2ZFTA

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zftA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zftA02
5JB9S 2AH4X 1CBWB 4KGAA 1ZR0A 3PV4A 3AAUA 1O3PB 1GI5A 1IQMA 1C1QA 2W26A 1TNIA 1DLEA 1SGFA 1O2YA 1P9UA 2XCNA 1WBGB 3LT3A 1PFXC 1Q31A 1IOEA 3U8RH 1KDQA 1BTHH 3M7QA 4JMYA 4CH2B 1UTKA 2ZU3A 3PMJA 2VVVA 4HI3A 4HTCH 1ELVA 1TQ0B 1YPGH 1SFQB 4HZHA 2Z3CA 5A0BA 5C1XA 1MBQA 1GBMA 1GJDB 1MKWH 4Y8ZA 1DM4B 4WXVA 4XBBA 1O5AB 1CA0C 1VR1H 2BTCE 4ZXYH 4MDSA 4FUCA 1B7XB 2ZF0H 5C5OA 1GMHF 5E8EH 4NZLA 1O5GH 2ZFRH 3BTFE 1XX9A 1RFNA 5EPYA 1HIAB 4YLQH 5T6GA 1P2JA 4XOJA 1AE8H 1EB2A 3A8DA 1DX5M 2ZA5A 1FXYA 3UPEA 1C5MD 2OXSA 2G5NA 1G3DA 5EQRA 4MG3A 3ZZAA 2XWBI 4KTCA 2QAAA 3SO3A 4MPVA 2PKSB 2BQWB 2GCTB 1D9IA 3LGYA 4JZFH 3TK6A 8GCHG 4IS5A 1GI0A 1AB9C 1K22H 2PW8H 3UIRA 2BDHA 3AVZA 2UWOA 2AIQA 2VIPA 2WPKS 1WOFA 5E0GA 3TH2H 3GY7A 2VH6A 4MTBA 1RIWB 2ZP0H 1ACBE 3VXFH 3S69A 1C1OA 6CHAB 3TNTA 3F1SB 1YPJH 4TWYA 3NZIA 1O5FH 1WQVH 1QRZA 2QYIA 4MNXA 2ZIQH 5EW1H 1NROH 4U32A 2Q6DA 1CGHA 3A7ZA 1KXAA 2FDAA 4B1TA 4UFGH 1LKAA 4O97A 5HM2A 3JZ2B 3P8FA 1TWXB 2CGAA 4ZXXH 2H2ZA 2QC2A 1GJAB 3MFJA 1C1SA 2PLXA 1O3BA 1HLTH 3VB5A 1S84A 1P57B 1OX1A 1CU1A 1FN6A 5BPEA 1GI1A 2FXRA 2HGTH 2IJOB 3MNXA 1UVTH 2C8ZB 1XVOA 1ZMJA 3M3TA 1YC0A 1TGNA 3PB1E 1HAOH 2SNVA 1OSSA 2ZDAH 3P8GA 2GV7A 2TRMA 3ZZ3A 4CBOA 1NRSH 1T4UH 1AFQB 1P06A 4I32A 2CJIA 1AFEH 2BDAA 4FUHA 4K3JA 3SGBE 3LC5A 1AQ7A 3E6PH 3LJOA 3EA8A 2V3OH 4CH8B 3GCHC 1DLKB 4PROA 2BB4A 3MOCA 4IW4E 1KXFA 4LOYH 2ZPQA 2J94A 1DOJA 3FP7E 4I8GA 4ISIH 3SOSA 1TGSZ 2QA9E 2A7CA 2FOFA 1C2KA 3A7TA 4KKDA 3BEUA 3A7XA 1LQDB 1JIMA 3RXAA 3SORA 4B2AA 1DY8A 1O2QA 1TPAE 5GIBA 3AW0A 1OYTH 1J15A 1QFKH 2TGPZ 3OYPA 1YM0A 1NRQH 3E90B 1J9CH 3KN2A 2BYAX 2VWNA 1GVLA 4MPWA 1QA0A 5F6MA 1OYQA 4CRBA 1TBZH 2OUAA 2V6NA 1CT4E 4X8VH 3ZVCA 4FUGA 1Z8RA 3JZ1B 2WYJA 4UFEH 1LPKB 4CBNA 1ELDE 1L4DA 1LHGH 1BCUH 1TRNA 4DG4A 2R2MB 3EA9A 1AMHA 1K1JA 3RXCA 1F0UA 1SGPE 1S83A 3TNSA 2H1UA 1NPMA 4WMEA 1LTOA 2DE9A 1LHFH 4E05H 3RC6A 5SGAE 4XBDA 2P59A 5E0HA 1GJCB 2A2XH 3GOVB 1CGIE 1FI8A 3EQ0H 1SGIB 3MO6A 1DE7H 4X2XA 3C1KA 3SUGA 2KAIB 2P8OB 4O9VA 1FMGA 2F9OA 2HLCA 4O3UA 2ZI2H 4GVUA 3LC3A 3VPKA 2V35A 1FONA 3Q3XA 1W7GH 1G30B 3MYWA 1T8OA 1FJSA 1SQOA 1AO5A 3QGNB 4FUEA 3VB3A 1UCYE 4J1YA 1P8VC 4K69A 1EJNA 2FLBH 5TJXA 1BMAA 1P09A 3SHAH 1NZQH 3AW1A 5L6NH 3S7HB 1O0DH 4ESTE 3NPSA 1ZGVA 1IQFA 1UMAH 1MTVA 2AIPA 4GAWA 2BVRH 3RMNH 5JB8S 2G55A 2GZ8A 3GY2A 1O5EH 2P93A 3U9AH 1S82A 1Y3VA 3LIWA 3V13A 1EJAA 1W10U 9ESTA 3RU4T 3TK5A 4JK5A 4JZ1A 4M7GA 1VITH 4CRDA 1YPHC 1O30A 7KMEH 1MBMA 2A4QA 3GYMA 1AWFH 1E38B 2O8WA 2F9BH 2WPJS 1OP8A 4OS6A 1O3DA 1WYKA 4FUDA 