2ZFBB

Crystal structure of parrot hemoglobin (psittacula krameri) at ph 7.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
VHWSAEEKQLITGLWGKVNVAECGAEALARLLIVYPWTQRFFTSFGNLSSASAVLGNPNVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAGHFGKDFTPDCQAAWQKLVRAVAHALARKYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of parrot hemoglobin (Psittacula krameri) at pH 7.5
rcsb
molecule tags Metal binding protein
molecule keywords Hemoglobin subunit alpha
total genus 48
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2zfbB00
1MLFA 2B7HB 3VRGB 1G09A 4TYXA 3MYMA 4X0LA 1N9XA 1QPWB 3G4YA 5HU6A 1XZ2B 3NMMA 2W31A 1Y5KB 5JGGB 1J3YB 1Y01B 1A6NA 3MN0A 1YIEA 1J7SA 2DN3B 1JF4A 4NK1A 3WR1B 1HDAB 3FH9B 2SPNA 3P5QB 3DHRA 1T1NA 4MPMA 1YG5B 1Y8HA 1GVHA 1Y8WB 1MLSA 1HCOA 2GNVA 3A2GA 4F6BA 1O1OB 1YEQA 1DKEA 3S1IA 3A5GA 4U8UC 1YOIA 4XDIA 2YRSB 1BZ0A 3PI8B 5MBNA 1PMBA 2R80B 5CMVA 1CO8A 3WHMA 5KKKA 3E55A 1Y0AA 1OUTA 3S1JA 1FDHG 5EU2A 3ZJIA 3MKBB 112MA 3ZJPA 1IT3A 1CLSB 5CNBA 3NFEA 1YGFA 4LPIA 6HBWB 2W6VB 1Y31B 1B86B 4F68A 1IT2A 1VXGA 3ONZB 1Y85A 2G10A 1Y4GA 1Y0CB 3MJPB 1GZXB 1ABSA 1HDAA 3GKTA 4ROMA 1J7WA 1NQPB 2H35B 5EOHA 5CNGA 1ABYB 2LH2A 3QMAA 1LFQB 1T1NB 1UIWA 1YG5A 4PQ6A 1O1IB 1F65A 3HYUA 2D2MA 4N7PB 4N8TA 1Y0DB 1YDZA 3UHNA 5JOMA 5CHQA 4O4TA 2MYEA 4ZVBA 1FN3A 5JGGA 4C44A 1J3YA 1HDSB 1DXTA 1LFLA 1LTWA 2QLSA 4L7YA 5MBAA 1OBMA 3GQPB 2HBFB 2OH9A 4MU5A 2SPOA 1V4UA 2QFNA 1YVQA 2AV0A 1ABWB 1V4WB 2XKHA 3D4XA 4SDHA 2ZT1A 1O1MB 3PT8A 2NRMA 1MGNA 1S69A 3GK9A 1MLKA 1N9HA 1RQAA 2HHBA 1YENB 1NXFA 3GQRB 1XZ7A 2QSPA 2WTGA 1OFKA 4MQIA 3ECLA 1Y83B 3UBCA 3HF4A 2ZS1B 1HGCA 5B84A 5B85A 1URVA 2QU0A 2W6YA 1HV4B 1MWBA 2HZ3A 2EVKA 1CH7A 1EBTA 3PI3A 5E29A 1H1XA 3EU1A 2H8FB 1HBAA 3AT6A 3PI1A 1B0BA 1LFZA 4N7OB 1MYZA 1VXEA 1JF3A 5CN9A 1DO3A 5JDOE 1TESA 1Y4PB 1DXTB 1COHA 1JP8A 1HRMA 3UHXA 1ECNA 2WY4A 1J3ZB 1GDLA 5EE4D 3ZJJA 3PT7A 1UX8A 3G4VA 2VRYA 1V5HA 1HBRA 1QSIA 2JHOA 2D5ZA 2ZLUB 1Y5JA 2ZSRA 1A3OA 1HGAB 2EB8A 1BBBB 2M6ZA 1AJGA 2ZLXA 1GCWB 2MBWA 5HLXA 2MGKA 1LH2A 3G4QA 1ECOA 3UHEA 1FN3B 3QZZA 4ROLB 1V07A 1M9PA 2ZS0A 1Y5FA 4KN3A 3LR9A 1J40B 3UHYA 5EV5A 1LH1A 3GQPA 5EQMA 1IRDB 5KDQA 3E4NA 2MGGA 3ECXA 1S6AA 3G4WA 3WCWC 2GRFA 1Y2ZA 1C40A 2YRSA 2ZT0A 1Y8KB 3HEPA 1Y46B 3VAUA 1FSXB 1YCBA 3NL7B 2HCOB 5ILRA 1G0AB 3VREA 3UHDA 3MVCA 3E5OA 4MQKA 1N9FA 1SI4B 2VYWA 4G1BA 1RTEA 4MBNA 1UX9A 5KERA 1WMUB 1G9VA 2QMBA 4FC3B 1IBEA 3CY5B 3IXFA 1DTIA 2D5XA 3WCWB 2M6ZB 1MZ0A 3D17A 3LR7A 4FWYA 4HSXA 5AZRA 1NS6A 2MGBA 1NS9A 1DXDA 1SHRA 1MLLA 1NIHB 5HBIA 2XKIA 1MNJA 1QXDB 1IOPA 2AURA 1O1KA 1CQXA 1GBUA 4PQBA 5CHRA 1Y5JB 1C40B 3HHBA 4F69A 4MQGA 3VRFB 1RQ3B 3DR9A 3HC9A 3QQRA 1B86A 4F6GA 2ZSOA 1OFJA 1FAWA 1Y4QB 2D2MD 1RPSB 3ODQB 1C7BB 1Y45A 4FWXA 2HBSA 4TWVA 2ZSQA 3UHRA 1NGKA 1YHUD 5CN7A 1QXEA 5HY8B 4DC7A 1YEUA 2QSSB 4ESAB 2HHBB 2MGDA 1MBIA 2R4YA 5KERB 1Y8WA 1C7CB 1RVWB 1HHOA 1HABB 3QQQA 5JDOF 1Y8IA 4XS0B 1S5XB 1F63A 5HLUA 1YZIA 3D1AB 2EB9A 1YHEB 2HBGA 1NIHA 1LFTA 2DN1A 4PQCA 1DUOA 1DLWA 2VLZA 3WCTC 3QM5A 2V1EA 2MGFA 1F5PA 1SDKA 4MQGB 1JL6A 2DHBA 3UHHA 1G9VB 3BJ3B 2DN2B 1IBEB 3VRFA 1CPWA 1U7RA 3PI4A 4M4BA 2FRKX 3SZKB 3GKVA 1Y85B 1YE2A 1Y7DA 5E6EB 4YU4A 2HBCB 1NS9B 1X9FC 2FRIX 3HENA 3MJUB 1JEBB 3K9ZA 1O1OA 1KD2B 2W72C 1MLMA 1XQ5B 1O1NB 5C6YA 3GQGB 1ITHA 3OVUC 1Y4GB 3UH7A 1YHUB 1A6MA 1M9PB 3IC0B 1J3FA 3PELA 5IKSA 4JACA 1YDZB 4C0NA 4F6FA 2BK9A 3MYNA 3ECZA 1CMYB 4N7NA 2ZT3A 2AA1A 2HZ1A 5SW7B 1Y4VA 2V1KA 2OH8A 1BVDA 1FSXA 4N7OA 2ZFOA 1NZ3A 1LJWB 1VXAA 1BZ0B 2DN2A 3WFUA 2Z6TA 3UHKA 1A9WE 2PEGA 3PI2A 4G1VA 2OIFA 1MBOA 1O1PB 1CIOA 4DWTA 3UGZA 3EDAA 1YIHB 3P5QA 1PBXB 1MNIA 3O89A 1EMYA 1MWDA 1X3KA 2ZSSA 4MAXA 1Y22A 1A6KA 1G0BB 1O1JA 2DHBB 2VM0A 3NG6B 3BJ3A 1LA6B 2EVPA 2HBFA 1YH9B 1SDLB 4NK2A 3OO4B 1MYFA 3LHBA 3BOMB 1XCHA 3QJBA 3M3BA 1BZ6A 1GDIA 3GYSB 1J41B 1Y4FA 2E2YA 2ZFOB 4WCHD 1N9IA 5M3SA 2ZFOD 1XZ2A 3NMMB 5ILPA 2G0RA 2HHDB 1X9FD 1YFFB 1Y09B 2ZWJA 5CN6A 2DXMB 1J7SB 3OK5A 2Z6NB 5JDOC 1YMCA 3KUNA 5E83B 1ECDA 1S5YA 3HEOA 3FH9A 3OGBA 3PIAB 2G11A 4U8UA 1YEUB 1GZXA 1MLGA 4BJAA 2B7HA 1QI8B 1GLIA 103MA 2MYAA 2QRWA 1UIWB 1MTJA 1GBUB 1Y22B 1A01B 1IRCA 1JZKA 1XZUA 1Y2ZB 4KMWA 1BZ1B 1EWAA 1DUKA 1YGDA 1LFTB 1LA6A 1ECAA 5KDQB 3BOMA 1BABB 1DWSA 1U7SA 2MGMA 1H97A 3HRWA 110MA 2ZS0C 1YOGA 2C0KA 5D5RA 2W6VA 3UI0A 4MXLA 1LH3A 2LH3A 3UBVA 4M4AB 3HXNB 2AUQA 1EW6A 3ZOLA 1YHRA 1MKOB 1G0AA 3CY5A 1R1YB 4ROLA 1RQ4B 1YE2B 1THBB 3S66B 1Y5FB 2D2MC 3SDHA 1BIJB 1ABYA 1MBSA 1X46A 1JEBA 1IRDA 3KUOA 1QSHB 1JPBA 1A00B 1SPGA 1M6CA 3ZJMA 2D2NC 3BJ1A 1A0UA 5CN8A 1CH2A 3A0GA 1BZ1A 2ZLXB 1MLUA 1Y0TA 1CP0A 1SPEA 1Y7CA 1Y0CA 1Y7ZA 2VYYA 2ZS0B 3V2VA 2FRJX 1HBGA 1CG5B 3LQDA 3GDJA 1Y35A 3UHZA 3GKVB 1OUTB 4U8UB 3K8BB 4JYQA 3UHWA 1CQ2A 2V1IA 2FRFA 3MJUA 3OZUA 1RQ3A 4QAUA 1QI8A 3WCUC 3GOUA 3ARKA 1V75A 2QMBB 4AVEA 1MYMA 3OZVA 3GQRA 2LH5A 4ESAA 3MBAA 2BW9M 1MKOA 2ZS0D 1BUWA 3H58A 1HGBB 3QM9A 3UHQA 1FDHA 3R5IA 2EF2A 1NS6B 1JW8A 1GBVA 4PNJA 1K1KA 2V1JA 4NS2A 2AUPA 3QJEA 1Y4BA 1OJ6A 1G08A 1AZIA 5JDOD 1O1IA 4FC3A 1O1JB 1DXUA 1XZ7B 3TM9A 3UHSA 1X9FB 1MBAA 4H07A 4G51B 3AQ8A 3CIUA 1YMAA 1FSLA 2O5SX 3UHGA 4H2LA 2PGHA 2QU0B 1GJNA 1KFRA 1HDSA 3SDNA 3TLDA 2BLIA 2G14A 1SHRB 2O5TX 1V4UB 2H8FA 3G4RA 4HSWA 3VRGA 3LB1A 4ILZA 1YEQB 1MYIA 2QSSA 1Z8UB 2R50A 1YFFA 1G09B 106MA 3AQ7A 5EYJA 1SWMA 3HHBB 4DWUA 1C7CA 1RVWA 3ZJRA 1A6GA 3WFWA 1XXTB 1RTXA 1W92A 1MLHA 2VLYA 1YENA 1FAWB 3ZJLA 1Y0TB 3D1KA 4FH6A 2D2NB 3WCWA 1LUEA 1MYGA 5CN4A 4IT8A 1R1XB 2HBSB 1XZ5A 4TWUA 1GBVB 1MBNA 1CG5A 3QJBB 1Y4BB 3ED9A 3LB3A 5HLQA 3BA2A 1HCOB 2OHBA 2AA1B 1UVYA 1V75B 2VEBA 1UFJA 1Y0WB 1X9FA 4KJTA 2MB5A 3NG6A 5EUIA 3A9MA 4M4BB 1HBBA 1HGBA 1MBCA 2W6WA 2LHBA 1YH9A 3M38A 1XYEA 2QFKA 1MLOA 4YU3A 4MQCB 4H0BA 3S65A 3NMLA 5HAVA 2H8DB 1IWHA 4HRRB 1XQ5A 7HBIA 3D7OB 2GNWA 3UHUA 3ONZA 5EETA 1MOAA 4F6DA 3AT5A 3AG0A 1XY0A 3WHMB 3ASEA 1NQPA 2H35A 3IC2B 2EKUA 3DHTA 4F4OB 4MQKB 2HBCA 1DO1A 4ODCB 2GTLB 1GLIB 3HRWB 1FLPA 1HDBA 1MODA 3W4UA 2IG3A 3A59A 1NEJB 5CNEA 2ZT2A 3ORDA 1V9QA 3UHTA 1FCSA 108MA 1A3NA 3V2ZA 3WCTD 1C7DB 1JL7A 1R1YA 2HHEA 2ZSXA 2D2NA 3BCQA 101MA 2D60B 1YIHA 2SPLA 1ABWA 5E6EA 1CH5A 3RGKA 2BLJM 3UGYA 3UHIA 3FS4B 4FH7A 1CH1A 1VXBA 3B75B 2GDMA 4MQHA 2ZLWB 3UHCA 1KD2A 1MWCA 2G3HA 4M4AA 1A4FB 1S5YB 5F2AA 3HF4B 3ODQA 1J3ZA 4FWZA 2HBEB 4MXKA 1RQ4A 3ZOMA 1YHEA 3PT7B 1CH3A 1HV4A 4L7YB 1HBBB 1Q1FA 5C6EA 1HBIA 1QXEB 1A0ZA 1L2KA 3UHVA 4NI0B 2RAOB 2V1FA 1IDRA 1LHTA 1HBAB 3LB4A 1O1KB 4L2MA 1HDBB 1HJTA 2HHDA 1GCWA 3MOUA 4X0LB 3EOKB 1COHB 2XKGA 1D8UA 3A0GB 1C7DA 2Z6NA 1A3NB 1YCAA 1JZLA 2GLNA 3U3EA 4UIQA 1RPSA 3O7NA 1LH6A 1Y35B 3ZHWA 1YVTA 1K1KB 2D6CA 4O2GA 3BJ2B 2GRZA 1DTMA 2GKNA 1HBSB 3GOUB 2ZLWA 1UT0A 2O58X 3UH6A 1A00A 1DXVB 4HHBB 4ROMB 4AVDA 1NAZA 1A0UB 1HLMA 3K3UA 5E83A 1JP9A 1MLRA 1FHJA 3SZKA 2NX0A 1MNKA 3WFXA 1Y7ZB 1A0ZB 4O35A 1HLBA 1SI4A 2ZLTB 1S0HB 3QJEB 3LQDB 2IN4A 2D2MB 1URYA 4N7PA 1EBCA 1MTKA 1CH4A 1OR6A 1CG8B 4NI1A 1UFPA 1MNOA 1YEOB 1S61A 3EOKA 3HXNA 1BBBA 2G0ZA 3QJCB 3ZH0A 5CN5A 2MGCA 1DXCA 4VHBA 1THBA 1JZMA 4N7NB 2HCOA 1YVTB 1V4WA 1BABA 3ZJOA 3VREB 2HZ2A 4HRRA 1JWNA 3LB2A 4B4YA 2RAOA 3HYUB 2QSPB 1WMUA 3WCTB 6HBWA 3ARLA 1O1NA 2DN3A 2GL3A 3GQGA 1K0YA 1JY7B 1YOHA 2ZSPA 1XY0B 3A5BA 1DWTA 5EUIB 3E5IA 3WCUA 2VEEA 3MJPA 1BINA 1MYTA 1BIJA 2D2ND 5E29B 1OUUA 5EE4C 3UH5A 1XZ5B 1S0HA 2GRHA 2HBDB 3EU1B 2ZLTA 3WFTA 3DUTA 2NSRA 2ZT4A 3BJ1B 1CIKA 1QPWA 2BLHA 1Y09A 1HBSA 2PGHB 2R1HA 4IROA 1XZVA 2R4XA 1Y0DA 1Y0WA 3M39A 2HHEB 1Y0AB 1YIEB 4HHBA 1XZ4B 2NRLA 4MQIB 1NPFA 2DN1B 1HGCB 1GDJA 1YVQB 1SDKB 2GTLA 1ASHA 1TU9A 3ZJNA 5HU6B 1PBXA 3A5AA 1LFZB 4MBAA 1O1LA 2VHBA 1NEJA 1HABA 1R1XA 2Z6SA 1Y8IB 3QJDB 3AT5B 2ZS1C 2KSCA 4HRTA 1LFVB 2ZS1A 3OZWA 4KMVA 3QM6A 5ILMA 1GDKA 1OUUB 1DO4A 3OO4A 1Y7GA 5HY8A 3K8BA 2O5OX 1DXUB 3FS4A 4UURA 4G51A 1Y31A 2R1HB 4U8UD 1HHOB 2R4ZA 2G0SA 1BZZB 3H57A 2MHBB 1M6MA 4ZVAA 3EDBA 4XS0A 1VXFA 1J7WB 1UVXA 1CP5A 4YU4B 1MNHA 2MYDA 3AQ5A 1Y4VB 4B3WA 2D60A 1LFQA 1Y4RA 1QSHA 1HBRB 1MOCA 2GTLD 3IC2A 104MA 1MYHA 3NFEB 2ZFBB 1G08B 2W72A 4ODCA 1JDOA 1XXTA 1Y83A 1J52A 2ZLVB 1FHJB 2G0VA 1YHUA 1NWIA 1YHUC 1YE0B 3DHTB 1O1PA 1MLQA 1LH7A 1J7YB 3TM3A 4HBIA 3PI8A 1YMBA 2R80A 1YGDB 4O1TA 1MLNA 4NZIA 4YU3B 1HBHB 1MOHA 3S65B 2O5LX 5AB8A 3D4XB 1MCYA 2OLPA 1DLYA 3RJNB 2R4WA 5ILEA 1IWHB 1HACB 2ZFOC 4N8TB 3D7OA 1CLSA 3QJCA 1Y46A 3QM7A 3WCWD 2MGHA 2BWHA 2PEGB 2Z85A 1LHSA 3NL7A 1YHRB 3G4UA 3WR1A 1AJ9B 1I3DA 3WCPB 1XYEB 4HRTB 3OO5A 3WCVA 1MBDA 3S66A 2HBEA 4MQCA 1A9WA 1Y8HB 2G12A 2RI4A 1A3OB 1V4XB 1UC3A 1DKEB 1NPGA 1VXHA 3M3AA 1DXVA 2V1HA 1YE0A 3WCVD 1G0BA 3WTGB 2BKMA 1VWTA 2XYKA 107MA 5C6EB 1Y4QA 1NWNA 2SPMA 2FAMA 1I3EA 3OJ1A 1SDLA 1NZ2A 2FALA 1NZ5A 2MYCA 1GCVB 1Y4RB 1XZUB 2ZS1D 2O5MX 1NZ4A 3B75A 2QLSB 4O4ZA 1HSYA 1Y4PA 3CIUB 1LFYB 1Y5KA 3RJ6A 2EKTA 3KMFA 4WJG1 3AQ6A 2NSSA 3OO5B 3KMFC 1YZIB 3D1AA 4NXCA 1C7BA 3S48C 2GKMA 2MGEA 1CO9A 3PIAA 2LH7A 3WCVB 1V4XA 3PI9B 3VHBA 2RI4B 4NI0A 1HBHA 3IA3B 1MYJA 1O1LB 4UZVA 3WCUD 3GYSA 1HACA 4MQHB 3ZJQA 1O16A 3QJDA 1K0YB 3W4UB 3D1KB 4F6IA 3AQ9A 3WTGA 4MQJB 2GTLC 1CMYA 2MGJA 5D1VA 3UHBA 1QXDA 1F5OA 1AJ9A 3WCPA 1JP6A 2AV3A 4GZGA 4NI1B 2CMMA 3DUTB 3QZXA 2H8DA 3MKBA 3QM8A 2ZSZA 5AZQA 2AUOA 1YEVB 3R0GA 1LFYA 1YGFB 2D5XB 1MOBA 2WTHA 1UMOA 1LFLB 3D17B 2V1GA 3WCTA 3IC0A 1VXDA 2MYBA 2MGLA 2ZSTA 2LH1A 4F4OA 1JY7A 3PI9A 3WCVC 1RSEA 1BZRA 3WCUB 2W6XA 1J40A 2ZFBA 4OODA 3AT6B 2MGIA 1OR4A 1CG8A 1SPGB 1LH5A 2ZLVA 5CNCA 3G52A 1VXCA 1Y7CB 3ARJA 3G46A 1KR7A 1LJWA 2VLXA 1VRFA 1J7YA 1Y8KA 2ZSNA 3PELB 2MHBA 1CBLA 2HBDA 5CNDA 4MQJA 3GDJB 2ZSYA 2O5BX 1BZPA 111MA 1XZ4A 2LH6A 1QSIB 2VYZA 1Y7GB 5CNFA 1XZVB 4IROB 1HGAA 1O1MA 3PT8B 1YEOA 5F0BA 1DWRA 2DXMA 3BJ2A 1YEVA 2W72B 1BVCA 4WJGA 1DM1A 1BJEA 3UH3A 1VREA 102MA 2BNLA 1RQAB 2Z8AA 4NXAA 2G0XA 1MDNA 1AJHA 105MA 1BZZA 2DC3A 109MA 2BMMA 1Y7DB 3ZJHA 1VHBA 3DHRB 4DC8A 6HBIA 4OF9A 5EYSA 1DO7A 1MTIA 2D5ZB 2ZLUA 2MGAA 4F6JA 1WVPA 1A01A 2OHAA 1S56A 3G53A 3GLNA 1CBMA 1J41A 1Y4FB 1A4FA 3ZJSA 1VWTB 1LFVA 3A59B 3WI8A 4H2LB 1MLJA 1S5XA 2O5QX 1BUWB 5SW7A 3R5IB 1GCVA 1CH9A 3BCQB 1Y45B 1WLAA
