB 3I3EA 3VKOA 2XR4A 3SCFA 5KC6A 1OLME 4Q4X2 3AZZA 2IFWA 3GYDA 2VPVA 4LITA 3VDDC 4LE3A 3MHZA 3I2IA 4FPYA 4DEVA 5ACA1 1R1A1 4N53A 4EV0A 5CFCA 1UU4A 3TNPB 4UF0B 1QWRA 3DN7A 4BDVB 4LR4A 4CDUB 4QQOA 5D8AC 5FZFA 3AX4A 5C3OA 1POV0 2IXHA 1TZOA 1QHDA 5FCCA 1A8MA 4XUNA 5DUVA 3DKWA 1MR5A 2IUWA 4M00A 5FK8A 1XE0A 2JE9A 2JJ6A 3J9SA 2W52A 4CCLA 2QQPA 1N3OA 5GKAC 5DN2A 2D93A 2Z69A 5DZEA 1VR3A 3AYDA 1MS4A 3M1HA 4GULA 2XBO2 3OEBA 4OI1A 2QQLA 2VTFA 4MO3M 4Q8KA 3LA2A 3VZKA 4OLLA 3LDBA 3EJKA 5DAPA 4CDQB 1EPWA 1RUI3 3WOGA 4L9BA 2VUCA 5FUPA 4HN0A 5GZFA 2UURA 1LOAA 4QX7A 5F1RA 5IVBA 2EICA 5H9QA 3LE0A 4IV3A 1COV3 1MZEA 2RS13 2WT1A 3LKJA 1IGOA 2ZZJA 3NAPC 1LECA 3TNQA 1ASJ3 1C5HA 4AFBA 3M3CA 4RQPB 3NV2A 5JOWA 4NIHA 3AP5A 1YWKA 5BNOA 2WNEA 1BBT2 5I8SA 2ZZQA 5FBJA 3DL3A 4ZS2A 1RUF3 1NCRC 4PF1A 3ZX7A 4ET7A 2VU9A 4Y3OA 1CGPA 4FTBA 1LEMA 2Y6JA 3WNMA 4YM2A 4NRPA 4K7JA 2RS52 2VZVA 4CCEA 1W03A 2VUDA 2RDRA 2ZGQA 1US3A 2CDPA 1G7YA 5CADA 1T6GC 1UO9A 1C8M3 4YZ5A 2HWE1 1AR83 1VBA1 1ULPA 3K75B 3KGLA 4LBJA 2VZ1A 3RYPA 3KV6A 4AQ6A 4DNYA 4M01A 1BMV1 5CU1A 5IJRA 2GC0A 2J1VA 2PAMA 3VZLA 3C8XA 1MQTC 1RUH2 4YYOA 2VMEA 4GXLA 5HCFA 3N9PA 1CAUA 4FFIA 4FFHA 4Y22A 5FYSA 2BWCA 5FXVA 3RS6A 2Z79A 3SH4A 4FAGA 2BFUL 2VH9A 4H2AA 1HQNA 5FZLA 3KGZA 5IK4A 5T5OA 5ANQA 4WVZA 1OQDA 1WCSA 2WJSA 3FHQA 2D7FA 4Y33A 4IGPA 3KQRA 3AC0A 3NW4A 2TEPA 3C2UA 2PLV2 4MV2A 1ALYA 5ANNA 4CCMA 2HBTA 1D2SA 1UU6A 4HBNA 5C3PA 4L8QA 4QU1A 2ZOEB 3JBG3 2WQ4A 2EIDA 5FYUA 2KA3A 1Q8SA 3LEGA 3T0DA 2GZWA 2PYTA 3T2TA 1FT9A 2PHLA 4OQ8A 3UJQA 5CFCB 4B1LA 2RS51 4CSWA 1YLLA 1O91A 3D3AA 3VBRC 4F7ZA 5C9AC 4HKWA 1K12A 5FYHA 1RUC2 2BEOA 2WA3A 3N36A 4PDWB 3VBOB 4XDOA 4XFAA 1H9WA 4JGZC 4YVWB 3ZYHA 3I97A 5HCHA 4JDNA 1VE0A 2V5DA 1IS3A 1ODNA 4BQ2A 1SACA 1D4VB 1UYYA 4YW5A 1ZA4A 4Z1VA 1HIXA 3OPTA 2VMCA 4CP0A 4Y1ZA 3KF5A 1PM4A 2Q4SA 4Y4YA 1O5LA 2I45A 1UOJA 5KHJA 1XPWA 2JKBA 1YC61 4DY3A 1RUD3 5DPNA 2EF6A 1WA6X 3Q9OA 4JHZA 5A1LA 1JBCA 5B4NA 1DLCA 3RZZA 3GDBA 3OB8A 2JEMA 3FX3A 1OA2A 3OBZA 4JCKA 4RA0A 4XDQA 1LULA 4ZY9A 3AYCA 3ZN4A 5EV7A 4Y24A 1VRBA 3NNJA 2D6KA 1PVC3 3RG0A 1GQPA 2HBUA 1GNYA 2NMNA 2BZDA 4BA6A 1LODA 1HLCA 2I2SA 1MVQA 1URXA 4XIOA 3WNXA 5FUIA 3PUHA 2ET1A 3SHRA 3SNMA 1W6PB 4BPZA 2WNOA 4FXGB 4K8FA 4UFMA 3BALA 2CAVA 4HANA 2V5YA 3ZYPA 1F2NA 2HEWF 3BODA 1ZZBA 3I2DA 4XMIA 4AI9A 4HVQA 5FMCA 2EIEA 4XFGA 2Q1MA 5FQ0B 5E88A 1H8TB 3I4IA 2JDAA 4Q0QA 1MEC3 2GH8A 2B42B 3HT2A 2BNNA 1I6XA 2R061 4IV3B 1UZWA 5I93A 2HWB3 3CJIB 3AFKA 2WZR2 3OY8B 1NLRA 3LEIA 1V6JA 3LPGA 4YW4A 3NWKA 3FMGA 1H8TA 4FTEA 2XL9A 2OYZA 3WDVA 1HKDA 2JE7A 2P34A 2VNOA 1DFQA 2NYYA 4AE2A 1D4M3 2WYSA 1AYN2 4OI2A 2WS92 5A32B 5AVPA 4B7EA 1QMJA 4ARXA 3ECQA 2P5BA 4NHYA 3UKTA 3BU7A 2RHPA 4HG6B 4HK8A 1OFNA 4HT1T 4AGRA 1CZSA 1C3HA 3ZYRA 3AKTA 1DCSA 3J7HA 1VMHA 4AVVA 2HYXA 3B94A 4LT5A 3W21A 2JX9A 4L2NA 2X09A 2R042 3QACA 4E2QA 4FPKA 2ADEA 1OLQA 4M4PA 3MW3A 4CZSA 2GP5A 2GDFA 4H7MA 3GJAA 3GBFA 1LHNA 1W6QA 3R4DB 3ZSMA 4A7KA 1X8MA 2UY9A 3R6SA 1GWKA 4LLFA 4KNCA 3ZFFB 1XBFA 2BW8A 4CRQA 1XQNA 1HB4A 1GP4A 1GOGA 1HB1A 2JDPA 4UBHA 3VBUB 4CDXB 1OLRA 2A6XA 1H30A 4BISA 4DOUA 3OD0A 2WNUC 1YFXA 5ACA3 3P3NA 2CHHA 5T50A 4HETA 3BIEA 3OGVA 3S57A 3BB6A 3OJBA 4IE6A 3KB5A 1JN2P 2ARCA 3IAQA 2X8KA 4COYA 1O59A 3FLPA 1AR72 3KT1A 4CPBD 4AEDA 3ILRA 4KG8A 1RL3A 3FUOA 4QX1A 5LBCA 1RUD1 3AL6A 2YU1A 1SLTA 3RWKX 5CVRA 2MEV3 1UW8A 2DCYA 2ZMLA 3RMYA 5T5PA 3TAYA 1AYN3 1RUC3 3GCXA 1QJX1 1JI6A 2W5FA 2HEYF 5A3NA 1YQ6A 4KU8A 2VZ3A 3RJRA 1WLTA 3C3VA 1V6OA 2K2SA 2LW8A 3OD4A 5A3OA 1LU2A 1FOD2 2YV8A 4HFSA 1YFWA 5FO7B 2FHRA 2HWC1 1N3QA 4ZZ5A 4J1WA 2CL2A 5FY9A 2BBVA 5BUVA 5CKNA 1RVF3 3BI3A 2BPA2 3P1IA 2WIIB 3G7DA 4UAPA 2H0VA 4KWKA 1OKOA 1EAH3 1HW5A 2TBVA 4LHSA 4IDZA 4MGKE 4YSFA 1OURA 5H9SA 3URFA 1TMF1 3T0BA 2V72A 2HWC2 3GZTB 4NE9A 4QDRA 4MGQA 5LCWL 2JWPA 4FXKB 1HB2A 1HN0A 4QQ2A 2D5HA 3HNYM 1HRI1 2E6VA 1LHWA 2HH9A 2RR13 4XAEA 5G05L 1JYNA 1LGBA 2PHDA 1TNRA 2C4XA 3ALQA 4FVVA 4NPLA 2AC1A 4XETA 4XILA 2PFWA 2W87A 3FHIB 2Y64A 1O3QA 1AR62 4P9YA 1F35A 4UOJA 4HVOA 4XE9A 3VBSC 4UFJA 4CCNA 1CAVB 3E1F1 4QXBA 1QF3A 1V6MA 1AXKA 2BERA 5FAXA 5IUQA 1JZ7A 3K46A 2FDFA 3CLPA 1NCRA 2ZKNA 1AR91 5FZMA 4NIGA 1RMU1 5LEJA 4DQAA 1VBB3 2JDHA 4A41A 4YG0A 1PO11 4AGVA 4URAA 4HKOA 1NUKA 1U12A 3PHMA 3CBNA 4DUVA 4GKYA 2VR4A 5LZ6A 4FCAA 3D0SA 4HOOA 4FPEA 3TEYA 4IE0A 3ETPA 4LBKA 3KLSA 3WNNA 1MVEA 2W94A 3I59A 4W50A 1AZDA 4GB31 4B1MA 2HWF1 2AEZA 1XYPA 2YGMA 1L7QA 3E5UA 1RYYA 4HMZA 4XHXA 3ZXGA 5FP9A 3ZN5A 4AF9A 2JIGA 1E5SA 3WP4A 1WD4A 3B7MA 1WMFA 1EPZA 3IT8A 4E4ZA 5AFEA 4FT8A 3KWVA 4C0BA 2XUMA 3C7GA 1QKQA 1RXFA 1OLMA 2EIGA 2X10A 5FPZA 1JYXA 5A32A 1IS6A 1POV3 1E5IA 2Y6FA 2L9LA 3AP7A 4XF1A 1O8SA 4BCUA 2QVSB 1SLLA 5FYBA 4QU2A 4NROA 1ENQA 1QOSA 1N1YA 3O5SA 3GHMA 2D97A 4GH4B 1JZ6A 3N9QA 4HXCA 3ETQA 5LW9A 4Y1XA 3WDTA 1VBB1 4DUXA 1DDLA 1QOOA 1GNZA 4P9JA 4BK5A 1BZWA 3CQOA 2ZGLA 2P6HA 4CU9A 1W6OA 4QHZA 3MI8A 3LA3A 3A22A 5CBLA 1O5UA 5FKBA 1Z0HA 5LASA 1WKYA 2BBAA 2A3WA 2W1WA 3LQCA 2WC2A 3VBRA 1UZYA 1ZZ9A 3UYJA 4HKLA 4EQVA 4UW4A 3E5QA 3W5MA 2ZGTA 1CD3G 3PUQA 4PT6A 4QM9A 3ZPOA 4WM8C 4O61A 3LDRA 1YI9A 1NY71 5KHHA 2ZEWA 3I2GA 1RUG1 4XVHA 2OPWA 1DGRA 3U0ZA 3B9IA 1AF9A 1FMD1 3ABZA 1RGSA 3SCHA 1AX1A 2GALA 1ZZCA 3AJYA 4K40A 1HXS2 5HV0A 1TMF3 4M3CF 4EN8B 1SBFA 2EXHA 4M3CA 4QWNA 5IW0A 4XZUG 5FZ3A 3RRDA 3SISA 4DO0A 1QEXA 4XC9A 3M3IA 4NWVA 4D8MA 1OXCA 4V1PA 2UWBA 5FP3A 4D6QA 1SPPA 3VDAA 4BH9A 1SFNA 5LA0A 4A2UA 1STMA 1NZIA 4K1YA 5C3QA 3T3YA 3AK0A 1NG0A 3B5LB 3FE5A 3NNLA 3FLTA 3N9NA 2D6NA 1MZFA 4FP3A 1ULOA 1ZVFA 2JDYA 4Q4W1 4S2GA 4CP2A 2WAAA 1GZWA 3ACHA 5HPOA 3TEXA 3I2OA 2D40A 2GC2A 4OHZA 3VKFC 5LBFA 5ERLA 4CDUA 4XTMA 2K0GA 3W20A 2XMLA 5DUWA 1HRV3 1DQ6A 3RSJA 1EV11 1FPN1 3FFQA 2VGDA 2CGOA 5DDJ3 4FOYA 3ZFEC 4LBLA 3HD8B 1MZ6A 2A5ZA 1JU3A 2RMU2 3B00A 4XBLA 4DB5A 3CKHA 4XFIA 1OF4A 2B39A 2Q1ZB 1KS4A 1YQCA 1E57A 3I3DA 3FL7A 1CAXB 2YC4A 4HK9A 4IERA 5FZAA 5IYYA 2KD7A 1W6QB 4XXPA 5LBEA 4AI1A 3LEKA 5BXXA 5I8YA 4GIQA 2XBO3 1G9BA 3IB3A 4MXWB 4OUMA 1ND3C 3R05A 4LKDA 4S2FA 4HSLA 2WBKA 2WFF2 1ST8A 1UNBA 3I59B 1XE8A 4S2DA 1ZRCA 1W3VA 1H2LA 1YCIA 3T2OA 2IXJA 3KT4A 4LTAA 3GGLA 1W8TA 4B8EA 1JMUB 3AVSA 3ZDSA 4ARYA 3NQHA 3W9AA 3E6BA 3LFIA 1HJGA 2OS2A 1R1A2 1UU5A 3HQXA 1A6CA 4N90A 4BOWA 2VULA 5GLTA 3THCA 5T55A 4AXOA 5ACA2 4Q29A 5J7MA 5LRRA 4UWDA 4OVEA 2HWE2 1Y7BA 3USUA 4HPKB 3ENRA 3HPNA 1OD5A 1SQ4A 2ZAHA 5A3PA 1HRV2 4MHUA 5E16A 1OH4A 1VLNA 2B4KA 1JZ3A 1PMJX 2Z5WA 2ILMA 4B4RA 2WNVC 3U10A 3VBFC 2J1TA 1VBE3 4PCRA 3W59A 4I2OA 1DZQA 1DLLA 1COV1 1BEV2 2HWD1 1CZTA 3KVBA 2WNUA 2F4LA 1PIV1 2DUOA 4CXXA 4N7UA 1OH3A 1CIWA 1N1TA 2JECA 2WT2A 1BJQA 4IESA 3N7KA 1DG6A 1VBD1 2WT0A 1T2XA 2YBSA 1MS5A 3PJYA 1GBGA 1H4HA 1JOJA 3AZYA 5KHIA 1AR93 1RTVA 4FOVA 4AFAA 3POBA 2WFPA 4P00B 3H9AA 1UOFA 2EA7A 1HN1A 3NJVA 2QQUA 1VALA 5EFUA 4ZZ8A 3POWA 3NAPB 3DF0A 5FV3A 4IEZA 2WL1A 4XIKA 2WR9A 5IHRA 5IVEA 1ULDA 3ATGA 2X29A 5FPBA 3WDYA 4QPGB 1UOGA 2XBO1 5IFPA 1NCRB 4ZU7A 1DQ0A 2RS32 5LK7B 2BDRA 5JLVA 2ZGRA 2RS53 2E7AA 3GNEA 3PMSA 4ZHNA 4HSJA 3O14A 5K7PA 4LBQA 1C8M2 2JDUA 5FYZA 5DZFA 4A7YA 4LO6B 4YM0A 5F3CA 4YVWA 2SLIA 5J09A 4RHV2 4AAPA 3SEEA 4NWWA 5HCAA 1PGSA 2IWGB 3PU8A 1JZ8A 4AL9A 1QQP1 2XVLA 3P5BA 5IVCA 5F32A 2IFRA 4NHKA 5BNNA 4X8PA 4YZ1A 1CPMA 5JPNB 3KV5A 4AEJA 1K42A 2D44A 3RGBA 3VBSA 2DCKA 5FMDA 4DXRA 1U5IA 1V6LA 1QH6A 2A70A 5CFDB 4ZU4A 3POFA 1UZVA 1C28A 1V6IA 4FI9A 2K46A 4MXWA 4YGCA 5F2WA 2YHJA 3UK9A 4CEYB 3O7OA 4A6SA 1JXNA 4LBMA 5EXOA 3AZWA 5F3IA 3IKWA 2LUWA 1DBNA 2VZSA 5DQ0A 1F5FA 4XFFA 2YFUA 3WQBA 1SG3A 1PK6A 1W9TA 4QKFA 5C71A 5CEHA 1W9YA 1Q56A 2B46X 5BV6A 2YROA 3O0WA 4XF4A 3DPRA 2RDNA 3ZMOA 3M7AA 1S55A 1W8OA 3J4UH 1JYCA 3ZFGC 4C1WA 2RDSA 3ZR6A 3NMBA 3RJ2X 5JR2A 1E5HA 5FZGA 1H1AA 2R49A 2QQNA 5DG2A 2ZEXA 5DMYA 3WX5A 4AFCA 3MIBA 1GLHA 5JXHA 5KC5A 5FREA 1PO12 4XW3A 2F17A 4XUPA 4IUGA 1RMU2 3VD7A 4W6WA 2VOVA 2RS11 3LSEA 2J1RA 1AR92 5H9RA 1DYKA 2RM22 4GMP1 3ZKUA 2RJLA 3UKVA 2YY1A 4A6OA 3FHAA 2VOKA 3JD71 5FLJA 1Q43A 1VB4A 3VBFB 4R9CA 2WUHA 3ZLIA 2SBAA 1A34A 2WWUA 3NJYA 4G3YC 4YW3A 3HBZA 2PHUA 5FZOB 1Q5OA 3BTXA 4H7LA 4L97A 2FQPA 1JUHA 1H6XA 2VZPA 2QTWB 4FPOB 3DCQA 2OKXA 5L7OA 1W2NA 2QCSB 4GAZA 4ASMB 5K4LA 2HWF3 3K51A 5D1IA 1OA3A 4UFLA 4A45A 5LY1A 1AL23 4PJYA 4D7SA 2PHTA 4Q4Y1 1C4RA 4LHKA 2YUEA 4W4ZA 3DEMA 2XH6A 3K48A 3VV1A 3UETA 1B35A 2VO5A 3M3EA 4RD7A 2E26A 5A1FA 2ZACA 2VMDA 4LO5B 1F31A 1HV0A 1OSGA 1GQHA 3T30A 1MS1A 3C7OA 4RS5C 1JYTA 2XDVA 1ENRA 3GZEA 3OBRA 1RUF1 2FCTA 5CNAA 2VY0A 1JH5A 1F4HA 5A7WB 1QXJA 3BYWA 3RZKA 5A7QA 4P14A 4KGQA 1HXS3 2ZGMA 1MS3A 3OGRA 5FZ1A 2OPKA 4UF0A 3RZJA 3T2PA 2VBPA 4IW3A 3FN9A 4YVSB 4EWEA 3QLQA 1G9DA 3SH5A 4IEOA 2XKOA 1O6UA 2NZ9A 2YFZA 5GALA 2O8OA 1GZCA 1J59A 1WGPA 3A7QA 3ZO0B 2J1UA 2RR11 3LZZA 5LA1A 2VECA 2Y0IA 3O12A 2YC2A 5K9YA 4RQPA 3ZFEA 2WFF3 3J7LA 2W0XA 3O1MA 4AOCA 3AL5A 2CYFA 5L19A 2R32A 4P9XA 2G1MA 2FD8A 4RR3C 1CAWA 4NAOA 4JKMA 5A3TA 2BV4A 3BIWE 5A3WA 1GICA 1RB8G 3OGJA 1OBNA 1ZZ7A 4EJRA 5DUXA 3MIHA 