2I6SA 3SUEA 2BD3A 2VIWA 3SU3A 3SHCH 3ZYDA 3Q00A 1UTMA 4LZ1H 3KIDU 1ANBA 1DXPA 1CE5A 5JPMH 3RXIA 3KQBA 2ILNA 3TK9A 1O3EA 4O03A 3TJOA 3VFEA 1P2NA 1BT7A 4NG9H 1GJ9B 1GHBF 1HAZB 1QURH 1QRWA 3A7YA 4OS1A 4VGCB 1PQ8A 3LH3A 3HATH 1S0QA 3TPIZ 3URCA 4NCYA 3BIUH 2HWLB 1INCA 3P17H 5EXMA 3SI4H 1GVKB 5DP4A 3U1IB 2O8UA 1GCTC 1BRUP 2FI3E 2Z3EA 1TMUH 5F8ZA 5CE1A 1H9IE 2FOMB 4A7IB 4H6SB 1GJBB 3V12A 1QJ7B 4UD9H 1C1NA 3B9FH 5I46H 3FFGA 2ZTXA 4ZROA 4BTIB 1K1OA 1RJXB 4LXBH 1MUEB 1QQ4A 2TGAA 4JZEH 4X2VA 1C5YB 2QXHA 1TX6A 3BEIB 4BANB 1QB6A 2RA0A 3RXFA 5EU8A 4ABEA 3EAJA 4FXGH 1MU6B 1HAPH 2FOCA 2O9QA 2AGIX 1G36A 4IN1A 1AGJA 3E3TA 4IC5A 1LVOA 4ABDA 1C5WB 1OWJA 1V2LT 1YBWA 1C5UA 1JRSA 1SOTA 1Z8GA 5F8TA 3FANA 2ZTYA 2O8MA 3A86A 1GHZA 1BQYA 1MD8A 3H7OA 3S9BA 4MQAA 4E06H 2QV1A 5AVDA 3RMLH 1O3HA 1OWEA 5F8XA 2NWNA 4UE7H 3SQEE 4IBLH 1DICA 4AN7A 1NRRH 1H1BA 4UDWH 3ZZCA 1ARBA 1NRPH 3P6ZB 1TRMA 1MZAA 3KHVA 4A1XA 1W3CA 1GHAF 4CHAC 1C2DA 4X2YA 2BQ7B 1W8BH 4X0WU 4AZ2B 4GPGA 3TH4H 2NU1E 1QNJA 3SN8A 1QJ6B 1BJUA 2VU8E 1BUIA 1NRNH 1XKBC 1TOCB 2RA3A 1ZMNA 4FU8A 4WY3A 1FY1A 5LPFA 1THSH 5DJ7A 3PROA 4YO9A 4FU7A 1NU7B 2HNTC 2Y82A 1SFIA 4TYDA 1E36B 4K8YA 1FZZA 2A5AA 3EE0B 2BD9A 1Z8IB 2GTBA 3T28A 4WXIA 1THRH 1P01A 1G3EA 1BBRH 1JMOH 4ISNA 2TIOA 1L4ZA 1VCPA 3RXTA 2ZGHA 3RXSA 4ABGA 4DT7B 5T6DA 3SJ9A 4INHA 4J2YB 1AUJA 2B8OH 2J9NA 1YCPK 1S85A 3BG8A 5DPAA 2FX4A 3MNBA 4CR9A 6GCHG 1AHTH 2P3FH 3GCTG 2GT8A 2PUXB 5J4QA 5AFZH 1UO6A 2BVXH 1HV7A 4NWKA 5EPNA 4AFZA 2H9EH 4XE4A 3ATIA 2NU2E 3RXVA 1D3PB 1O39A 4GSOA 1CT0E 3DFJA 3I77A 2A0QB 2P3UB 4Y79A 1O2XA 5DP7A 1ELTA 5LPEA 4X1RU 2ZFTA 4K5ZA 4NFEA 1GHXH 2FIRH 1FPCH 1F5LA 2ODPA 3PO1C 4A92A 5DKMA 3SNCA 3EA7A 2ULLA 1UHBB 2W3IA 4H6TA 1O31A 5C1UA 1A0JA 1BRBE 2JKHA 1ZTKA 1HAVA 2TBSA 3PLKA 3TJUA 2A4GA 1EPTB 1O36A 1ANEA 4K1EA 1ZHPA 1QBVH 1HJAC 1YP9A 1AKSA 1GBHA 1P2MA 1S81A 3S0NA 1KIGH 1MKWK 1F2SE 2FI5E 3FVFB 3N7OA 1GHYH 1C4U2 1C5RA 4YOIA 1BRCE 1VITG 1IAUA 4D7GA 1AD8H 1DWCH 1V6DA 1ZMLA 3ZVGA 3ATWA 1YPHE 2Y5FA 5GWZA 3MH4A 2Z94A 4MLFB 1RGQA 4INKA 3S9CA 1SLXB 1TX8A 2CHAC 1TABE 1A7SA 4E7NA 4B71A 1Y5UT 3FZZA 5A8YA 3UTUH 1KTSB 3GCNA 1E0FD 1RTLA 1UTJA 2TGTA 1QRXA 4A5TS 4ISOA 3PLPA 1C1WH 4BOHA 5E2OA 4XBCA 1C5PA 5H4IB 1EP6A 3PMBB 3MH7A 2EI7A 1DITH 3G01A 4U30A 4ZKSU 2C8YB 3SJKA 2QXGA 2XBYA 5GXPA 2XWAA 3RXRA 1ELAA 1C5TA 1FUJA 3LGWA 5FCKA 2A45B 2D26C 2VH0A 3QDZB 5C2ZA 2CMYA 4ABJA 2A4OA 2UUKB 1BMNH 1TNGA 1EUFA 1UTQA 1MMJN 3SU1A 3ZV9A 3GY8A 1NFWA 4D7FA 1ABJH 1ELFA 2XC4A 3RMMH 2CF9H 1AI8H 2FO9A 3M36A 1P3CA 1IQEA 1TPSA 1A5HA 3SW2B 3P8NA 3RXMA 1UVUH 1ZYOA 1XKAC 1EZQA 2RDLA 2QGRA 5JBCS 1HAGE 1TB6H 2ZO3H 2Q6GA 3MHWU 3W95A 1MD7A 4OGYA 