chains in the Genus database with same CATH superfamily
4F0UB 1MLFA 2B7HB 3VRGB 1G09A 5FVBA 4TYXA 3MYMA 4X0LA 1N9XA 1QPWB 3G4YA 5HU6A 1XZ2B 3NMMA 2W31A 1Y5KB 5JGGB 1J3YB 1Y01B 1A6NA 1HA7B 3MN0A 1ON7A 1YIEA 1J7SA 2DN3B 1JF4A 4NK1A 3WR1B 1HDAB 3FH9B 2SPNA 3P5QB 3DHRA 1T1NA 4MPMA 1YG5B 1Y8HA 1GVHA 1Y8WB 1MLSA 1HCOA 2GNVA 3A2GA 4F6BA 1O1OB 1YEQA 1DKEA 3S1IA 2JLFA 3A5GA 4U8UC 1YOIA 5B13A 4XDIA 2YRSB 1BZ0A 3PI8B 5MBNA 1PMBA 2R80B 5CMVA 1CO8A 3WHMA 5KKKA 3E55A 1Y0AA 1OUTA 3S1JA 3GUQA 1FDHG 5EU2A 3ZJIA 3MKBB 1B8DA 112MA 3ZJPA 1IT3A 1CLSB 5CNBA 3NFEA 1YGFA 4LPIA 6HBWB 2W6VB 1Y31B 1B86B 4F68A 1IT2A 1VXGA 3ONZB 3O18B 1Y85A 2G10A 1Y4GA 1Y0CB 3MJPB 1GZXB 1ABSA 1HDAA 3GKTA 4ROMA 1J7WA 1NQPB 2H35B 5EOHA 5AQDA 5CNGA 1ABYB 2LH2A 3QMAA 1LFQB 2C7LA 1T1NB 1UIWA 1YG5A 4PQ6A 1O1IB 3PMDA 1F65A 3HYUA 2WCRA 1TOXA 2D2MA 4N7PB 4N8TA 1Y0DB 1YDZA 3UHNA 5JOMA 5CHQA 4O4TA 2MYEA 4ZVBA 1FN3A 5JGGA 4C44A 1J3YA 1HDSB 1DXTA 1LFLA 1LTWA 2QLSA 4L7YA 5MBAA 1OBMA 3GQPB 2HBFB 2OH9A 4MU5A 2SPOA 1HHTP 1V4UA 2QFNA 1YVQA 2AV0A 1ABWB 1V4WB 2XKHA 3D4XA 4SDHA 2ZT1A 1O1MB 3PT8A 2NRMA 1MGNA 1S69A 3GK9A 1MLKA 1N9HA 1RQAA 2HHBA 1YENB 1NXFA 3GQRB 1XZ7A 4BS9A 1KN1B 2QSPA 2UUMA 2WTGA 1OFKA 4MQIA 3ECLA 5B13G 1Y83B 3UBCA 3HF4A 2ZS1B 1HGCA 5B84A 5B85A 1URVA 2QU0A 2W6YA 1HV4B 1MWBA 2HZ3A 2EVKA 4A8MP 1CH7A 1EBTA 3PI3A 5E29A 1H1XA 3EU1A 2H8FB 1HBAA 3AT6A 3PI1A 1B0BA 1XG0C 1LFZA 4N7OB 1MYZA 1VXEA 1JF3A 5CN9A 1DO3A 5JDOE 1TESA 1Y4PB 1DXTB 1COHA 1JP8A 3V57A 1HRMA 3UHXA 1ECNA 2VMLB 2WY4A 1J3ZB 1GDLA 5EE4D 3ZJJA 3PT7A 1UX8A 3G4VA 2VRYA 1V5HA 1HBRA 1QSIA 2JHOA 2D5ZA 2ZLUB 1Y5JA 4L1EA 2ZSRA 1A3OA 2X4AA 1HGAB 2EB8A 1BBBB 4AE1A 1B33B 2M6ZA 1AJGA 2ZLXA 2I88A 1GCWB 1DDTA 2MBWA 5HLXA 2MGKA 1LH2A 3G4QA 1ECOA 3UHEA 1FN3B 3QZZA 4ROLB 1V07A 1M9PA 2ZS0A 1Y5FA 4KN3A 3LR9A 1J40B 3UHYA 5EV5A 1LH1A 3GQPA 5EQMA 1IRDB 5KDQA 3E4NA 2MGGA 3ECXA 1S6AA 3G4WA 2UULC 3WCWC 2GRFA 1Y2ZA 1C40A 2YRSA 2ZT0A 4H0MB 1Y8KB 3HEPA 1Y46B 3VAUA 1FSXB 1YCBA 3NL7B 2HCOB 5ILRA 1G0AB 3VREA 3UHDA 3MVCA 3E5OA 4MQKA 1N9FA 1KTPB 1SI4B 2VYWA 4A8QA 4G1BA 1RTEA 4MBNA 1UX9A 4L1EB 5KERA 1WMUB 1G9VA 2QMBA 4FC3B 1IBEA 4ZIZA 3CY5B 3IXFA 1DTIA 2D5XA 3WCWB 2M6ZB 1MZ0A 3D17A 2X49A 3LR7A 4FWYA 4HSXA 5AZRA 1NS6A 1XDTT 2VMLA 2MGBA 1NS9A 1DXDA 1SHRA 1MLLA 1NIHB 5HBIA 2XKIA 1MNJA 1QXDB 1IOPA 2AURA 1O1KA 1CQXA 1GBUA 4PQBA 5CHRA 1Y5JB 1C40B 3HHBA 4F69A 4MQGA 3VRFB 1RQ3B 3DR9A 3HC9A 3QQRA 1B86A 4F6GA 2ZSOA 1OFJA 1FAWA 1Y4QB 2D2MD 1RPSB 3ODQB 1C7BB 1Y45A 4FWXA 1HA7A 1LIAA 2HBSA 4TWVA 2ZSQA 3UHRA 1NGKA 1YHUD 5CN7A 1QXEA 5HY8B 4DC7A 1YEUA 2QSSB 4ESAB 2HHBB 2MGDA 1MBIA 2R4YA 5KERB 1Y8WA 1C7CB 1RVWB 1HHOA 1PHNA 1HABB 3QQQA 5JDOF 1Y8IA 1HI8A 4XS0B 1S5XB 1F63A 5HLUA 1YZIA 3D1AB 2EB9A 4LMXB 1YHEB 2HBGA 1NIHA 1LFTA 2DN1A 4PQCA 1DUOA 1DLWA 1F0LA 1RH1A 2VLZA 3WCTC 3QM5A 2V1EA 2MGFA 1F5PA 1SDKA 4MQGB 2UUND 1JL6A 2DHBA 3UHHA 1G9VB 3BJ3B 2DN2B 1IBEB 3VRFA 1CPWA 1U7RA 3PI4A 4M4BA 2FRKX 3SZKB 3GKVA 1Y85B 1YE2A 1Y7DA 5E6EB 4YU4A 2HBCB 1NS9B 1X9FC 2FRIX 3HENA 3MJUB 1JEBB 3K9ZA 1O1OA 1KD2B 2W72C 1MLMA 1XQ5B 1O1NB 5C6YA 3GQGB 1ITHA 1HHSA 3OVUC 3O2CB 1Y4GB 3UH7A 1YHUB 4GXEB 1A6MA 1M9PB 3IC0B 1J3FA 3PELA 5IKSA 4JACA 1YDZB 4C0NA 4F6FA 2BK9A 3MYNA 3ECZA 1CMYB 4N7NA 1NY9A 2ZT3A 3KVSB 1B8DB 2AA1A 2HZ1A 5SW7B 2UULH 3NUHB 1Y4VA 2V1KA 2OH8A 1BVDA 1FSXA 4N7OA 2ZFOA 1NZ3A 1LJWB 1VXAA 1BZ0B 2DN2A 3WFUA 2Z6TA 3UHKA 1A9WE 3O18A 2PEGA 3PI2A 4G1VA 2OIFA 1MBOA 1O1PB 1CIOA 1KTPA 1WACA 4DWTA 4N6SB 3UGZA 3EDAA 1YIHB 3P5QA 1PBXB 2V8AB 4TMAB 1MNIA 3O89A 1EMYA 1MWDA 4ETVA 1X3KA 2ZSSA 4MAXA 4BJUA 1Y22A 1A6KA 1G0BB 1O1JA 2DHBB 2VM0A 3NG6B 3BJ3A 1LA6B 2EVPA 2HBFA 1YH9B 1SDLB 4NK2A 3OO4B 2C7KA 1MYFA 3LHBA 3BOMB 1XCHA 3QJBA 3M3BA 1BZ6A 1GDIA 3GYSB 1J41B 1Y4FA 2E2YA 2ZFOB 4A8FA 4WCHD 1N9IA 5M3SA 2ZFOD 1XZ2A 3NMMB 5ILPA 2G0RA 2HHDB 1X9FD 4ERVA 1YFFB 1XF6C 1Y09B 2ZWJA 5CN6A 2DXMB 2VJRB 1J7SB 3OK5A 2Z6NB 5JDOC 4A8WA 1YMCA 3KUNA 5E83B 1ECDA 1S5YA 3HEOA 3FH9A 3OGBA 3PIAB 2G11A 4U8UA 1YEUB 1GZXA 1MLGA 4BJAA 2B7HA 1QI8B 1GLIA 103MA 2MYAA 2QRWA 1UIWB 1MTJA 1GBUB 1Y22B 1A01B 2DKAA 1IRCA 1JZKA 1XZUA 1Y2ZB 4KMWA 1BZ1B 2UUMX 1EWAA 3MWNA 1DUKA 1YGDA 1LFTB 1LA6A 1ECAA 5KDQB 3BOMA 1BABB 1DWSA 1U7SA 2MGMA 1H97A 1UVNA 3HRWA 110MA 2ZS0C 1YOGA 2C0KA 5D5RA 2W6VA 3UI0A 4MXLA 1LH3A 2LH3A 3UBVA 4M4AB 3HXNB 2AUQA 3VNCA 1EW6A 3ZOLA 1YHRA 4HH1A 2UULA 1MKOB 1G0AA 3CY5A 1R1YB 4ROLA 1RQ4B 1YE2B 1THBB 3S66B 1Y5FB 2D2MC 3SDHA 1BIJB 1ABYA 1MBSA 1X46A 1JEBA 1IRDA 3KUOA 1QSHB 1JPBA 1A00B 1SPGA 4A8OA 1M6CA 3ZJMA 2D2NC 3BJ1A 1A0UA 5CN8A 1CH2A 3A0GA 1BZ1A 2ZLXB 1MLUA 1Y0TA 1CP0A 1SPEA 1Y7CA 1Y0CA 1Y7ZA 2VYYA 2ZS0B 3V2VA 4ETUA 2FRJX 1HBGA 1CG5B 3LQDA 3GDJA 1Y35A 3UHZA 3GKVB 1OUTB 3V58B 4U8UB 3K8BB 1MDTA 4JYQA 1CQ2A 3UHWA 2V1IA 4A8KA 2FRFA 3MJUA 3OZUA 1RQ3A 4QAUA 1QI8A 3WCUC 3GOUA 3ARKA 1V75A 4H0MA 2QMBB 4AVEA 1MYMA 3OZVA 3GQRA 2LH5A 4ESAA 3MBAA 2BW9M 1MKOA 2ZS0D 4ETTA 1BUWA 3H58A 1HGBB 3QM9A 3UHQA 1FDHA 3R5IA 2EF2A 1NS6B 1JW8A 1GBVA 4PNJA 4PO5A 1K1KA 2V1JA 4NS2A 2AUPA 3QJEA 1Y4BA 1OJ6A 1G08A 1AZIA 5JDOD 4ERTA 1O1IA 4FC3A 1O1JB 1COLA 1DXUA 1XZ7B 3TM9A 1UVKA 3UHSA 1X9FB 1MBAA 4H07A 4G51B 1JBOB 3AQ8A 3CIUA 1YMAA 1FSLA 2O5SX 3UHGA 4H2LA 4YJJA 2PGHA 2QU0B 1GJNA 1KFRA 1HDSA 3SDNA 3TLDA 2BLIA 2G14A 1SHRB 2O5TX 1V4UB 2H8FA 3G4RA 4HSWA 3VRGA 3LB1A 4ILZA 1YEQB 1MYIA 2QSSA 4F0UA 1Z8UB 2R50A 1YFFA 1G09B 106MA 3AQ7A 5EYJA 1SWMA 3HHBB 4DWUA 1C7CA 1RVWA 3ZJRA 1A6GA 3WFWA 1XXTB 1RTXA 1W92A 1MLHA 2VLYA 1YENA 1FAWB 3ZJLA 1Y0TB 3D1KA 1KN1A 4FH6A 2D2NB 3WCWA 1LUEA 1MYGA 5CN4A 4IT8A 1R1XB 2HBSB 1XZ5A 4TWUA 1GBVB 1MBNA 1CG5A 3BRPA 3QJBB 1Y4BB 3ED9A 3LB3A 5HLQA 3BA2A 1HCOB 2OHBA 4Q70B 2AA1B 1UVYA 1V75B 2VEBA 5FVBM 1UFJA 1Y0WB 1X9FA 4KJTA 2MB5A 3NG6A 5EUIA 3A9MA 3LQ9A 4M4BB 3ZTAA 4YJJB 1HBBA 1HGBA 1MBCA 2W6WA 2LHBA 1YH9A 3M38A 1XYEA 2QFKA 1MLOA 4YU3A 4MQCB 4H0BA 3S65A 3NMLA 5HAVA 2H8DB 1IWHA 4HRRB 1XQ5A 7HBIA 3D7OB 2GNWA 3UHUA 3ONZA 4F0TA 5EETA 1MOAA 4F6DA 3AT5A 3AG0A 1XY0A 3WHMB 3ASEA 1NQPA 2H35A 3IC2B 2EKUA 3DHTA 4F4OB 4MQKB 2HBCA 1DO1A 4ODCB 2GTLB 1GLIB 3HRWB 1FLPA 1HDBA 1MODA 3W4UA 2IG3A 3A59A 2YSKA 1NEJB 5CNEA 2ZT2A 3ORDA 1V9QA 3UHTA 4ESUA 1FCSA 108MA 1A3NA 3V2ZA 3WCTD 1C7DB 1JL7A 1R1YA 2HHEA 2ZSXA 2D2NA 3BCQA 101MA 4Z8KA 2D60B 1YIHA 2SPLA 1ABWA 4GY3A 5E6EA 1CH5A 3RGKA 2UULD 2BLJM 3UGYA 2VJRA 3UHIA 3FS4B 4FH7A 1CH1A 1VXBA 3B75B 2GDMA 4MQHA 2ZLWB 3UHCA 1KD2A 1MWCA 2G3HA 4M4AA 1A4FB 1S5YB 3GIOA 5F2AA 3HF4B 3ODQA 1J3ZA 4B02A 4FWZA 2HBEB 4MXKA 1RQ4A 3ZOMA 1YHEA 3PT7B 1CH3A 1HV4A 2JLGA 2BV8A 4L7YB 1HBBB 1Q1FA 5C6EA 1HBIA 1QXEB 1A0ZA 1L2KA 3UHVA 4NI0B 2RAOB 2V1FA 1IDRA 1LHTA 1HI1A 1HBAB 3LB4A 1O1KB 4L2MA 1HDBB 1HJTA 2HHDA 1ALLB 1GCWA 3MOUA 4X0LB 3EOKB 1COHB 2XKGA 1D8UA 3A0GB 1C7DA 2Z6NA 1A3NB 1YCAA 1JZLA 2GLNA 3U3EA 4UIQA 4Z8KB 1RPSA 3O7NA 1LH6A 1Y35B 3ZHWA 1YVTA 3V58A 1K1KB 4LM6B 2D6CA 4O2GA 3BJ2B 2GRZA 1DTMA 2GKNA 1HBSB 3GOUB 2ZLWA 1UT0A 2O58X 4RMPB 3UH6A 1A00A 2WCQA 1DXVB 1B33A 4HHBB 4ROMB 4AVDA 1NAZA 1A0UB 1HLMA 3K3UA 5E83A 1JP9A 1MLRA 1FHJA 3SZKA 2NX0A 1MNKA 3WFXA 1Y7ZB 1A0ZB 4O35A 1HLBA 1SI4A 2ZLTB 1S0HB 3QJEB 3LQDB 2IN4A 2D2MB 1URYA 4N7PA 1EBCA 1MTKA 2UUNB 1CH4A 1OR6A 1CG8B 4NI1A 1UFPA 1MNOA 1YEOB 1S61A 3EOKA 3HXNA 1BBBA 2G0ZA 3QJCB 3ZH0A 5CN5A 2MGCA 1DXCA 4VHBA 1THBA 1JZMA 4N7NB 2HCOA 1YVTB 1V4WA 1BABA 2BV8B 3ZJOA 3VREB 2HZ2A 4HRRA 1JWNA 3LB2A 4B4YA 2RAOA 3HYUB 4ZIZB 2QSPB 1WMUA 3WCTB 6HBWA 3ARLA 1O1NA 2DN3A 2GL3A 3GQGA 1K0YA 1ALLA 1JY7B 1YOHA 2ZSPA 1XY0B 3A5BA 1DWTA 5EUIB 3E5IA 3WCUA 2C7JA 2VEEA 3MJPA 1BINA 1MYTA 1BIJA 2D2ND 5E29B 1OUUA 5EE4C 3UH5A 1XZ5B 1S0HA 2GRHA 2HBDB 3EU1B 2DKDA 2ZLTA 3WFTA 3DUTA 3RQRA 2NSRA 2ZT4A 3BJ1B 1CIKA 1QPWA 2BLHA 1Y09A 1HBSA 1CPCB 2PGHB 2R1HA 4IROA 1XZVA 2R4XA 1Y0DA 1Y0WA 3M39A 2HHEB 1Y0AB 1YIEB 4HHBA 1XZ4B 2NRLA 4MQIB 1NPFA 2DN1B 1HGCB 1F99A 1GDJA 1YVQB 4AE0A 1SDKB 2GTLA 1ASHA 1TU9A 3ZJNA 5HU6B 1PBXA 2V8AA 3A5AA 1LFZB 1A87A 4MBAA 1O1LA 2VHBA 1NEJA 1HABA 4HH0A 1R1XA 2Z6SA 1Y8IB 3QJDB 3AT5B 2ZS1C 2KSCA 4HRTA 1UVIA 1LFVB 2ZS1A 3OZWA 4KMVA 3QM6A 5ILMA 1GDKA 2VJHB 1OUUB 1DO4A 3OO4A 2C7KB 1Y7GA 1SGKA 5HY8A 3K8BA 2O5OX 1DXUB 4GXEA 3FS4A 4UURA 4G51A 1Y31A 2R1HB 4U8UD 1HHOB 1PHNB 2R4ZA 3DBJA 2G0SA 1BZZB 3H57A 3V57B 2MHBB 1M6MA 4ZVAA 3EDBA 4XS0A 1VXFA 1J7WB 1UVXA 1CP5A 4YU4B 4A8YA 1MNHA 4A8SA 2MYDA 3AQ5A 1Y4VB 4B3WA 2D60A 1LFQA 1Y4RA 1QSHA 1HBRB 1MOCA 2GTLD 3IC2A 104MA 1MYHA 4RMPA 3NFEB 2ZFBB 1ON7B 1G08B 2W72A 4ODCA 1JDOA 1XXTA 1GH0B 1Y83A 1J52A 2ZLVB 1FHJB 2G0VA 1YHUA 1NWIA 1HI0P 1UVLA 1YHUC 1YE0B 3DHTB 1O1PA 1MLQA 1LH7A 1J7YB 4N6SA 3TM3A 4HBIA 3PI8A 1YMBA 2R80A 1YGDB 4O1TA 1MLNA 4NZIA 4YU3B 1HBHB 1MOHA 3S65B 2O5LX 5AB8A 3D4XB 1MCYA 2OLPA 1DLYA 3RJNB 2R4WA 5ILEA 1IWHB 