2UY8A 3WD5A 1QJX3 1ND3A 2E9QA 4H14A 3BGAA 3WLUA 1CN1A 1PZ8A 2D3SA 2VQTA 2XQRA 2EXIA 3FBMA 4CCDA 1CWPA 5FP7A 4E27A 2A71A 5KBFA 2ZGSA 3POYA 5C8CB 1WMXA 4QXCA 2PAKA 2VTXJ 1I3HA 3DYOA 4GH4C 3HQRA 5CFDA 1D7PM 3S0MA 1K5JA 1PVXA 2UWAA 2WZ8A 3WP3A 1BEV3 4QKDA 1BYHA 3ZFGB 5F3GA 2JICA 3M70A 4JGYA 4XBNA 3I49A 2C0ZA 5EIYB 1W2UA 3HWJA 2XJUA 4BZ4A 4A7ZA 4Z2WA 5ABJB 2WZR1 1UY3A 4TTGA 4D69A 4QM8A 1RC6A 4LKEA 3LFMA 1HQWA 4RN5A 4XCBA 4YNIA 2Z2SB 2WNVA 3VDDB 3VBFA 1JW6A 3LF7A 4SBVA 4O7XA 4UW6A 1XNKA 4QB1A 1BHGA 4YGEA 4AVSA 2RJKA 3LIGA 4R9DA 1UZZA 1A78A 5D8AB 1SMVA 5C3RA 3T4VA 3OCPA 2Y6LA 4Q4Y3 2QKDA 2Q8OA 1UKGA 5FYMA 4AVTA 2QZ3A 5FP8A 4B29A 2PLV3 3A0NA 3PVOA 4CCKA 1S2EA 4CEWA 2AYHA 4UW5A 4M4RA 4YGDA 2D43A 3RZGA 3RNSA 2FDIA 4LA2A 5FWEA 1ND2A 1UF2C 4URTA 4WM7C 5FMOS 3ZYBA 1PX4A 3Q8BA 5DAXA 3ZN6B 4P02B 3E5XA 3WR0A 2VZOA 3O0VA 1ASJ1 3BTAA 2VVFA 1DYPA 2BFUS 3M3QA 1RUJ3 4AVCA 5FJHA 3I3QA 1AR82 2H6CA 3OUIA 1VBC2 3POIA 4CE8A 3M4FA 2BVVA 5JI7A 1WD3A 4OULA 3J7NA 3MIDA 4B4QA 3HJRA 2R072 5L73A 1SLAA 2BP6A 4RHV1 5FR3A 2YG0A 3CZUA 1UMZA 4BMBA 4UFIA 3NV3A 5FIXA 4PQ9A 1U5YA 1C8M1 1CJDA 4R52A 4TZDA 4JGYB 3VDCA 3C7EA 4ORFA 1UZ0A 3B69A 2H6BA 4EZ4A 4BWOA 3F2ZA 4FO9A 3WSOA 3AP6A 4YFWA 4G4FA 2RS31 4W6YA 3ZSLA 4GMP3 4YZ2A 1DQ2A 4NOTA 4WVWA 2W47A 4BE3A 5F5CA 2PMWB 3N3HA 5L9BA 5T5JA 1YFUA 4IV1C 1LTEA 5BNNC 2WZEA 4MUVA 1QNWA 2WZR3 3KMHA 4NIAA 5AFBA 3BKZA 5FY4A 1C5IA 4Y5SA 5FMOL 1GOFA 2P4EA 4SLIA 1PO21 5FBZA 1ZA7A 2BJSA 5FZ4A 3S5QA 3WG1A 2XKPA 3WNOA 4ES9A 1YJLA 1WW5A 3V56A 5F3EA 2VQAA 1D0HA 1JZ4A 3N7MA 4P5HA 3B3QE 4QX8A 1DZRA 3MBWA 2EIBA 2PLV1 4AQ2A 5CISA 1UPIA 3LB9A 1YI7A 3WY6A 4QDSA 3N7LA 5FPAA 1XNCA 3OYWB 1VBD2 2B9VA 4IQPA 2FBEA 3LIHA 5I8TA 1APNA 4DUWA 1HDKA 2VL4A 3F95A 3RWNA 3T4HB 2J1AA 5FLIA 2B9UA 3DPRC 4M0HA 1J1LA 2XQXA 4OHYA 3AXDA 2EAKA 1POQA 5FYYA 3WP6A 3M3OA 1SLBA 3THDA 2WO3A 4UT5A 5LBBA 4QPWA 3AMQA 1QJFA 4CDWA 2J1EA 2Q8DA 3WP5A 5JDBA 2FMDA 4R8HA 3J7MA 4FOQA 4N43B 4ZPIA 5A33A 1D4M2 3CJIA 1DQ5A 3KD4A 1SCSA 1GMMA 4LBQD 4MYEA 4XFBA 3VB9A 2WLPA 3AMMA 3WF1A 1D2QA 3B93A 1PNGA 2EVXA 1KITA 4CCCA 3WT3A 4Q2FA 2CDOA 1BBT1 3PURA 5F2SA 3VBUA 1FNZA 5FPXA 2ZEZA 1PHMA 1OVSA 5FXWA 5KXDA 3VZOA 5A7WA 3LSDA 5EJZB 4NJ4A 4LK6A 4JDMA 4XACA 4D6SA 3RQ0A 2AUYA 2WFF1 5L7OC 2ADDA 3TBDA 1UKRA 2DVDA 3RZMA 5DABA 4KU7A 4NRQA 2RG4A 5J48A 1PO22 1W0OA 2P3KA 3H0OA 1RHI3 4LIVA 1I5PA 4O65A 2VCMA 3JU9A 4FPGA 2X05A 3SXWA 5JIUA 2XHNA 3J8F1 5A1AA 4EWAA 1B35C 4CEWB 1O3TA 1RIRA 3RVHA 4KL1A 3N9LA 3OGGA 4QQPA 2P3IA 4B7KA 4I02A 3AP9A 2VNVA 4KWUA 3EHKA 4LORA 5JZGA 4IEWA 1DGWX 2W08A 3K3OA 4RS5A 3GJBA 4YFZA 1V6KA 3EO6A 2C5DA 1OOPC 2ARAA 1VBE2 2O0OA 1RUJ2 2HWB1 5EQUA 3ACIA 2VCAA 3SKVA 4JKLA 4YG3A 3W58A 1JS9A 3AFGA 2CNAA 3WG4A 1Z7S1 3H50A 4Q4X1 4D6RA 1D4M1 2PN5A 2FMYA 4BYYA 3DXTA 2XOMA 1W28A 4C0HA 3CEWA 4LQRA 4QPGC 3ZYGA 4C8DA 4ZKTB 5IFTA 1BQPA 4LUKA 4AHXA 5HBAA 3O1VA 3NO8A 2PELA 2R1BA 3AYEA 3OUJA 4YM3A 1CR7A 2VZUA 4DY5A 5LK5A 4AQSA 1UOBA 3GF6A 4CEYC 4AHZA 1G9AA 1LB2A 4XF3A 3ZYJB 4A42A 3ZFFA 4RQPC 1NA1A 2CU5A 2GC3A 1TG7A 4HONA 1RXGA 1S0DA 4QX5A 4PIZA 3GBGA 2LS6A 1WW6A 1LHOA 3TOJA 3BOWA 1GWLA 3G6JB 2WINB 1CJPA 3PTYA 5I91A 1I9RA 5F5IA 4I30A 4TLFA 5JMCA 4QHBA 3JQXA 1OA4A 1U0AA 4W8JA 1LOBA 1YYNA 2CY6A 3WW1A 3I3BA 3OF1A 1OC1A 1NA1B 4V2VA 5FZDA 3IAPA 1GP5A 3PJQA 2ARXA 4MG2A 1DGWA 4C91A 1DF0A 1Z78A 4DEQA 2X5IC 2P17A 2VMIA 2GN7A 1H2MA 1REEA 1Z7S3 5EZWA 1M4WA 2PHXA 3KQ4B 3C7HA 5A33B 2LROA 2BVBA 4CDXC 5T3NA 1O3SA 4JTNA 4Q4V3 4I0WB 4N9HA 5CFDC 2EALA 2R30A 4WZFA 1ZNPA 4AK3A 1S0BA 3SCGA 1UIKA 1JYVA 3WCRA 2JD4A 2ZCWA 3N7JA 1VBB2 4BQ5A 5CYYA 1W8NA 4WV8A 5EPAA 4E9KA 1IHMA 1W8UA 2YZ4A 4Q1RA 1FX5A 4XJWA 2IXCA 1H6YA 1O7FA 1PGL1 3VZJA 1NOVA 1T6BX 1EP0A 2UU8A 3DUIA 1NXMA 1QY4A 1X50A 2BOJA 1RHI2 5T54A 4MH0E 3PUAA 4OFGA 1PVC2 1R091 4QX0A 3JD73 1PGW2 1ZRFA 4GWIA 1X9PA 5KHKA 1SDWA 3HN3A 1JOPA 1VJ2A 4EROA 4XCAA 4YM1A 1S4CA 2G9GA 3QOPA 2AH2A 1ZBA2 1LHUA 1Q8PA 2GNBA 1QJY1 2HWF2 2W68A 2YC0A 4L92A 4GB32 4QX3A 5FZIA 4N8MA 5AC92 1OQ1A 3LEMA 3FJSA 1P8JA 1GZTA 1J83A 1GFF2 5FRAA 3WNLA 1WUVA 3INAA 1W6MA 4IEQA 3H7JA 1CQ9A 2G4IA 1VBC3 4CDQA 5L7OB 1XNAA 1WMDA 2YBKA 3OBAA 3E6CC 4JX0A 3K3NA 1H4GA 4B4PA 1ND2C 4QQLA 2NN8A 2WQZC 2ZMNA 3I2FA 4BIFA 1UMIA 1PNFA 1CVNA 1X33A 2AENA 2ZHKA 2HWC3 4LXLA 1EV13 4PLNA 3V64A 2JB4A 3U37A 1PMIA 4AHWA 2OZ6A 1YJKA 5FY1A 4COUA 1QJU1 1O3RA 3MICA 3BPZA 4OZOA 3CHXA 3O1TA 1XB9A 2AACA 1NLSA 2Y26A 1TNFA 2OXBA 3NJZA 4LHNA 5FY0A 3VBSB 1GWMA 1WA4A 3QH7A 4PI2A 2EXJA 1UL9A 1W8WA 1OHFA 4UFHA 1AR63 1QJU2 4MADA 3UT0A 5JOYA 5T52A 1NE4A 4YARA 5A6QA 1QJY3 1L7RA 1QOTA 3D4KA 4MSVA 1RUF2 5ISLA 5GM0A 3JQWA 5GZCA 2JG9B 2LTNA 1AYM3 2XLGA 2WO7A 4QT6A 1TMF2 4CU8A 4K8RB 1GZWB 3APBA 5HV4A 3PIJA 2A3YA 3PU3A 3WF2A 4LE4A 3ZR5A 3P3PA 2WKKA 5A7NA 1H2KA 1ONAA 4IV1A 5IATA 3AZXA 3BTZA 2XLAA 4GA9A 4NAMA 5A3MA 4E4SA 5AC91 4AEDC 4MGIE 4BMEA 2XJRA 3RI9A 3VGIA 4EE2A 2RJ2A 2JXAA 5C7GA 4AEMA 4QXHA 1WLCA 2BUKA 2C9AA 2Q5TA 1QJX2 1UX6A 2VUAA 4QQHA 4D94A 2YYOA 2AEYA 5A7SA 1CONA 1R1ZA 4Q8LA 5C70A 5I0RA 1AHSA 3POJA 4LEJA 1ULFA 4PDWC 1RJ7A 3EB7A 1WMEA 1Q8OA 2ZGPA 4JAAA 2Y6GA 4NUBA 4AVBA 4D7YA 3NKTA 3IPVA 3IDEA 3PMEA 4Q0VA 5FYIA 2C1FA 1QDCA 3T1LA 3TWIA 1BK1A 4JDOA 1JZ2A 2JDMA 4Y26A 3WQ7A 4JV4A 2W39A 4LKSA 5FZOA 4YLZA 1VBD3 2DU0A 4N43C 3ZXDA 2VC9A 2WWJA 2QDNA 1IS5A 1WBLA 4XUOA 2Y8KA 5A7PA 3FFZA 3VBHB 4CDWC 5FY8A 1IZ3A 1XXNA 1C1LA 3ACGA 4FPJA 4R9BA 1R081 4XMAA 3S30A 1UY0A 1O4ZA 2DCJA 2XONA 3BCWA 4IEUA 4LULA 4OUEA 5GZEA 4DPNA 1S2KA 4XJUA 2ID4A 2P2KA 3H1YA 5FOBB 2O1QA 4AZZA 1MEC2 1W6PA 4NRMA 4IEYA 2A1XA 1H2NA 2QBXA 3GALA 4AWDA 4COWA 4RS5B 3VBUC 4EN6B 2WSVA 1XC6A 1CIYA 4I0AA 3VBOC 5F6LB 1W0NA 3FBYA 4JGZB 3RYKA 2QQVA 3HOBA 5GZDA 5BNPB 1X82A 2WWSA 3MUZ1 4JRLA 1NX9A 2MEV1 1LESA 3OBTA 4EWDA 4DXZA 3TEZA 4NMIA 3GBWA 2YU2A 3WHTA 3S5AA 2VZQA 4KWJA 2OT7A 4HL0A 3WV6A 4JTOA 5AC93 1OUXA 1SFYA 3D8CA 4XJAA 3VD9A 4IEVA 4H3WA 1QJY2 1UXXX 2JDKA 1S0IA 4XJ9A 1QQP3 3MYXA 1IOAA 4X6QB 5JSRA 4IE5A 2RDQA 4N53C 4XQDA 4CA9A 2BTVC 2XJVA 4MZUA 1K3IA 4QGNA 3LWCA 1LR5A 1MQTB 1R092 3DKQA 5D8AA 1AYM1 4XQWA 4Z8BA 3IWZA 2RVAA 2HWB2 1NCQB 4NIDA 1XU2A 2D3RA 4Y20B 1OOPA 4PLOA 5F6KA 3ZDVA 2W3JA 3OY8A 4XABA 1IPSA 1F9KA 3H7YA 1F8VA 1Y9QA 1Y4WA 5C33A 5M0TA 5A6YA 1J84A 3AKPA 4BXFA 1OUSA 1ZBE2 4BXSV 1JYWA 1CX4A 1V6NA 3JB8A 5F5AA 4U36A 1GOHA 2VCBA 2R0HA 2O8QA 3X29B 2VVEA 1W2OA 5JAXA 1WCDJ 1OQEA 1FPN3 3ACFA 2E32A 4I0BA 1GUIA 4QPGA 3WW3A 5JUVA 1YFYA 4BIOA 2E53A 2VOWA 1ZREA 4A4AA 1BLZA 5C8CC 1ND3B 2OZJA 4IV3C 1U5ZA 2ZGUA 2ZMKA 3N9OA 3NAPA 3ORJA 5G04L 2Y0OA 4AVAA 3ZFFC 2WS93 1NA1C 1KXGA 2PQSA 2VZTA 5LA2A 4A44A 4CU7A 4YGBA 4OYUA 1LEDA 3GCWA 1F4AA 3EYPA 3RI8A 2DVGA 2C26A 4WM8A 4Q5OA 1EUUA 2ZGOA 1UPSA 5E89A 2ERFA 4XBQA 3WQ1A 3ZXAC 2R7EB 2XXZA 3OG2A 3B9CA 5BPXA 2BNOA 2R073 5J96B 1ENSA 1AXZA 4LOSA 5JI9A 1AUYA 3ASIA 2JDZA 4OMDA 3HBKA 5FLHA 3VBHA 4RFRB 2X5IA 4K21A 2MPFA 2N7GA 4O9EA 4Q0PA 5JWPA 4PF5A 2W1SA 1UY1A 5K0UC 1GYKA 1ULEA 3VDBA 4CDXA 1UAIA 3ZM8A 5IVFA 2Q0AA 4AG4A 3I2HA 5I0UA 1SHWB 4IEXA 4RGGA 1LOFA 1PO13 2JG8B 3WF0A 1XSQA 3VD4A 2ZEYA 3VZNA 2G9ZA 3WDXA 2A6ZA 1SDDB 2QQJA 4LMFA 1Z7S2 4MGSA 3IPVB 4HZFA 1N47A 3H8XA 1QNYA 5LB6A 3HN1A 2W1UA 1D0GA 5AVAA 3MEPA 4P9GA 3WUDA 4BK4A 5FXXA 3N4MA 1XOYA 3CF6E 1VBE1 2ZS6B 3MLJA 2ENRA 1U5XA 4CDUC 4RGKA 3WW2A 4CU6A 3K4AA 4HVRA 3FLRA 2KR2A 1SLCA 3EMRA 4JRAA 1R64A 4GWJA 1OPOA 4RSUA 2J42A 4NHMA 1N3PA 1KS5A 1AJKA 2I07B 2VMFA 3OYWA 2QDRA 4CUCA 4IGQA 5CG8A 1WW7A 4MGTA 1JHJA 1BMV2 4QMAA 3ZSEA 1VBA2 1W6NB 4BLIA 2GNDA 2D5FA 5FZCA 4AFMA 4AR2A 4AEKA 5DAWA 3JB4C 4NN0A 1WLDA 3HAGA 1ZBE1 4KI5M 3ZKYA 4CDQC 4LKFA 3QD6A 4QGLA 4JZRA 4COVA 5F7UA 2RM23 2E31A 4YZ4A 3ST7A 4JGZA 3L9JT 2IVJA 1H0BA 4GB33 4PBOA 5IK7A 3PDQA 3QBQA 2E7QA 2CV6A 3K4DA 1VP6A 3WQ0A 3ILFA 1J1TA 1V9U3 2OUHA 3J8F3 3VHNA 1JU4A 4G9SB 3FZ3A 2A6WA 3AKQA 3SITA 1S1AA 3U07A 4Y1YA 1AYM2 3R0RA 3IMNA 4LBQB 1US2A 2ORXA 1YQ5A 1YEWA 2GMPA 2PA7A 4H55A 2R071 2G19A 2DUQA 2P1BA 4AI0A 1HQLA 1BEV1 2HWD2 3H1MA 4FAHA 4W6XA 3VN4A 4Q26A 3VD5A 2GU9A 2Z42A 3CL1A 3BPSA 3WF3A 4Q27A 3KCYA 3NNMA 5HI0A 1HRV1 1W39A 2YMZA 5L9VA 4YVSA 5IVJA 4BQWA 5EYYA 2QQWA 5GJ6A 3GHNA 3KZ4C 1IQAA 2VXJA 3WW4A 3IDBB 1DGLA 1BCXA 4XUTA 2XVKA 2Q8CA 2ZGNA 3HQUA 4M0NA 4MGYE 4UYBA 1IQDC 5FMBA 2DYCA 5C5TA 2JDNA 2DV9A 2PHWA 1WWYA 2ZKLA 1L7LA 2A75A 4AFDA 2VW2A 3O1PA 2V4VA 3ZFEB 4X6RB 1OF3A 2V09A 2ZX1A 3ZXFA 4E2SA 5GLWA 1G6NA 3NNGA 2WABA 3P6BA 1NKGA 1FATA 4CUAA 1IPKA 3AMHA 3DYPA 1O4TA 3U14A 5CKQA 1CAWB 1Q8QA 2GH2A 2VXRA 2DU1A 2VUJA 4QXKA 3PNAA 5LRSA 3D0JA 5A6ZA 5IK8A 3ZPYA 3SQOA 2O14A 3KCXA 4CUBA 2RE9A 5JCTA 4QPIB 3K2OA 1ZRIA 2VMGA 4ITCA 1WZXA 3GZUC 2RMU1 3UV9A 4I3PA 3MW4A 4XPVA 3FWEA 4EYUA 1PO23 4DXTA 3B02A 4C90A 4N43A 4LBNA 4QKBA 3VD3A 3MW2A 3VL8A 1HJFA 4MLOA 1H8VA 4ASKA 1MACA 4XJZA 2A3XA 1JHNA 1UD1A 5JZGB 4QDQA 1WLWA 2RS33 3QCWA 1NQDA 2P3JA 3V0AB 1PK6B 2ZBJA 3AMPA 5A6XA 1PX3A 4GALA 1F15A 1KFXL 5FPVA 3BUCA 3TN92 1FNYA 4M3CB 4R4ZA 4CTEA 5HXMA 3KHCA 3AB0A 3RFRA 2MNGA 3EQEA 1LU1A 5FZKA 2GSYA 1DQ1A 5DXDA 4WM8B