1DY9A 1IQHA 2GGVB 4R8TB 3B23B 2PTCE 2PKAA 1GWAA 4NA7A 1MH0A 1ELBA 1FV9A 3GY3A 1N8OB 4K60A 3UR9A 3QX5H 3MU8A 3ZZ7A 1MTNB 1NESE 1C2FA 3VB7A 4BAMB 1SB1H 1NFXA 2QF3A 1TGCA 2PSXA 1JWTA 1K2I1 1SLWB 2QCYA 2Q6FA 1V2MT 2HPQH 4MVNA 2GT7A 2AERH 1D6RA 4GUXA 1GBTA 3I29A 4BAOB 2V3HH 1CHOF 1NM6A 1Y3XA 2OD3B 5FCRA 1XM1A 3BF6H 3P92A 5JDUB 3H7TA 2R3YA 3PMHB 3URDA 4XFQA 1CGJE 3DHKH 3ZZDA 1FIZA 1GMDF 1O33A 4NSYA 2J4IA 5GJ4B 3ZV8A 2EA3A 2GMTB 1EASA 5HM9A 1GBAA 5FBEA 2HNTE 1GI8B 3OTJE 2WYGA 2P94A 3F9GA 2PUQH 1AY6H 5K7RA 4NIYA 2ZFFH 2QN5T 3VGCB 1BTUA 2R0KA 2BM2A 1VJ9U 3LGIA 1PPFE 3NXPA 1DUAA 4K2YA 5EGMA 2P95A 1S5SA 1AZ8A 2ZDKA 1NT1A 1GDNA 2GX4A 3A89A 1P2KA 1BTXA 4GHQA 8ESTE 1Z71A 2ZDNA 5ESTE 1C2MA 1XUIA 5EQQA 2XXLA 2LPRA 4YOGA 1HRTH 1GI7B 1ZTJA 3SNDA 2WPLS 1C4V2 1CT2E 4OS4A 1TYNA 1Y3YA 2CV3A 4Y0YE 4ZAEA 1SGTA 1GBLA 2SFAA 1F0SA 3LDXH 3M35A 1PPHE 1KLIH 1O2LA 3NCLA 2HALA 2AGEX 1HAIH 4OS2A 1T31A 3BV9B 1GBIA 2JETC 1FIWA 4FUFA 4IN2A 1WV7H 3F6UH 1EZUC 3LGTA 3F9EA 4GHTA 1V2NT 1DXWA 1TNLA 1XUHA 1HDTH 3LGUA 4KELA 3LONA 3OSYA 2ANKH 1NFUA 1W11U 1BTZA 1LHEH 5FAHA 3HPTB 2ZCLP 1C5XB 3PWCA 1HAXB 3E8LA 1LDTT 2VGCB 2Z6BD 2WV5A 3QUMP 1C4Y2 5I25A 5HMAA 3ZZ5A 2FPZA 1O3GA 2STAE 1V2TT 1C9TA 1BDAA 2ZZUH 3BG4B 5FX6A 1OS8A 2F3CE 2BD2A 4YM9A 4FUJA 3PM3A 2DE8A 2ZGBH 4MPXA 2A4RA 1GGDB 4WMDA 2XNIA 4F49A 3SU0A 2BX3A 3QTVH 3MNCA 3T29A 3P8OA 1O3KA 1SGYE 2ZQ2A 5DP8A 2BMGB 2YNBA 1PQ5A 1V2OT 1YF4A 2OCVB 5CHAC 2BDBA 2D1JA 2ZPRA 3RM0H 4X8UH 1C2JA 1GDUA 1O3JA 2ALVA 1HYLA 5PTPA 3MH6A 3TGKE 3RLWH 1C2IA 1K28D 2ZGJA 2FMJA 4Y71A 2GDEH 5FX5A 1C1UH 1L1GA 1PPEE 3I78A 4DJZB 1HGTH 5B6OA 2ZU4A 2HRVA 5A09A 4X8SH 2CN0H 1EZSC 3SV9A 4YESB 3VXEH 3EGKH 2XC0A 2BZ6H 1UK2A 4NIWA 2ZDLA 3Q76A 1CBWC 3LU9B 4Q7ZA 3ZZBA 4I31A 2Z9KA 1UK3A 3L33A 1LVBA 1SR5C 1GBJA 1BOQA 1GMHG 4NWLA 2ANMH 1ELEE 2VIOA 5DG6A 1VGCB 4X6MA 3T62A 1YPEH 4CREA 1GI6A 2BLWA 1KYNA 3K65B 4AG2A 4NIXA 1NU9A 5AFYH 2ZHFH 1W0ZU 1A5IA 3PMAB 1VZQH 5T6FA 1KXDA 1CHGA 5GCHG 4AYYB 1Q3XA 3STJA 3AAVA 1OWHA 5AF9H 1UTOA 1P2OA 3EDXB 3NWUA 2G51A 3UY9A 3SUFA 3HKIB 4ZKOU 5C1YA 1TGTA 1O3LA 4DIHH 3TITA 3UWIA 1F92A 1P3EA 4UONA 1F5KU 1BJVA 4IMZA 1TPPA 2PKSC 4CRAA 2Q1JA 2GCTC 3RXQA 1TLDA 1HIAA 3A8AA 2SGAA 4ISHH 1H9HE 3GCOA 2ODQA 3SV6A 3RM2H 1ESBA 1WTHD 5ETXA 2ZU1A 2A1DB 2FZZA 2ZHEH 2GVFA 4GCHG 1ZZZA 2FP7B 5C3NA 2HNTF 1V2WT 1N6XA 1RIWC 4BAKB 6CHAC 2ESTE 4YT6H 4MNVA 2Y7ZA 3QN7A 4E7RG 3ZVEA 1V3XA 6GCHF 1IQNA 3O8BA 1T4VH 5FHTA 3GCTF 3SU4A 3GDSA 1BZXE 4WJG2 3RXGA 3UNRA 2TGDA 1SLVB 4AORA 4B74A 1GG6B 3RC5A 1V2KT 1HB0B 4K8BA 3OY6U 5EW2H 2UWPA 4B76A 3HK6B 3F68H 1D3DB 4AB8A 4AOQA 3RP2A 4BTUB 1RTFB 1KXEA 1AVWA 1Y3UA 1O35A 1MKXH 2R9PA 1BBRK 