1HACB 1CIIA 2ZFOC 4N8TB 3D7OA 1CLSA 3QJCA 2J96A 4F0TB 1I7YA 1Y46A 3QM7A 3WCWD 2MGHA 2BWHA 2PEGB 2Z85A 1LHSA 3NL7A 1YHRB 3G4UA 3WR1A 2UULB 1AJ9B 1I3DA 3WCPB 1XYEB 4HRTB 3OO5A 3WCVA 1MBDA 3S66A 2HBEA 4MQCA 1A9WA 1Y8HB 2G12A 2RI4A 3L0FB 1A3OB 1V4XB 1UC3A 3KVSA 1DKEB 1NPGA 1VXHA 1QGWC 2JL9A 3M3AA 1DXVA 2V1HA 4XXIA 1YE0A 3WCVD 1G0BA 3WTGB 2BKMA 1VWTA 2XYKA 107MA 5C6EB 1Y4QA 1NWNA 1EYXA 2SPMA 2FAMA 1I3EA 3OJ1A 1SDLA 1NZ2A 2FALA 1NZ5A 2MYCA 2DKCA 1GCVB 1Y4RB 2UUNA 1XZUB 2ZS1D 2O5MX 1NZ4A 3B75A 2QLSB 4O4ZA 1HSYA 1Y4PA 3CIUB 1LFYB 1Y5KA 3RJ6A 2EKTA 3KMFA 4WJG1 3AQ6A 2NSSA 3OO5B 3KMFC 1YZIB 3D1AA 4NXCA 1C7BA 3S48C 2GKMA 2MGEA 1CO9A 3PIAA 2LH7A 3WCVB 1V4XA 3PI9B 3VHBA 3BRPB 4PO5B 2RI4B 3L0FA 4GY3B 4NI0A 1HBHA 3IA3B 1MYJA 5AQDM 3O2CA 1O1LB 2UUMB 4UZVA 3WCUD 3GYSA 1HACA 4MQHB 3ZJQA 1O16A 3QJDA 1K0YB 3W4UB 3D1KB 4F6IA 1I7YB 3AQ9A 3WTGA 4MQJB 2GTLC 1CMYA 2VJHA 2MGJA 2VJTB 5D1VA 3UHBA 1QXDA 1EYXB 1F5OA 1AJ9A 3WCPA 1JP6A 2AV3A 4GZGA 4NI1B 2CMMA 3DUTB 3QZXA 2H8DA 3MKBA 3QM8A 2ZSZA 5AZQA 2AUOA 1YEVB 3R0GA 1LFYA 1YGFB 2D5XB 1MOBA 2WTHA 1UMOA 1LFLB 3D17B 2V1GA 3WCTA 3IC0A 1VXDA 2MYBA 2MGLA 2ZSTA 2LH1A 4F4OA 1JY7A 3PI9A 3WCVC 1RSEA 1BZRA 3WCUB 2W6XA 1J40A 2ZFBA 4OODA 3AT6B 2MGIA 1OR4A 3FEWX 1UVMA 1CG8A 1SPGB 1LH5A 2ZLVA 5CNCA 3G52A 1VXCA 1Y7CB 3ARJA 4Q70A 2C7JB 3G46A 1KR7A 1LJWA 2VLXA 1VRFA 1J7YA 1Y8KA 2ZSNA 3PELB 2MHBA 1CBLA 2HBDA 5CNDA 4MQJA 3GDJB 2ZSYA 1LIAB 2O5BX 1BZPA 111MA 1XZ4A 2LH6A 1QSIB 2VYZA 1Y7GB 5CNFA 1XZVB 4IROB 1HGAA 1O1MA 3PT8B 1YEOA 5F0BA 1DWRA 2DXMA 3BJ2A 1YEVA 1UVJA 2W72B 1BVCA 4WJGA 1DM1A 1BJEA 3UH3A 1VREA 102MA 1GH0A 2BNLA 1RQAB 2Z8AA 4NXAA 2G0XA 1MDNA 1AJHA 105MA 1BZZA 2DC3A 109MA 1F99B 2BMMA 1Y7DB 3ZJHA 1VHBA 3DHRB 4DC8A 6HBIA 2VJTA 3PMCA 4OF9A 5EYSA 1DO7A 1MTIA 2D5ZB 2ZLUA 2MGAA 4F6JA 4LMSB 1WVPA 1A01A 2OHAA 1S56A 3G53A 3GLNA 1CBMA 1J41A 1Y4FB 1A4FA 4XXKA 3ZJSA 1CPCA 1VWTB 1LFVA 3A59B 3WI8A 4H2LB 1MLJA 1S5XA 2O5QX 1JBOA 1BUWB 5SW7A 3DBJB 2C7LB 3R5IB 1GCVA 1CH9A 3BCQB 1Y45B 1WLAA
chains in the Genus database with same CATH topology
1MLFA 2B7HB 3VRGB 1G09A 4TYXA 3MYMA 4X0LA 1N9XA 1QPWB 3G4YA 5HU6A 1XZ2B 3NMMA 2W31A 1Y5KB 5JGGB 1J3YB 1Y01B 1A6NA 3MN0A 1YIEA 1J7SA 2DN3B 1JF4A 4NK1A 3WR1B 1HDAB 3FH9B 2SPNA 3P5QB 3DHRA 1T1NA 4MPMA 1YG5B 1Y8HA 1GVHA 1Y8WB 1MLSA 1HCOA 2GNVA 3A2GA 4F6BA 1O1OB 1YEQA 1DKEA 3S1IA 3A5GA 4U8UC 1YOIA 4XDIA 2YRSB 1BZ0A 3PI8B 5MBNA 1PMBA 2R80B 5CMVA 1CO8A 3WHMA 5KKKA 3E55A 1Y0AA 1OUTA 3S1JA 1FDHG 5EU2A 3ZJIA 3MKBB 112MA 3ZJPA 1IT3A 1CLSB 5CNBA 3NFEA 1YGFA 4LPIA 6HBWB 2W6VB 1Y31B 1B86B 4F68A 1IT2A 1VXGA 3ONZB 1Y85A 2G10A 1Y4GA 1Y0CB 3MJPB 1GZXB 1ABSA 1HDAA 3GKTA 4ROMA 1J7WA 1NQPB 2H35B 5EOHA 5CNGA 1ABYB 2LH2A 3QMAA 1LFQB 1T1NB 1UIWA 1YG5A 4PQ6A 1O1IB 1F65A 3HYUA 2D2MA 4N7PB 4N8TA 1Y0DB 1YDZA 3UHNA 5JOMA 5CHQA 4O4TA 2MYEA 4ZVBA 1FN3A 5JGGA 4C44A 1J3YA 1HDSB 1DXTA 1LFLA 1LTWA 2QLSA 4L7YA 5MBAA 1OBMA 3GQPB 2HBFB 2OH9A 4MU5A 2SPOA 1V4UA 2QFNA 1YVQA 2AV0A 1ABWB 1V4WB 2XKHA 3D4XA 4SDHA 2ZT1A 1O1MB 3PT8A 2NRMA 1MGNA 1S69A 3GK9A 1MLKA 1N9HA 1RQAA 2HHBA 1YENB 1NXFA 3GQRB 1XZ7A 2QSPA 2WTGA 1OFKA 4MQIA 3ECLA 1Y83B 3UBCA 3HF4A 2ZS1B 1HGCA 5B84A 5B85A 1URVA 2QU0A 2W6YA 1HV4B 1MWBA 2HZ3A 2EVKA 1CH7A 1EBTA 3PI3A 5E29A 1H1XA 3EU1A 2H8FB 1HBAA 3AT6A 3PI1A 1B0BA 1LFZA 4N7OB 1MYZA 1VXEA 1JF3A 5CN9A 1DO3A 5JDOE 1TESA 1Y4PB 1DXTB 1COHA 1JP8A 1HRMA 3UHXA 1ECNA 2WY4A 1J3ZB 1GDLA 5EE4D 3ZJJA 3PT7A 1UX8A 3G4VA 2VRYA 1V5HA 1HBRA 1QSIA 2JHOA 2D5ZA 2ZLUB 1Y5JA 2ZSRA 1A3OA 1HGAB 2EB8A 1BBBB 2M6ZA 1AJGA 2ZLXA 1GCWB 2MBWA 5HLXA 2MGKA 1LH2A 3G4QA 1ECOA 3UHEA 1FN3B 3QZZA 4ROLB 1V07A 1M9PA 2ZS0A 1Y5FA 4KN3A 3LR9A 1J40B 3UHYA 5EV5A 1LH1A 3GQPA 5EQMA 1IRDB 5KDQA 3E4NA 2MGGA 3ECXA 1S6AA 3G4WA 3WCWC 2GRFA 1Y2ZA 1C40A 2YRSA 2ZT0A 1Y8KB 3HEPA 1Y46B 3VAUA 1FSXB 1YCBA 3NL7B 2HCOB 5ILRA 1G0AB 3VREA 3UHDA 3MVCA 3E5OA 4MQKA 1N9FA 1SI4B 2VYWA 4G1BA 1RTEA 4MBNA 1UX9A 5KERA 1WMUB 1G9VA 2QMBA 4FC3B 1IBEA 3CY5B 3IXFA 1DTIA 2D5XA 3WCWB 2M6ZB 1MZ0A 3D17A 3LR7A 4FWYA 4HSXA 5AZRA 1NS6A 2MGBA 1NS9A 1DXDA 1SHRA 1MLLA 1NIHB 5HBIA 2XKIA 1MNJA 1QXDB 1IOPA 2AURA 1O1KA 1CQXA 1GBUA 4PQBA 5CHRA 1Y5JB 1C40B 3HHBA 4F69A 4MQGA 3VRFB 1RQ3B 3DR9A 3HC9A 3QQRA 1B86A 4F6GA 2ZSOA 1OFJA 1FAWA 1Y4QB 2D2MD 1RPSB 3ODQB 1C7BB 1Y45A 4FWXA 2HBSA 4TWVA 2ZSQA 3UHRA 1NGKA 1YHUD 5CN7A 1QXEA 5HY8B 4DC7A 1YEUA 2QSSB 4ESAB 2HHBB 2MGDA 1MBIA 2R4YA 5KERB 1Y8WA 1C7CB 1RVWB 1HHOA 1HABB 3QQQA 5JDOF 1Y8IA 4XS0B 1S5XB 1F63A 5HLUA 1YZIA 3D1AB 2EB9A 1YHEB 2HBGA 1NIHA 1LFTA 2DN1A 4PQCA 1DUOA 1DLWA 2VLZA 3WCTC 3QM5A 2V1EA 2MGFA 1F5PA 1SDKA 4MQGB 1JL6A 2DHBA 3UHHA 1G9VB 3BJ3B 2DN2B 1IBEB 3VRFA 1CPWA 1U7RA 3PI4A 4M4BA 2FRKX 3SZKB 3GKVA 1Y85B 1YE2A 1Y7DA 5E6EB 4YU4A 2HBCB 1NS9B 1X9FC 2FRIX 3HENA 3MJUB 1JEBB 3K9ZA 1O1OA 1KD2B 2W72C 1MLMA 1XQ5B 1O1NB 5C6YA 3GQGB 1ITHA 3OVUC 1Y4GB 3UH7A 1YHUB 1A6MA 1M9PB 3IC0B 1J3FA 3PELA 5IKSA 4JACA 1YDZB 4C0NA 4F6FA 2BK9A 3MYNA 3ECZA 1CMYB 4N7NA 2ZT3A 2AA1A 2HZ1A 5SW7B 1Y4VA 2V1KA 2OH8A 1BVDA 1FSXA 4N7OA 2ZFOA 1NZ3A 1LJWB 1VXAA 1BZ0B 2DN2A 3WFUA 2Z6TA 3UHKA 1A9WE 2PEGA 3PI2A 4G1VA 2OIFA 1MBOA 1O1PB 1CIOA 4DWTA 3UGZA 3EDAA 1YIHB 3P5QA 1PBXB 1MNIA 3O89A 1EMYA 1MWDA 1X3KA 2ZSSA 4MAXA 1Y22A 1A6KA 1G0BB 1O1JA 2DHBB 2VM0A 3NG6B 3BJ3A 1LA6B 2EVPA 2HBFA 1YH9B 1SDLB 4NK2A 3OO4B 1MYFA 3LHBA 3BOMB 1XCHA 3QJBA 3M3BA 1BZ6A 1GDIA 3GYSB 1J41B 1Y4FA 2E2YA 2ZFOB 4WCHD 1N9IA 5M3SA 2ZFOD 1XZ2A 3NMMB 5ILPA 2G0RA 2HHDB 1X9FD 1YFFB 1Y09B 2ZWJA 5CN6A 2DXMB 1J7SB 3OK5A 2Z6NB 5JDOC 1YMCA 3KUNA 5E83B 1ECDA 1S5YA 3HEOA 3FH9A 3OGBA 3PIAB 2G11A 4U8UA 1YEUB 1GZXA 1MLGA 4BJAA 2B7HA 1QI8B 1GLIA 103MA 2MYAA 2QRWA 1UIWB 1MTJA 1GBUB 1Y22B 1A01B 1IRCA 1JZKA 1XZUA 1Y2ZB 4KMWA 1BZ1B 1EWAA 1DUKA 1YGDA 1LFTB 1LA6A 1ECAA 5KDQB 3BOMA 1BABB 1DWSA 1U7SA 2MGMA 1H97A 3HRWA 110MA 2ZS0C 1YOGA 2C0KA 5D5RA 2W6VA 3UI0A 4MXLA 1LH3A 2LH3A 3UBVA 4M4AB 3HXNB 2AUQA 1EW6A 3ZOLA 1YHRA 1MKOB 1G0AA 3CY5A 1R1YB 4ROLA 1RQ4B 1YE2B 1THBB 3S66B 1Y5FB 2D2MC 3SDHA 1BIJB 1ABYA 1MBSA 1X46A 1JEBA 1IRDA 3KUOA 1QSHB 1JPBA 1A00B 1SPGA 1M6CA 3ZJMA 2D2NC 3BJ1A 1A0UA 5CN8A 1CH2A 3A0GA 1BZ1A 2ZLXB 1MLUA 1Y0TA 1CP0A 1SPEA 1Y7CA 1Y0CA 1Y7ZA 2VYYA 2ZS0B 3V2VA 2FRJX 1HBGA 1CG5B 3LQDA 3GDJA 1Y35A 3UHZA 3GKVB 1OUTB 4U8UB 3K8BB 4JYQA 3UHWA 1CQ2A 2V1IA 2FRFA 3MJUA 3OZUA 1RQ3A 4QAUA 1QI8A 3WCUC 3GOUA 3ARKA 1V75A 2QMBB 4AVEA 1MYMA 3OZVA 3GQRA 2LH5A 4ESAA 3MBAA 2BW9M 1MKOA 2ZS0D 1BUWA 3H58A 1HGBB 3QM9A 3UHQA 1FDHA 3R5IA 2EF2A 1NS6B 1JW8A 1GBVA 4PNJA 1K1KA 2V1JA 4NS2A 2AUPA 3QJEA 1Y4BA 1OJ6A 1G08A 1AZIA 5JDOD 1O1IA 4FC3A 1O1JB 1DXUA 1XZ7B 3TM9A 3UHSA 1X9FB 1MBAA 4H07A 4G51B 3AQ8A 3CIUA 1YMAA 1FSLA 2O5SX 3UHGA 4H2LA 2PGHA 2QU0B 1GJNA 1KFRA 1HDSA 3SDNA 3TLDA 2BLIA 2G14A 1SHRB 2O5TX 1V4UB 2H8FA 3G4RA 4HSWA 3VRGA 3LB1A 4ILZA 1YEQB 1MYIA 2QSSA 1Z8UB 2R50A 1YFFA 1G09B 106MA 3AQ7A 5EYJA 1SWMA 3HHBB 4DWUA 1C7CA 1RVWA 3ZJRA 1A6GA 3WFWA 1XXTB 1RTXA 1W92A 1MLHA 2VLYA 1YENA 1FAWB 3ZJLA 1Y0TB 3D1KA 4FH6A 2D2NB 3WCWA 1LUEA 1MYGA 5CN4A 4IT8A 1R1XB 2HBSB 1XZ5A 4TWUA 1GBVB 1MBNA 1CG5A 3QJBB 1Y4BB 3ED9A 3LB3A 5HLQA 3BA2A 1HCOB 2OHBA 2AA1B 1UVYA 1V75B 2VEBA 1UFJA 1Y0WB 1X9FA 4KJTA 2MB5A 3NG6A 5EUIA 3A9MA 4M4BB 1HBBA 1HGBA 1MBCA 2W6WA 2LHBA 1YH9A 3M38A 1XYEA 2QFKA 1MLOA 4YU3A 4MQCB 4H0BA 3S65A 3NMLA 5HAVA 2H8DB 1IWHA 4HRRB 1XQ5A 7HBIA 3D7OB 2GNWA 3UHUA 3ONZA 5EETA 1MOAA 4F6DA 3AT5A 3AG0A 1XY0A 3WHMB 3ASEA 1NQPA 2H35A 3IC2B 2EKUA 3DHTA 4F4OB 4MQKB 2HBCA 1DO1A 4ODCB 2GTLB 1GLIB 3HRWB 1FLPA 1HDBA 1MODA 3W4UA 2IG3A 3A59A 1NEJB 5CNEA 2ZT2A 3ORDA 1V9QA 3UHTA 1FCSA 108MA 1A3NA 3V2ZA 3WCTD 1C7DB 1JL7A 1R1YA 2HHEA 2ZSXA 2D2NA 3BCQA 101MA 2D60B 1YIHA 2SPLA 1ABWA 5E6EA 1CH5A 3RGKA 2BLJM 3UGYA 3UHIA 3FS4B 4FH7A 1CH1A 1VXBA 3B75B 2GDMA 4MQHA 2ZLWB 3UHCA 1KD2A 1MWCA 2G3HA 4M4AA 1A4FB 1S5YB 5F2AA 3HF4B 3ODQA 1J3ZA 4FWZA 2HBEB 4MXKA 1RQ4A 3ZOMA 1YHEA 3PT7B 1CH3A 1HV4A 4L7YB 1HBBB 1Q1FA 5C6EA 1HBIA 1QXEB 1A0ZA 1L2KA 3UHVA 4NI0B 2RAOB 2V1FA 1IDRA 1LHTA 1HBAB 3LB4A 1O1KB 4L2MA 1HDBB 1HJTA 2HHDA 1GCWA 3MOUA 4X0LB 3EOKB 1COHB 2XKGA 1D8UA 3A0GB 1C7DA 2Z6NA 1A3NB 1YCAA 1JZLA 2GLNA 3U3EA 4UIQA 1RPSA 3O7NA 1LH6A 1Y35B 3ZHWA 1YVTA 1K1KB 2D6CA 4O2GA 3BJ2B 2GRZA 1DTMA 2GKNA 1HBSB 3GOUB 2ZLWA 1UT0A 2O58X 3UH6A 1A00A 1DXVB 4HHBB 4ROMB 4AVDA 1NAZA 1A0UB 1HLMA 3K3UA 5E83A 1JP9A 1MLRA 1FHJA 3SZKA 2NX0A 1MNKA 3WFXA 1Y7ZB 1A0ZB 4O35A 1HLBA 1SI4A 2ZLTB 1S0HB 3QJEB 3LQDB 2IN4A 2D2MB 1URYA 4N7PA 1EBCA 1MTKA 1CH4A 1OR6A 1CG8B 4NI1A 1UFPA 1MNOA 1YEOB 1S61A 3EOKA 3HXNA 1BBBA 2G0ZA 3QJCB 3ZH0A 5CN5A 2MGCA 1DXCA 4VHBA 1THBA 1JZMA 4N7NB 2HCOA 1YVTB 1V4WA 1BABA 3ZJOA 3VREB 2HZ2A 4HRRA 1JWNA 3LB2A 4B4YA 2RAOA 3HYUB 2QSPB 1WMUA 3WCTB 6HBWA 3ARLA 1O1NA 2DN3A 2GL3A 3GQGA 1K0YA 1JY7B 1YOHA 2ZSPA 1XY0B 3A5BA 1DWTA 5EUIB 3E5IA 3WCUA 2VEEA 3MJPA 1BINA 1MYTA 1BIJA 2D2ND 5E29B 1OUUA 5EE4C 3UH5A 1XZ5B 1S0HA 2GRHA 2HBDB 3EU1B 2ZLTA 3WFTA 3DUTA 2NSRA 2ZT4A 3BJ1B 1CIKA 1QPWA 2BLHA 1Y09A 1HBSA 2PGHB 2R1HA 4IROA 1XZVA 2R4XA 1Y0DA 1Y0WA 3M39A 2HHEB 1Y0AB 1YIEB 4HHBA 1XZ4B 2NRLA 4MQIB 1NPFA 2DN1B 1HGCB 1GDJA 1YVQB 1SDKB 2GTLA 1ASHA 1TU9A 3ZJNA 5HU6B 1PBXA 3A5AA 1LFZB 4MBAA 1O1LA 2VHBA 1NEJA 1HABA 1R1XA 2Z6SA 1Y8IB 3QJDB 3AT5B 2ZS1C 2KSCA 4HRTA 1LFVB 2ZS1A 3OZWA 4KMVA 3QM6A 5ILMA 1GDKA 1OUUB 1DO4A 3OO4A 1Y7GA 5HY8A 3K8BA 2O5OX 1DXUB 3FS4A 4UURA 4G51A 1Y31A 2R1HB 4U8UD 1HHOB 2R4ZA 2G0SA 1BZZB 3H57A 2MHBB 1M6MA 