chains in the Genus database with same CATH topology
4D8MA 3VDAA 2XHNA 5A1AA 5LA0A 3UESA 2JKXA 4KWUA 4ZXEA 3T2QA 1ULOA 5HPOA 2WAAA 3ACHA 3ACIA 2VCAA 3SKVA 4YPJA 4JKLA 2QQKA 4E8CA 1JU3A 2XOMA 4LQRA 5IFTA 3CKHA 1OF4A 3T08A 3I3DA 4AAXA 1W99A 4UI9L 3FL7A 2VZUA 2YC4A 4JKKA 5EJ1B 1WCQA 5IYYA 2KD7A 3LEKA 4A42A 4PQQA 3I2KA 1TG7A 1W9WA 3IB3A 2VOTA 2LS6A 2ZXQA 5JMOA 3GM8A 2WBKA 4OMCA 3HNBM 5J1XA 2W95A 3WNKA 4W8JA 3T2OA 3CIHA 3I3BA 2J1SA 3GGLA 3IAPA 1TVGA 4ARYA 3NQHA 3CZJA 3HEIA 1PMHX 4DEQA 3THCA 5I0DA 3C7HA 3T0AA 2W92A 2Y6KA 3HPNA 2DDUA 2JE8A 1OH4A 2B4KA 1JZ3A 1JYVA 1PMJX 5CYYA 2J1TA 1W8NA 3MV01 4RYDA 1CZTA 3I3EA 3C7FA 1H6YA 1O8PA 4DEVA 4BJ0A 3I2IA 2VZRA 4BDVB 4QX0A 2WN2A 4GWIA 1T2XA 3HN3A 4XUNA 4L0PA 1CZVA 4QX3A 4P00B 1UYZA 5DN2A 1DP0A 1HN1A 3NJVA 1P8JA 1OT5A 1J83A 4GZ9A 3WNLA 4ZZ8A 3SEPA 3OEBA 3OGSA 2QQLA 2VTFA 4MO3M 5IHRA 3SKJE 1XNAA 3OBAA 4JX0A 4TXWA 2JD9A 3I2FA 5IFPA 1UMIA 2EICA 3U37A 3LE0A 3MO4A 4QB2A 2ORZA 3IDAA 2VCCA 3DECA 2W91A 4OZOA 2Z4FA 3SEEA 2VJXA 1UY4A 1JZ8A 4PF1A 4MADA 4ET7A 2E33A 1L7RA 2Y6JA 3WNMA 1K42A 2VZVA 2DCKA 4CU8A 4DXRA 1US3A 2CDPA 3WF2A 2VM9A 1ULPA 3K75B 3NRUA 2VZ1A 1UWWA 5IJRA 2J1VA 3C8XA 4FI9A 2VMEA 1K45A 2VQUA 2BGPA 1DYOA 2VZSA 2RJ2A 3A23A 3JXSA 5DQ0A 5C7GA 3FHQA 2YFUA 3WQBA 1SG3A 1W9TA 5C71A 3AC0A 4P5YA 4E8DA 1W8OA 5C70A 2EIDA 1UYXA 3EB7A 2W1QA 3HNMA 5JR2A 2Y6GA 3LEGA 3T0DA 2QQNA 4MOAA 2ZEXA 5DMYA 5JXHA 1JZ2A 4Z2AA 2QQMA 4XUPA 4IUGA 4LKSA 3VD7A 2J1RA 3D3AA 3LPFA 4LPLA 2VC9A 5B4XA 4A6OA 1K12A 4A3ZA 3FHAA 4XUOA 2Y8KA 2WUHA 3NJXA 3ACGA 2WAOA 3I97A 3MV11 1UY0A 2DCJA 2XONA 4OUEA 1H6XA 2V5DA 2VZPA 2ID4A 1UYYA 2OKXA 2VMCA 2QBXA 4A45A 1XC6A 1CIYA 1XPWA 1W0NA 3HOBA 5DPNA 3MUZ1 1MPXA 4JHZA 4W4ZA 1NX9A 5B4NA 1DLCA 3GDBA 3OB8A 3UETA 2VO5A 2E26A 4ZY9A 1UXZA 2VMDA 2VZQA 3C7OA 3K77A 1GQPA 3I2JA 1GNYA 1CX1A 2BZDA 3VD9A 3CDZB 1UXXX 5FUIA 3PUHA 1F4HA 2WDBA 3OGRA 2J22A 4QX2A 3T2PA 1K3IA 3FN9A 1KGYA 2EIEA 2RVAA 2QQOA 2JDAA 2YFZA 2W3JA 1GU3A 3A7QA 3LEIA 3LPGA 2J1UA 1J84A 5LA1A 2YC2A 4BXSV 1JYWA 1GOHA 2VCBA 2WN3A 1XNTA 3ACFA 2E32A 1GUIA 5JUVA 2WYSA 3GXUA 4A4AA 4JKMA 4ARXA 3ECQA 5G04L 4HG6B 1CZSA 2PQSA 2VZTA 3J7HA 1LNSA 5LA2A 4A44A 4CU7A 4OYUA 3BGAA 1F4AA 2HYXA 3EYPA 4CVUA 2VQTA 2C26A 2X09A 1JZ5A 1EUUA 3UNPA 1UX7A 3DYOA 4M4PA 2R7EB 3OG2A 1D7PM 2WZ8A 4OMDA 1GOGA 2W1SA 4XUQA 1UY1A 5EIYB 3VDBA 3ZM8A 4QAWA 5CZKA 4AG4A 1UY3A 3I2HA 3OGVA 4TTGA 1SHWB 2C9KA 3WF0A 4RN5A 3VD4A 3IAQA 2ZEYA 1O59A 1SDDB 2QQJA 4MGSA 4QX1A 4QB1A 1BHGA 5JXIA 2W1UA 4BK4A 2Y6HA 1NAEA 2WO1A 2Y6LA 1JI6A 2W5FA 4CU6A 2VZ3A 3K4AA 2W9XA 1R64A 2LW8A 4GWJA 4M4RA 2VMFA 4ZZ5A 4QB6A 4CUCA 3IIIA 1JHJA 1YQ2A 1PX4A 3P1IA 4UAPA 4P02B 1EUTA 4LHSA 1W9SA 2VZOA 3BN6A 3T0BA 2V72A 3K4ZA 4KI5M 5F7UA 4QDRA 4MGQA 5LCWL 2E31A 1UMHA 3WEZA 3HNYM 2RV9A 3HJRA 3K4DA 1JU4A 5G05L 2YG0A 3CZUA 1JYNA 2C4XA 4P08A 2W87A 1US2A 2ORXA 2Y64A 4UOJA 3VDCA 3C7EA 1UZ0A 2BGOA 3E1F1 3F2ZA 2BERA 1JZ7A 3K46A 3WSOA 3VD5A 3WF3A 2W47A 4A41A 2WZEA 1NUKA 4DUVA 2VR4A 1GOFA 3DYMA 4XUTA 3WNOA 3ETPA 2YB7A 3WNPA 1IQDC 3WNNA 2W94A 4W50A 1JZ4A 3A21A 3MBWA 2EIBA 1L7QA 1RYYA 4QDSA 2V4VA 4XURA 1OF3A 2B9VA 3OEAA 1KEXA 4DUWA 3NNGA 2VL4A 2WABA 3C7GA 3P6BA 1NKGA 2X10A 1JYXA 4CUAA 1UY2A 3DYPA 2J1AA 2L9LA 1O8SA 3MUY1 2XQXA 2WO2A 1JZ6A 3THDA 2WO3A 4CUBA 4DXSA 4QPWA 4DUXA 2J1EA 4KMQA 4BK5A 3CQOA 4CU9A 4D0QA 3CMGA 3A22A 3PUIA 1GMMA 4DXTA 1WKYA 2BBAA 2W1WA 3LQCA 3WF1A 3VD3A 2CDOA 3WF4A 3W5MA 2QQIA 4PT6A 2ZEZA 4QDQA 2ZEWA 3I2GA 3T09A 5JXJA 4XVHA 5EJZB 1PX3A 2J7MA 3W5NA 1OD3A 5HXMA 5JXGA 2W46A 3ABZA 2HLEA 1I5PA 2WQ8A 4XZUG 2X05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8M A;  3VDA A;  2XHN A;  5A1A A;  5LA0 A;  3UES A;  2JKX A;  4KWU A;  4ZXE A;  3T2Q A;  1ULO A;  5HPO A;  2WAA A;  3ACH A;  3ACI A;  2VCA A;  3SKV A;  4YPJ A;  4JKL A;  2QQK A;  4E8C A;  1JU3 A;  2XOM A;  4LQR A;  5IFT A;  3CKH A;  1OF4 A;  3T08 A;  3I3D A;  4AAX A;  1W99 A;  4UI9 L;  3FL7 A;  2VZU A;  2YC4 A;  4JKK A;  5EJ1 B;  1WCQ A;  5IYY A;  2KD7 A;  3LEK A;  4A42 A;  4PQQ A;  3I2K A;  1TG7 A;  1W9W A;  3IB3 A;  2VOT A;  2LS6 A;  2ZXQ A;  5JMO A;  3GM8 A;  2WBK A;  4OMC A;  3HNB M;  5J1X A;  2W95 A;  3WNK A;  4W8J A;  3T2O A;  3CIH A;  3I3B A;  2J1S A;  3GGL A;  3IAP A;  1TVG A;  4ARY A;  3NQH A;  3CZJ A;  3HEI A;  1PMH X;  4DEQ A;  3THC A;  5I0D A;  3C7H A;  3T0A A;  2W92 A;  2Y6K A;  3HPN A;  2DDU A;  2JE8 A;  1OH4 A;  2B4K A;  1JZ3 A;  1JYV A;  1PMJ X;  5CYY A;  2J1T A;  1W8N A;  3MV0 1;  4RYD A;  1CZT A;  3I3E A;  3C7F A;  1H6Y A;  1O8P A;  4DEV A;  4BJ0 A;  3I2I A;  2VZR A;  4BDV B;  4QX0 A;  2WN2 A;  4GWI A;  1T2X A;  3HN3 A;  4XUN A;  4L0P A;  1CZV A;  4QX3 A;  4P00 B;  1UYZ A;  5DN2 A;  1DP0 A;  1HN1 A;  3NJV A;  1P8J A;  1OT5 A;  1J83 A;  4GZ9 A;  3WNL A;  4ZZ8 A;  3SEP A;  3OEB A;  3OGS A;  2QQL A;  2VTF A;  4MO3 M;  5IHR A;  3SKJ E;  1XNA A;  3OBA A;  4JX0 A;  4TXW A;  2JD9 A;  3I2F A;  5IFP A;  1UMI A;  2EIC A;  3U37 A;  3LE0 A;  3MO4 A;  4QB2 A;  2ORZ A;  3IDA A;  2VCC A;  3DEC A;  2W91 A;  4OZO A;  2Z4F A;  3SEE A;  2VJX A;  1UY4 A;  1JZ8 A;  4PF1 A;  4MAD A;  4ET7 A;  2E33 A;  1L7R A;  2Y6J A;  3WNM A;  1K42 A;  2VZV A;  2DCK A;  4CU8 A;  4DXR A;  1US3 A;  2CDP A;  3WF2 A;  2VM9 A;  1ULP A;  3K75 B;  3NRU A;  2VZ1 A;  1UWW A;  5IJR A;  2J1V A;  3C8X A;  4FI9 A;  2VME A;  1K45 A;  2VQU A;  2BGP A;  1DYO A;  2VZS A;  2RJ2 A;  3A23 A;  3JXS A;  5DQ0 A;  5C7G A;  3FHQ A;  2YFU A;  3WQB A;  1SG3 A;  1W9T A;  5C71 A;  3AC0 A;  4P5Y A;  4E8D A;  1W8O A;  5C70 A;  2EID A;  1UYX A;  3EB7 A;  2W1Q A;  3HNM A;  5JR2 A;  2Y6G A;  3LEG A;  3T0D A;  2QQN A;  4MOA A;  2ZEX A;  5DMY A;  5JXH A;  1JZ2 A;  4Z2A A;  2QQM A;  4XUP A;  4IUG A;  4LKS A;  3VD7 A;  2J1R A;  3D3A A;  3LPF A;  4LPL A;  2VC9 A;  5B4X A;  4A6O A;  1K12 A;  4A3Z A;  3FHA A;  4XUO A;  2Y8K A;  2WUH A;  3NJX A;  3ACG A;  2WAO A;  3I97 A;  3MV1 1;  1UY0 A;  2DCJ A;  2XON A;  4OUE A;  1H6X A;  2V5D A;  2VZP A;  2ID4 A;  1UYY A;  2OKX A;  2VMC A;  2QBX A;  4A45 A;  1XC6 A;  1CIY A;  1XPW A;  1W0N A;  3HOB A;  5DPN A;  3MUZ 1;  1MPX A;  4JHZ A;  4W4Z A;  1NX9 A;  5B4N A;  1DLC A;  3GDB A;  3OB8 A;  3UET A;  2VO5 A;  2E26 A;  4ZY9 A;  1UXZ A;  2VMD A;  2VZQ A;  3C7O A;  3K77 A;  1GQP A;  3I2J A;  1GNY A;  1CX1 A;  2BZD A;  3VD9 A;  3CDZ B;  1UXX X;  5FUI A;  3PUH A;  1F4H A;  2WDB A;  3OGR A;  2J22 A;  4QX2 A;  3T2P A;  1K3I A;  3FN9 A;  1KGY A;  2EIE A;  2RVA A;  2QQO A;  2JDA A;  2YFZ A;  2W3J A;  1GU3 A;  3A7Q A;  3LEI A;  3LPG A;  2J1U A;  1J84 A;  5LA1 A;  2YC2 A;  4BXS V;  1JYW A;  1GOH A;  2VCB A;  2WN3 A;  1XNT A;  3ACF A;  2E32 A;  1GUI A;  5JUV A;  2WYS A;  3GXU A;  4A4A A;  4JKM A;  4ARX A;  3ECQ A;  5G04 L;  4HG6 B;  1CZS A;  2PQS A;  2VZT A;  3J7H A;  1LNS A;  5LA2 A;  4A44 A;  4CU7 A;  4OYU A;  3BGA A;  1F4A A;  2HYX A;  3EYP A;  4CVU A;  2VQT A;  2C26 A;  2X09 A;  1JZ5 A;  1EUU A;  3UNP A;  1UX7 A;  3DYO A;  4M4P A;  2R7E B;  3OG2 A;  1D7P M;  2WZ8 A;  4OMD A;  1GOG A;  2W1S A;  4XUQ A;  1UY1 A;  5EIY B;  3VDB A;  3ZM8 A;  4QAW A;  5CZK A;  4AG4 A;  1UY3 A;  3I2H A;  3OGV A;  4TTG A;  1SHW B;  2C9K A;  3WF0 A;  4RN5 A;  3VD4 A;  3IAQ A;  2ZEY A;  1O59 A;  1SDD B;  2QQJ A;  4MGS A;  4QX1 A;  4QB1 A;  1BHG A;  5JXI A;  2W1U A;  4BK4 A;  2Y6H A;  1NAE A;  2WO1 A;  2Y6L A;  1JI6 A;  2W5F A;  4CU6 A;  2VZ3 A;  3K4A A;  2W9X A;  1R64 A;  2LW8 A;  4GWJ A;  4M4R A;  2VMF A;  4ZZ5 A;  4QB6 A;  4CUC A;  3III A;  1JHJ A;  1YQ2 A;  1PX4 A;  3P1I A;  4UAP A;  4P02 B;  1EUT A;  4LHS A;  1W9S A;  2VZO A;  3BN6 A;  3T0B A;  2V72 A;  3K4Z A;  4KI5 M;  5F7U A;  4QDR A;  4MGQ A;  5LCW L;  2E31 A;  1UMH A;  3WEZ A;  3HNY M;  2RV9 A;  3HJR A;  3K4D A;  1JU4 A;  5G05 L;  2YG0 A;  3CZU A;  1JYN A;  2C4X A;  4P08 A;  2W87 A;  1US2 A;  2ORX A;  2Y64 A;  4UOJ A;  3VDC A;  3C7E A;  1UZ0 A;  2BGO A;  3E1F 1;  3F2Z A;  2BER A;  1JZ7 A;  3K46 A;  3WSO A;  3VD5 A;  3WF3 A;  2W47 A;  4A41 A;  2WZE A;  1NUK A;  4DUV A;  2VR4 A;  1GOF A;  3DYM A;  4XUT A;  3WNO A;  3ETP A;  2YB7 A;  3WNP A;  1IQD C;  3WNN A;  2W94 A;  4W50 A;  1JZ4 A;  3A21 A;  3MBW A;  2EIB A;  1L7Q A;  1RYY A;  4QDS A;  2V4V A;  4XUR A;  1OF3 A;  2B9V A;  3OEA A;  1KEX A;  4DUW A;  3NNG A;  2VL4 A;  2WAB A;  3C7G A;  3P6B A;  1NKG A;  2X10 A;  1JYX A;  4CUA A;  1UY2 A;  3DYP A;  2J1A A;  2L9L A;  1O8S A;  3MUY 1;  2XQX A;  2WO2 A;  1JZ6 A;  3THD A;  2WO3 A;  4CUB A;  4DXS A;  4QPW A;  4DUX A;  2J1E A;  4KMQ A;  4BK5 A;  3CQO A;  4CU9 A;  4D0Q A;  3CMG A;  3A22 A;  3PUI A;  1GMM A;  4DXT A;  1WKY A;  2BBA A;  2W1W A;  3LQC A;  3WF1 A;  3VD3 A;  2CDO A;  3WF4 A;  3W5M A;  2QQI A;  4PT6 A;  2ZEZ A;  4QDQ A;  2ZEW A;  3I2G A;  3T09 A;  5JXJ A;  4XVH A;  5EJZ B;  1PX3 A;  2J7M A;  3W5N A;  1OD3 A;  5HXM A;  5JXG A;  2W46 A;  3ABZ A;  2HLE A;  1I5P A;  2WQ8 A;  4XZU G;  2X05 A; 
#chains in the Genus database with same CATH topology