5JYIA 1ZOMA 3QO6A 2J2UA 3KEEA 5AHGH 1XUJA 4D9RA 5EOKA 3Q3KA 4A6LA 3ENSB 3GY5A 3P70B 1G37A 4NIVA 3FP6E 2ZNKH 1DPOA 2O8TA 1UVPA 3BIVH 3Q77A 1C5LH 1SQTA 4NZQA 2FM2A 3SBKA 4H4FA 3LKWA 1N6YA 2BHGA 3A84A 1UJ1A 2BDGA 4H42U 2OC8A 1C1VH 1SHYA 2QIQA 1AFQC 1HPGA 3DD2H 2SGQE 1EX3A 3CENA 1GBDA 2FS9A 1VITF 3RLYH 3E0PB 3SJIA 1EJMA 1Q2WA 4XDEA 5HGGA 3TLOA 3UWJH 4X1PU 1UK4A 4DCDA 4ABHA 4KTUA 1U6QA 3MU0A 2VVUA 1L1NA 1J14A 4UFFH 7GCHF 1QJ1B 1BHXF 3KQCA 1MQ5A 3MU5A 5JBAS 2J92A 2GCHG 1O3OA 3QTOH 4BTTB 1NY22 1YPKH 2ZQ1A 1Y5BT 1ZPBA 3FP8E 4JZIA 4Q7XA 1GHVH 3QK1A 1TBRH 3RXEA 2C90B 1JRTA 1T8NA 2F9PA 2OQUA 2WPHS 3LGVA 2WINI 1KSNA 1LPZB 3TJVA 3R0FA 2FX6A 1O5CB 1GCDA 3RDZA 2EC9H 1IQKA 1JBUH 1HUTH 1SQAA 1KDQB 2JH0D 1OPHB 2PFEA 3L6PA 1AZZA 1TPOA 1A1RA 2OINA 2XBVA 1AIXH 1TMBH 2H9TH 5EG4A 4CRFA 2OC0A 2SGDE 4ASHA 1PQAA 3RXUA 1P05A 2BD4A 2THFB 2GZ9A 4FUIA 1G2LA 2OC7A 1HBTH 3ZZ9A 3OY5U 4WVPE 2FESH 1EAWA 2IOTA 3U8TH 3KQEA 1GJ4H 1K1LA 1UCYH 3F9HA 1CQQA 3BTME 2ZGXH 4Z0KA 4ZH8A 3ZVFA 1CA0B 4UEHH 1UVSH 2P8OC 3SUDA 3M5MA 1GJ6A 1YLDA 2ZHQH 1SBWA 1D4PB 2JH5D 2BD5A 3SV2H 3A87A 2ZGCA 3T26A 3MTYA 1C5OH 1ZTLA 2IPHA 2KAIA 2AYWA 3NKKA 5A0CA 2OBQA 4RN6A 2ZFQH 5EXNA 5IYTA 1PQ7A 1UVOA 5LGOA 1P03A 2AS9A 3CS0A 1FLEE 3D23A 1AB9B 1CVWH 1PPBH 1O32A 3M7TA 2W7SA 4Q2KA 3QZQA 2PGBB 1D3QB 4JYVH 4AG1A 4DIIH 1EAUA 1MAYA 1GBEA 3SQHE 1P2IA 4ABBA 1E34B 3O8RA 3PTNA 1FAKH 1ABIH 1VJAU 8GCHF 1DDJA 1JXPA 2FOAA 2GKVE 1W12U 1KXBA 2AMPA 3B8JA 1GHBG 2EI8A 5A8XA 3T25A 2ANWA 1QL7A 1PYTC 1MTWA 1LMWB 1ZSKA 3SGAE 1HXEH 2J34A 3U1JB 3ATKA 4XSKU 1FPHH 3S9AA 1ELCA 3TU7H 3ODDA 1O3IA 2TPIZ 1QQUA 4A1VA 6ESTA 5IDKA 1ZSLA 1TBQH 3A8BA 4VGCC 5L30H 1GVZA 2A5IA 1ORFA 2BLVA 2HOBA 3DFLA 4Y76A 1C2HA 1V2UT 3VB6A 2AGGX 3TVJB 3A8CA 5ESBA 4DW2U 1G2MA 1SC8U 1ZSJA 2F9UA 1HXFH 1SGDE 1OP2A 1NO9H 1TA6A 1SG8B 2RG3A 1EATA 1KY9A 3M3VA 1H4WA 3GYLB 1EZXC 1YCPM 1O2OA 2FYQA 3UFAA 2VWLA 1XXDA 3A7WA 2G81E 2F91A 1FQ3A 4INLA 2J38A 2ZCKP 3BTTE 1TRYA 5JBBS 3BSQA 3RXJA 1GI4A 4QT8C 3OU0A 1F7ZA 2FWWA 1XUKA 1W14U 5EODA 4A1TA 2OQ5A 1NFYA 1P04A 3P95A 1O37A 4LZ4B 2B0FA 2VJ1A 2M5TA 3GCHB 1T7CA 1F5RA 4B75A 1FY5A 1SPJA 1O2IA 4JZDH 2ZDMA 1YCPH 3M37A 2ZECA 4AFUA 4AFQA 1B0FA 1TIOA 1XXFA 3RU4D 4YT7H 3MU4A 3HGPA 1ETTH 2UUYA 1LVYA 4B2CA 1W2KH 2LNCA 3QWCH 1O2JA 2A31A 1O2NA 3MO9A 2BDIA 3H5CB 4DVAU 1QCPA 2C8WB 2OBOA 2UUFB 1B5GH 1TOMH 4SGAE 3SU2A 3IWMA 1O3MA 4ZHLU 1BTYA 3KGPA 1SGNE 2WUCA 1FN8A 2H6MA 3SJ8A 3RXDA 1DT2A 1DANH 1IQGA 4I8LA 5GPIB 1E37B 1QHRB 1QBOA 1W7XH 3D49H 2WPMS 4Y8XA 1RXPA 2A2QH 2H9HA 2XBXA 2H5CA 1SMFE 4TY6A 4Y8YA 2A5KA 1LHDH 2Z7FE 1EKBB 2DUCA 5A2MH 4MNWA 4IMQA 2Y5HA 2XC5A 1K1IA 1TQ7B 1ID5H 1C5QA 2YOLA 3D62A 