4ZVAA 3EDBA 4XS0A 1VXFA 1J7WB 1UVXA 1CP5A 4YU4B 1MNHA 2MYDA 3AQ5A 1Y4VB 4B3WA 2D60A 1LFQA 1Y4RA 1QSHA 1HBRB 1MOCA 2GTLD 3IC2A 104MA 1MYHA 3NFEB 2ZFBB 1G08B 2W72A 4ODCA 1JDOA 1XXTA 1Y83A 1J52A 2ZLVB 1FHJB 2G0VA 1YHUA 1NWIA 1YHUC 1YE0B 3DHTB 1O1PA 1MLQA 1LH7A 1J7YB 3TM3A 4HBIA 3PI8A 1YMBA 2R80A 1YGDB 4O1TA 1MLNA 4NZIA 4YU3B 1HBHB 1MOHA 3S65B 2O5LX 5AB8A 3D4XB 1MCYA 2OLPA 1DLYA 3RJNB 2R4WA 5ILEA 1IWHB 1HACB 2ZFOC 4N8TB 3D7OA 1CLSA 3QJCA 1Y46A 3QM7A 3WCWD 2MGHA 2BWHA 2PEGB 2Z85A 1LHSA 3NL7A 1YHRB 3G4UA 3WR1A 1AJ9B 1I3DA 3WCPB 1XYEB 4HRTB 3OO5A 3WCVA 1MBDA 3S66A 2HBEA 4MQCA 1A9WA 1Y8HB 2G12A 2RI4A 1A3OB 1V4XB 1UC3A 1DKEB 1NPGA 1VXHA 3M3AA 1DXVA 2V1HA 1YE0A 3WCVD 1G0BA 3WTGB 2BKMA 1VWTA 2XYKA 107MA 5C6EB 1Y4QA 1NWNA 2SPMA 2FAMA 1I3EA 3OJ1A 1SDLA 1NZ2A 2FALA 1NZ5A 2MYCA 1GCVB 1Y4RB 1XZUB 2ZS1D 2O5MX 1NZ4A 3B75A 2QLSB 4O4ZA 1HSYA 1Y4PA 3CIUB 1LFYB 1Y5KA 3RJ6A 2EKTA 3KMFA 4WJG1 3AQ6A 2NSSA 3OO5B 3KMFC 1YZIB 3D1AA 4NXCA 1C7BA 3S48C 2GKMA 2MGEA 1CO9A 3PIAA 2LH7A 3WCVB 1V4XA 3PI9B 3VHBA 2RI4B 4NI0A 1HBHA 3IA3B 1MYJA 1O1LB 4UZVA 3WCUD 3GYSA 1HACA 4MQHB 3ZJQA 1O16A 3QJDA 1K0YB 3W4UB 3D1KB 4F6IA 3AQ9A 3WTGA 4MQJB 2GTLC 1CMYA 2MGJA 5D1VA 3UHBA 1QXDA 1F5OA 1AJ9A 3WCPA 1JP6A 2AV3A 4GZGA 4NI1B 2CMMA 3DUTB 3QZXA 2H8DA 3MKBA 3QM8A 2ZSZA 5AZQA 2AUOA 1YEVB 3R0GA 1LFYA 1YGFB 2D5XB 1MOBA 2WTHA 1UMOA 1LFLB 3D17B 2V1GA 3WCTA 3IC0A 1VXDA 2MYBA 2MGLA 2ZSTA 2LH1A 4F4OA 1JY7A 3PI9A 3WCVC 1RSEA 1BZRA 3WCUB 2W6XA 1J40A 2ZFBA 4OODA 3AT6B 2MGIA 1OR4A 1CG8A 1SPGB 1LH5A 2ZLVA 5CNCA 3G52A 1VXCA 1Y7CB 3ARJA 3G46A 1KR7A 1LJWA 2VLXA 1VRFA 1J7YA 1Y8KA 2ZSNA 3PELB 2MHBA 1CBLA 2HBDA 5CNDA 4MQJA 3GDJB 2ZSYA 2O5BX 1BZPA 111MA 1XZ4A 2LH6A 1QSIB 2VYZA 1Y7GB 5CNFA 1XZVB 4IROB 1HGAA 1O1MA 3PT8B 1YEOA 5F0BA 1DWRA 2DXMA 3BJ2A 1YEVA 2W72B 1BVCA 4WJGA 1DM1A 1BJEA 3UH3A 1VREA 102MA 2BNLA 1RQAB 2Z8AA 4NXAA 2G0XA 1MDNA 1AJHA 105MA 1BZZA 2DC3A 109MA 2BMMA 1Y7DB 3ZJHA 1VHBA 3DHRB 4DC8A 6HBIA 4OF9A 5EYSA 1DO7A 1MTIA 2D5ZB 2ZLUA 2MGAA 4F6JA 1WVPA 1A01A 2OHAA 1S56A 3G53A 3GLNA 1CBMA 1J41A 1Y4FB 1A4FA 3ZJSA 1VWTB 1LFVA 3A59B 3WI8A 4H2LB 1MLJA 1S5XA 2O5QX 1BUWB 5SW7A 3R5IB 1GCVA 1CH9A 3BCQB 1Y45B 1WLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MLF A;  2B7H B;  3VRG B;  1G09 A;  4TYX A;  3MYM A;  4X0L A;  1N9X A;  1QPW B;  3G4Y A;  5HU6 A;  1XZ2 B;  3NMM A;  2W31 A;  1Y5K B;  5JGG B;  1J3Y B;  1Y01 B;  1A6N A;  3MN0 A;  1YIE A;  1J7S A;  2DN3 B;  1JF4 A;  4NK1 A;  3WR1 B;  1HDA B;  3FH9 B;  2SPN A;  3P5Q B;  3DHR A;  1T1N A;  4MPM A;  1YG5 B;  1Y8H A;  1GVH A;  1Y8W B;  1MLS A;  1HCO A;  2GNV A;  3A2G A;  4F6B A;  1O1O B;  1YEQ A;  1DKE A;  3S1I A;  3A5G A;  4U8U C;  1YOI A;  4XDI A;  2YRS B;  1BZ0 A;  3PI8 B;  5MBN A;  1PMB A;  2R80 B;  5CMV A;  1CO8 A;  3WHM A;  5KKK A;  3E55 A;  1Y0A A;  1OUT A;  3S1J A;  1FDH G;  5EU2 A;  3ZJI A;  3MKB B;  112M A;  3ZJP A;  1IT3 A;  1CLS B;  5CNB A;  3NFE A;  1YGF A;  4LPI A;  6HBW B;  2W6V B;  1Y31 B;  1B86 B;  4F68 A;  1IT2 A;  1VXG A;  3ONZ B;  1Y85 A;  2G10 A;  1Y4G A;  1Y0C B;  3MJP B;  1GZX B;  1ABS A;  1HDA A;  3GKT A;  4ROM A;  1J7W A;  1NQP B;  2H35 B;  5EOH A;  5CNG A;  1ABY B;  2LH2 A;  3QMA A;  1LFQ B;  1T1N B;  1UIW A;  1YG5 A;  4PQ6 A;  1O1I B;  1F65 A;  3HYU A;  2D2M A;  4N7P B;  4N8T A;  1Y0D B;  1YDZ A;  3UHN A;  5JOM A;  5CHQ A;  4O4T A;  2MYE A;  4ZVB A;  1FN3 A;  5JGG A;  4C44 A;  1J3Y A;  1HDS B;  1DXT A;  1LFL A;  1LTW A;  2QLS A;  4L7Y A;  5MBA A;  1OBM A;  3GQP B;  2HBF B;  2OH9 A;  4MU5 A;  2SPO A;  1V4U A;  2QFN A;  1YVQ A;  2AV0 A;  1ABW B;  1V4W B;  2XKH A;  3D4X A;  4SDH A;  2ZT1 A;  1O1M B;  3PT8 A;  2NRM A;  1MGN A;  1S69 A;  3GK9 A;  1MLK A;  1N9H A;  1RQA A;  2HHB A;  1YEN B;  1NXF A;  3GQR B;  1XZ7 A;  2QSP A;  2WTG A;  1OFK A;  4MQI A;  3ECL A;  1Y83 B;  3UBC A;  3HF4 A;  2ZS1 B;  1HGC A;  5B84 A;  5B85 A;  1URV A;  2QU0 A;  2W6Y A;  1HV4 B;  1MWB A;  2HZ3 A;  2EVK A;  1CH7 A;  1EBT A;  3PI3 A;  5E29 A;  1H1X A;  3EU1 A;  2H8F B;  1HBA A;  3AT6 A;  3PI1 A;  1B0B A;  1LFZ A;  4N7O B;  1MYZ A;  1VXE A;  1JF3 A;  5CN9 A;  1DO3 A;  5JDO E;  1TES A;  1Y4P B;  1DXT B;  1COH A;  1JP8 A;  1HRM A;  3UHX A;  1ECN A;  2WY4 A;  1J3Z B;  1GDL A;  5EE4 D;  3ZJJ A;  3PT7 A;  1UX8 A;  3G4V A;  2VRY A;  1V5H A;  1HBR A;  1QSI A;  2JHO A;  2D5Z A;  2ZLU B;  1Y5J A;  2ZSR A;  1A3O A;  1HGA B;  2EB8 A;  1BBB B;  2M6Z A;  1AJG A;  2ZLX A;  1GCW B;  2MBW A;  5HLX A;  2MGK A;  1LH2 A;  3G4Q A;  1ECO A;  3UHE A;  1FN3 B;  3QZZ A;  4ROL B;  1V07 A;  1M9P A;  2ZS0 A;  1Y5F A;  4KN3 A;  3LR9 A;  1J40 B;  3UHY A;  5EV5 A;  1LH1 A;  3GQP A;  5EQM A;  1IRD B;  5KDQ A;  3E4N A;  2MGG A;  3ECX A;  1S6A A;  3G4W A;  3WCW C;  2GRF A;  1Y2Z A;  1C40 A;  2YRS A;  2ZT0 A;  1Y8K B;  3HEP A;  1Y46 B;  3VAU A;  1FSX B;  1YCB A;  3NL7 B;  2HCO B;  5ILR A;  1G0A B;  3VRE A;  3UHD A;  3MVC A;  3E5O A;  4MQK A;  1N9F A;  1SI4 B;  2VYW A;  4G1B A;  1RTE A;  4MBN A;  1UX9 A;  5KER A;  1WMU B;  1G9V A;  2QMB A;  4FC3 B;  1IBE A;  3CY5 B;  3IXF A;  1DTI A;  2D5X A;  3WCW B;  2M6Z B;  1MZ0 A;  3D17 A;  3LR7 A;  4FWY A;  4HSX A;  5AZR A;  1NS6 A;  2MGB A;  1NS9 A;  1DXD A;  1SHR A;  1MLL A;  1NIH B;  5HBI A;  2XKI A;  1MNJ A;  1QXD B;  1IOP A;  2AUR A;  1O1K A;  1CQX A;  1GBU A;  4PQB A;  5CHR A;  1Y5J B;  1C40 B;  3HHB A;  4F69 A;  4MQG A;  3VRF B;  1RQ3 B;  3DR9 A;  3HC9 A;  3QQR A;  1B86 A;  4F6G A;  2ZSO A;  1OFJ A;  1FAW A;  1Y4Q B;  2D2M D;  1RPS B;  3ODQ B;  1C7B B;  1Y45 A;  4FWX A;  2HBS A;  4TWV A;  2ZSQ A;  3UHR A;  1NGK A;  1YHU D;  5CN7 A;  1QXE A;  5HY8 B;  4DC7 A;  1YEU A;  2QSS B;  4ESA B;  2HHB B;  2MGD A;  1MBI A;  2R4Y A;  5KER B;  1Y8W A;  1C7C B;  1RVW B;  1HHO A;  1HAB B;  3QQQ A;  5JDO F;  1Y8I A;  4XS0 B;  1S5X B;  1F63 A;  5HLU A;  1YZI A;  3D1A B;  2EB9 A;  1YHE B;  2HBG A;  1NIH A;  1LFT A;  2DN1 A;  4PQC A;  1DUO A;  1DLW A;  2VLZ A;  3WCT C;  3QM5 A;  2V1E A;  2MGF A;  1F5P A;  1SDK A;  4MQG B;  1JL6 A;  2DHB A;  3UHH A;  1G9V B;  3BJ3 B;  2DN2 B;  1IBE B;  3VRF A;  1CPW A;  1U7R A;  3PI4 A;  4M4B A;  2FRK X;  3SZK B;  3GKV A;  1Y85 B;  1YE2 A;  1Y7D A;  5E6E B;  4YU4 A;  2HBC B;  1NS9 B;  1X9F C;  2FRI X;  3HEN A;  3MJU B;  1JEB B;  3K9Z A;  1O1O A;  1KD2 B;  2W72 C;  1MLM A;  1XQ5 B;  1O1N B;  5C6Y A;  3GQG B;  1ITH A;  3OVU C;  1Y4G B;  3UH7 A;  1YHU B;  1A6M A;  1M9P B;  3IC0 B;  1J3F A;  3PEL A;  5IKS A;  4JAC A;  1YDZ B;  4C0N A;  4F6F A;  2BK9 A;  3MYN A;  3ECZ A;  1CMY B;  4N7N A;  2ZT3 A;  2AA1 A;  2HZ1 A;  5SW7 B;  1Y4V A;  2V1K A;  2OH8 A;  1BVD A;  1FSX A;  4N7O A;  2ZFO A;  1NZ3 A;  1LJW B;  1VXA A;  1BZ0 B;  2DN2 A;  3WFU A;  2Z6T A;  3UHK A;  1A9W E;  2PEG A;  3PI2 A;  4G1V A;  2OIF A;  1MBO A;  1O1P B;  1CIO A;  4DWT A;  3UGZ A;  3EDA A;  1YIH B;  3P5Q A;  1PBX B;  1MNI A;  3O89 A;  1EMY A;  1MWD A;  1X3K A;  2ZSS A;  4MAX A;  1Y22 A;  1A6K A;  1G0B B;  1O1J A;  2DHB B;  2VM0 A;  3NG6 B;  3BJ3 A;  1LA6 B;  2EVP A;  2HBF A;  1YH9 B;  1SDL B;  4NK2 A;  3OO4 B;  1MYF A;  3LHB A;  3BOM B;  1XCH A;  3QJB A;  3M3B A;  1BZ6 A;  1GDI A;  3GYS B;  1J41 B;  1Y4F A;  2E2Y A;  2ZFO B;  4WCH D;  1N9I A;  5M3S A;  2ZFO D;  1XZ2 A;  3NMM B;  5ILP A;  2G0R A;  2HHD B;  1X9F D;  1YFF B;  1Y09 B;  2ZWJ A;  5CN6 A;  2DXM B;  1J7S B;  3OK5 A;  2Z6N B;  5JDO C;  1YMC A;  3KUN A;  5E83 B;  1ECD A;  1S5Y A;  3HEO A;  3FH9 A;  3OGB A;  3PIA B;  2G11 A;  4U8U A;  1YEU B;  1GZX A;  1MLG A;  4BJA A;  2B7H A;  1QI8 B;  1GLI A;  103M A;  2MYA A;  2QRW A;  1UIW B;  1MTJ A;  1GBU B;  1Y22 B;  1A01 B;  1IRC A;  1JZK A;  1XZU A;  1Y2Z B;  4KMW A;  1BZ1 B;  1EWA A;  1DUK A;  1YGD A;  1LFT B;  1LA6 A;  1ECA A;  5KDQ B;  3BOM A;  1BAB B;  1DWS A;  1U7S A;  2MGM A;  1H97 A;  3HRW A;  110M A;  2ZS0 C;  1YOG A;  2C0K A;  5D5R A;  2W6V A;  3UI0 A;  4MXL A;  1LH3 A;  2LH3 A;  3UBV A;  4M4A B;  3HXN B;  2AUQ A;  1EW6 A;  3ZOL A;  1YHR A;  1MKO B;  1G0A A;  3CY5 A;  1R1Y B;  4ROL A;  1RQ4 B;  1YE2 B;  1THB B;  3S66 B;  1Y5F B;  2D2M C;  3SDH A;  1BIJ B;  1ABY A;  1MBS A;  1X46 A;  1JEB A;  1IRD A;  3KUO A;  1QSH B;  1JPB A;  1A00 B;  1SPG A;  1M6C A;  3ZJM A;  2D2N C;  3BJ1 A;  1A0U A;  5CN8 A;  1CH2 A;  3A0G A;  1BZ1 A;  2ZLX B;  1MLU A;  1Y0T A;  1CP0 A;  1SPE A;  1Y7C A;  1Y0C A;  1Y7Z A;  2VYY A;  2ZS0 B;  3V2V A;  2FRJ X;  1HBG A;  1CG5 B;  3LQD A;  3GDJ A;  1Y35 A;  3UHZ A;  3GKV B;  1OUT B;  4U8U B;  3K8B B;  4JYQ A;  3UHW A;  1CQ2 A;  2V1I A;  2FRF A;  3MJU A;  3OZU A;  1RQ3 A;  4QAU A;  1QI8 A;  3WCU C;  3GOU A;  3ARK A;  1V75 A;  2QMB B;  4AVE A;  1MYM A;  3OZV A;  3GQR A;  2LH5 A;  4ESA A;  3MBA A;  2BW9 M;  1MKO A;  2ZS0 D;  1BUW A;  3H58 A;  1HGB B;  3QM9 A;  3UHQ A;  1FDH A;  3R5I A;  2EF2 A;  1NS6 B;  1JW8 A;  1GBV A;  4PNJ A;  1K1K A;  2V1J A;  4NS2 A;  2AUP A;  3QJE A;  1Y4B A;  1OJ6 A;  1G08 A;  1AZI A;  5JDO D;  1O1I A;  4FC3 A;  1O1J B;  1DXU A;  1XZ7 B;  3TM9 A;  3UHS A;  1X9F B;  1MBA A;  4H07 A;  4G51 B;  3AQ8 A;  3CIU A;  1YMA A;  1FSL A;  2O5S X;  3UHG A;  4H2L A;  2PGH A;  2QU0 B;  1GJN A;  1KFR A;  1HDS A;  3SDN A;  3TLD A;  2BLI A;  2G14 A;  1SHR B;  2O5T X;  1V4U B;  2H8F A;  3G4R A;  4HSW A;  3VRG A;  3LB1 A;  4ILZ A;  1YEQ B;  1MYI A;  2QSS A;  1Z8U B;  2R50 A;  1YFF A;  1G09 B;  106M A;  3AQ7 