 1MS9 A;  5DAQ A;  2D6L X;  5J37 A;  3MGU A;  3T1M A;  2MEV 2;  3ROU A;  1HXS 1;  1GR3 A;  2PHR A;  2UYB A;  2BWA A;  5CIR A;  4Y1U A;  2Q8E A;  4XEZ A;  3VUO A;  3IBM A;  4IND A;  3CJX A;  3UES A;  4ZXE A;  1KDK A;  4OI0 A;  1RUG 2;  3T2Q A;  3WDU A;  1MS8 A;  1MEC 1;  5JVV A;  1W3X A;  2A6V A;  4CPB A;  4DRV A;  1SZB A;  2LRP A;  3KV4 A;  4BM8 A;  3BVC A;  4U2A A;  3KS7 A;  2AGS A;  5CKM A;  4BQX A;  5BNO B;  4LO7 A;  5EJ3 A;  2YDE A;  1OVP A;  3OUH A;  1ZYB A;  2AZ5 A;  2EAA A;  1V70 A;  1R08 2;  2NM1 A;  1R1A 3;  2IZW A;  3OPW A;  4IE4 A;  4YPJ A;  3H3U A;  5SV8 A;  4OCT A;  4J1X A;  3TRS B;  3H8O A;  3UGF A;  1POV 1;  2QQK A;  2PXJ A;  3ON7 A;  4ZON A;  1HRI 2;  2ZX3 A;  1Q3E A;  4XF9 A;  3ZFG A;  4E8C A;  3MFA A;  3VZM A;  3E6D A;  2OW4 A;  2WYF A;  1L3J A;  1IG0 A;  1OFS A;  1XJA A;  4ZU5 A;  3LCP A;  2ARE A;  1W99 A;  1SCR A;  2R06 3;  5IVY A;  1KFU L;  2XWJ B;  3IDC B;  3N9M A;  1RUE 1;  1RUO A;  2VNG A;  4ZXK A;  2HWD 3;  5L9R A;  1I1E A;  1O4Y A;  1VAV A;  2OUJ A;  3RMX A;  2V4A A;  3I2K A;  4ASL A;  1PZ7 A;  3OSD A;  4QPY A;  5JR7 B;  2ZXQ A;  3M2M A;  4Y1V A;  3GM8 A;  4XAA A;  4KQ7 A;  5FO9 B;  2OX0 A;  1RUI 1;  3HNB M;  4QHO A;  4CCJ A;  2W95 A;  5C8C A;  1LEN A;  2QFE A;  3CIH A;  2VD7 A;  2J1S A;  4PLM A;  4TN7 A;  5C4W A;  3ELN A;  4K1Z A;  2P3Y A;  4FPL A;  2XB6 C;  3B01 A;  3LOI A;  4XHB A;  1TVG A;  1K5M C;  1W9F A;  2JB8 A;  3HEI A;  1SBD A;  5EWS A;  1RHI 1;  1RUD 2;  2UWC A;  4IGO A;  3VKM A;  1XE7 A;  1KQR A;  1BKZ A;  1SLI A;  3POE A;  4XYX A;  2ZPX A;  3I3M A;  4OQ9 A;  3ZIW A;  3I8T A;  1REF A;  2A7A A;  2W92 A;  5FPL A;  1A3K A;  2RMU 3;  5J98 B;  2Y6K A;  4AHY A;  5K0U B;  1UN1 A;  2XWB B;  2DBI A;  2DDU A;  2JE8 A;  4PHZ A;  5D21 A;  3JBG 1;  3MIG A;  4IXL A;  4PBP A;  3KV9 A;  4YW2 A;  1BVV A;  4RL7 A;  4YG6 A;  1ULG A;  1VPH A;  3VBH C;  3ZMN A;  3UKN A;  1OMI A;  4AED B;  1HRI 3;  2JG8 C;  4CDW B;  5A3U A;  3AKS A;  2QJV A;  2ZTN A;  4XTP A;  4RYD A;  1VAM A;  5K0U A;  3C7F A;  1NYW A;  1GNH A;  3KT7 A;  4AGG A;  1O8P A;  1QGL A;  4BJ0 A;  4B3N A;  4AYU A;  1SBE A;  2P37 A;  1LOF C;  2PHF A;  3R4S A;  2VZR A;  2R04 3;  4LUM A;  5ABJ A;  3WZ1 A;  5L36 A;  1IS4 A;  1RIN A;  3IIA A;  2WN2 A;  4C1X A;  1RVF 1;  1QIQ A;  5JSO A;  2Y34 A;  3O1R A;  1A8D A;  1ND2 B;  2DWR A;  4L0P A;  5BNP C;  1CZV A;  3USU B;  3AKR A;  3PL0 A;  3RPQ A;  3U1X A;  3VLB B;  2XHK A;  5JIA A;  2VMH A;  1DU3 D;  2DUP A;  1UYZ A;  1LOC A;  1DP0 A;  4GZ9 A;  1OT5 A;  4F8A A;  5KR7 A;  3SEP A;  1H1M A;  4XOG A;  3OGS A;  2WRA A;  1AYN 1;  1EAH 2;  2DFC A;  3SKJ E;  2HWE 3;  1ACC A;  3NVC A;  3D6E A;  4L99 A;  3ZIX A;  2VTX A;  2HKX A;  4BB3 A;  4F3J A;  4FPF A;  4TXW A;  5IWF A;  3TN9 3;  2JD9 A;  4QGM A;  3IZO A;  3WG3 A;  5F37 A;  5FDB A;  4CXY A;  2ZAB A;  2D98 A;  1FYU A;  2GC1 A;  4RR3 A;  4F83 A;  3MO4 A;  4QB2 A;  2ORZ A;  3IDA A;  2VCC A;  4XFH A;  1QQP 2;  1NCQ C;  3DEC A;  3PVE A;  2ZGK A;  1I5Z A;  2VBB A;  2W91 A;  5LWB A;  3ME2 A;  2QNK A;  2Z4F A;  2BRT A;  1HV1 A;  1ZRR A;  3H1W A;  2YBP A;  2VVD A;  1SEF A;  4KH9 A;  4LO8 A;  1R09 3;  4Y5Z 0;  1GP6 A;  1RUJ 1;  5FY7 A;  1G86 A;  2JG9 A;  3OOX A;  2VJX A;  1W90 A;  4FPC A;  5GLV A;  3LA7 A;  1UY4 A;  5C8W A;  2VG9 A;  4MET A;  1HB3 A;  2Q1F A;  4GH4 A;  3ZSK A;  2E33 A;  2NLR A;  4FSJ A;  3EXU A;  1RUE 3;  4ATF A;  2RS1 2;  4WVM A;  3J8F 2;  2C6S A;  4AI2 A;  4K9S A;  4N9I A;  3SC7 X;  4HN1 A;  3PIG A;  4BQ3 A;  4M3C E;  2VM9 A;  3NRU A;  3ITQ A;  4LBO A;  5I0T A;  3NL1 A;  3L2Y A;  5EHD A;  1UWW A;  2ZA9 A;  3MLL A;  3ZN6 A;  3LAG A;  3RYR A;  4CP9 B;  1PIV 3;  1KJL A;  3FUQ A;  3THP A;  4L11 A;  5C6C A;  4YVS C;  2TNF A;  5E8A A;  4XXA A;  1K45 A;  2CWM A;  2VE1 A;  2VQU A;  2XJS A;  4GJZ A;  4IET A;  2BGP A;  4ONU A;  2CTV A;  4ES8 A;  3O1S A;  1AXY A;  1DYO A;  3DV8 A;  3IM0 A;  3QH6 A;  1BXH A;  2Y33 A;  3A23 A;  3JXS A;  4Y5T A;  1ZX5 A;  5CB7 A;  2DTY A;  3U75 A;  4E4H A;  1GV9 A;  2IC1 A;  2XPJ A;  5C4W B;  2DUR A;  4P5Y A;  2F6B A;  4E8D A;  1CAU B;  1FV2 A;  1C8N A;  1TME 3;  4JQT A;  1W0P A;  1JOB A;  2JIJ A;  3LD8 A;  4JHT A;  4Z82 A;  4E2G A;  4PI0 A;  1QXR A;  3IMM A;  4RHV 3;  4GD4 A;  1UYX A;  3HNM A;  2W1Q A;  4LJH A;  2WSU A;  1NE6 A;  2WS9 1;  3HMY A;  4MGZ E;  1M06 G;  1RIT A;  2IXI A;  4MOA A;  4K6B A;  1VRH 3;  1CAV A;  1VIW B;  2DVB A;  4UW3 A;  4CYD A;  4Z92 B;  2IXK A;  2FZ2 A;  1FV3 A;  4IEP A;  4S2H A;  4DZG A;  1W6O B;  2QQM A;  4FBF A;  4Z2A A;  3MFC A;  2TUN A;  2G9F A;  3S6P A;  3LPF A;  1QJZ A;  4LPL A;  5B4X A;  1BBT 3;  1NXD 1;  2VQ0 A;  4CUG A;  4FPH A;  4OHV A;  4A3Z A;  2BNM A;  5LEK A;  1S0J A;  3MPP G;  3U4X A;  2HJI A;  3NJX A;  1MZ5 A;  1W8H A;  3NST A;  2WAO A;  3UGH A;  3LOB A;  2NPI A;  5F5Q A;  3MV1 1;  2NMO A;  1OPM A;  2W2I A;  2XJT A;  3KCC A;  3VHR A;  1RUN A;  1X7N A;  3Q8E A;  5FZ6 A;  1W6N A;  5DDJ 1;  4NII A;  5KHG A;  1FOD 3;  1Y9G A;  1XYN A;  5K8S A;  1JYI A;  3AXE A;  3D82 A;  2Q30 A;  2VW0 A;  2VAU A;  1XYO A;  1G9C A;  3HVD A;  4BQ1 A;  1FXZ A;  2QZ2 A;  1UCX A;  1YRZ A;  4BQY A;  1EYB A;  1GZ9 A;  4TWT A;  1RUH 1;  2OQ7 A;  2CGP A;  1MPX A;  2YXS A;  1YIP A;  1ZBA 3;  4FFF A;  2OII A;  3MF9 A;  5FOJ B;  4P9W A;  3ILN A;  3EBR A;  1C57 A;  3WCS A;  2FDH A;  1UXZ A;  4GWN A;  1N1V A;  2B7Y A;  4LLO A;  1WBF A;  1UQX A;  3CNA A;  4Q4W 3;  2HYK A;  3K77 A;  2JEN A;  3Q8A A;  3I2J A;  4N7I A;  1J58 A;  3VL9 A;  4EN0 A;  5J36 A;  1CX1 A;  2GAU A;  2DVF A;  5FPU A;  4QKN A;  2DBN A;  3ZXK A;  1UYP A;  3CDZ B;  1VRH 2;  1OKQ A;  1EY2 A;  4RFT 0;  2WDB A;  3R4U A;  1OOP B;  4AI3 A;  1KD7 A;  5A7O A;  2J22 A;  4QX2 A;  2WZP P;  1FPN 2;  1EV1 2;  1PZ9 A;  1XND A;  1KGY A;  3A0K A;  4MXV A;  4R9A A;  2QQO A;  4OHX A;  2GNT A;  2BGC A;  1TQ5 A;  4EN7 B;  1NT0 A;  2K9Z A;  1PIV 2;  4WM7 B;  2FCU A;  5A70 A;  2ZAA A;  4O9G A;  1Y3T A;  1ZZ6 A;  4HPK A;  1RUC 1;  4RR3 B;  3V65 A;  5E1R A;  3WXP A;  4XF0 A;  1GU3 A;  1AR8 1;  1VRH 1;  2A73 B;  4NHL A;  1CPN A;  1RUG 3;  2Y38 A;  4KWL A;  1BVP 1;  2YGL A;  4V2W A;  2WN3 A;  1XNT A;  1B09 A;  1VB2 A;  1IG3 A;  4HLT A;  5BY5 A;  1R08 3;  3GXU A;  4EN9 B;  1CES A;  3ES4 A;  4FTS A;  3WVJ A;  1YUD A;  1DGR N;  2QE3 A;  1E5R A;  4I09 A;  5FP4 A;  5FFO C;  4LIU A;  1SPP B;  3CJI C;  1FMD 2;  3ZXE A;  4XFC A;  4BHP A;  5LAT A;  1S0G A;  1XNB A;  3O0X A;  4TYS A;  1LNS A;  3Q8C A;  3WHU A;  4LHL A;  3U78 A;  4CVU A;  1NZC A;  1NY7 2;  1WCU A;  4YVW C;  5TSW A;  1Y43 B;  2B5H A;  2WA4 A;  5DDJ 2;  1JZ5 A;  3UNP A;  1UX7 A;  5C4W C;  4FP2 A;  2YPD A;  4CP9 A;  2D3P A;  2I74 A;  3I7D A;  4DMI A;  5BNN B;  2C24 A;  3ACL A;  3SH3 A;  1K5M A;  2XJP A;  4GWM A;  4OZX A;  3USS A;  1MS0 A;  4QPI C;  2R16 A;  2E7T A;  5D2A A;  5HXV A;  5C5U A;  2BQP A;  1KDM A;  3MF6 A;  4DS0 A;  4XUQ A;  5T5L A;  5JSP A;  4NPR A;  4DIQ A;  2ZX2 A;  4TSV A;  2D6P A;  1VAK A;  4QAW A;  5CZK A;  1GQG A;  2R1D A;  2WNV B;  2X53 S;  5LY2 A;  3VDD A;  3UGG A;  2CGN A;  5FZ9 A;  2C9K A;  4WVV A;  5CFC C;  4I01 A;  3ZVX A;  3ZXJ A;  2WLQ A;  1QH7 A;  3JCI A;  1ZRD A;  4ZS3 A;  2QUO A;  1XSR A;  2FDJ A;  5FQ0 A;  2E51 A;  2JG8 A;  2XG3 A;  3GZA A;  5JZG C;  3O1U A;  5JXI A;  4YWA A;  4QD2 A;  1GKB A;  2ATF A;  3TYJ A;  1V0A A;  1AL2 1;  1PK6 C;  2Y6H A;  2XL7 A;  1NAE A;  2WO1 A;  4LK7 A;  4CCO A;  2XVG A;  1YNA A;  1J3P A;  4Q4W 2;  3CO2 A;  3H3Z A;  5ABJ C;  4ISQ A;  1F5J A;  2VOX A;  1IKQ A;  3H8U A;  1VMJ A;  2W9X A;  3MZH A;  1VBC 1;  4J6G A;  2OQ6 A;  3I54 A;  3V0B A;  3NV4 A;  1W2A X;  4NO4 A;  4NPM A;  1VMF A;  5FUN A;  1W05 A;  1LRH A;  1J3Q A;  4GMP 0;  5BNP A;  4QB6 A;  1ASJ 2;  3VHP A;  2V73 A;  3PVB B;  3BU0 A;  1AR7 3;  1PM7 A;  2CSG A;  3III A;  1YQ2 A;  2DCT A;  2BYV E;  5KXB A;  2B8M A;  3A4U A;  3KM5 A;  1EUT A;  1CAX A;  5FYT A;  2EXK A;  1W8F A;  1W9S A;  2XJQ A;  4I3G A;  3VKL A;  4UBG A;  5KXE A;  2B45 X;  3BN6 A;  3S7I A;  4CEY A;  4WBB A;  4W65 A;  2R6Q A;  5GZG A;  1W6M B;  2LAL A;  2P6C A;  3AP4 A;  3K4Z A;  3U4S A;  1C1F A;  4OHW A;  4X8N A;  4WVM B;  1UMH A;  5FK7 A;  4P9L A;  1RJ8 A;  3ZXL A;  5IAX A;  4R4X A;  3ZYF A;  5FWJ A;  2FDG A;  3WEZ A;  5BNO C;  3KF3 A;  2RV9 A;  3SLI A;  1ZM1 A;  2GNM A;  2FCV A;  3H8R A;  1YQ8 A;  1AR6 1;  2ET7 A;  1OI6 A;  3PVN A;  4BU2 A;  1AJO A;  5GLZ A;  1JUI A;  4P08 A;  1AX0 A;  4E4D X;  1NCQ A;  5A3L A;  2E63 A;  1LGN A;  1LCL A;  4Q1P A;  4AQT A;  4Z07 A;  2ETE A;  4UFK A;  2D6O X;  2BGO A;  3MPB A;  2ZX4 A;  1H1I A;  1QJU 3;  3BTY A;  2PTM A;  2JG9 C;  1GAN A;  3ES1 A;  4YW1 A;  4BQ4 A;  3MDP A;  1DQ4 A;  3NNF A;  3OPZ A;  3AZV A;  4KBB A;  3POS A;  1AX2 A;  4YRD A;  5FZE A;  5DG1 A;  5F9T A;  1MQT A;  2H0B A;  3UJO A;  5J3U A;  2VBD A;  1EAH 1;  3DYM A;  3U11 A;  3RZL A;  4MX3 A;  1J3R A;  1S2B A;  