1HFDA 3E91A 3ZVDA 1XMNB 4GLYA 3A7VA 3VEQB 4CRCA 2I6QA 1C1PA 2Z9JA 1O2SA 1P02A 2SGPE 1SVPA 1K1NA 2PV9B 3TJNA 4YOJA 4HFPB 1WQSA 1KXCA 4Z6AH 3LH1A 1DVAH 5TCAA 1OKXA 1O38A 2C93B 5HYOA 2A32A 3MH5A 1C9PA 1ZRBA 3E0NB 5GCHF 1LCYA 4Y0ZE 3V0XA 2OP9A 1C1RA 1KLJH 3ESTA 4FVBA 1MZDA 2C8XB 8LPRA 3KNXA 1QA7A 2ZU5A 7ESTE 2VB0A 4KP0A 1BITA 3NUMA 1SOZA 1W13U 1WCZA 2BDCA 3SV8A 1V2ST 3C27B 4ZHAA 1O2WA 1LQEA 3R3GB 3ODFA 1WUNH 3T27A 1F0RA 1UTPA 5LH8A 1EPTC 3T2NA 1UHBA 3BEFB 4WWYA 5FPTA 3ATMA 4JK6A 1OWDA 1ANDA 1PJPA 1A3EH 1L1JA 5LPRA 4AGJA 2ZFSA 4Y7BA 1TMTH 1RS0A 2ZPSA 4GCHF 1K1MA 4BAHB 4B73A 5DP3A 1GPZA 2K1QA 3RXHA 1EPTA 1M9UA 4I8KA 3UNSA 2B5TB 4FVDA 2ZC9H 4ABIA 4BNRA 1TAWA 1THPB 3RC4A 1PYTD 2R3UA 1A46H 3LJJA 2CF8H 1ZJDA 1RTKA 5FPYA 3PLBA 1GMCG 3L3TA 1L0ZA 2W5EA 5E2PA 2BY9X 1DWBH 1C5VA 2G8TA 2XRCA 3O8DA 1QL8A 3STIA 1O2UA 2NU0E 3UUZA 1DWEH 3SJOA 1GCTB 1H9LB 3E1XB 3MWIU 4I8JA 4AFSA 1O2GH 3A83A 2FOEA 4OS5A 3CS7A 2GDDA 2Z9LA 4R0IA 4RKJB 1NN6A 1J16A 3M5LA 4X6NA 1IQLA 4D8NA 3T5FH 2FLRH 1PPZA 1GBCA 4ABAA 1BMMH 1TGBA 3A82A 1C1TA 4Y10E 5A8ZA 1PPCE 3LPRA 4K1SA 1CA8B 1ESTA 3QGJA 4X1QU 1BTPA 1GBFA 1K21H 7LPRA 5T3HA 1DWDH 5L2ZH 1SGQE 1SHHB 4BXSA 3GICB 1P0SH 4I8HA 1L2EA 3MO3A 2HPPH 3V3MA 8KME2 1WTGH 5K0HA 2W3KA 1Y59T 3D65E 3RMOH 1P10A 2ALPA 2F9NA 4ZUHA 1BMLA 4NSVA 2VIQA 2ASUB 2BOKA 1MKXK 1SI5H 5DP6A 4DOQA 4X8TH 3UQOA 1IQJA 2BDYA 1CHOG 4FU9A 4CR5A 4Q7YA 2R0LA 2ZDVH 1N8OC 4DGJA 2EEKA 3ITIA 1MTNC 4AYVB 1EOJA 1GI2A 3RUOA 2Z9GA 4CHAB 4I7YH 2GCHF 3ZVBA 1GMDG 3ELAH 1O34A 1C5SA 2FYRA 2PHBA 3ZVAA 1G32B 3BTKE 1RRKA 4Y6DA 3PYHA 4NA8A 1Z6EA 3ZZ8A 2G4UA 1SGEE 2P3TB 2Z9IA 3LOXA 3M61U 4JYTA 2QY0B 2BY6X 3UREA 1OWKA 3V7TA 1AWHB 1H8IH 1GI3A 4X1NU 2FOHA 1A4WH 5FXLA 1NC6A 2FEQH 2WPIS 1NS3A 1BB0B 4ZMAH 2GMTC 3TGJE 3TGIE 1C2EA 1VCQA 3FZDA 1YYY1 5A0AE 1B0EA 2ZG0H 1BRAA 1O5BB 3KF2A 5TCCA 1ZHRA 3E16B 3VGCC 2ODYB 4SGBE 2BLQA 4OGXA 1Y8TA 2FTMA 2PR3A 1EXFA 2UUJB 4YZUA 3MI4A 2AFQB 2CXVA 1V2RT 1C2LA 1WAYB 4JYUH 2SGEE 2Z3DA 3RXKA 1GJ5H 1BIOA 1BBRE 5BRRE 3KQDA 4Y7AA 1GBBA 4F4OC 3SU5A 4RSPA 1FY4A 2A7JA 1HAVB 2OLGA 3M5OA 3IG6B 1SSXA 3M5NA 3PO1B 2WUBA 2B7DH 2UWLA 2VIVA 3SI3H 1QTFA 1FAXA 3SNBA 2BX4A 3HKJB 1AKSB 3FAOA 2PTNA 2C3SA 1TNKA 1YKTA 1TALA 1J17T 4X1SU 2Y7XA 3K9XB 1LHCH 1BTWA 4TWWA 1TA2A 4ZKNU 1GL1A 4TY7A 2R2WU 3DT0H 1HJAB 1UCYK 3MMGA 3ATLA 3M3SA 5FBIA 9LPRA 2VGCC 3K6ZA 1C5ZB 1OWIA 1G9IE 4D9QA 1HCGA 2ZCHP 2QF0A 1EOLA 2P16A 4AX9H 3SGQE 3GDUA 4AGKA 4Q80A 4U2WA 1IQIA 3BG4C 4X2WA 1Z6JH 1ZRKA 2BXUH 2PWXA 1P11E 1UTNA 4X6PA 4Y11E 2VVCA 1T32A 1BHXB 1QR3E 1MQ6A 2CHAB 1A2CH 1GGDC 4ABFA 3UQVA 5EQSA 1C2GA 1H8DH 2EI6A 3ZZ6A 3U69H 4DY7B 1O3NA 2ZU2A 1FY3A 4IGDA 1TNJA 