A;  5EYJ A;  1SWM A;  3HHB B;  4DWU A;  1C7C A;  1RVW A;  3ZJR A;  1A6G A;  3WFW A;  1XXT B;  1RTX A;  1W92 A;  1MLH A;  2VLY A;  1YEN A;  1FAW B;  3ZJL A;  1Y0T B;  3D1K A;  4FH6 A;  2D2N B;  3WCW A;  1LUE A;  1MYG A;  5CN4 A;  4IT8 A;  1R1X B;  2HBS B;  1XZ5 A;  4TWU A;  1GBV B;  1MBN A;  1CG5 A;  3QJB B;  1Y4B B;  3ED9 A;  3LB3 A;  5HLQ A;  3BA2 A;  1HCO B;  2OHB A;  2AA1 B;  1UVY A;  1V75 B;  2VEB A;  1UFJ A;  1Y0W B;  1X9F A;  4KJT A;  2MB5 A;  3NG6 A;  5EUI A;  3A9M A;  4M4B B;  1HBB A;  1HGB A;  1MBC A;  2W6W A;  2LHB A;  1YH9 A;  3M38 A;  1XYE A;  2QFK A;  1MLO A;  4YU3 A;  4MQC B;  4H0B A;  3S65 A;  3NML A;  5HAV A;  2H8D B;  1IWH A;  4HRR B;  1XQ5 A;  7HBI A;  3D7O B;  2GNW A;  3UHU A;  3ONZ A;  5EET A;  1MOA A;  4F6D A;  3AT5 A;  3AG0 A;  1XY0 A;  3WHM B;  3ASE A;  1NQP A;  2H35 A;  3IC2 B;  2EKU A;  3DHT A;  4F4O B;  4MQK B;  2HBC A;  1DO1 A;  4ODC B;  2GTL B;  1GLI B;  3HRW B;  1FLP A;  1HDB A;  1MOD A;  3W4U A;  2IG3 A;  3A59 A;  1NEJ B;  5CNE A;  2ZT2 A;  3ORD A;  1V9Q A;  3UHT A;  1FCS A;  108M A;  1A3N A;  3V2Z A;  3WCT D;  1C7D B;  1JL7 A;  1R1Y A;  2HHE A;  2ZSX A;  2D2N A;  3BCQ A;  101M A;  2D60 B;  1YIH A;  2SPL A;  1ABW A;  5E6E A;  1CH5 A;  3RGK A;  2BLJ M;  3UGY A;  3UHI A;  3FS4 B;  4FH7 A;  1CH1 A;  1VXB A;  3B75 B;  2GDM A;  4MQH A;  2ZLW B;  3UHC A;  1KD2 A;  1MWC A;  2G3H A;  4M4A A;  1A4F B;  1S5Y B;  5F2A A;  3HF4 B;  3ODQ A;  1J3Z A;  4FWZ A;  2HBE B;  4MXK A;  1RQ4 A;  3ZOM A;  1YHE A;  3PT7 B;  1CH3 A;  1HV4 A;  4L7Y B;  1HBB B;  1Q1F A;  5C6E A;  1HBI A;  1QXE B;  1A0Z A;  1L2K A;  3UHV A;  4NI0 B;  2RAO B;  2V1F A;  1IDR A;  1LHT A;  1HBA B;  3LB4 A;  1O1K B;  4L2M A;  1HDB B;  1HJT A;  2HHD A;  1GCW A;  3MOU A;  4X0L B;  3EOK B;  1COH B;  2XKG A;  1D8U A;  3A0G B;  1C7D A;  2Z6N A;  1A3N B;  1YCA A;  1JZL A;  2GLN A;  3U3E A;  4UIQ A;  1RPS A;  3O7N A;  1LH6 A;  1Y35 B;  3ZHW A;  1YVT A;  1K1K B;  2D6C A;  4O2G A;  3BJ2 B;  2GRZ A;  1DTM A;  2GKN A;  1HBS B;  3GOU B;  2ZLW A;  1UT0 A;  2O58 X;  3UH6 A;  1A00 A;  1DXV B;  4HHB B;  4ROM B;  4AVD A;  1NAZ A;  1A0U B;  1HLM A;  3K3U A;  5E83 A;  1JP9 A;  1MLR A;  1FHJ A;  3SZK A;  2NX0 A;  1MNK A;  3WFX A;  1Y7Z B;  1A0Z B;  4O35 A;  1HLB A;  1SI4 A;  2ZLT B;  1S0H B;  3QJE B;  3LQD B;  2IN4 A;  2D2M B;  1URY A;  4N7P A;  1EBC A;  1MTK A;  1CH4 A;  1OR6 A;  1CG8 B;  4NI1 A;  1UFP A;  1MNO A;  1YEO B;  1S61 A;  3EOK A;  3HXN A;  1BBB A;  2G0Z A;  3QJC B;  3ZH0 A;  5CN5 A;  2MGC A;  1DXC A;  4VHB A;  1THB A;  1JZM A;  4N7N B;  2HCO A;  1YVT B;  1V4W A;  1BAB A;  3ZJO A;  3VRE B;  2HZ2 A;  4HRR A;  1JWN A;  3LB2 A;  4B4Y A;  2RAO A;  3HYU B;  2QSP B;  1WMU A;  3WCT B;  6HBW A;  3ARL A;  1O1N A;  2DN3 A;  2GL3 A;  3GQG A;  1K0Y A;  1JY7 B;  1YOH A;  2ZSP A;  1XY0 B;  3A5B A;  1DWT A;  5EUI B;  3E5I A;  3WCU A;  2VEE A;  3MJP A;  1BIN A;  1MYT A;  1BIJ A;  2D2N D;  5E29 B;  1OUU A;  5EE4 C;  3UH5 A;  1XZ5 B;  1S0H A;  2GRH A;  2HBD B;  3EU1 B;  2ZLT A;  3WFT A;  3DUT A;  2NSR A;  2ZT4 A;  3BJ1 B;  1CIK A;  1QPW A;  2BLH A;  1Y09 A;  1HBS A;  2PGH B;  2R1H A;  4IRO A;  1XZV A;  2R4X A;  1Y0D A;  1Y0W A;  3M39 A;  2HHE B;  1Y0A B;  1YIE B;  4HHB A;  1XZ4 B;  2NRL A;  4MQI B;  1NPF A;  2DN1 B;  1HGC B;  1GDJ A;  1YVQ B;  1SDK B;  2GTL A;  1ASH A;  1TU9 A;  3ZJN A;  5HU6 B;  1PBX A;  3A5A A;  1LFZ B;  4MBA A;  1O1L A;  2VHB A;  1NEJ A;  1HAB A;  1R1X A;  2Z6S A;  1Y8I B;  3QJD B;  3AT5 B;  2ZS1 C;  2KSC A;  4HRT A;  1LFV B;  2ZS1 A;  3OZW A;  4KMV A;  3QM6 A;  5ILM A;  1GDK A;  1OUU B;  1DO4 A;  3OO4 A;  1Y7G A;  5HY8 A;  3K8B A;  2O5O X;  1DXU B;  3FS4 A;  4UUR A;  4G51 A;  1Y31 A;  2R1H B;  4U8U D;  1HHO B;  2R4Z A;  2G0S A;  1BZZ B;  3H57 A;  2MHB B;  1M6M A;  4ZVA A;  3EDB A;  4XS0 A;  1VXF A;  1J7W B;  1UVX A;  1CP5 A;  4YU4 B;  1MNH A;  2MYD A;  3AQ5 A;  1Y4V B;  4B3W A;  2D60 A;  1LFQ A;  1Y4R A;  1QSH A;  1HBR B;  1MOC A;  2GTL D;  3IC2 A;  104M A;  1MYH A;  3NFE B;  2ZFB B;  1G08 B;  2W72 A;  4ODC A;  1JDO A;  1XXT A;  1Y83 A;  1J52 A;  2ZLV B;  1FHJ B;  2G0V A;  1YHU A;  1NWI A;  1YHU C;  1YE0 B;  3DHT B;  1O1P A;  1MLQ A;  1LH7 A;  1J7Y B;  3TM3 A;  4HBI A;  3PI8 A;  1YMB A;  2R80 A;  1YGD B;  4O1T A;  1MLN A;  4NZI A;  4YU3 B;  1HBH B;  1MOH A;  3S65 B;  2O5L X;  5AB8 A;  3D4X B;  1MCY A;  2OLP A;  1DLY A;  3RJN B;  2R4W A;  5ILE A;  1IWH B;  1HAC B;  2ZFO C;  4N8T B;  3D7O A;  1CLS A;  3QJC A;  1Y46 A;  3QM7 A;  3WCW D;  2MGH A;  2BWH A;  2PEG B;  2Z85 A;  1LHS A;  3NL7 A;  1YHR B;  3G4U A;  3WR1 A;  1AJ9 B;  1I3D A;  3WCP B;  1XYE B;  4HRT B;  3OO5 A;  3WCV A;  1MBD A;  3S66 A;  2HBE A;  4MQC A;  1A9W A;  1Y8H B;  2G12 A;  2RI4 A;  1A3O B;  1V4X B;  1UC3 A;  1DKE B;  1NPG A;  1VXH A;  3M3A A;  1DXV A;  2V1H A;  1YE0 A;  3WCV D;  1G0B A;  3WTG B;  2BKM A;  1VWT A;  2XYK A;  107M A;  5C6E B;  1Y4Q A;  1NWN A;  2SPM A;  2FAM A;  1I3E A;  3OJ1 A;  1SDL A;  1NZ2 A;  2FAL A;  1NZ5 A;  2MYC A;  1GCV B;  1Y4R B;  1XZU B;  2ZS1 D;  2O5M X;  1NZ4 A;  3B75 A;  2QLS B;  4O4Z A;  1HSY A;  1Y4P A;  3CIU B;  1LFY B;  1Y5K A;  3RJ6 A;  2EKT A;  3KMF A;  4WJG 1;  3AQ6 A;  2NSS A;  3OO5 B;  3KMF C;  1YZI B;  3D1A A;  4NXC A;  1C7B A;  3S48 C;  2GKM A;  2MGE A;  1CO9 A;  3PIA A;  2LH7 A;  3WCV B;  1V4X A;  3PI9 B;  3VHB A;  2RI4 B;  4NI0 A;  1HBH A;  3IA3 B;  1MYJ A;  1O1L B;  4UZV A;  3WCU D;  3GYS A;  1HAC A;  4MQH B;  3ZJQ A;  1O16 A;  3QJD A;  1K0Y B;  3W4U B;  3D1K B;  4F6I A;  3AQ9 A;  3WTG A;  4MQJ B;  2GTL C;  1CMY A;  2MGJ A;  5D1V A;  3UHB A;  1QXD A;  1F5O A;  1AJ9 A;  3WCP A;  1JP6 A;  2AV3 A;  4GZG A;  4NI1 B;  2CMM A;  3DUT B;  3QZX A;  2H8D A;  3MKB A;  3QM8 A;  2ZSZ A;  5AZQ A;  2AUO A;  1YEV B;  3R0G A;  1LFY A;  1YGF B;  2D5X B;  1MOB A;  2WTH A;  1UMO A;  1LFL B;  3D17 B;  2V1G A;  3WCT A;  3IC0 A;  1VXD A;  2MYB A;  2MGL A;  2ZST A;  2LH1 A;  4F4O A;  1JY7 A;  3PI9 A;  3WCV C;  1RSE A;  1BZR A;  3WCU B;  2W6X A;  1J40 A;  2ZFB A;  4OOD A;  3AT6 B;  2MGI A;  1OR4 A;  1CG8 A;  1SPG B;  1LH5 A;  2ZLV A;  5CNC A;  3G52 A;  1VXC A;  1Y7C B;  3ARJ A;  3G46 A;  1KR7 A;  1LJW A;  2VLX A;  1VRF A;  1J7Y A;  1Y8K A;  2ZSN A;  3PEL B;  2MHB A;  1CBL A;  2HBD A;  5CND A;  4MQJ A;  3GDJ B;  2ZSY A;  2O5B X;  1BZP A;  111M A;  1XZ4 A;  2LH6 A;  1QSI B;  2VYZ A;  1Y7G B;  5CNF A;  1XZV B;  4IRO B;  1HGA A;  1O1M A;  3PT8 B;  1YEO A;  5F0B A;  1DWR A;  2DXM A;  3BJ2 A;  1YEV A;  2W72 B;  1BVC A;  4WJG A;  1DM1 A;  1BJE A;  3UH3 A;  1VRE A;  102M A;  2BNL A;  1RQA B;  2Z8A A;  4NXA A;  2G0X A;  1MDN A;  1AJH A;  105M A;  1BZZ A;  2DC3 A;  109M A;  2BMM A;  1Y7D B;  3ZJH A;  1VHB A;  3DHR B;  4DC8 A;  6HBI A;  4OF9 A;  5EYS A;  1DO7 A;  1MTI A;  2D5Z B;  2ZLU A;  2MGA A;  4F6J A;  1WVP A;  1A01 A;  2OHA A;  1S56 A;  3G53 A;  3GLN A;  1CBM A;  1J41 A;  1Y4F B;  1A4F A;  3ZJS A;  1VWT B;  1LFV A;  3A59 B;  3WI8 A;  4H2L B;  1MLJ A;  1S5X A;  2O5Q X;  1BUW B;  5SW7 A;  3R5I B;  1GCV A;  1CH9 A;  3BCQ B;  1Y45 B;  1WLA A; 
#chains in the Genus database with same CATH topology
 4F0U B;  1MLF A;  2B7H B;  3VRG B;  1G09 A;  5FVB A;  4TYX A;  3MYM A;  4X0L A;  1N9X A;  1QPW B;  3G4Y A;  5HU6 A;  1XZ2 B;  3NMM A;  2W31 A;  1Y5K B;  5JGG B;  1J3Y B;  1Y01 B;  1A6N A;  1HA7 B;  3MN0 A;  1ON7 A;  1YIE A;  1J7S A;  2DN3 B;  1JF4 A;  4NK1 A;  3WR1 B;  1HDA B;  3FH9 B;  2SPN A;  3P5Q B;  3DHR A;  1T1N A;  4MPM A;  1YG5 B;  1Y8H A;  1GVH A;  1Y8W B;  1MLS A;  1HCO A;  2GNV A;  3A2G A;  4F6B A;  1O1O B;  1YEQ A;  1DKE A;  3S1I A;  2JLF A;  3A5G A;  4U8U C;  1YOI A;  5B13 A;  4XDI A;  2YRS B;  1BZ0 A;  3PI8 B;  5MBN A;  1PMB A;  2R80 B;  5CMV A;  1CO8 A;  3WHM A;  5KKK A;  3E55 A;  1Y0A A;  1OUT A;  3S1J A;  3GUQ A;  1FDH G;  5EU2 A;  3ZJI A;  3MKB B;  1B8D A;  112M A;  3ZJP A;  1IT3 A;  1CLS B;  5CNB A;  3NFE A;  1YGF A;  4LPI A;  6HBW B;  2W6V B;  1Y31 B;  1B86 B;  4F68 A;  1IT2 A;  1VXG A;  3ONZ B;  3O18 B;  1Y85 A;  2G10 A;  1Y4G A;  1Y0C B;  3MJP B;  1GZX B;  1ABS A;  1HDA A;  3GKT A;  4ROM A;  1J7W A;  1NQP B;  2H35 B;  5EOH A;  5AQD A;  5CNG A;  1ABY B;  2LH2 A;  3QMA A;  1LFQ B;  2C7L A;  1T1N B;  1UIW A;  1YG5 A;  4PQ6 A;  1O1I B;  3PMD A;  1F65 A;  3HYU A;  2WCR A;  1TOX A;  2D2M A;  4N7P B;  4N8T A;  1Y0D B;  1YDZ A;  3UHN A;  5JOM A;  5CHQ A;  4O4T A;  2MYE A;  4ZVB A;  1FN3 A;  5JGG A;  4C44 A;  1J3Y A;  1HDS B;  1DXT A;  1LFL A;  1LTW A;  2QLS A;  4L7Y A;  5MBA A;  1OBM A;  3GQP B;  2HBF B;  2OH9 A;  4MU5 A;  2SPO A;  1HHT P;  1V4U A;  2QFN A;  1YVQ A;  2AV0 A;  1ABW B;  1V4W B;  2XKH A;  3D4X A;  4SDH A;  2ZT1 A;  1O1M B;  3PT8 A;  2NRM A;  1MGN A;  1S69 A;  3GK9 A;  1MLK A;  1N9H A;  1RQA A;  2HHB A;  1YEN B;  1NXF A;  3GQR B;  1XZ7 A;  4BS9 A;  1KN1 B;  2QSP A;  2UUM A;  2WTG A;  1OFK A;  4MQI A;  3ECL A;  5B13 G;  1Y83 B;  3UBC A;  3HF4 A;  2ZS1 B;  1HGC A;  5B84 A;  5B85 A;  1URV A;  2QU0 A;  2W6Y A;  1HV4 B;  1MWB A;  2HZ3 A;  2EVK A;  4A8M P;  1CH7 A;  1EBT A;  3PI3 A;  5E29 A;  1H1X A;  3EU1 A;  2H8F B;  1HBA A;  3AT6 A;  3PI1 A;  1B0B A;  1XG0 C;  1LFZ A;  4N7O B;  1MYZ A;  1VXE A;  1JF3 A;  5CN9 A;  1DO3 A;  5JDO E;  1TES A;  1Y4P B;  1DXT B;  1COH A;  1JP8 A;  3V57 A;  1HRM A;  3UHX A;  1ECN A;  2VML B;  2WY4 A;  