3NV1 A;  3AM2 A;  5FZ8 A;  1TME 2;  3WNP A;  2YB7 A;  2MHF A;  5FKC A;  5LA9 A;  1FOD 1;  3PLQ A;  3KHB A;  3CU7 A;  1FI2 A;  1IKP A;  5DAV A;  3VHO A;  1Y9M A;  3A21 A;  2ARB A;  2FDK A;  4CP1 A;  1LHV A;  4IV1 B;  5IK5 A;  1W8Z A;  1AL0 G;  1G8W A;  5FXZ A;  4XUR A;  1RVF 2;  4Y4R A;  4YZ3 A;  3LDK A;  3IN9 A;  1RUH 3;  3OEA A;  1LKN A;  4GQ7 A;  1IPJ A;  1KEX A;  3TB0 A;  1QU0 A;  2YPJ A;  3DXU A;  3WIN E;  3TEW A;  1FMD 3;  1X36 A;  2BOI A;  4WZC A;  2PQQ A;  1UY2 A;  3RDI A;  4YW6 A;  5FTT C;  4FFG A;  3LGR A;  3DGT A;  3M8L A;  4IL7 A;  1AR7 1;  3MUY 1;  4K20 A;  5HCB A;  1LJ7 A;  5JOZ A;  3V0B B;  3JD7 2;  2WO2 A;  2Y60 A;  3PUS A;  4Q4X 3;  5C9A A;  5JOX A;  2IXL A;  2RM2 1;  5SV5 A;  3PTR B;  2IVI B;  2ZHN A;  2DFB A;  4DXS A;  3AYA A;  1LOG A;  1ULC A;  1ZBE 3;  5FZB A;  3JBG 2;  2RR1 2;  4KMQ A;  3WDW A;  5CA6 A;  1YHF A;  3H42 B;  4Q4V 1;  3ZSJ A;  1UIJ A;  3CMG A;  4OI4 A;  4D0Q A;  1YO8 A;  3PUI A;  3OTF A;  4JC1 A;  3VBR B;  5C9A B;  2NP0 A;  5IAV A;  2FZ1 A;  2WNU B;  3FC0 A;  1GSL A;  4GJY A;  3MLK A;  1V9U 1;  4ATE A;  2OA2 A;  1K5M B;  1AVB A;  1Q8V A;  3N35 A;  1W04 A;  1DIW A;  4NR1 A;  4Q0U A;  2DF7 A;  2UYA A;  4RGA A;  2GN3 A;  3WF4 A;  3WUC A;  1X9T A;  2D6M A;  4AW7 A;  2QQI A;  2X5I B;  1ENX A;  2XLF A;  5H9P A;  5I0S A;  5KXC A;  4YW7 A;  1BK0 A;  3H3L A;  5JXJ A;  3T09 A;  1V00 A;  4FQ4 A;  5FZ0 A;  3BOP A;  1B35 B;  2J7M A;  2AR6 A;  2NQY A;  2LM3 A;  4MHR A;  3S7E A;  5CAZ A;  3W5N A;  1QDO A;  1OD3 A;  2DTW A;  1RUI 2;  5E6H A;  1KRI A;  1WW4 A;  3ZOI A;  5JXG A;  2W46 A;  1G9F A;  2OVU A;  4KBZ A;  4LO4 B;  5APA A;  1TME 1;  5FY5 A;  1RMU 3;  4P9I A;  3WG2 A;  1FAY A;  2HLE A;  4JGY C;  2WQ8 A;  4Q0S A;  3JUU A;  1S0F A;  5IVV A;  5B2G B;  5JPM B;  1RUE 2;  5BNQ A;  4EZH A;  4JVA A;  4NHX A;  3Q8F A;  4Q4Y 2;  1NQJ A;  1WCK A;  4FOW A;  4CXW A;  1XU1 A;  1LAJ A;  4J25 A;  4N53 B;  2ES3 A;  4K3U A;  4PIY A;  4XDP A;  1ZBA 1;  2JKX A;  5DZG A;  1XRU A;  5IT6 A;  5EP9 A;  3AJZ A;  2R06 2;  4Y20 A;  1KJR A;  2GP3 A;  3NKG A;  1JTZ X;  1TEI A;  5GLU A;  1PGW 1;  5FZH A;  1PVC 1;  3L2H A;  2CAU A;  4GKX A;  2ZHL A;  1W2T A;  4D3W A;  2XGX A;  3AVR A;  1RED A;  1V9U 2;  1X8E A;  1DHK B;  4CEW C;  2BU9 A;  3UL2 A;  4LOT A;  3ZYI B;  1H8T C;  1QXP A;  4DRR A;  1PGL 2;  4XJ8 A;  4PDW A;  4Q4V 2;  4COZ A;  1HX6 A;  4WM7 A;  4TLG A;  5A80 A;  4MVT A;  2ZX0 A;  4A3X A;  2DCZ A;  3HR9 A;  3T08 A;  4AAX A;  4UI9 L;  5BYN A;  4JKK A;  4DFS A;  5EJ1 B;  3DPR B;  4LNV A;  1WCQ A;  4PIX A;  1S0E A;  1YIF A;  5EYX A;  3THT A;  2GME A;  4LA3 A;  4PQQ A;  5FJK A;  3MIF A;  2DVA A;  1W9W A;  5FYV A;  4FQZ A;  1TE1 B;  2VOT A;  4IE7 A;  5FYC A;  5JMO A;  1LGC A;  1DZT A;  3KSC A;  4JQR A;  4OMC A;  3TN9 1;  2R04 1;  5DUU A;  5J1X A;  3WNK A;  4KG0 A;  4XQ4 A;  1H9P A;  1W06 A;  3O1O A;  3D5O A;  4NVP A;  3E97 A;  1N1S A;  2HEV F;  3POG A;  2R0F A;  5C3S A;  3HIF A;  4KGG A;  2ZJC A;  1AL2 2;  1NLQ A;  1JOD A;  3AMN A;  3CZJ A;  1PMH X;  2VW1 A;  3HT1 A;  5FZ7 A;  3KVA A;  4Y22 B;  3J26 N;  3RZH A;  3V0A A;  3VBO A;  3SMH A;  5I0D A;  4ISR A;  2ZHM A;  2PAE A;  3T0A A;  5KWR A;  1ODM A;  2VNR A;  1COV 2;  1LOE A;  2KM2 A;  5FO8 B;  4AI8 A;  2F4P A;  4XZP A;  1QJE A;  4OUS A;  2KXL A;  1YXW A;  2GMM A;  2XUE A;  4UXA A;  2A6Y A;  1SFP A;  3JZV A;  4QPI A;  5F39 A;  3VKN A;  5CG9 A;  3MIE A;  1S0C A;  3MV0 1;  1ZZ8 A;  5F8P A;  2CWS A;  1VBA 3;  4BLJ A;  4D7T A;  4DIN B;  3I3E A;  3VKO A;  2XR4 A;  3SCF A;  5KC6 A;  1OLM E;  4Q4X 2;  3AZZ A;  2IFW A;  3GYD A;  2VPV A;  4LIT A;  3VDD C;  4LE3 A;  3MHZ A;  3I2I A;  4FPY A;  4DEV A;  5ACA 1;  1R1A 1;  4N53 A;  4EV0 A;  5CFC A;  1UU4 A;  3TNP B;  4UF0 B;  1QWR A;  3DN7 A;  4BDV B;  4LR4 A;  4CDU B;  4QQO A;  5D8A C;  5FZF A;  3AX4 A;  5C3O A;  1POV 0;  2IXH A;  1TZO A;  1QHD A;  5FCC A;  1A8M A;  4XUN A;  5DUV A;  3DKW A;  1MR5 A;  2IUW A;  4M00 A;  5FK8 A;  1XE0 A;  2JE9 A;  2JJ6 A;  3J9S A;  2W52 A;  4CCL A;  2QQP A;  1N3O A;  5GKA C;  5DN2 A;  2D93 A;  2Z69 A;  5DZE A;  1VR3 A;  3AYD A;  1MS4 A;  3M1H A;  4GUL A;  2XBO 2;  3OEB A;  4OI1 A;  2QQL A;  2VTF A;  4MO3 M;  4Q8K A;  3LA2 A;  3VZK A;  4OLL A;  3LDB A;  3EJK A;  5DAP A;  4CDQ B;  1EPW A;  1RUI 3;  3WOG A;  4L9B A;  2VUC A;  5FUP A;  4HN0 A;  5GZF A;  2UUR A;  1LOA A;  4QX7 A;  5F1R A;  5IVB A;  2EIC A;  5H9Q A;  3LE0 A;  4IV3 A;  1COV 3;  1MZE A;  2RS1 3;  2WT1 A;  3LKJ A;  1IGO A;  2ZZJ A;  3NAP C;  1LEC A;  3TNQ A;  1ASJ 3;  1C5H A;  4AFB A;  3M3C A;  4RQP B;  3NV2 A;  5JOW A;  4NIH A;  3AP5 A;  1YWK A;  5BNO A;  2WNE A;  1BBT 2;  5I8S A;  2ZZQ A;  5FBJ A;  3DL3 A;  4ZS2 A;  1RUF 3;  1NCR C;  4PF1 A;  3ZX7 A;  4ET7 A;  2VU9 A;  4Y3O A;  1CGP A;  4FTB A;  1LEM A;  2Y6J A;  3WNM A;  4YM2 A;  4NRP A;  4K7J A;  2RS5 2;  2VZV A;  4CCE A;  1W03 A;  2VUD A;  2RDR A;  2ZGQ A;  1US3 A;  2CDP A;  1G7Y A;  5CAD A;  1T6G C;  1UO9 A;  1C8M 3;  4YZ5 A;  2HWE 1;  1AR8 3;  1VBA 1;  1ULP A;  3K75 B;  3KGL A;  4LBJ A;  2VZ1 A;  3RYP A;  3KV6 A;  4AQ6 A;  4DNY A;  4M01 A;  1BMV 1;  5CU1 A;  5IJR A;  2GC0 A;  2J1V A;  2PAM A;  3VZL A;  3C8X A;  1MQT C;  1RUH 2;  4YYO A;  2VME A;  4GXL A;  5HCF A;  3N9P A;  1CAU A;  4FFI A;  4FFH A;  4Y22 A;  5FYS A;  2BWC A;  5FXV A;  3RS6 A;  2Z79 A;  3SH4 A;  4FAG A;  2BFU L;  2VH9 A;  4H2A A;  1HQN A;  5FZL A;  3KGZ A;  5IK4 A;  5T5O A;  5ANQ A;  4WVZ A;  1OQD A;  1WCS A;  2WJS A;  3FHQ A;  2D7F A;  4Y33 A;  4IGP A;  3KQR A;  3AC0 A;  3NW4 A;  2TEP A;  3C2U A;  2PLV 2;  4MV2 A;  1ALY A;  5ANN A;  4CCM A;  2HBT A;  1D2S A;  1UU6 A;  4HBN A;  5C3P A;  4L8Q A;  4QU1 A;  2ZOE B;  3JBG 3;  2WQ4 A;  2EID A;  5FYU A;  2KA3 A;  1Q8S A;  3LEG A;  3T0D A;  2GZW A;  2PYT A;  3T2T A;  1FT9 A;  2PHL A;  4OQ8 A;  3UJQ A;  5CFC B;  4B1L A;  2RS5 1;  4CSW A;  1YLL A;  1O91 A;  3D3A A;  3VBR C;  4F7Z A;  5C9A C;  4HKW A;  1K12 A;  5FYH A;  1RUC 2;  2BEO A;  2WA3 A;  3N36 A;  4PDW B;  3VBO B;  4XDO A;  4XFA A;  1H9W A;  4JGZ C;  4YVW B;  3ZYH A;  3I97 A;  5HCH A;  4JDN A;  1VE0 A;  2V5D A;  1IS3 A;  1ODN A;  4BQ2 A;  1SAC A;  1D4V B;  1UYY A;  4YW5 A;  1ZA4 A;  4Z1V A;  1HIX A;  3OPT A;  2VMC A;  4CP0 A;  4Y1Z A;  3KF5 A;  1PM4 A;  2Q4S A;  4Y4Y A;  1O5L A;  2I45 A;  1UOJ A;  5KHJ A;  1XPW A;  2JKB A;  1YC6 1;  4DY3 A;  1RUD 3;  5DPN A;  2EF6 A;  1WA6 X;  3Q9O A;  4JHZ A;  5A1L A;  1JBC A;  5B4N A;  1DLC A;  3RZZ A;  3GDB A;  3OB8 A;  2JEM A;  3FX3 A;  1OA2 A;  3OBZ A;  4JCK A;  4RA0 A;  4XDQ A;  1LUL A;  4ZY9 A;  3AYC A;  3ZN4 A;  5EV7 A;  4Y24 A;  1VRB A;  3NNJ A;  2D6K A;  1PVC 3;  3RG0 A;  1GQP A;  2HBU A;  1GNY A;  2NMN A;  2BZD A;  4BA6 A;  1LOD A;  1HLC A;  2I2S A;  1MVQ A;  1URX A;  4XIO A;  3WNX A;  5FUI A;  3PUH A;  2ET1 A;  3SHR A;  3SNM A;  1W6P B;  4BPZ A;  2WNO A;  4FXG B;  4K8F A;  4UFM A;  3BAL A;  2CAV A;  4HAN A;  2V5Y A;  3ZYP A;  1F2N A;  2HEW F;  3BOD A;  1ZZB A;  3I2D A;  4XMI A;  4AI9 A;  4HVQ A;  5FMC A;  2EIE A;  4XFG A;  2Q1M A;  5FQ0 B;  5E88 A;  1H8T B;  3I4I A;  2JDA A;  4Q0Q A;  1MEC 3;  2GH8 A;  2B42 B;  3HT2 A;  2BNN A;  1I6X A;  2R06 1;  4IV3 B;  1UZW A;  5I93 A;  2HWB 3;  3CJI B;  3AFK A;  2WZR 2;  3OY8 B;  1NLR A;  3LEI A;  1V6J A;  3LPG A;  4YW4 A;  3NWK A;  3FMG A;  1H8T A;  4FTE A;  2XL9 A;  2OYZ A;  3WDV A;  1HKD A;  2JE7 A;  2P34 A;  2VNO A;  1DFQ A;  2NYY A;  4AE2 A;  1D4M 3;  2WYS A;  1AYN 2;  4OI2 A;  2WS9 2;  5A32 B;  5AVP A;  4B7E A;  1QMJ A;  4ARX A;  3ECQ A;  2P5B A;  4NHY A;  3UKT A;  3BU7 A;  2RHP A;  4HG6 B;  4HK8 A;  1OFN A;  4HT1 T;  4AGR A;  1CZS A;  1C3H A;  3ZYR A;  3AKT A;  1DCS A;  3J7H A;  1VMH A;  4AVV A;  2HYX A;  3B94 A;  4LT5 A;  3W21 A;  2JX9 A;  4L2N A;  2X09 A;  2R04 2;  3QAC A;  4E2Q A;  4FPK A;  2ADE A;  1OLQ A;  4M4P A;  3MW3 A;  4CZS A;  2GP5 A;  2GDF A;  4H7M A;  3GJA A;  3GBF A;  1LHN A;  1W6Q A;  3R4D B;  3ZSM A;  4A7K A;  1X8M A;  2UY9 A;  3R6S A;  1GWK A;  4LLF A;  4KNC A;  3ZFF B;  1XBF A;  2BW8 A;  4CRQ A;  1XQN A;  1HB4 A;  1GP4 A;  1GOG A;  1HB1 A;  2JDP A;  4UBH A;  3VBU B;  4CDX B;  1OLR A;  2A6X A;  1H30 A;  4BIS A;  4DOU A;  3OD0 A;  2WNU C;  1YFX A;  5ACA 3;  3P3N A;  2CHH A;  5T50 A;  4HET A;  3BIE A;  3OGV A;  3S57 A;  3BB6 A;  3OJB A;  4IE6 A;  3KB5 A;  1JN2 P;  2ARC A;  3IAQ A;  2X8K A;  4COY A;  1O59 A;  3FLP A;  1AR7 2;  3KT1 A;  4CPB D;  4AED A;  3ILR A;  4KG8 A;  1RL3 A;  3FUO A;  4QX1 A;  5LBC A;  1RUD 1;  3AL6 A;  2YU1 A;  1SLT A;  3RWK X;  5CVR A;  2MEV 3;  1UW8 A;  2DCY A;  2ZML A;  3RMY A;  5T5P A;  3TAY A;  1AYN 3;  1RUC 3;  3GCX A;  1QJX 1;  1JI6 A;  2W5F A;  2HEY F;  5A3N A;  1YQ6 A;  4KU8 A;  2VZ3 A;  3RJR A;  1WLT A;  3C3V A;  1V6O A;  2K2S A;  2LW8 A;  3OD4 A;  5A3O A;  1LU2 A;  1FOD 2;  2YV8 A;  4HFS A;  1YFW A;  5FO7 B;  2FHR A;  2HWC 1;  1N3Q A;  4ZZ5 A;  4J1W A;  2CL2 A;  5FY9 A;  2BBV