1UTLM 3DUXH 1YGCH 2F83A 2FS8A 4WH6A 5DP5A 4KTSA 2AEIH 2B9LA 1D3TB 4ISLA 3UR6A 1ELGA 1O2HA 1LPGB 3AASA 1TONA 1KTTB 2AMDA 1PPGE 4CRGA 4THNH 3UOUA 1GDQA 1NTPA 1O2RA 5DK1A 1ANCA 1QL9A 3PWBA 2QXIA 1GI9B 5FPSA 4D76A 1V2VT 1WSSH 2FOBA 4WMFA 1GJ7B 2GZ7A 1Y5AT 2GP9B 3MU1A 1D6WA 2PGQB 3RXBA 3K6YA 4JCNA 3GY4A 4LK4A 2VWOA 1CSOE 1XVMA 5C5NA 2F9VA 3M7UA 3Q3YA 1O2TA 3GISB 2BY5X 1T8MA 3TH3H 2GD4B 2PKAB 2BLOA 1TE0A 2V0BA 1MU8B 1QIXB 2H5DA 1VGCC 2BD8A 1A5GH 2ZHWH 3BTWE 4BAQB 1FY8E 1EP5A 2WV4A 1YLCA 2G52A 2XTTB 4MPUA 1BA8B 1A3BH 1S0RA 2XCFA 2FODA 3CP7A 3A85A 5C20A 1C5NH 1K9OE 1EQ9A 1TX7A 3BTGE 1AN1E 1LKBA 2BVSH 3O8CA 3TIUA 3UNQA 2ANYA 1HAYB 3KCGH 1S6HA 1CO7E 1MTUA 3K2UA 2W7UA 4YLUA 2ZEBA 1YPLH 2BZAA 1GBKA 1F0TA 1S6FA 2STBE 4DURA 1O2PA 1A0LA 1V2JT 3OX7U 2AMQA 1ETRH 1O3AA 1MCVA 3BN9A 1YPMH 1ARCA 3HGNA 1ZLRA 5L2YH 2O8LA 2NU3E 5DO4H 1LVMA 2JH6D 3QLPH 1HNEE 1Z1JA 1ZHMA 3A80A 3SNEA 1A0HB 1C1MA 1O5DH 1SL3A 3BTDE 2SNWA 2ZFPH 4X6OA 4FUBA 1XUFA 1ZJKA 1DFPA 1ETSH 3A81A 4B2BA 1V2PT 1XUGA 1G3CA 4OS7A 1Z1IA 3WY8A 1QGFA 1AUTC 2D8WA 1JIRA 2XW9A 1O3FA 2FI4E 1DSUA 3MNSA 3SZNA 1AVGH 5F03A 5C67A 1EB1H 3NK8A 5ABWA 2Y80A 2Y81A 1P9SA 2SGFE 1RD3B 2PSYA 3QZRA 3RXPA 1AU8A 2XYAA 2BD7A 2G5VA 1E35B 1GG6C 2OC1A 5HXFA 4HGCA 4K1TA 2VWMA 3SV7A 2FOGA 2BOHB 4AB9A 4NFFA 5J4SA 2VIDA 1GHWH 1K1PA 5DP9A 2ZHDA 1SGRE 4I33A 4TPIZ 2JETB 1JOUB 1Z7KA 1AVXA 1IHTH 2J95A 1HJ9A 4NA9H 6LPRA 5CMXH 1W0YH 1QB1A 4IC6A 3ZYEA 1MCTA 3RXLA 1HAHH 3A88A 1GL0E 2Y6TA 4U01A 1P12E 1P2QA 3BTQE 2IN2A 5G4BA 2VINA 3ZZ4A 2NU4E 2BQ6B 1ZPZA 1O2KA 3GY6A 5GDSH 1ZGIA 1EAXA 4ZKRU 2G4TA 1QY6A 1QBNA 1O2VA 1T8LA 1G3BA 1LO6A 2G00A 3IITA 3PTBA 2HVXA 4NGAH 4O3TA 3EYDA 5E0JA 1DS2E 2GV6A 1A61H 1J8AA 1EAIA 2ZKSA 7GCHG 1AE5A 3UOPA 4MNYA 1N1LA 2BY8X 1MTSA 2Y5GA 2BXTH 5JBTA 1O2MA 1HJ8A 4WH8A 2VNTA 2QXJA 2OTVA 5CHAB 3U98H 1VCWA 1DUEA 1ESAA 1Z8JB 1Y3WA 4YTAA 1SGCA 4UFDH 5EXLA 2YNAA 1DSTA 1MAXA 1QB9A 4WF8A 1GHAG 4BXWA 1GMCF 3S7KB 3KL6A 2RCEA 3SU6A 1GJ8B 1TFXA 5DGJA 1TNHA 3VB4A 3U8OH 4TPYA 3RU4E 2A7HA 1V2QT 3F9FA 2C4FH 1X7AC 4ZHMU 3BTEE 3GDVA 1O3CA 3BTHE 3W94A 3HK3B 1ZPCA 2FTLE 1FNIA 1OXGA 3DA9B 1OOKB 3SNAA 1SLUB 1O2ZA 2XBWA 1FDPA 1OP0A 1WU1A 2ZWLH 2BY7X 1KLTA 3RXOA 1IHSH 1SGFG 4RKOB 2D2DA 2ZTZA
chains in the Genus database with same CATH superfamily