1J3Z B;  1GDL A;  5EE4 D;  3ZJJ A;  3PT7 A;  1UX8 A;  3G4V A;  2VRY A;  1V5H A;  1HBR A;  1QSI A;  2JHO A;  2D5Z A;  2ZLU B;  1Y5J A;  4L1E A;  2ZSR A;  1A3O A;  2X4A A;  1HGA B;  2EB8 A;  1BBB B;  4AE1 A;  1B33 B;  2M6Z A;  1AJG A;  2ZLX A;  2I88 A;  1GCW B;  1DDT A;  2MBW A;  5HLX A;  2MGK A;  1LH2 A;  3G4Q A;  1ECO A;  3UHE A;  1FN3 B;  3QZZ A;  4ROL B;  1V07 A;  1M9P A;  2ZS0 A;  1Y5F A;  4KN3 A;  3LR9 A;  1J40 B;  3UHY A;  5EV5 A;  1LH1 A;  3GQP A;  5EQM A;  1IRD B;  5KDQ A;  3E4N A;  2MGG A;  3ECX A;  1S6A A;  3G4W A;  2UUL C;  3WCW C;  2GRF A;  1Y2Z A;  1C40 A;  2YRS A;  2ZT0 A;  4H0M B;  1Y8K B;  3HEP A;  1Y46 B;  3VAU A;  1FSX B;  1YCB A;  3NL7 B;  2HCO B;  5ILR A;  1G0A B;  3VRE A;  3UHD A;  3MVC A;  3E5O A;  4MQK A;  1N9F A;  1KTP B;  1SI4 B;  2VYW A;  4A8Q A;  4G1B A;  1RTE A;  4MBN A;  1UX9 A;  4L1E B;  5KER A;  1WMU B;  1G9V A;  2QMB A;  4FC3 B;  1IBE A;  4ZIZ A;  3CY5 B;  3IXF A;  1DTI A;  2D5X A;  3WCW B;  2M6Z B;  1MZ0 A;  3D17 A;  2X49 A;  3LR7 A;  4FWY A;  4HSX A;  5AZR A;  1NS6 A;  1XDT T;  2VML A;  2MGB A;  1NS9 A;  1DXD A;  1SHR A;  1MLL A;  1NIH B;  5HBI A;  2XKI A;  1MNJ A;  1QXD B;  1IOP A;  2AUR A;  1O1K A;  1CQX A;  1GBU A;  4PQB A;  5CHR A;  1Y5J B;  1C40 B;  3HHB A;  4F69 A;  4MQG A;  3VRF B;  1RQ3 B;  3DR9 A;  3HC9 A;  3QQR A;  1B86 A;  4F6G A;  2ZSO A;  1OFJ A;  1FAW A;  1Y4Q B;  2D2M D;  1RPS B;  3ODQ B;  1C7B B;  1Y45 A;  4FWX A;  1HA7 A;  1LIA A;  2HBS A;  4TWV A;  2ZSQ A;  3UHR A;  1NGK A;  1YHU D;  5CN7 A;  1QXE A;  5HY8 B;  4DC7 A;  1YEU A;  2QSS B;  4ESA B;  2HHB B;  2MGD A;  1MBI A;  2R4Y A;  5KER B;  1Y8W A;  1C7C B;  1RVW B;  1HHO A;  1PHN A;  1HAB B;  3QQQ A;  5JDO F;  1Y8I A;  1HI8 A;  4XS0 B;  1S5X B;  1F63 A;  5HLU A;  1YZI A;  3D1A B;  2EB9 A;  4LMX B;  1YHE B;  2HBG A;  1NIH A;  1LFT A;  2DN1 A;  4PQC A;  1DUO A;  1DLW A;  1F0L A;  1RH1 A;  2VLZ A;  3WCT C;  3QM5 A;  2V1E A;  2MGF A;  1F5P A;  1SDK A;  4MQG B;  2UUN D;  1JL6 A;  2DHB A;  3UHH A;  1G9V B;  3BJ3 B;  2DN2 B;  1IBE B;  3VRF A;  1CPW A;  1U7R A;  3PI4 A;  4M4B A;  2FRK X;  3SZK B;  3GKV A;  1Y85 B;  1YE2 A;  1Y7D A;  5E6E B;  4YU4 A;  2HBC B;  1NS9 B;  1X9F C;  2FRI X;  3HEN A;  3MJU B;  1JEB B;  3K9Z A;  1O1O A;  1KD2 B;  2W72 C;  1MLM A;  1XQ5 B;  1O1N B;  5C6Y A;  3GQG B;  1ITH A;  1HHS A;  3OVU C;  3O2C B;  1Y4G B;  3UH7 A;  1YHU B;  4GXE B;  1A6M A;  1M9P B;  3IC0 B;  1J3F A;  3PEL A;  5IKS A;  4JAC A;  1YDZ B;  4C0N A;  4F6F A;  2BK9 A;  3MYN A;  3ECZ A;  1CMY B;  4N7N A;  1NY9 A;  2ZT3 A;  3KVS B;  1B8D B;  2AA1 A;  2HZ1 A;  5SW7 B;  2UUL H;  3NUH B;  1Y4V A;  2V1K A;  2OH8 A;  1BVD A;  1FSX A;  4N7O A;  2ZFO A;  1NZ3 A;  1LJW B;  1VXA A;  1BZ0 B;  2DN2 A;  3WFU A;  2Z6T A;  3UHK A;  1A9W E;  3O18 A;  2PEG A;  3PI2 A;  4G1V A;  2OIF A;  1MBO A;  1O1P B;  1CIO A;  1KTP A;  1WAC A;  4DWT A;  4N6S B;  3UGZ A;  3EDA A;  1YIH B;  3P5Q A;  1PBX B;  2V8A B;  4TMA B;  1MNI A;  3O89 A;  1EMY A;  1MWD A;  4ETV A;  1X3K A;  2ZSS A;  4MAX A;  4BJU A;  1Y22 A;  1A6K A;  1G0B B;  1O1J A;  2DHB B;  2VM0 A;  3NG6 B;  3BJ3 A;  1LA6 B;  2EVP A;  2HBF A;  1YH9 B;  1SDL B;  4NK2 A;  3OO4 B;  2C7K A;  1MYF A;  3LHB A;  3BOM B;  1XCH A;  3QJB A;  3M3B A;  1BZ6 A;  1GDI A;  3GYS B;  1J41 B;  1Y4F A;  2E2Y A;  2ZFO B;  4A8F A;  4WCH D;  1N9I A;  5M3S A;  2ZFO D;  1XZ2 A;  3NMM B;  5ILP A;  2G0R A;  2HHD B;  1X9F D;  4ERV A;  1YFF B;  1XF6 C;  1Y09 B;  2ZWJ A;  5CN6 A;  2DXM B;  2VJR B;  1J7S B;  3OK5 A;  2Z6N B;  5JDO C;  4A8W A;  1YMC A;  3KUN A;  5E83 B;  1ECD A;  1S5Y A;  3HEO A;  3FH9 A;  3OGB A;  3PIA B;  2G11 A;  4U8U A;  1YEU B;  1GZX A;  1MLG A;  4BJA A;  2B7H A;  1QI8 B;  1GLI A;  103M A;  2MYA A;  2QRW A;  1UIW B;  1MTJ A;  1GBU B;  1Y22 B;  1A01 B;  2DKA A;  1IRC A;  1JZK A;  1XZU A;  1Y2Z B;  4KMW A;  1BZ1 B;  2UUM X;  1EWA A;  3MWN A;  1DUK A;  1YGD A;  1LFT B;  1LA6 A;  1ECA A;  5KDQ B;  3BOM A;  1BAB B;  1DWS A;  1U7S A;  2MGM A;  1H97 A;  1UVN A;  3HRW A;  110M A;  2ZS0 C;  1YOG A;  2C0K A;  5D5R A;  2W6V A;  3UI0 A;  4MXL A;  1LH3 A;  2LH3 A;  3UBV A;  4M4A B;  3HXN B;  2AUQ A;  3VNC A;  1EW6 A;  3ZOL A;  1YHR A;  4HH1 A;  2UUL A;  1MKO B;  1G0A A;  3CY5 A;  1R1Y B;  4ROL A;  1RQ4 B;  1YE2 B;  1THB B;  3S66 B;  1Y5F B;  2D2M C;  3SDH A;  1BIJ B;  1ABY A;  1MBS A;  1X46 A;  1JEB A;  1IRD A;  3KUO A;  1QSH B;  1JPB A;  1A00 B;  1SPG A;  4A8O A;  1M6C A;  3ZJM A;  2D2N C;  3BJ1 A;  1A0U A;  5CN8 A;  1CH2 A;  3A0G A;  1BZ1 A;  2ZLX B;  1MLU A;  1Y0T A;  1CP0 A;  1SPE A;  1Y7C A;  1Y0C A;  1Y7Z A;  2VYY A;  2ZS0 B;  3V2V A;  4ETU A;  2FRJ X;  1HBG A;  1CG5 B;  3LQD A;  3GDJ A;  1Y35 A;  3UHZ A;  3GKV B;  1OUT B;  3V58 B;  4U8U B;  3K8B B;  1MDT A;  4JYQ A;  1CQ2 A;  3UHW A;  2V1I A;  4A8K A;  2FRF A;  3MJU A;  3OZU A;  1RQ3 A;  4QAU A;  1QI8 A;  3WCU C;  3GOU A;  3ARK A;  1V75 A;  4H0M A;  2QMB B;  4AVE A;  1MYM A;  3OZV A;  3GQR A;  2LH5 A;  4ESA A;  3MBA A;  2BW9 M;  1MKO A;  2ZS0 D;  4ETT A;  1BUW A;  3H58 A;  1HGB B;  3QM9 A;  3UHQ A;  1FDH A;  3R5I A;  2EF2 A;  1NS6 B;  1JW8 A;  1GBV A;  4PNJ A;  4PO5 A;  1K1K A;  2V1J A;  4NS2 A;  2AUP A;  3QJE A;  1Y4B A;  1OJ6 A;  1G08 A;  1AZI A;  5JDO D;  4ERT A;  1O1I A;  4FC3 A;  1O1J B;  1COL A;  1DXU A;  1XZ7 B;  3TM9 A;  1UVK A;  3UHS A;  1X9F B;  1MBA A;  4H07 A;  4G51 B;  1JBO B;  3AQ8 A;  3CIU A;  1YMA A;  1FSL A;  2O5S X;  3UHG A;  4H2L A;  4YJJ A;  2PGH A;  2QU0 B;  1GJN A;  1KFR A;  1HDS A;  3SDN A;  3TLD A;  2BLI A;  2G14 A;  1SHR B;  2O5T X;  1V4U B;  2H8F A;  3G4R A;  4HSW A;  3VRG A;  3LB1 A;  4ILZ A;  1YEQ B;  1MYI A;  2QSS A;  4F0U A;  1Z8U B;  2R50 A;  1YFF A;  1G09 B;  106M A;  3AQ7 A;  5EYJ A;  1SWM A;  3HHB B;  4DWU A;  1C7C A;  1RVW A;  3ZJR A;  1A6G A;  3WFW A;  1XXT B;  1RTX A;  1W92 A;  1MLH A;  2VLY A;  1YEN A;  1FAW B;  3ZJL A;  1Y0T B;  3D1K A;  1KN1 A;  4FH6 A;  2D2N B;  3WCW A;  1LUE A;  1MYG A;  5CN4 A;  4IT8 A;  1R1X B;  2HBS B;  1XZ5 A;  4TWU A;  1GBV B;  1MBN A;  1CG5 A;  3BRP A;  3QJB B;  1Y4B B;  3ED9 A;  3LB3 A;  5HLQ A;  3BA2 A;  1HCO B;  2OHB A;  4Q70 B;  2AA1 B;  1UVY A;  1V75 B;  2VEB A;  5FVB M;  1UFJ A;  1Y0W B;  1X9F A;  4KJT A;  2MB5 A;  3NG6 A;  5EUI A;  3A9M A;  3LQ9 A;  4M4B B;  3ZTA A;  4YJJ B;  1HBB A;  1HGB A;  1MBC A;  2W6W A;  2LHB A;  1YH9 A;  3M38 A;  1XYE A;  2QFK A;  1MLO A;  4YU3 A;  4MQC B;  4H0B A;  3S65 A;  3NML A;  5HAV A;  2H8D B;  1IWH A;  4HRR B;  1XQ5 A;  7HBI A;  3D7O B;  2GNW A;  3UHU A;  3ONZ A;  4F0T A;  5EET A;  1MOA A;  4F6D A;  3AT5 A;  3AG0 A;  1XY0 A;  3WHM B;  3ASE A;  1NQP A;  2H35 A;  3IC2 B;  2EKU A;  3DHT A;  4F4O B;  4MQK B;  2HBC A;  1DO1 A;  4ODC B;  2GTL B;  1GLI B;  3HRW B;  1FLP A;  1HDB A;  1MOD A;  3W4U A;  2IG3 A;  3A59 A;  2YSK A;  1NEJ B;  5CNE A;  2ZT2 A;  3ORD A;  1V9Q A;  3UHT A;  4ESU A;  1FCS A;  108M A;  1A3N A;  3V2Z A;  3WCT D;  1C7D B;  1JL7 A;  1R1Y A;  2HHE A;  2ZSX A;  2D2N A;  3BCQ A;  101M A;  4Z8K A;  2D60 B;  1YIH A;  2SPL A;  1ABW A;  4GY3 A;  5E6E A;  1CH5 A;  3RGK A;  2UUL D;  2BLJ M;  3UGY A;  2VJR A;  3UHI A;  3FS4 B;  4FH7 A;  1CH1 A;  1VXB A;  3B75 B;  2GDM A;  4MQH A;  2ZLW B;  3UHC A;  1KD2 A;  1MWC A;  2G3H A;  4M4A A;  1A4F B;  1S5Y B;  3GIO A;  5F2A A;  3HF4 B;  3ODQ A;  1J3Z A;  4B02 A;  4FWZ A;  2HBE B;  4MXK A;  1RQ4 A;  3ZOM A;  1YHE A;  3PT7 B;  1CH3 A;  1HV4 A;  2JLG A;  2BV8 A;  4L7Y B;  1HBB B;  1Q1F A;  5C6E A;  1HBI A;  1QXE B;  1A0Z A;  1L2K A;  3UHV A;  4NI0 B;  2RAO B;  2V1F A;  1IDR A;  1LHT A;  1HI1 A;  1HBA B;  3LB4 A;  1O1K B;  4L2M A;  1HDB B;  1HJT A;  2HHD A;  1ALL B;  1GCW A;  3MOU A;  4X0L B;  3EOK B;  1COH B;  2XKG A;  1D8U A;  3A0G B;  1C7D A;  2Z6N A;  1A3N B;  1YCA A;  1JZL A;  2GLN A;  3U3E A;  4UIQ A;  4Z8K B;  1RPS A;  3O7N A;  1LH6 A;  1Y35 B;  3ZHW A;  1YVT A;  3V58 A;  1K1K B;  4LM6 B;  2D6C A;  4O2G A;  3BJ2 B;  2GRZ A;  1DTM A;  2GKN A;  1HBS B;  3GOU B;  2ZLW A;  1UT0 A;  2O58 X;  4RMP B;  3UH6 A;  1A00 A;  2WCQ A;  1DXV B;  1B33 A;  4HHB B;  4ROM B;  4AVD A;  1NAZ A;  1A0U B;  1HLM A;  3K3U A;  5E83 A;  1JP9 A;  1MLR A;  1FHJ A;  3SZK A;  2NX0 A;  1MNK A;  3WFX A;  1Y7Z B;  1A0Z B;  4O35 A;  1HLB A;  1SI4 A;  2ZLT B;  1S0H B;  3QJE B;  3LQD B;  2IN4 A;  2D2M B;  1URY A;  4N7P A;  1EBC A;  1MTK A;  2UUN B;  1CH4 A;  1OR6 A;  1CG8 B;  4NI1 A;  1UFP A;  1MNO A;  1YEO B;  1S61 A;  3EOK A;  3HXN A;  1BBB A;  2G0Z A;  3QJC B;  3ZH0 A;  5CN5 A;  2MGC A;  1DXC A;  4VHB A;  1THB A;  1JZM A;  4N7N B;  2HCO A;  1YVT B;  1V4W A;  1BAB A;  2BV8 B;  3ZJO A;  3VRE B;  2HZ2 A;  4HRR A;  1JWN A;  3LB2 A;  4B4Y A;  2RAO A;  3HYU B;  4ZIZ B;  2QSP B;  1WMU A;  3WCT B;  6HBW A;  3ARL A;  1O1N A;  2DN3 A;  2GL3 A;  3GQG A;  1K0Y A;  1ALL A;  1JY7 B;  1YOH A;  2ZSP A;  1XY0 B;  3A5B A;  1DWT A;  5EUI B;  3E5I A;  3WCU A;  2C7J A;  2VEE A;  3MJP A;  1BIN A;  1MYT A;  1BIJ A;  2D2N D;  5E29 B;  1OUU A;  5EE4 C;  3UH5 A;  1XZ5 B;  1S0H A;  2GRH A;  2HBD B;  3EU1 B;  2DKD A;  2ZLT A;  3WFT A;  3DUT A;  3RQR A;  2NSR A;  2ZT4 A;  3BJ1 B;  1CIK A;  1QPW A;  2BLH A;  1Y09 A;  1HBS A;  1CPC B;  2PGH B;  2R1H A;  4IRO A;  1XZV A;  2R4X A;  1Y0D A;  1Y0W A;  3M39 A;  2HHE B;  1Y0A B;  1YIE B;  4HHB A;  1XZ4 B;  2NRL A;  4MQI