A;  5BUV A;  5CKN A;  1RVF 3;  3BI3 A;  2BPA 2;  3P1I A;  2WII B;  3G7D A;  4UAP A;  2H0V A;  4KWK A;  1OKO A;  1EAH 3;  1HW5 A;  2TBV A;  4LHS A;  4IDZ A;  4MGK E;  4YSF A;  1OUR A;  5H9S A;  3URF A;  1TMF 1;  3T0B A;  2V72 A;  2HWC 2;  3GZT B;  4NE9 A;  4QDR A;  4MGQ A;  5LCW L;  2JWP A;  4FXK B;  1HB2 A;  1HN0 A;  4QQ2 A;  2D5H A;  3HNY M;  1HRI 1;  2E6V A;  1LHW A;  2HH9 A;  2RR1 3;  4XAE A;  5G05 L;  1JYN A;  1LGB A;  2PHD A;  1TNR A;  2C4X A;  3ALQ A;  4FVV A;  4NPL A;  2AC1 A;  4XET A;  4XIL A;  2PFW A;  2W87 A;  3FHI B;  2Y64 A;  1O3Q A;  1AR6 2;  4P9Y A;  1F35 A;  4UOJ A;  4HVO A;  4XE9 A;  3VBS C;  4UFJ A;  4CCN A;  1CAV B;  3E1F 1;  4QXB A;  1QF3 A;  1V6M A;  1AXK A;  2BER A;  5FAX A;  5IUQ A;  1JZ7 A;  3K46 A;  2FDF A;  3CLP A;  1NCR A;  2ZKN A;  1AR9 1;  5FZM A;  4NIG A;  1RMU 1;  5LEJ A;  4DQA A;  1VBB 3;  2JDH A;  4A41 A;  4YG0 A;  1PO1 1;  4AGV A;  4URA A;  4HKO A;  1NUK A;  1U12 A;  3PHM A;  3CBN A;  4DUV A;  4GKY A;  2VR4 A;  5LZ6 A;  4FCA A;  3D0S A;  4HOO A;  4FPE A;  3TEY A;  4IE0 A;  3ETP A;  4LBK A;  3KLS A;  3WNN A;  1MVE A;  2W94 A;  3I59 A;  4W50 A;  1AZD A;  4GB3 1;  4B1M A;  2HWF 1;  2AEZ A;  1XYP A;  2YGM A;  1L7Q A;  3E5U A;  1RYY A;  4HMZ A;  4XHX A;  3ZXG A;  5FP9 A;  3ZN5 A;  4AF9 A;  2JIG A;  1E5S A;  3WP4 A;  1WD4 A;  3B7M A;  1WMF A;  1EPZ A;  3IT8 A;  4E4Z A;  5AFE A;  4FT8 A;  3KWV A;  4C0B A;  2XUM A;  3C7G A;  1QKQ A;  1RXF A;  1OLM A;  2EIG A;  2X10 A;  5FPZ A;  1JYX A;  5A32 A;  1IS6 A;  1POV 3;  1E5I A;  2Y6F A;  2L9L A;  3AP7 A;  4XF1 A;  1O8S A;  4BCU A;  2QVS B;  1SLL A;  5FYB A;  4QU2 A;  4NRO A;  1ENQ A;  1QOS A;  1N1Y A;  3O5S A;  3GHM A;  2D97 A;  4GH4 B;  1JZ6 A;  3N9Q A;  4HXC A;  3ETQ A;  5LW9 A;  4Y1X A;  3WDT A;  1VBB 1;  4DUX A;  1DDL A;  1QOO A;  1GNZ A;  4P9J A;  4BK5 A;  1BZW A;  3CQO A;  2ZGL A;  2P6H A;  4CU9 A;  1W6O A;  4QHZ A;  3MI8 A;  3LA3 A;  3A22 A;  5CBL A;  1O5U A;  5FKB A;  1Z0H A;  5LAS A;  1WKY A;  2BBA A;  2A3W A;  2W1W A;  3LQC A;  2WC2 A;  3VBR A;  1UZY A;  1ZZ9 A;  3UYJ A;  4HKL A;  4EQV A;  4UW4 A;  3E5Q A;  3W5M A;  2ZGT A;  1CD3 G;  3PUQ A;  4PT6 A;  4QM9 A;  3ZPO A;  4WM8 C;  4O61 A;  3LDR A;  1YI9 A;  1NY7 1;  5KHH A;  2ZEW A;  3I2G A;  1RUG 1;  4XVH A;  2OPW A;  1DGR A;  3U0Z A;  3B9I A;  1AF9 A;  1FMD 1;  3ABZ A;  1RGS A;  3SCH A;  1AX1 A;  2GAL A;  1ZZC A;  3AJY A;  4K40 A;  1HXS 2;  5HV0 A;  1TMF 3;  4M3C F;  4EN8 B;  1SBF A;  2EXH A;  4M3C A;  4QWN A;  5IW0 A;  4XZU G;  5FZ3 A;  3RRD A;  3SIS A;  4DO0 A;  1QEX A;  4XC9 A;  3M3I A;  4NWV A;  4D8M A;  1OXC A;  4V1P A;  2UWB A;  5FP3 A;  4D6Q A;  1SPP A;  3VDA A;  4BH9 A;  1SFN A;  5LA0 A;  4A2U A;  1STM A;  1NZI A;  4K1Y A;  5C3Q A;  3T3Y A;  3AK0 A;  1NG0 A;  3B5L B;  3FE5 A;  3NNL A;  3FLT A;  3N9N A;  2D6N A;  1MZF A;  4FP3 A;  1ULO A;  1ZVF A;  2JDY A;  4Q4W 1;  4S2G A;  4CP2 A;  2WAA A;  1GZW A;  3ACH A;  5HPO A;  3TEX A;  3I2O A;  2D40 A;  2GC2 A;  4OHZ A;  3VKF C;  5LBF A;  5ERL A;  4CDU A;  4XTM A;  2K0G A;  3W20 A;  2XML A;  5DUW A;  1HRV 3;  1DQ6 A;  3RSJ A;  1EV1 1;  1FPN 1;  3FFQ A;  2VGD A;  2CGO A;  5DDJ 3;  4FOY A;  3ZFE C;  4LBL A;  3HD8 B;  1MZ6 A;  2A5Z A;  1JU3 A;  2RMU 2;  3B00 A;  4XBL A;  4DB5 A;  3CKH A;  4XFI A;  1OF4 A;  2B39 A;  2Q1Z B;  1KS4 A;  1YQC A;  1E57 A;  3I3D A;  3FL7 A;  1CAX B;  2YC4 A;  4HK9 A;  4IER A;  5FZA A;  5IYY A;  2KD7 A;  1W6Q B;  4XXP A;  5LBE A;  4AI1 A;  3LEK A;  5BXX A;  5I8Y A;  4GIQ A;  2XBO 3;  1G9B A;  3IB3 A;  4MXW B;  4OUM A;  1ND3 C;  3R05 A;  4LKD A;  4S2F A;  4HSL A;  2WBK A;  2WFF 2;  1ST8 A;  1UNB A;  3I59 B;  1XE8 A;  4S2D A;  1ZRC A;  1W3V A;  1H2L A;  1YCI A;  3T2O A;  2IXJ A;  3KT4 A;  4LTA A;  3GGL A;  1W8T A;  4B8E A;  1JMU B;  3AVS A;  3ZDS A;  4ARY A;  3NQH A;  3W9A A;  3E6B A;  3LFI A;  1HJG A;  2OS2 A;  1R1A 2;  1UU5 A;  3HQX A;  1A6C A;  4N90 A;  4BOW A;  2VUL A;  5GLT A;  3THC A;  5T55 A;  4AXO A;  5ACA 2;  4Q29 A;  5J7M A;  5LRR A;  4UWD A;  4OVE A;  2HWE 2;  1Y7B A;  3USU A;  4HPK B;  3ENR A;  3HPN A;  1OD5 A;  1SQ4 A;  2ZAH A;  5A3P A;  1HRV 2;  4MHU A;  5E16 A;  1OH4 A;  1VLN A;  2B4K A;  1JZ3 A;  1PMJ X;  2Z5W A;  2ILM A;  4B4R A;  2WNV C;  3U10 A;  3VBF C;  2J1T A;  1VBE 3;  4PCR A;  3W59 A;  4I2O A;  1DZQ A;  1DLL A;  1COV 1;  1BEV 2;  2HWD 1;  1CZT A;  3KVB A;  2WNU A;  2F4L A;  1PIV 1;  2DUO A;  4CXX A;  4N7U A;  1OH3 A;  1CIW A;  1N1T A;  2JEC A;  2WT2 A;  1BJQ A;  4IES A;  3N7K A;  1DG6 A;  1VBD 1;  2WT0 A;  1T2X A;  2YBS A;  1MS5 A;  3PJY A;  1GBG A;  1H4H A;  1JOJ A;  3AZY A;  5KHI A;  1AR9 3;  1RTV A;  4FOV A;  4AFA A;  3POB A;  2WFP A;  4P00 B;  3H9A A;  1UOF A;  2EA7 A;  1HN1 A;  3NJV A;  2QQU A;  1VAL A;  5EFU A;  4ZZ8 A;  3POW A;  3NAP B;  3DF0 A;  5FV3 A;  4IEZ A;  2WL1 A;  4XIK A;  2WR9 A;  5IHR A;  5IVE A;  1ULD A;  3ATG A;  2X29 A;  5FPB A;  3WDY A;  4QPG B;  1UOG A;  2XBO 1;  5IFP A;  1NCR B;  4ZU7 A;  1DQ0 A;  2RS3 2;  5LK7 B;  2BDR A;  5JLV A;  2ZGR A;  2RS5 3;  2E7A A;  3GNE A;  3PMS A;  4ZHN A;  4HSJ A;  3O14 A;  5K7P A;  4LBQ A;  1C8M 2;  2JDU A;  5FYZ A;  5DZF A;  4A7Y A;  4LO6 B;  4YM0 A;  5F3C A;  4YVW A;  2SLI A;  5J09 A;  4RHV 2;  4AAP A;  3SEE A;  4NWW A;  5HCA A;  1PGS A;  2IWG B;  3PU8 A;  1JZ8 A;  4AL9 A;  1QQP 1;  2XVL A;  3P5B A;  5IVC A;  5F32 A;  2IFR A;  4NHK A;  5BNN A;  4X8P A;  4YZ1 A;  1CPM A;  5JPN B;  3KV5 A;  4AEJ A;  1K42 A;  2D44 A;  3RGB A;  3VBS A;  2DCK A;  5FMD A;  4DXR A;  1U5I A;  1V6L A;  1QH6 A;  2A70 A;  5CFD B;  4ZU4 A;  3POF A;  1UZV A;  1C28 A;  1V6I A;  4FI9 A;  2K46 A;  4MXW A;  4YGC A;  5F2W A;  2YHJ A;  3UK9 A;  4CEY B;  3O7O A;  4A6S A;  1JXN A;  4LBM A;  5EXO A;  3AZW A;  5F3I A;  3IKW A;  2LUW A;  1DBN A;  2VZS A;  5DQ0 A;  1F5F A;  4XFF A;  2YFU A;  3WQB A;  1SG3 A;  1PK6 A;  1W9T A;  4QKF A;  5C71 A;  5CEH A;  1W9Y A;  1Q56 A;  2B46 X;  5BV6 A;  2YRO A;  3O0W A;  4XF4 A;  3DPR A;  2RDN A;  3ZMO A;  3M7A A;  1S55 A;  1W8O A;  3J4U H;  1JYC A;  3ZFG C;  4C1W A;  2RDS A;  3ZR6 A;  3NMB A;  3RJ2 X;  5JR2 A;  1E5H A;  5FZG A;  1H1A A;  2R49 A;  2QQN A;  5DG2 A;  2ZEX A;  5DMY A;  3WX5 A;  4AFC A;  3MIB A;  1GLH A;  5JXH A;  5KC5 A;  5FRE A;  1PO1 2;  4XW3 A;  2F17 A;  4XUP A;  4IUG A;  1RMU 2;  3VD7 A;  4W6W A;  2VOV A;  2RS1 1;  3LSE A;  2J1R A;  1AR9 2;  5H9R A;  1DYK A;  2RM2 2;  4GMP 1;  3ZKU A;  2RJL A;  3UKV A;  2YY1 A;  4A6O A;  3FHA A;  2VOK A;  3JD7 1;  5FLJ A;  1Q43 A;  1VB4 A;  3VBF B;  4R9C A;  2WUH A;  3ZLI A;  2SBA A;  1A34 A;  2WWU A;  3NJY A;  4G3Y C;  4YW3 A;  3HBZ A;  2PHU A;  5FZO B;  1Q5O A;  3BTX A;  4H7L A;  4L97 A;  2FQP A;  1JUH A;  1H6X A;  2VZP A;  2QTW B;  4FPO B;  3DCQ A;  2OKX A;  5L7O A;  1W2N A;  2QCS B;  4GAZ A;  4ASM B;  5K4L A;  2HWF 3;  3K51 A;  5D1I A;  1OA3 A;  4UFL A;  4A45 A;  5LY1 A;  1AL2 3;  4PJY A;  4D7S A;  2PHT A;  4Q4Y 1;  1C4R A;  4LHK A;  2YUE A;  4W4Z A;  3DEM A;  2XH6 A;  3K48 A;  3VV1 A;  3UET A;  1B35 A;  2VO5 A;  3M3E A;  4RD7 A;  2E26 A;  5A1F A;  2ZAC A;  2VMD A;  4LO5 B;  1F31 A;  1HV0 A;  1OSG A;  1GQH A;  3T30 A;  1MS1 A;  3C7O A;  4RS5 C;  1JYT A;  2XDV A;  1ENR A;  3GZE A;  3OBR A;  1RUF 1;  2FCT A;  5CNA A;  2VY0 A;  1JH5 A;  1F4H A;  5A7W B;  1QXJ A;  3BYW A;  3RZK A;  5A7Q A;  4P14 A;  4KGQ A;  1HXS 3;  2ZGM A;  1MS3 A;  3OGR A;  5FZ1 A;  2OPK A;  4UF0 A;  3RZJ A;  3T2P A;  2VBP A;  4IW3 A;  3FN9 A;  4YVS B;  4EWE A;  3QLQ A;  1G9D A;  3SH5 A;  4IEO A;  2XKO A;  1O6U A;  2NZ9 A;  2YFZ A;  5GAL A;  2O8O A;  1GZC A;  1J59 A;  1WGP A;  3A7Q A;  3ZO0 B;  2J1U A;  2RR1 1;  3LZZ A;  5LA1 A;  2VEC A;  2Y0I A;  3O12 A;  2YC2 A;  5K9Y A;  4RQP A;  3ZFE A;  2WFF 3;  3J7L A;  2W0X A;  3O1M A;  4AOC A;  3AL5 A;  2CYF A;  5L19 A;  2R32 A;  4P9X A;  2G1M A;  2FD8 A;  4RR3 C;  1CAW A;  4NAO A;  4JKM A;  5A3T A;  2BV4 A;  3BIW E;  5A3W A;  1GIC A;  1RB8 G;  3OGJ A;  1OBN A;  1ZZ7 A;  4EJR A;  5DUX A;  3MIH A;  2UY8 A;  3WD5 A;  1QJX 3;  1ND3 A;  2E9Q A;  4H14 A;  3BGA A;  3WLU A;  1CN1 A;  1PZ8 A;  2D3S A;  2VQT A;  2XQR A;  2EXI A;  3FBM A;  4CCD A;  1CWP A;  5FP7 A;  4E27 A;  2A71 A;  5KBF A;  2ZGS A;  3POY A;  5C8C B;  1WMX A;  4QXC A;  2PAK A;  2VTX J;  1I3H A;  3DYO A;  4GH4 C;  3HQR A;  5CFD A;  1D7P M;  3S0M A;  1K5J A;  1PVX A;  2UWA A;  2WZ8 A;  3WP3 A;  1BEV 3;  4QKD A;  1BYH A;  3ZFG B;  5F3G A;  2JIC A;  3M70 A;  4JGY A;  4XBN A;  3I49 A;  2C0Z A;  5EIY B;  1W2U A;  3HWJ A;  2XJU A;  4BZ4 A;  4A7Z A;  4Z2W A;  5ABJ B;  2WZR 1;  1UY3 A;  4TTG A;  4D69 A;  4QM8 A;  1RC6 A;  4LKE A;  3LFM A;  1HQW A;  4RN5 A;  4XCB A;  4YNI A;  2Z2S B;  2WNV A;  3VDD B;  3VBF A;  1JW6 A;  3LF7 A;  4SBV A;  4O7X A;  4UW6 A;  1XNK A;  4QB1 A;  1BHG A;  4YGE A;  4AVS A;  2RJK A;  3LIG A;  4R9D A;  1UZZ A;  1A78 A;  5D8A B;  1SMV A;  5C3R A;  3T4V A;  3OCP A;  2Y6L A;  4Q4Y 3;  2QKD A;  2Q8O A;  1UKG