5JB9S 2AH4X 1CBWB 4KGAA 5C17A 1ZR0A 3PV4A 3AAUA 1O3PB 1GI5A 1IQMA 1C1QA 2W26A 1TNIA 1DLEA 1SGFA 1O2YA 1P9UA 2XCNA 1WBGB 3LT3A 1PFXC 1Q31A 1IOEA 3U8RH 1KDQA 1BTHH 3M7QA 4JMYA 4CH2B 1UTKA 2ZU3A 3PMJA 2VVVA 4HI3A 4HTCH 1ELVA 1TQ0B 1YPGH 1SFQB 4HZHA 2Z3CA 5A0BA 5C1XA 1MBQA 1GBMA 1GJDB 1MKWH 4Y8ZA 1DM4B 4WXVA 4XBBA 1O5AB 1CA0C 1H8HD 1VR1H 2BTCE 4ZXYH 4MDSA 4FUCA 1B7XB 2ZF0H 5C5OA 1GMHF 5E8EH 4NZLA 1O5GH 2ZFRH 3BTFE 1SQRA 1RFNA 1XX9A 5EPYA 3FOAA 1HIAB 4YLQH 5T6GA 1P2JA 4XOJA 1AE8H 1EB2A 3A8DA 1DX5M 2ZA5A 1FXYA 3UPEA 1C5MD 2OXSA 2G5NA 1G3DA 5EQRA 4MG3A 3ZZAA 2XWBI 4KTCA 2QAAA 3SO3A 4MPVA 2PKSB 2BQWB 2GCTB 1D9IA 3LGYA 4JZFH 3N7DA 3TK6A 8GCHG 2PP6A 4IS5A 1GI0A 1AB9C 5GNDA 5DSFA 1K22H 2PW8H 4P00A 3UIRA 2BDHA 3AVZA 2UWOA 2AIQA 2VIPA 2WPKS 4YXWD 1WOFA 5E0GA 3TH2H 3GY7A 2VH6A 2WSSD 4MTBA 1RIWB 2ZP0H 1ACBE 3VXFH 3S69A 1C1OA 6CHAB 1FX0B 3TNTA 3F1SB 1YPJH 4TWYA 3NZIA 1O5FH 1WQVH 1QRZA 2QYIA 4MNXA 2ZIQH 5B6LA 5EW1H 1NROH 4U32A 2Q6DA 1CGHA 3A7ZA 1KXAA 2FDAA 4B1TA 4UFGH 1LKAA 4O97A 5HM2A 3AK5A 3JZ2B 3P8FA 1TWXB 2CGAA 4ZXXH 2H2ZA 2QC2A 1GJAB 3MFJA 1C1SA 2PLXA 1O3BA 1HLTH 2LELA 3VB5A 1S84A 1P57B 1OX1A 1CU1A 1FN6A 5BPEA 1GI1A 2FXRA 2HGTH 2IJOB 3MNXA 1UVTH 2C8ZB 1XVOA 1ZMJA 3M3TA 1YC0A 5HKKD 1TGNA 3PB1E 1HAOH 2SNVA 1OSSA 2ZDAH 3P8GA 2GV7A 2TRMA 3ZZ3A 4CBOA 1NRSH 1T4UH 1AFQB 1P06A 4I32A 2CJIA 1AFEH 2BDAA 4FUHA 4K3JA 3SGBE 3LC5A 1AQ7A 3E6PH 2WV9A 3LJOA 3EA8A 2V3OH 4CH8B 3GCHC 1DLKB 4PROA 2BB4A 3MOCA 4IW4E 1KXFA 4LOYH 2ZPQA 2J94A 1DOJA 2YMSB 3FP7E 4I8GA 4ISIH 3SOSA 1TGSZ 2QA9E 2A7CA 2FOFA 1C2KA 3A7TA 4KKDA 3BEUA 3A7XA 4RT0A 1LQDB 1JIMA 3RXAA 3SORA 4B2AA 1DY8A 1O2QA 1TPAE 5GIBA 3AW0A 1OYTH 1J15A 1QFKH 2TGPZ 3OYPA 1YM0A 2HVYB 1NRQH 3E90B 1J9CH 3KN2A 2BYAX 2VWNA 1GVLA 4MPWA 1QA0A 5F6MA 1OYQA 4CRBA 1TBZH 2OUAA 2V6NA 2QF4A 1CT4E 4X8VH 3ZVCA 4FUGA 1Z8RA 3JZ1B 2WYJA 4UFEH 1LPKB 4CBNA 1ELDE 1L4DA 1LHGH 1BCUH 1TRNA 4DG4A 2R2MB 3EA9A 1AMHA 1K1JA 3RXCA 1F0UA 1SGPE 1S83A 3TNSA 2H1UA 1NPMA 4WMEA 1LTOA 2DE9A 1LHFH 4E05H 3RC6A 5SGAE 4XBDA 2P59A 1H8ED 1GJCB 5E0HA 2A2XH 3GOVB 1CGIE 1FI8A 3EQ0H 3VG8A 1SGIB 2KCAA 3MO6A 1DE7H 4X2XA 3C1KA 3SUGA 2KAIB 2P8OB 4O9VA 1FMGA 2F9OA 2HLCA 4O3UA 2ZI2H 2F4LA 4GVUA 3LC3A 3VPKA 2V35A 1FONA 3UAIC 3Q3XA 1W7GH 4FETA 1G30B 3MYWA 1T8OA 3UB0A 1FJSA 1SQOA 1AO5A 3QGNB 4FUEA 3VB3A 1UCYE 4J1YA 1P8VC 4K69A 1EJNA 2FLBH 2KCYA 1BMAA 1P09A 5TJXA 3SHAH 1NZQH 3AW1A 5L6NH 3S7HB 1O0DH 4ESTE 3NPSA 1ZGVA 1IQFA 1UMAH 1MTVA 2AIPA 4GAWA 2BVRH 3RMNH 5JB8S 2G55A 2GZ8A 3GY2A 1O5EH 2P93A 3U9AH 1S82A 1Y3VA 3LIWA 3V13A 1EJAA 1W10U 9ESTA 3RU4T 3TK5A 4JK5A 4JZ1A 4M7GA 1VITH 4CRDA 1YPHC 1O30A 7KMEH 1MBMA 2A4QA 3GYMA 1AWFH 1E38B 2O8WA 2F9BH 2WPJS 1OP8A 4OS6A 1O3DA 1WYKA 4P02A 4FUDA 2I6SA 3SUEA 2BD3A 1E1RD 2VIWA 3SU3A 3SHCH 3ZYDA 3Q00A 1UTMA 4LZ1H 3PV5A 3KIDU 1ANBA 1DXPA 1CE5A 5JPMH 3RXIA 3KQBA 2ILNA 3TK9A 1O3EA 4O03A 3TJOA 3VFEA 1P2NA 1BT7A 4NG9H 1GJ9B 1GHBF 1HAZB 1QURH 1QRWA 3A7YA 4OS1A 4VGCB 1PQ8A 3LH3A 3HATH 2KZ4A 1S0QA 3TPIZ 3URCA 4NCYA 3BIUH 2HWLB 1INCA 3P17H 5EXMA 