B;  1NPF A;  2DN1 B;  1HGC B;  1F99 A;  1GDJ A;  1YVQ B;  4AE0 A;  1SDK B;  2GTL A;  1ASH A;  1TU9 A;  3ZJN A;  5HU6 B;  1PBX A;  2V8A A;  3A5A A;  1LFZ B;  1A87 A;  4MBA A;  1O1L A;  2VHB A;  1NEJ A;  1HAB A;  4HH0 A;  1R1X A;  2Z6S A;  1Y8I B;  3QJD B;  3AT5 B;  2ZS1 C;  2KSC A;  4HRT A;  1UVI A;  1LFV B;  2ZS1 A;  3OZW A;  4KMV A;  3QM6 A;  5ILM A;  1GDK A;  2VJH B;  1OUU B;  1DO4 A;  3OO4 A;  2C7K B;  1Y7G A;  1SGK A;  5HY8 A;  3K8B A;  2O5O X;  1DXU B;  4GXE A;  3FS4 A;  4UUR A;  4G51 A;  1Y31 A;  2R1H B;  4U8U D;  1HHO B;  1PHN B;  2R4Z A;  3DBJ A;  2G0S A;  1BZZ B;  3H57 A;  3V57 B;  2MHB B;  1M6M A;  4ZVA A;  3EDB A;  4XS0 A;  1VXF A;  1J7W B;  1UVX A;  1CP5 A;  4YU4 B;  4A8Y A;  1MNH A;  4A8S A;  2MYD A;  3AQ5 A;  1Y4V B;  4B3W A;  2D60 A;  1LFQ A;  1Y4R A;  1QSH A;  1HBR B;  1MOC A;  2GTL D;  3IC2 A;  104M A;  1MYH A;  4RMP A;  3NFE B;  2ZFB B;  1ON7 B;  1G08 B;  2W72 A;  4ODC A;  1JDO A;  1XXT A;  1GH0 B;  1Y83 A;  1J52 A;  2ZLV B;  1FHJ B;  2G0V A;  1YHU A;  1NWI A;  1HI0 P;  1UVL A;  1YHU C;  1YE0 B;  3DHT B;  1O1P A;  1MLQ A;  1LH7 A;  1J7Y B;  4N6S A;  3TM3 A;  4HBI A;  3PI8 A;  1YMB A;  2R80 A;  1YGD B;  4O1T A;  1MLN A;  4NZI A;  4YU3 B;  1HBH B;  1MOH A;  3S65 B;  2O5L X;  5AB8 A;  3D4X B;  1MCY A;  2OLP A;  1DLY A;  3RJN B;  2R4W A;  5ILE A;  1IWH B;  1HAC B;  1CII A;  2ZFO C;  4N8T B;  3D7O A;  1CLS A;  3QJC A;  2J96 A;  4F0T B;  1I7Y A;  1Y46 A;  3QM7 A;  3WCW D;  2MGH A;  2BWH A;  2PEG B;  2Z85 A;  1LHS A;  3NL7 A;  1YHR B;  3G4U A;  3WR1 A;  2UUL B;  1AJ9 B;  1I3D A;  3WCP B;  1XYE B;  4HRT B;  3OO5 A;  3WCV A;  1MBD A;  3S66 A;  2HBE A;  4MQC A;  1A9W A;  1Y8H B;  2G12 A;  2RI4 A;  3L0F B;  1A3O B;  1V4X B;  1UC3 A;  3KVS A;  1DKE B;  1NPG A;  1VXH A;  1QGW C;  2JL9 A;  3M3A A;  1DXV A;  2V1H A;  4XXI A;  1YE0 A;  3WCV D;  1G0B A;  3WTG B;  2BKM A;  1VWT A;  2XYK A;  107M A;  5C6E B;  1Y4Q A;  1NWN A;  1EYX A;  2SPM A;  2FAM A;  1I3E A;  3OJ1 A;  1SDL A;  1NZ2 A;  2FAL A;  1NZ5 A;  2MYC A;  2DKC A;  1GCV B;  1Y4R B;  2UUN A;  1XZU B;  2ZS1 D;  2O5M X;  1NZ4 A;  3B75 A;  2QLS B;  4O4Z A;  1HSY A;  1Y4P A;  3CIU B;  1LFY B;  1Y5K A;  3RJ6 A;  2EKT A;  3KMF A;  4WJG 1;  3AQ6 A;  2NSS A;  3OO5 B;  3KMF C;  1YZI B;  3D1A A;  4NXC A;  1C7B A;  3S48 C;  2GKM A;  2MGE A;  1CO9 A;  3PIA A;  2LH7 A;  3WCV B;  1V4X A;  3PI9 B;  3VHB A;  3BRP B;  4PO5 B;  2RI4 B;  3L0F A;  4GY3 B;  4NI0 A;  1HBH A;  3IA3 B;  1MYJ A;  5AQD M;  3O2C A;  1O1L B;  2UUM B;  4UZV A;  3WCU D;  3GYS A;  1HAC A;  4MQH B;  3ZJQ A;  1O16 A;  3QJD A;  1K0Y B;  3W4U B;  3D1K B;  4F6I A;  1I7Y B;  3AQ9 A;  3WTG A;  4MQJ B;  2GTL C;  1CMY A;  2VJH A;  2MGJ A;  2VJT B;  5D1V A;  3UHB A;  1QXD A;  1EYX B;  1F5O A;  1AJ9 A;  3WCP A;  1JP6 A;  2AV3 A;  4GZG A;  4NI1 B;  2CMM A;  3DUT B;  3QZX A;  2H8D A;  3MKB A;  3QM8 A;  2ZSZ A;  5AZQ A;  2AUO A;  1YEV B;  3R0G A;  1LFY A;  1YGF B;  2D5X B;  1MOB A;  2WTH A;  1UMO A;  1LFL B;  3D17 B;  2V1G A;  3WCT A;  3IC0 A;  1VXD A;  2MYB A;  2MGL A;  2ZST A;  2LH1 A;  4F4O A;  1JY7 A;  3PI9 A;  3WCV C;  1RSE A;  1BZR A;  3WCU B;  2W6X A;  1J40 A;  2ZFB A;  4OOD A;  3AT6 B;  2MGI A;  1OR4 A;  3FEW X;  1UVM A;  1CG8 A;  1SPG B;  1LH5 A;  2ZLV A;  5CNC A;  3G52 A;  1VXC A;  1Y7C B;  3ARJ A;  4Q70 A;  2C7J B;  3G46 A;  1KR7 A;  1LJW A;  2VLX A;  1VRF A;  1J7Y A;  1Y8K A;  2ZSN A;  3PEL B;  2MHB A;  1CBL A;  2HBD A;  5CND A;  4MQJ A;  3GDJ B;  2ZSY A;  1LIA B;  2O5B X;  1BZP A;  111M A;  1XZ4 A;  2LH6 A;  1QSI B;  2VYZ A;  1Y7G B;  5CNF A;  1XZV B;  4IRO B;  1HGA A;  1O1M A;  3PT8 B;  1YEO A;  5F0B A;  1DWR A;  2DXM A;  3BJ2 A;  1YEV A;  1UVJ A;  2W72 B;  1BVC A;  4WJG A;  1DM1 A;  1BJE A;  3UH3 A;  1VRE A;  102M A;  1GH0 A;  2BNL A;  1RQA B;  2Z8A A;  4NXA A;  2G0X A;  1MDN A;  1AJH A;  105M A;  1BZZ A;  2DC3 A;  109M A;  1F99 B;  2BMM A;  1Y7D B;  3ZJH A;  1VHB A;  3DHR B;  4DC8 A;  6HBI A;  2VJT A;  3PMC A;  4OF9 A;  5EYS A;  1DO7 A;  1MTI A;  2D5Z B;  2ZLU A;  2MGA A;  4F6J A;  4LMS B;  1WVP A;  1A01 A;  2OHA A;  1S56 A;  3G53 A;  3GLN A;  1CBM A;  1J41 A;  1Y4F B;  1A4F A;  4XXK A;  3ZJS A;  1CPC A;  1VWT B;  1LFV A;  3A59 B;  3WI8 A;  4H2L B;  1MLJ A;  1S5X A;  2O5Q X;  1JBO A;  1BUW B;  5SW7 A;  3DBJ B;  2C7L B;  3R5I B;  1GCV A;  1CH9 A;  3BCQ B;  1Y45 B;  1WLA A; 
#chains in the Genus database with same CATH homology
 1MLF A;  2B7H B;  3VRG B;  1G09 A;  4TYX A;  3MYM A;  4X0L A;  1N9X A;  1QPW B;  3G4Y A;  5HU6 A;  1XZ2 B;  3NMM A;  2W31 A;  1Y5K B;  5JGG B;  1J3Y B;  1Y01 B;  1A6N A;  3MN0 A;  1YIE A;  1J7S A;  2DN3 B;  1JF4 A;  4NK1 A;  3WR1 B;  1HDA B;  3FH9 B;  2SPN A;  3P5Q B;  3DHR A;  1T1N A;  4MPM A;  1YG5 B;  1Y8H A;  1GVH A;  1Y8W B;  1MLS A;  1HCO A;  2GNV A;  3A2G A;  4F6B A;  1O1O B;  1YEQ A;  1DKE A;  3S1I A;  3A5G A;  4U8U C;  1YOI A;  4XDI A;  2YRS B;  1BZ0 A;  3PI8 B;  5MBN A;  1PMB A;  2R80 B;  5CMV A;  1CO8 A;  3WHM A;  5KKK A;  3E55 A;  1Y0A A;  1OUT A;  3S1J A;  1FDH G;  5EU2 A;  3ZJI A;  3MKB B;  112M A;  3ZJP A;  1IT3 A;  1CLS B;  5CNB A;  3NFE A;  1YGF A;  4LPI A;  6HBW B;  2W6V B;  1Y31 B;  1B86 B;  4F68 A;  1IT2 A;  1VXG A;  3ONZ B;  1Y85 A;  2G10 A;  1Y4G A;  1Y0C B;  3MJP B;  1GZX B;  1ABS A;  1HDA A;  3GKT A;  4ROM A;  1J7W A;  1NQP B;  2H35 B;  5EOH A;  5CNG A;  1ABY B;  2LH2 A;  3QMA A;  1LFQ B;  1T1N B;  1UIW A;  1YG5 A;  4PQ6 A;  1O1I B;  1F65 A;  3HYU A;  2D2M A;  4N7P B;  4N8T A;  1Y0D B;  1YDZ A;  3UHN A;  5JOM A;  5CHQ A;  4O4T A;  2MYE A;  4ZVB A;  1FN3 A;  5JGG A;  4C44 A;  1J3Y A;  1HDS B;  1DXT A;  1LFL A;  1LTW A;  2QLS A;  4L7Y A;  5MBA A;  1OBM A;  3GQP B;  2HBF B;  2OH9 A;  4MU5 A;  2SPO A;  1V4U A;  2QFN A;  1YVQ A;  2AV0 A;  1ABW B;  1V4W B;  2XKH A;  3D4X A;  4SDH A;  2ZT1 A;  1O1M B;  3PT8 A;  2NRM A;  1MGN A;  1S69 A;  3GK9 A;  1MLK A;  1N9H A;  1RQA A;  2HHB A;  1YEN B;  1NXF A;  3GQR B;  1XZ7 A;  2QSP A;  2WTG A;  1OFK A;  4MQI A;  3ECL A;  1Y83 B;  3UBC A;  3HF4 A;  2ZS1 B;  1HGC A;  5B84 A;  5B85 A;  1URV A;  2QU0 A;  2W6Y A;  1HV4 B;  1MWB A;  2HZ3 A;  2EVK A;  1CH7 A;  1EBT A;  3PI3 A;  5E29 A;  1H1X A;  3EU1 A;  2H8F B;  1HBA A;  3AT6 A;  3PI1 A;  1B0B A;  1LFZ A;  4N7O B;  1MYZ A;  1VXE A;  1JF3 A;  5CN9 A;  1DO3 A;  5JDO E;  1TES A;  1Y4P B;  1DXT B;  1COH A;  1JP8 A;  1HRM A;  3UHX A;  1ECN A;  2WY4 A;  1J3Z B;  1GDL A;  5EE4 D;  3ZJJ A;  3PT7 A;  1UX8 A;  3G4V A;  2VRY A;  1V5H A;  1HBR A;  1QSI A;  2JHO A;  2D5Z A;  2ZLU B;  1Y5J A;  2ZSR A;  1A3O A;  1HGA B;  2EB8 A;  1BBB B;  2M6Z A;  1AJG A;  2ZLX A;  1GCW B;  2MBW A;  5HLX A;  2MGK A;  1LH2 A;  3G4Q A;  1ECO A;  3UHE A;  1FN3 B;  3QZZ A;  4ROL B;  1V07 A;  1M9P A;  2ZS0 A;  1Y5F A;  4KN3 A;  3LR9 A;  1J40 B;  3UHY A;  5EV5 A;  1LH1 A;  3GQP A;  5EQM A;  1IRD B;  5KDQ A;  3E4N A;  2MGG A;  3ECX A;  1S6A A;  3G4W A;  3WCW C;  2GRF A;  1Y2Z A;  1C40 A;  2YRS A;  2ZT0 A;  1Y8K B;  3HEP A;  1Y46 B;  3VAU A;  1FSX B;  1YCB A;  3NL7 B;  2HCO B;  5ILR A;  1G0A B;  3VRE A;  3UHD A;  3MVC A;  3E5O A;  4MQK A;  1N9F A;  1SI4 B;  2VYW A;  4G1B A;  1RTE A;  4MBN A;  1UX9 A;  5KER A;  1WMU B;  1G9V A;  2QMB A;  4FC3 B;  1IBE A;  3CY5 B;  3IXF A;  1DTI A;  2D5X A;  3WCW B;  2M6Z B;  1MZ0 A;  3D17 A;  3LR7 A;  4FWY A;  4HSX A;  5AZR A;  1NS6 A;  2MGB A;  1NS9 A;  1DXD A;  1SHR A;  1MLL A;  1NIH B;  5HBI A;  2XKI A;  1MNJ A;  1QXD B;  1IOP A;  2AUR A;  1O1K A;  1CQX A;  1GBU A;  4PQB A;  5CHR A;  1Y5J B;  1C40 B;  3HHB A;  4F69 A;  4MQG A;  3VRF B;  1RQ3 B;  3DR9 A;  3HC9 A;  3QQR A;  1B86 A;  4F6G A;  2ZSO A;  1OFJ A;  1FAW A;  1Y4Q B;  2D2M D;  1RPS B;  3ODQ B;  1C7B B;  1Y45 A;  4FWX A;  2HBS A;  4TWV A;  2ZSQ A;  3UHR A;  1NGK A;  1YHU D;  5CN7 A;  1QXE A;  5HY8 B;  4DC7 A;  1YEU A;  2QSS B;  4ESA B;  2HHB B;  2MGD A;  1MBI A;  2R4Y A;  5KER B;  1Y8W A;  1C7C B;  1RVW B;  1HHO A;  1HAB B;  3QQQ A;  5JDO F;  1Y8I A;  4XS0 B;  1S5X B;  1F63 A;  5HLU A;  1YZI A;  3D1A B;  2EB9 A;  1YHE B;  2HBG A;  1NIH A;  1LFT A;  2DN1 A;  4PQC A;  1DUO A;  1DLW A;  2VLZ A;  3WCT C;  3QM5 A;  2V1E A;  2MGF A;  1F5P A;  1SDK A;  4MQG B;  1JL6 A;  2DHB A;  3UHH A;  1G9V B;  3BJ3 B;  2DN2 B;  1IBE B;  3VRF A;  1CPW A;  1U7R A;  3PI4 A;  4M4B A;  2FRK X;  3SZK B;  3GKV A;  1Y85 B;  1YE2 A;  1Y7D A;  5E6E B;  4YU4 A;  2HBC B;  1NS9 B;  1X9F C;  2FRI X;  3HEN A;  3MJU B;  1JEB B;  3K9Z A;  1O1O A;  1KD2 B;  2W72 C;  1MLM A;  1XQ5 B;  1O1N B;  5C6Y A;  3GQG B;  1ITH A;  3OVU C;  1Y4G B;  3UH7 A;  1YHU B;  1A6M A;  1M9P B;  3IC0 B;  1J3F A;  3PEL A;  5IKS A;  4JAC A;  1YDZ B;  4C0N A;  4F6F A;  2BK9 A;  3MYN A;  3ECZ A;  1CMY B;  4N7N A;  2ZT3 A;  2AA1 A;  2HZ1 A;  5SW7 B;  1Y4V A;  2V1K A;  2OH8 A;  1BVD A;  1FSX A;  4N7O A;  2ZFO A;  1NZ3 A;  1LJW B;  1VXA A;  1BZ0 B;  2DN2 A;  3WFU A;  2Z6T A;  3UHK A;  1A9W E;  2PEG A;  3PI2 A;  4G1V A;  2OIF A;  1MBO A;  1O1P B;  1CIO A;  4DWT A;  3UGZ A;  3EDA A;  1YIH B;  3P5Q A;  1PBX B;  1MNI A;  3O89 A;  1EMY A;  1MWD A;  1X3K A;  2ZSS A;  4MAX A;  1Y22 A;  1A6K A;  1G0B B;  1O1J A;  2DHB B;  2VM0 A;  3NG6 B;  3BJ3 A;  1LA6 B;  2EVP A;  2HBF A;  1YH9 B;  1SDL B;  4NK2 A;  3OO4 B;  1MYF A;  3LHB A;  3BOM B;  1XCH A;  3QJB A;  3M3B A;  1BZ6 A;  1GDI A;  