A;  5FYM A;  4AVT A;  2QZ3 A;  5FP8 A;  4B29 A;  2PLV 3;  3A0N A;  3PVO A;  4CCK A;  1S2E A;  4CEW A;  2AYH A;  4UW5 A;  4M4R A;  4YGD A;  2D43 A;  3RZG A;  3RNS A;  2FDI A;  4LA2 A;  5FWE A;  1ND2 A;  1UF2 C;  4URT A;  4WM7 C;  5FMO S;  3ZYB A;  1PX4 A;  3Q8B A;  5DAX A;  3ZN6 B;  4P02 B;  3E5X A;  3WR0 A;  2VZO A;  3O0V A;  1ASJ 1;  3BTA A;  2VVF A;  1DYP A;  2BFU S;  3M3Q A;  1RUJ 3;  4AVC A;  5FJH A;  3I3Q A;  1AR8 2;  2H6C A;  3OUI A;  1VBC 2;  3POI A;  4CE8 A;  3M4F A;  2BVV A;  5JI7 A;  1WD3 A;  4OUL A;  3J7N A;  3MID A;  4B4Q A;  3HJR A;  2R07 2;  5L73 A;  1SLA A;  2BP6 A;  4RHV 1;  5FR3 A;  2YG0 A;  3CZU A;  1UMZ A;  4BMB A;  4UFI A;  3NV3 A;  5FIX A;  4PQ9 A;  1U5Y A;  1C8M 1;  1CJD A;  4R52 A;  4TZD A;  4JGY B;  3VDC A;  3C7E A;  4ORF A;  1UZ0 A;  3B69 A;  2H6B A;  4EZ4 A;  4BWO A;  3F2Z A;  4FO9 A;  3WSO A;  3AP6 A;  4YFW A;  4G4F A;  2RS3 1;  4W6Y A;  3ZSL A;  4GMP 3;  4YZ2 A;  1DQ2 A;  4NOT A;  4WVW A;  2W47 A;  4BE3 A;  5F5C A;  2PMW B;  3N3H A;  5L9B A;  5T5J A;  1YFU A;  4IV1 C;  1LTE A;  5BNN C;  2WZE A;  4MUV A;  1QNW A;  2WZR 3;  3KMH A;  4NIA A;  5AFB A;  3BKZ A;  5FY4 A;  1C5I A;  4Y5S A;  5FMO L;  1GOF A;  2P4E A;  4SLI A;  1PO2 1;  5FBZ A;  1ZA7 A;  2BJS A;  5FZ4 A;  3S5Q A;  3WG1 A;  2XKP A;  3WNO A;  4ES9 A;  1YJL A;  1WW5 A;  3V56 A;  5F3E A;  2VQA A;  1D0H A;  1JZ4 A;  3N7M A;  4P5H A;  3B3Q E;  4QX8 A;  1DZR A;  3MBW A;  2EIB A;  2PLV 1;  4AQ2 A;  5CIS A;  1UPI A;  3LB9 A;  1YI7 A;  3WY6 A;  4QDS A;  3N7L A;  5FPA A;  1XNC A;  3OYW B;  1VBD 2;  2B9V A;  4IQP A;  2FBE A;  3LIH A;  5I8T A;  1APN A;  4DUW A;  1HDK A;  2VL4 A;  3F95 A;  3RWN A;  3T4H B;  2J1A A;  5FLI A;  2B9U A;  3DPR C;  4M0H A;  1J1L A;  2XQX A;  4OHY A;  3AXD A;  2EAK A;  1POQ A;  5FYY A;  3WP6 A;  3M3O A;  1SLB A;  3THD A;  2WO3 A;  4UT5 A;  5LBB A;  4QPW A;  3AMQ A;  1QJF A;  4CDW A;  2J1E A;  2Q8D A;  3WP5 A;  5JDB A;  2FMD A;  4R8H A;  3J7M A;  4FOQ A;  4N43 B;  4ZPI A;  5A33 A;  1D4M 2;  3CJI A;  1DQ5 A;  3KD4 A;  1SCS A;  1GMM A;  4LBQ D;  4MYE A;  4XFB A;  3VB9 A;  2WLP A;  3AMM A;  3WF1 A;  1D2Q A;  3B93 A;  1PNG A;  2EVX A;  1KIT A;  4CCC A;  3WT3 A;  4Q2F A;  2CDO A;  1BBT 1;  3PUR A;  5F2S A;  3VBU A;  1FNZ A;  5FPX A;  2ZEZ A;  1PHM A;  1OVS A;  5FXW A;  5KXD A;  3VZO A;  5A7W A;  3LSD A;  5EJZ B;  4NJ4 A;  4LK6 A;  4JDM A;  4XAC A;  4D6S A;  3RQ0 A;  2AUY A;  2WFF 1;  5L7O C;  2ADD A;  3TBD A;  1UKR A;  2DVD A;  3RZM A;  5DAB A;  4KU7 A;  4NRQ A;  2RG4 A;  5J48 A;  1PO2 2;  1W0O A;  2P3K A;  3H0O A;  1RHI 3;  4LIV A;  1I5P A;  4O65 A;  2VCM A;  3JU9 A;  4FPG A;  2X05 A;  3SXW A;  5JIU A;  2XHN A;  3J8F 1;  5A1A A;  4EWA A;  1B35 C;  4CEW B;  1O3T A;  1RIR A;  3RVH A;  4KL1 A;  3N9L A;  3OGG A;  4QQP A;  2P3I A;  4B7K A;  4I02 A;  3AP9 A;  2VNV A;  4KWU A;  3EHK A;  4LOR A;  5JZG A;  4IEW A;  1DGW X;  2W08 A;  3K3O A;  4RS5 A;  3GJB A;  4YFZ A;  1V6K A;  3EO6 A;  2C5D A;  1OOP C;  2ARA A;  1VBE 2;  2O0O A;  1RUJ 2;  2HWB 1;  5EQU A;  3ACI A;  2VCA A;  3SKV A;  4JKL A;  4YG3 A;  3W58 A;  1JS9 A;  3AFG A;  2CNA A;  3WG4 A;  1Z7S 1;  3H50 A;  4Q4X 1;  4D6R A;  1D4M 1;  2PN5 A;  2FMY A;  4BYY A;  3DXT A;  2XOM A;  1W28 A;  4C0H A;  3CEW A;  4LQR A;  4QPG C;  3ZYG A;  4C8D A;  4ZKT B;  5IFT A;  1BQP A;  4LUK A;  4AHX A;  5HBA A;  3O1V A;  3NO8 A;  2PEL A;  2R1B A;  3AYE A;  3OUJ A;  4YM3 A;  1CR7 A;  2VZU A;  4DY5 A;  5LK5 A;  4AQS A;  1UOB A;  3GF6 A;  4CEY C;  4AHZ A;  1G9A A;  1LB2 A;  4XF3 A;  3ZYJ B;  4A42 A;  3ZFF A;  4RQP C;  1NA1 A;  2CU5 A;  2GC3 A;  1TG7 A;  4HON A;  1RXG A;  1S0D A;  4QX5 A;  4PIZ A;  3GBG A;  2LS6 A;  1WW6 A;  1LHO A;  3TOJ A;  3BOW A;  1GWL A;  3G6J B;  2WIN B;  1CJP A;  3PTY A;  5I91 A;  1I9R A;  5F5I A;  4I30 A;  4TLF A;  5JMC A;  4QHB A;  3JQX A;  1OA4 A;  1U0A A;  4W8J A;  1LOB A;  1YYN A;  2CY6 A;  3WW1 A;  3I3B A;  3OF1 A;  1OC1 A;  1NA1 B;  4V2V A;  5FZD A;  3IAP A;  1GP5 A;  3PJQ A;  2ARX A;  4MG2 A;  1DGW A;  4C91 A;  1DF0 A;  1Z78 A;  4DEQ A;  2X5I C;  2P17 A;  2VMI A;  2GN7 A;  1H2M A;  1REE A;  1Z7S 3;  5EZW A;  1M4W A;  2PHX A;  3KQ4 B;  3C7H A;  5A33 B;  2LRO A;  2BVB A;  4CDX C;  5T3N A;  1O3S A;  4JTN A;  4Q4V 3;  4I0W B;  4N9H A;  5CFD C;  2EAL A;  2R30 A;  4WZF A;  1ZNP A;  4AK3 A;  1S0B A;  3SCG A;  1UIK A;  1JYV A;  3WCR A;  2JD4 A;  2ZCW A;  3N7J A;  1VBB 2;  4BQ5 A;  5CYY A;  1W8N A;  4WV8 A;  5EPA A;  4E9K A;  1IHM A;  1W8U A;  2YZ4 A;  4Q1R A;  1FX5 A;  4XJW A;  2IXC A;  1H6Y A;  1O7F A;  1PGL 1;  3VZJ A;  1NOV A;  1T6B X;  1EP0 A;  2UU8 A;  3DUI A;  1NXM A;  1QY4 A;  1X50 A;  2BOJ A;  1RHI 2;  5T54 A;  4MH0 E;  3PUA A;  4OFG A;  1PVC 2;  1R09 1;  4QX0 A;  3JD7 3;  1PGW 2;  1ZRF A;  4GWI A;  1X9P A;  5KHK A;  1SDW A;  3HN3 A;  1JOP A;  1VJ2 A;  4ERO A;  4XCA A;  4YM1 A;  1S4C A;  2G9G A;  3QOP A;  2AH2 A;  1ZBA 2;  1LHU A;  1Q8P A;  2GNB A;  1QJY 1;  2HWF 2;  2W68 A;  2YC0 A;  4L92 A;  4GB3 2;  4QX3 A;  5FZI A;  4N8M A;  5AC9 2;  1OQ1 A;  3LEM A;  3FJS A;  1P8J A;  1GZT A;  1J83 A;  1GFF 2;  5FRA A;  3WNL A;  1WUV A;  3INA A;  1W6M A;  4IEQ A;  3H7J A;  1CQ9 A;  2G4I A;  1VBC 3;  4CDQ A;  5L7O B;  1XNA A;  1WMD A;  2YBK A;  3OBA A;  3E6C C;  4JX0 A;  3K3N A;  1H4G A;  4B4P A;  1ND2 C;  4QQL A;  2NN8 A;  2WQZ C;  2ZMN A;  3I2F A;  4BIF A;  1UMI A;  1PNF A;  1CVN A;  1X33 A;  2AEN A;  2ZHK A;  2HWC 3;  4LXL A;  1EV1 3;  4PLN A;  3V64 A;  2JB4 A;  3U37 A;  1PMI A;  4AHW A;  2OZ6 A;  1YJK A;  5FY1 A;  4COU A;  1QJU 1;  1O3R A;  3MIC A;  3BPZ A;  4OZO A;  3CHX A;  3O1T A;  1XB9 A;  2AAC A;  1NLS A;  2Y26 A;  1TNF A;  2OXB A;  3NJZ A;  4LHN A;  5FY0 A;  3VBS B;  1GWM A;  1WA4 A;  3QH7 A;  4PI2 A;  2EXJ A;  1UL9 A;  1W8W A;  1OHF A;  4UFH A;  1AR6 3;  1QJU 2;  4MAD A;  3UT0 A;  5JOY A;  5T52 A;  1NE4 A;  4YAR A;  5A6Q A;  1QJY 3;  1L7R A;  1QOT A;  3D4K A;  4MSV A;  1RUF 2;  5ISL A;  5GM0 A;  3JQW A;  5GZC A;  2JG9 B;  2LTN A;  1AYM 3;  2XLG A;  2WO7 A;  4QT6 A;  1TMF 2;  4CU8 A;  4K8R B;  1GZW B;  3APB A;  5HV4 A;  3PIJ A;  2A3Y A;  3PU3 A;  3WF2 A;  4LE4 A;  3ZR5 A;  3P3P A;  2WKK A;  5A7N A;  1H2K A;  1ONA A;  4IV1 A;  5IAT A;  3AZX A;  3BTZ A;  2XLA A;  4GA9 A;  4NAM A;  5A3M A;  4E4S A;  5AC9 1;  4AED C;  4MGI E;  4BME A;  2XJR A;  3RI9 A;  3VGI A;  4EE2 A;  2RJ2 A;  2JXA A;  5C7G A;  4AEM A;  4QXH A;  1WLC A;  2BUK A;  2C9A A;  2Q5T A;  1QJX 2;  1UX6 A;  2VUA A;  4QQH A;  4D94 A;  2YYO A;  2AEY A;  5A7S A;  1CON A;  1R1Z A;  4Q8L A;  5C70 A;  5I0R A;  1AHS A;  3POJ A;  4LEJ A;  1ULF A;  4PDW C;  1RJ7 A;  3EB7 A;  1WME A;  1Q8O A;  2ZGP A;  4JAA A;  2Y6G A;  4NUB A;  4AVB A;  4D7Y A;  3NKT A;  3IPV A;  3IDE A;  3PME A;  4Q0V A;  5FYI A;  2C1F A;  1QDC A;  3T1L A;  3TWI A;  1BK1 A;  4JDO A;  1JZ2 A;  2JDM A;  4Y26 A;  3WQ7 A;  4JV4 A;  2W39 A;  4LKS A;  5FZO A;  4YLZ A;  1VBD 3;  2DU0 A;  4N43 C;  3ZXD A;  2VC9 A;  2WWJ A;  2QDN A;  1IS5 A;  1WBL A;  4XUO A;  2Y8K A;  5A7P A;  3FFZ A;  3VBH B;  4CDW C;  5FY8 A;  1IZ3 A;  1XXN A;  1C1L A;  3ACG A;  4FPJ A;  4R9B A;  1R08 1;  4XMA A;  3S30 A;  1UY0 A;  1O4Z A;  2DCJ A;  2XON A;  3BCW A;  4IEU A;  4LUL A;  4OUE A;  5GZE A;  4DPN A;  1S2K A;  4XJU A;  2ID4 A;  2P2K A;  3H1Y A;  5FOB B;  2O1Q A;  4AZZ A;  1MEC 2;  1W6P A;  4NRM A;  4IEY A;  2A1X A;  1H2N A;  2QBX A;  3GAL A;  4AWD A;  4COW A;  4RS5 B;  3VBU C;  4EN6 B;  2WSV A;  1XC6 A;  1CIY A;  4I0A A;  3VBO C;  5F6L B;  1W0N A;  3FBY A;  4JGZ B;  3RYK A;  2QQV A;  3HOB A;  5GZD A;  5BNP B;  1X82 A;  2WWS A;  3MUZ 1;  4JRL A;  1NX9 A;  2MEV 1;  1LES A;  3OBT A;  4EWD A;  4DXZ A;  3TEZ A;  4NMI A;  3GBW A;  2YU2 A;  3WHT A;  3S5A A;  2VZQ A;  4KWJ A;  2OT7 A;  4HL0 A;  3WV6 A;  4JTO A;  5AC9 3;  1OUX A;  1SFY A;  3D8C A;  4XJA A;  3VD9 A;  4IEV A;  4H3W A;  1QJY 2;  1UXX X;  2JDK A;  1S0I A;  4XJ9 A;  1QQP 3;  3MYX A;  1IOA A;  4X6Q B;  5JSR A;  4IE5 A;  2RDQ A;  4N53 C;  4XQD A;  4CA9 A;  2BTV C;  2XJV A;  4MZU A;  1K3I A;  4QGN A;  3LWC A;  1LR5 A;  1MQT B;  1R09 2;  3DKQ A;  5D8A A;  1AYM 1;  4XQW A;  4Z8B A;  3IWZ A;  2RVA A;  2HWB 2;  1NCQ B;  4NID A;  1XU2 A;  2D3R A;  4Y20 B;  1OOP A;  4PLO A;  5F6K A;  3ZDV A;  2W3J A;  3OY8 A;  4XAB A;  1IPS A;  1F9K A;  3H7Y A;  1F8V A;  1Y9Q A;  1Y4W A;  5C33 A;  5M0T A;  5A6Y A;  1J84 A;  3AKP A;  4BXF A;  1OUS A;  1ZBE 2;  4BXS V;  1JYW A;  1CX4 A;  1V6N A;  3JB8 A;  5F5A A;  4U36 A;  1GOH A;  2VCB A;  2R0H A;  2O8Q A;  3X29 B;  2VVE A;  1W2O A;  5JAX A;  1WCD J;  1OQE A;  1FPN 3;  3ACF A;  2E32 A;  4I0B A;  1GUI A;  4QPG A;  3WW3 A;  5JUV A;  1YFY A;  4BIO A;  2E53 A;  2VOW A;  1ZRE A;  4A4A A;  1BLZ A;  5C8C C;  1ND3 B;  2OZJ A;  4IV3 C;  1U5Z A;  2ZGU A;  2ZMK A;  3N9O A;  3NAP A;  3ORJ A;  5G04 L;  2Y0O A;  4AVA A;  3ZFF C;  2WS9 3;  1NA1 C;  1KXG A;  2PQS A;  2VZT A;  5LA2 A;  4A44 A;  4CU7 A;  4YGB A;  4OYU A;  1LED A;  3GCW A;  1F4A A;  3EYP A;  3RI8 A;  2DVG A;  2C26 A;  4WM8 A;  4Q5O A;  1EUU A;  2ZGO A;  1UPS A;  5E89 A;  2ERF A;  4XBQ A;  3WQ1 A;  3ZXA C;  2R7E B;  2XXZ A;  3OG2 A;  3B9C A;  5BPX A;  2BNO A;  2R07 3;  5J96 B;  1ENS A;  1AXZ A;  4LOS A;  5JI9 A;  1AUY A;  3ASI A;  2JDZ A;  4OMD A;  3HBK A;  5FLH A;  3VBH A;  4RFR B;  2X5I A;  4K21 A;  2MPF A;  2N7G A;  4O9E A;  4Q0P A;  5JWP A;  4PF5 A;  2W1S A;  1UY1 A;  5K0U C;  1GYK A;  1ULE A;  3VDB A;  4CDX A;  1UAI A;  3ZM8 A;  5IVF A;  2Q0A A;  4AG4 A;  3I2H A;  5I0U A;  1SHW B;  4IEX A;  4RGG A;  1LOF A;  1PO1 3;  2JG8 B;  3WF0 A;  1XSQ A;  3VD4 A;  2ZEY A;  3VZN A;  2G9Z A;  3WDX A;  2A6Z A;  1SDD B;  2QQJ A;  4LMF A;  1Z7S 2;  4MGS A;  3IPV B;  4HZF A;  1N47 A;  3H8X A;  1QNY A;  5LB6 A;  3HN1 A;  2W1U A;  1D0G A;  5AVA A;  3MEP A;  4P9G A;  3WUD A;  4BK4 A;  5FXX A;  3N4M A;  1XOY A;  3CF6 E;  1VBE 1;  2ZS6 B;  3MLJ A;  2ENR A;  1U5X A;  4CDU C;  4RGK A;  3WW2 A;  4CU6 A;  3K4A A;  4HVR A;  3FLR A;  2KR2 A;  1SLC A;  3EMR A;  4JRA A;  1R64 A;  4GWJ A;  1OPO A;  4RSU A;  2J42 A;  4NHM A;  1N3P A;  1KS5 A;  1AJK A;  2I07 B;  2VMF A;  3OYW A;  2QDR A;  4CUC A;  4IGQ A;  5CG8 A;  1WW7 A;  4MGT A;  1JHJ A;  1BMV 2;  4QMA A;  3ZSE A;  1VBA 2;  1W6N B;  4BLI A;  2GND A;  2D5F A;  5FZC A;  4AFM A;  4AR2 A;  4AEK A;  5DAW A;  3JB4 C;  4NN0 A;  1WLD A;  3HAG A;  1ZBE 1;  4KI5 M;  3ZKY A;  4CDQ C;  4LKF A;  3QD6 A;  4QGL A;  4JZR A;  4COV A;  5F7U A;  2RM2 3;  2E31 A;  4YZ4 A;  3ST7 A;  4JGZ A;  3L9J T;  2IVJ A;  1H0B A;  4GB3 3;  4PBO A;  5IK7 A;  3PDQ A;  3QBQ A;  2E7Q A;  2CV6 A;  3K4D A;  1VP6 A;  3WQ0 A;  3ILF A;  1J1T A;  1V9U 3;  2OUH A;  3J8F 3;  3VHN A;  1JU4 A;  4G9S B;  3FZ3 A;  2A6W A;  3AKQ A;  3SIT A;  1S1A A;  3U07 A;  4Y1Y A;  1AYM 2;  3R0R A;  3IMN A;  4LBQ B;  1US2 A;  2ORX A;  1YQ5 A;  1YEW A;  2GMP A;  2PA7 A;  4H55 A;  2R07 1;  2G19 A;  2DUQ A;  2P1B A;  4AI0 A;  1HQL A;  1BEV 1;  2HWD 2;  3H1M A;  4FAH A;  4W6X A;  3VN4 A;  4Q26 A;  3VD5 A;  2GU9 A;  2Z42 A;  3CL1 A;  3BPS A;  3WF3 A;  4Q27 A;  3KCY A;  3NNM A;  5HI0 A;  1HRV 1;  1W39 A;  2YMZ A;  5L9V A;  4YVS A;  5IVJ A;  4BQW A;  5EYY A;  2QQW A;  5GJ6 A;  3GHN A;  3KZ4 C;  1IQA A;  2VXJ A;  3WW4 A;  3IDB B;  1DGL A;  1BCX A;  4XUT A;  2XVK A;  2Q8C A;  2ZGN A;  3HQU A;  4M0N A;  4MGY E;  4UYB A;  1IQD C;  5FMB A;  2DYC A;  5C5T A;  2JDN A;  2DV9 A;  2PHW A;  1WWY A;  2ZKL A;  1L7L A;  2A75 A;  4AFD A;  2VW2 A;  3O1P A;  2V4V A;  3ZFE B;  4X6R B;  1OF3 A;  2V09 A;  2ZX1 A;  3ZXF A;  4E2S A;  5GLW A;  1G6N A;  3NNG A;  2WAB A;  3P6B A;  1NKG A;  1FAT A;  4CUA A;  1IPK A;  3AMH A;  3DYP A;  1O4T A;  3U14 A;  5CKQ A;  1CAW B;  1Q8Q A;  2GH2 A;  2VXR A;  2DU1 A;  2VUJ A;  4QXK A;  3PNA A;  5LRS A;  3D0J A;  5A6Z A;  5IK8 A;  3ZPY A;  3SQO A;  2O14 A;  3KCX A;  4CUB A;  2RE9 A;  5JCT A;  4QPI B;  3K2O A;  1ZRI A;  2VMG A;  4ITC A;  1WZX A;  3GZU C;  2RMU 1;  3UV9 A;  4I3P A;  3MW4 A;  4XPV A;  3FWE A;  4EYU A;  1PO2 3;  4DXT A;  3B02 A;  4C90 A;  4N43 A;  4LBN A;  4QKB A;  3VD3 A;  3MW2 A;  3VL8 A;  1HJF A;  4MLO A;  1H8V A;  4ASK A;  1MAC A;  4XJZ A;  2A3X A;  1JHN A;  1UD1 A;  5JZG B;  4QDQ A;  1WLW A;  2RS3 3;  3QCW A;  1NQD A;  2P3J A;  3V0A B;  1PK6 B;  2ZBJ A;  3AMP A;  5A6X A;  1PX3 A;  4GAL A;  1F15 A;  1KFX L;  5FPV A;  3BUC A;  3TN9 2;  1FNY A;  4M3C B;  4R4Z A;  4CTE A;  5HXM A;  3KHC A;  3AB0 A;  3RFR A;  2MNG A;  3EQE A;  1LU1 A;  5FZK A;  2GSY A;  1DQ1 A;  5DXD A;  4WM8 B; 
#chains in the Genus database with same CATH homology
 4D8M A;  3VDA A;  2XHN A;  5A1A A;  5LA0 A;  3UES A;  2JKX A;  4KWU A;  4ZXE A;  3T2Q A;  1ULO A;  5HPO A;  2WAA A;  3ACH A;  3ACI A;  2VCA A;  3SKV A;  4YPJ A;  4JKL A;  2QQK A;  4E8C A;  1JU3 A;  2XOM A;  4LQR A;  5IFT A;  3CKH A;  1OF4 A;  3T08 A;  3I3D A;  4AAX A;  1W99 A;  4UI9 L;  3FL7 A;  2VZU A;  2YC4 A;  4JKK A;  5EJ1 B;  1WCQ A;  5IYY A;  2KD7 A;  3LEK A;  4A42 A;  4PQQ A;  3I2K A;  1TG7 A;  1W9W A;  3IB3 A;  2VOT A;  2LS6 A;  2ZXQ A;  5JMO A;  3GM8 A;  2WBK A;  4OMC A;  3HNB M;  5J1X A;  2W95 A;  3WNK A;  4W8J A;  3T2O A;  3CIH A;  3I3B A;  2J1S A;  3GGL A;  3IAP A;  1TVG A;  4ARY A;  3NQH A;  3CZJ A;  3HEI A;  1PMH X;  4DEQ A;  3THC A;  5I0D A;  3C7H A;  3T0A A;  2W92 A;  2Y6K A;  3HPN A;  2DDU A;  2JE8 A;  1OH4 A;  2B4K A;  1JZ3 A;  1JYV A;  1PMJ X;  5CYY A;  2J1T A;  1W8N A;  3MV0 1;  4RYD A;  1CZT A;  3I3E A;  3C7F A;  1H6Y A;  1O8P A;  4DEV A;  4BJ0 A;  3I2I A;  2VZR A;  4BDV B;  4QX0 A;  2WN2 A;  4GWI A;  1T2X A;  3HN3 A;  4XUN A;  4L0P A;  1CZV A;  4QX3 A;  4P00 B;  1UYZ A;  5DN2 A;  1DP0 A;  1HN1 A;  3NJV A;  1P8J A;  1OT5 A;  1J83 A;  4GZ9 A;  3WNL A;  4ZZ8 A;  3SEP A;  3OEB A;  3OGS A;  2QQL A;  2VTF A;  4MO3 M;  5IHR A;  3SKJ E;  1XNA A;  3OBA A;  4JX0 A;  4TXW A;  2JD9 A;  3I2F A;  5IFP A;  1UMI A;  2EIC A;  3U37 A;  3LE0 A;  3MO4 A;  4QB2 A;  2ORZ A;  3IDA A;  2VCC A;  3DEC A;  2W91 A;  4OZO A;  2Z4F A;  3SEE A;  2VJX A;  1UY4 A;  1JZ8 A;  4PF1 A;  4MAD A;  4ET7 A;  2E33 A;  1L7R A;  2Y6J A;  3WNM A;  1K42 A;  2VZV A;  2DCK A;  4CU8 A;  4DXR A;  1US3 A;  2CDP A;  3WF2 A;  2VM9 A;  1ULP A;  3K75 B;  3NRU A;  2VZ1 A;  1UWW A;  5IJR A;  2J1V A;  3C8X A;  4FI9 A;  2VME A;  1K45 A;  2VQU A;  2BGP A;  1DYO A;  2VZS A;  2RJ2 A;  3A23 A;  3JXS A;  5DQ0 A;  5C7G A;  3FHQ A;  2YFU A;  3WQB A;  1SG3 A;  1W9T A;  5C71 A;  3AC0 A;  4P5Y A;  4E8D A;  1W8O A;  5C70 A;  2EID A;  1UYX A;  3EB7 A;  2W1Q A;  3HNM A;  5JR2 A;  2Y6G A;  3LEG A;  3T0D A;  2QQN A;  4MOA A;  2ZEX A;  5DMY A;  5JXH A;  1JZ2 A;  4Z2A A;  2QQM A;  4XUP A;  4IUG A;  4LKS A;  3VD7 A;  2J1R A;  3D3A A;  3LPF A;  4LPL A;  2VC9 A;  5B4X A;  4A6O A;  1K12 A;  4A3Z A;  3FHA A;  4XUO A;  2Y8K A;  2WUH A;  3NJX A;  3ACG A;  2WAO A;  3I97 A;  3MV1 1;  1UY0 A;  2DCJ A;  2XON A;  4OUE A;  1H6X A;  2V5D A;  2VZP A;  2ID4 A;  1UYY A;  2OKX A;  2VMC A;  2QBX A;  4A45 A;  1XC6 A;  1CIY A;  1XPW A;  1W0N A;  3HOB A;  5DPN A;  3MUZ 1;  1MPX A;  4JHZ A;  4W4Z A;  1NX9 A;  5B4N A;  1DLC A;  3GDB A;  3OB8 A;  3UET A;  2VO5 A;  2E26 A;  4ZY9 A;  1UXZ A;  2VMD A;  2VZQ A;  3C7O A;  3K77 A;  1GQP A;  3I2J A;  1GNY A;  1CX1 A;  2BZD A;  3VD9 A;  3CDZ B;  1UXX X;  5FUI A;  3PUH A;  1F4H A;  2WDB A;  3OGR A;  2J22 A;  4QX2 A;  3T2P A;  1K3I A;  3FN9 A;  1KGY A;  2EIE A;  2RVA A;  2QQO A;  2JDA A;  2YFZ A;  2W3J A;  1GU3 A;  3A7Q A;  3LEI A;  3LPG A;  2J1U A;  1J84 A;  5LA1 A;  2YC2 A;  4BXS V;  1JYW A;  1GOH A;  2VCB A;  2WN3 A;  1XNT A;  3ACF A;  2E32 A;  1GUI A;  5JUV A;  2WYS A;  3GXU A;  4A4A A;  4JKM A;  4ARX A;  3ECQ A;  5G04 L;  4HG6 B;  1CZS A;  2PQS A;  2VZT A;  3J7H A;  1LNS A;  5LA2 A;  4A44 A;  4CU7 A;  4OYU A;  3BGA A;  1F4A A;  2HYX A;  3EYP A;  4CVU A;  2VQT A;  2C26 A;  2X09 A;  1JZ5 A;  1EUU A;  3UNP A;  1UX7 A;  3DYO A;  4M4P A;  2R7E B;  3OG2 A;  1D7P M;  2WZ8 A;  4OMD A;  1GOG A;  2W1S A;  4XUQ A;  1UY1 A;  5EIY B;  3VDB A;  3ZM8 A;  4QAW A;  5CZK A;  4AG4 A;  1UY3 A;  3I2H A;  3OGV A;  4TTG A;  1SHW B;  2C9K A;  3WF0 A;  4RN5 A;  3VD4 A;  3IAQ A;  2ZEY A;  1O59 A;  1SDD B;  2QQJ A;  4MGS A;  4QX1 A;  4QB1 A;  1BHG A;  5JXI A;  2W1U A;  4BK4 A;  2Y6H A;  1NAE A;  2WO1 A;  2Y6L A;  1JI6 A;  2W5F A;  4CU6 A;  2VZ3 A;  3K4A A;  2W9X A;  1R64 A;  2LW8 A;  4GWJ A;  4M4R A;  2VMF A;  4ZZ5 A;  4QB6 A;  4CUC A;  3III A;  1JHJ A;  1YQ2 A;  1PX4 A;  3P1I A;  4UAP A;  4P02 B;  1EUT A;  4LHS A;  1W9S A;  2VZO A;  3BN6 A;  3T0B A;  2V72 A;  3K4Z A;  4KI5 M;  5F7U A;  4QDR A;  4MGQ A;  5LCW L;  2E31 A;  1UMH A;  3WEZ A;  3HNY M;  2RV9 A;  3HJR A;  3K4D A;  1JU4 A;  5G05 L;  2YG0 A;  3CZU A;  1JYN A;  2C4X A;  4P08 A;  2W87 A;  1US2 A;  2ORX A;  2Y64 A;  4UOJ A;  3VDC A;  3C7E A;  1UZ0 A;  2BGO A;  3E1F 1;  3F2Z A;  2BER A;  1JZ7 A;  3K46 A;  3WSO A;  3VD5 A;  3WF3 A;  2W47 A;  4A41 A;  2WZE A;  1NUK A;  4DUV A;  2VR4 A;  1GOF A;  3DYM A;  4XUT A;  3WNO A;  3ETP A;  2YB7 A;  3WNP A;  1IQD C;  3WNN A;  2W94 A;  4W50 A;  1JZ4 A;  3A21 A;  3MBW A;  2EIB A;  1L7Q A;  1RYY A;  4QDS A;  2V4V A;  4XUR A;  1OF3 A;  2B9V A;  3OEA A;  1KEX A;  4DUW A;  3NNG A;  2VL4 A;  2WAB A;  3C7G A;  3P6B A;  1NKG A;  2X10 A;  1JYX A;  4CUA A;  1UY2 A;  3DYP A;  2J1A A;  2L9L A;  1O8S A;  3MUY 1;  2XQX A;  2WO2 A;  1JZ6 A;  3THD A;  2WO3 A;  4CUB A;  4DXS A;  4QPW A;  4DUX A;  2J1E A;  4KMQ A;  4BK5 A;  3CQO A;  4CU9 A;  4D0Q A;  3CMG A;  3A22 A;  3PUI A;  1GMM A;  4DXT A;  1WKY A;  2BBA A;  2W1W A;  3LQC A;  3WF1 A;  3VD3 A;  2CDO A;  3WF4 A;  3W5M A;  2QQI A;  4PT6 A;  2ZEZ A;  4QDQ A;  2ZEW A;  3I2G A;  3T09 A;  5JXJ A;  4XVH A;  5EJZ B;  1PX3 A;  2J7M A;  3W5N A;  1OD3 A;  5HXM A;  5JXG A;  2W46 A;  3ABZ A;  2HLE A;  1I5P A;  2WQ8 A;  4XZU G;  2X05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...