3GYS B;  1J41 B;  1Y4F A;  2E2Y A;  2ZFO B;  4WCH D;  1N9I A;  5M3S A;  2ZFO D;  1XZ2 A;  3NMM B;  5ILP A;  2G0R A;  2HHD B;  1X9F D;  1YFF B;  1Y09 B;  2ZWJ A;  5CN6 A;  2DXM B;  1J7S B;  3OK5 A;  2Z6N B;  5JDO C;  1YMC A;  3KUN A;  5E83 B;  1ECD A;  1S5Y A;  3HEO A;  3FH9 A;  3OGB A;  3PIA B;  2G11 A;  4U8U A;  1YEU B;  1GZX A;  1MLG A;  4BJA A;  2B7H A;  1QI8 B;  1GLI A;  103M A;  2MYA A;  2QRW A;  1UIW B;  1MTJ A;  1GBU B;  1Y22 B;  1A01 B;  1IRC A;  1JZK A;  1XZU A;  1Y2Z B;  4KMW A;  1BZ1 B;  1EWA A;  1DUK A;  1YGD A;  1LFT B;  1LA6 A;  1ECA A;  5KDQ B;  3BOM A;  1BAB B;  1DWS A;  1U7S A;  2MGM A;  1H97 A;  3HRW A;  110M A;  2ZS0 C;  1YOG A;  2C0K A;  5D5R A;  2W6V A;  3UI0 A;  4MXL A;  1LH3 A;  2LH3 A;  3UBV A;  4M4A B;  3HXN B;  2AUQ A;  1EW6 A;  3ZOL A;  1YHR A;  1MKO B;  1G0A A;  3CY5 A;  1R1Y B;  4ROL A;  1RQ4 B;  1YE2 B;  1THB B;  3S66 B;  1Y5F B;  2D2M C;  3SDH A;  1BIJ B;  1ABY A;  1MBS A;  1X46 A;  1JEB A;  1IRD A;  3KUO A;  1QSH B;  1JPB A;  1A00 B;  1SPG A;  1M6C A;  3ZJM A;  2D2N C;  3BJ1 A;  1A0U A;  5CN8 A;  1CH2 A;  3A0G A;  1BZ1 A;  2ZLX B;  1MLU A;  1Y0T A;  1CP0 A;  1SPE A;  1Y7C A;  1Y0C A;  1Y7Z A;  2VYY A;  2ZS0 B;  3V2V A;  2FRJ X;  1HBG A;  1CG5 B;  3LQD A;  3GDJ A;  1Y35 A;  3UHZ A;  3GKV B;  1OUT B;  4U8U B;  3K8B B;  4JYQ A;  3UHW A;  1CQ2 A;  2V1I A;  2FRF A;  3MJU A;  3OZU A;  1RQ3 A;  4QAU A;  1QI8 A;  3WCU C;  3GOU A;  3ARK A;  1V75 A;  2QMB B;  4AVE A;  1MYM A;  3OZV A;  3GQR A;  2LH5 A;  4ESA A;  3MBA A;  2BW9 M;  1MKO A;  2ZS0 D;  1BUW A;  3H58 A;  1HGB B;  3QM9 A;  3UHQ A;  1FDH A;  3R5I A;  2EF2 A;  1NS6 B;  1JW8 A;  1GBV A;  4PNJ A;  1K1K A;  2V1J A;  4NS2 A;  2AUP A;  3QJE A;  1Y4B A;  1OJ6 A;  1G08 A;  1AZI A;  5JDO D;  1O1I A;  4FC3 A;  1O1J B;  1DXU A;  1XZ7 B;  3TM9 A;  3UHS A;  1X9F B;  1MBA A;  4H07 A;  4G51 B;  3AQ8 A;  3CIU A;  1YMA A;  1FSL A;  2O5S X;  3UHG A;  4H2L A;  2PGH A;  2QU0 B;  1GJN A;  1KFR A;  1HDS A;  3SDN A;  3TLD A;  2BLI A;  2G14 A;  1SHR B;  2O5T X;  1V4U B;  2H8F A;  3G4R A;  4HSW A;  3VRG A;  3LB1 A;  4ILZ A;  1YEQ B;  1MYI A;  2QSS A;  1Z8U B;  2R50 A;  1YFF A;  1G09 B;  106M A;  3AQ7 A;  5EYJ A;  1SWM A;  3HHB B;  4DWU A;  1C7C A;  1RVW A;  3ZJR A;  1A6G A;  3WFW A;  1XXT B;  1RTX A;  1W92 A;  1MLH A;  2VLY A;  1YEN A;  1FAW B;  3ZJL A;  1Y0T B;  3D1K A;  4FH6 A;  2D2N B;  3WCW A;  1LUE A;  1MYG A;  5CN4 A;  4IT8 A;  1R1X B;  2HBS B;  1XZ5 A;  4TWU A;  1GBV B;  1MBN A;  1CG5 A;  3QJB B;  1Y4B B;  3ED9 A;  3LB3 A;  5HLQ A;  3BA2 A;  1HCO B;  2OHB A;  2AA1 B;  1UVY A;  1V75 B;  2VEB A;  1UFJ A;  1Y0W B;  1X9F A;  4KJT A;  2MB5 A;  3NG6 A;  5EUI A;  3A9M A;  4M4B B;  1HBB A;  1HGB A;  1MBC A;  2W6W A;  2LHB A;  1YH9 A;  3M38 A;  1XYE A;  2QFK A;  1MLO A;  4YU3 A;  4MQC B;  4H0B A;  3S65 A;  3NML A;  5HAV A;  2H8D B;  1IWH A;  4HRR B;  1XQ5 A;  7HBI A;  3D7O B;  2GNW A;  3UHU A;  3ONZ A;  5EET A;  1MOA A;  4F6D A;  3AT5 A;  3AG0 A;  1XY0 A;  3WHM B;  3ASE A;  1NQP A;  2H35 A;  3IC2 B;  2EKU A;  3DHT A;  4F4O B;  4MQK B;  2HBC A;  1DO1 A;  4ODC B;  2GTL B;  1GLI B;  3HRW B;  1FLP A;  1HDB A;  1MOD A;  3W4U A;  2IG3 A;  3A59 A;  1NEJ B;  5CNE A;  2ZT2 A;  3ORD A;  1V9Q A;  3UHT A;  1FCS A;  108M A;  1A3N A;  3V2Z A;  3WCT D;  1C7D B;  1JL7 A;  1R1Y A;  2HHE A;  2ZSX A;  2D2N A;  3BCQ A;  101M A;  2D60 B;  1YIH A;  2SPL A;  1ABW A;  5E6E A;  1CH5 A;  3RGK A;  2BLJ M;  3UGY A;  3UHI A;  3FS4 B;  4FH7 A;  1CH1 A;  1VXB A;  3B75 B;  2GDM A;  4MQH A;  2ZLW B;  3UHC A;  1KD2 A;  1MWC A;  2G3H A;  4M4A A;  1A4F B;  1S5Y B;  5F2A A;  3HF4 B;  3ODQ A;  1J3Z A;  4FWZ A;  2HBE B;  4MXK A;  1RQ4 A;  3ZOM A;  1YHE A;  3PT7 B;  1CH3 A;  1HV4 A;  4L7Y B;  1HBB B;  1Q1F A;  5C6E A;  1HBI A;  1QXE B;  1A0Z A;  1L2K A;  3UHV A;  4NI0 B;  2RAO B;  2V1F A;  1IDR A;  1LHT A;  1HBA B;  3LB4 A;  1O1K B;  4L2M A;  1HDB B;  1HJT A;  2HHD A;  1GCW A;  3MOU A;  4X0L B;  3EOK B;  1COH B;  2XKG A;  1D8U A;  3A0G B;  1C7D A;  2Z6N A;  1A3N B;  1YCA A;  1JZL A;  2GLN A;  3U3E A;  4UIQ A;  1RPS A;  3O7N A;  1LH6 A;  1Y35 B;  3ZHW A;  1YVT A;  1K1K B;  2D6C A;  4O2G A;  3BJ2 B;  2GRZ A;  1DTM A;  2GKN A;  1HBS B;  3GOU B;  2ZLW A;  1UT0 A;  2O58 X;  3UH6 A;  1A00 A;  1DXV B;  4HHB B;  4ROM B;  4AVD A;  1NAZ A;  1A0U B;  1HLM A;  3K3U A;  5E83 A;  1JP9 A;  1MLR A;  1FHJ A;  3SZK A;  2NX0 A;  1MNK A;  3WFX A;  1Y7Z B;  1A0Z B;  4O35 A;  1HLB A;  1SI4 A;  2ZLT B;  1S0H B;  3QJE B;  3LQD B;  2IN4 A;  2D2M B;  1URY A;  4N7P A;  1EBC A;  1MTK A;  1CH4 A;  1OR6 A;  1CG8 B;  4NI1 A;  1UFP A;  1MNO A;  1YEO B;  1S61 A;  3EOK A;  3HXN A;  1BBB A;  2G0Z A;  3QJC B;  3ZH0 A;  5CN5 A;  2MGC A;  1DXC A;  4VHB A;  1THB A;  1JZM A;  4N7N B;  2HCO A;  1YVT B;  1V4W A;  1BAB A;  3ZJO A;  3VRE B;  2HZ2 A;  4HRR A;  1JWN A;  3LB2 A;  4B4Y A;  2RAO A;  3HYU B;  2QSP B;  1WMU A;  3WCT B;  6HBW A;  3ARL A;  1O1N A;  2DN3 A;  2GL3 A;  3GQG A;  1K0Y A;  1JY7 B;  1YOH A;  2ZSP A;  1XY0 B;  3A5B A;  1DWT A;  5EUI B;  3E5I A;  3WCU A;  2VEE A;  3MJP A;  1BIN A;  1MYT A;  1BIJ A;  2D2N D;  5E29 B;  1OUU A;  5EE4 C;  3UH5 A;  1XZ5 B;  1S0H A;  2GRH A;  2HBD B;  3EU1 B;  2ZLT A;  3WFT A;  3DUT A;  2NSR A;  2ZT4 A;  3BJ1 B;  1CIK A;  1QPW A;  2BLH A;  1Y09 A;  1HBS A;  2PGH B;  2R1H A;  4IRO A;  1XZV A;  2R4X A;  1Y0D A;  1Y0W A;  3M39 A;  2HHE B;  1Y0A B;  1YIE B;  4HHB A;  1XZ4 B;  2NRL A;  4MQI B;  1NPF A;  2DN1 B;  1HGC B;  1GDJ A;  1YVQ B;  1SDK B;  2GTL A;  1ASH A;  1TU9 A;  3ZJN A;  5HU6 B;  1PBX A;  3A5A A;  1LFZ B;  4MBA A;  1O1L A;  2VHB A;  1NEJ A;  1HAB A;  1R1X A;  2Z6S A;  1Y8I B;  3QJD B;  3AT5 B;  2ZS1 C;  2KSC A;  4HRT A;  1LFV B;  2ZS1 A;  3OZW A;  4KMV A;  3QM6 A;  5ILM A;  1GDK A;  1OUU B;  1DO4 A;  3OO4 A;  1Y7G A;  5HY8 A;  3K8B A;  2O5O X;  1DXU B;  3FS4 A;  4UUR A;  4G51 A;  1Y31 A;  2R1H B;  4U8U D;  1HHO B;  2R4Z A;  2G0S A;  1BZZ B;  3H57 A;  2MHB B;  1M6M A;  4ZVA A;  3EDB A;  4XS0 A;  1VXF A;  1J7W B;  1UVX A;  1CP5 A;  4YU4 B;  1MNH A;  2MYD A;  3AQ5 A;  1Y4V B;  4B3W A;  2D60 A;  1LFQ A;  1Y4R A;  1QSH A;  1HBR B;  1MOC A;  2GTL D;  3IC2 A;  104M A;  1MYH A;  3NFE B;  2ZFB B;  1G08 B;  2W72 A;  4ODC A;  1JDO A;  1XXT A;  1Y83 A;  1J52 A;  2ZLV B;  1FHJ B;  2G0V A;  1YHU A;  1NWI A;  1YHU C;  1YE0 B;  3DHT B;  1O1P A;  1MLQ A;  1LH7 A;  1J7Y B;  3TM3 A;  4HBI A;  3PI8 A;  1YMB A;  2R80 A;  1YGD B;  4O1T A;  1MLN A;  4NZI A;  4YU3 B;  1HBH B;  1MOH A;  3S65 B;  2O5L X;  5AB8 A;  3D4X B;  1MCY A;  2OLP A;  1DLY A;  3RJN B;  2R4W A;  5ILE A;  1IWH B;  1HAC B;  2ZFO C;  4N8T B;  3D7O A;  1CLS A;  3QJC A;  1Y46 A;  3QM7 A;  3WCW D;  2MGH A;  2BWH A;  2PEG B;  2Z85 A;  1LHS A;  3NL7 A;  1YHR B;  3G4U A;  3WR1 A;  1AJ9 B;  1I3D A;  3WCP B;  1XYE B;  4HRT B;  3OO5 A;  3WCV A;  1MBD A;  3S66 A;  2HBE A;  4MQC A;  1A9W A;  1Y8H B;  2G12 A;  2RI4 A;  1A3O B;  1V4X B;  1UC3 A;  1DKE B;  1NPG A;  1VXH A;  3M3A A;  1DXV A;  2V1H A;  1YE0 A;  3WCV D;  1G0B A;  3WTG B;  2BKM A;  1VWT A;  2XYK A;  107M A;  5C6E B;  1Y4Q A;  1NWN A;  2SPM A;  2FAM A;  1I3E A;  3OJ1 A;  1SDL A;  1NZ2 A;  2FAL A;  1NZ5 A;  2MYC A;  1GCV B;  1Y4R B;  1XZU B;  2ZS1 D;  2O5M X;  1NZ4 A;  3B75 A;  2QLS B;  4O4Z A;  1HSY A;  1Y4P A;  3CIU B;  1LFY B;  1Y5K A;  3RJ6 A;  2EKT A;  3KMF A;  4WJG 1;  3AQ6 A;  2NSS A;  3OO5 B;  3KMF C;  1YZI B;  3D1A A;  4NXC A;  1C7B A;  3S48 C;  2GKM A;  2MGE A;  1CO9 A;  3PIA A;  2LH7 A;  3WCV B;  1V4X A;  3PI9 B;  3VHB A;  2RI4 B;  4NI0 A;  1HBH A;  3IA3 B;  1MYJ A;  1O1L B;  4UZV A;  3WCU D;  3GYS A;  1HAC A;  4MQH B;  3ZJQ A;  1O16 A;  3QJD A;  1K0Y B;  3W4U B;  3D1K B;  4F6I A;  3AQ9 A;  3WTG A;  4MQJ B;  2GTL C;  1CMY A;  2MGJ A;  5D1V A;  3UHB A;  1QXD A;  1F5O A;  1AJ9 A;  3WCP A;  1JP6 A;  2AV3 A;  4GZG A;  4NI1 B;  2CMM A;  3DUT B;  3QZX A;  2H8D A;  3MKB A;  3QM8 A;  2ZSZ A;  5AZQ A;  2AUO A;  1YEV B;  3R0G A;  1LFY A;  1YGF B;  2D5X B;  1MOB A;  2WTH A;  1UMO A;  1LFL B;  3D17 B;  2V1G A;  3WCT A;  3IC0 A;  1VXD A;  2MYB A;  2MGL A;  2ZST A;  2LH1 A;  4F4O A;  1JY7 A;  3PI9 A;  3WCV C;  1RSE A;  1BZR A;  3WCU B;  2W6X A;  1J40 A;  2ZFB A;  4OOD A;  3AT6 B;  2MGI A;  1OR4 A;  1CG8 A;  1SPG B;  1LH5 A;  2ZLV A;  5CNC A;  3G52 A;  1VXC A;  1Y7C B;  3ARJ A;  3G46 A;  1KR7 A;  1LJW A;  2VLX A;  1VRF A;  1J7Y A;  1Y8K A;  2ZSN A;  3PEL B;  2MHB A;  1CBL A;  2HBD A;  5CND A;  4MQJ A;  3GDJ B;  2ZSY A;  2O5B X;  1BZP A;  111M A;  1XZ4 A;  2LH6 A;  1QSI B;  2VYZ A;  1Y7G B;  5CNF A;  1XZV B;  4IRO B;  1HGA A;  1O1M A;  3PT8 B;  1YEO A;  5F0B A;  1DWR A;  2DXM A;  3BJ2 A;  1YEV A;  2W72 B;  1BVC A;  4WJG A;  1DM1 A;  1BJE A;  3UH3 A;  1VRE A;  102M A;  2BNL A;  1RQA B;  2Z8A A;  4NXA A;  2G0X A;  1MDN A;  1AJH A;  105M A;  1BZZ A;  2DC3 A;  109M A;  2BMM A;  1Y7D B;  3ZJH A;  1VHB A;  3DHR B;  4DC8 A;  6HBI A;  4OF9 A;  5EYS A;  1DO7 A;  1MTI A;  2D5Z B;  2ZLU A;  2MGA A;  4F6J A;  1WVP A;  1A01 A;  2OHA A;  1S56 A;  3G53 A;  3GLN A;  1CBM A;  1J41 A;  1Y4F B;  1A4F A;  3ZJS A;  1VWT B;  1LFV A;  3A59 B;  3WI8 A;  4H2L B;  1MLJ A;  1S5X A;  2O5Q X;  1BUW B;  5SW7 A;  3R5I B;  1GCV A;  1CH9 A;  3BCQ B;  1Y45 B;  1WLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...