4RT1A 3SI4H 3GS9A 1GVKB 5DP4A 3U1IB 2O8UA 1GCTC 1BRUP 2FI3E 2Z3EA 1TMUH 3F3BA 5F8ZA 5CE1A 1H9IE 2FOMB 4A7IB 4H6SB 1GJBB 3V12A 1QJ7B 4UD9H 1C1NA 3B9FH 2W6JD 5I46H 3FFGA 2ZTXA 4ZROA 4XRNA 4BTIB 1K1OA 1RJXB 4LXBH 1MUEB 1QQ4A 2TGAA 4JZEH 4X2VA 1C5YB 2QXHA 1TX6A 2HLDD 3BEIB 4BANB 1QB6A 2RA0A 3RXFA 5EU8A 4ABEA 3FO8D 3EAJA 4FXGH 1MU6B 1HAPH 2FOCA 2O9QA 2AGIX 1G36A 4IN1A 1AGJA 3E3TA 4IC5A 1LVOA 4ABDA 1C5WB 1OWJA 5C0TA 1V2LT 1YBWA 1C5UA 1JRSA 1SOTA 1Z8GA 5F8TA 3FANA 4Q4LA 2ZTYA 2O8MA 3A86A 1GHZA 1BQYA 1MD8A 3H7OA 3S9BA 4MQAA 4E06H 2QV1A 5AVDA 3RMLH 1O3HA 1OWEA 5F8XA 3WW7A 2NWNA 4UE7H 3SQEE 4IBLH 1DICA 4AN7A 1NRRH 1H1BA 4UDWH 3ZZCA 1ARBA 1NRPH 3P6ZB 1TRMA 1MZAA 3KHVA 4A1XA 1W3CA 1GHAF 4CHAC 1C2DA 4X2YA 2BQ7B 1W8BH 4X0WU 4AZ2B 4GPGA 3TH4H 2NU1E 1QNJA 3SN8A 1QJ6B 1BJUA 2VU8E 1BUIA 1NRNH 1XKBC 1TOCB 2RA3A 1ZMNA 4FU8A 4WY3A 1FY1A 5LPFA 1THSH 5DJ7A 3PROA 4YO9A 4FU7A 1NU7B 2HNTC 1YLNA 2Y82A 1SFIA 4TYDA 1E36B 4K8YA 1FZZA 2A5AA 3EE0B 2BD9A 1Z8IB 2GTBA 3T28A 4WXIA 1THRH 1P01A 1G3EA 1BBRH 1JMOH 4ISNA 2TIOA 1L4ZA 1VCPA 3RXTA 2ZGHA 3RXSA 4ABGA 4DT7B 5T6DA 3SJ9A 4INHA 4J2YB 1AUJA 2B8OH 2J9NA 1YCPK 1S85A 3BG8A 5DPAA 2FX4A 3MNBA 4CR9A 6GCHG 1AHTH 2P3FH 3GCTG 2GT8A 2PUXB 5J4QA 5AFZH 1UO6A 2BVXH 1HV7A 4NWKA 5EPNA 4AFZA 2H9EH 4XE4A 3ATIA 2NU2E 3RXVA 1D3PB 1O39A 3KYGA 4GSOA 1CT0E 3DFJA 3I77A 2A0QB 2P3UB 4Y79A 3N99A 1O2XA 5DP7A 1ELTA 5LPEA 4X1RU 2ZFTA 4K5ZA 4NFEA 1GHXH 2FIRH 1FPCH 4DT4A 1F5LA 2ODPA 5KECA 3PO1C 4A92A 5DKMA 3SNCA 3EA7A 2ULLA 1UHBB 2W3IA 4H6TA 1O31A 5C1UA 1A0JA 1BRBE 2JKHA 1ZTKA 1HAVA 2TBSA 3PLKA 3TJUA 2A4GA 1EPTB 1O36A 1ANEA 4K1EA 1ZHPA 1QBVH 1HJAC 1YP9A 1AKSA 1GBHA 1P2MA 1S81A 3S0NA 1KIGH 1MKWK 1F2SE 2FI5E 3FVFB 3OFND 3N7OA 1GHYH 1C4U2 1C5RA 4YOIA 1BRCE 1VITG 1IAUA 4D7GA 1AD8H 1DWCH 1V6DA 3MQKC 1ZMLA 3ZVGA 3ATWA 1YPHE 2Y5FA 5GWZA 3MH4A 2Z94A 4MLFB 1RGQA 4INKA 3S9CA 1SLXB 1TX8A 2CHAC 1TABE 1A7SA 4E7NA 4B71A 1Y5UT 3FZZA 5A8YA 3UTUH 1KTSB 3GCNA 1E0FD 1RTLA 1UTJA 4ASUD 2TGTA 1QRXA 4A5TS 4ISOA 3PLPA 1C1WH 4BOHA 5E2OA 2CK3D 4XBCA 1C5PA 5H4IB 1EP6A 3PMBB 3MH7A 2EI7A 1DITH 3G01A 4B6FA 4U30A 4ZKSU 2C8YB 3SJKA 2QXGA 2XBYA 5GXPA 2XWAA 3RXRA 1ELAA 1C5TA 1FUJA 3LGWA 5FCKA 2A45B 2D26C 2VH0A 3QDZB 5C2ZA 2CMYA 4ABJA 2A4OA 2UUKB 1BMNH 1TNGA 2W6ID 1EUFA 1UTQA 1MMJN 3SU1A 3ZV9A 3GY8A 1NFWA 4D7FA 1ABJH 1ELFA 2XC4A 3RMMH 2CF9H 1AI8H 2FO9A 3M36A 1P3CA 1IQEA 1TPSA 1A5HA 3SW2B 3P8NA 3RXMA 1UVUH 1ZYOA 1XKAC 1EZQA 2RDLA 2QGRA 5JBCS 1HAGE 1TB6H 1W0JD 2ZO3H 2Q6GA 3MHWU 2YMSD 3W95A 1MD7A 4OGYA 3F2GA 1DY9A 1IQHA 2GGVB 4R8TB 5IK2D 3B23B 2PTCE 2PKAA 1GWAA 4NA7A 1MH0A 1ELBA 1FV9A 3GY3A 1N8OB 4K60A 3UR9A 3QX5H 3MU8A 3ZZ7A 1MTNB 1NESE 1C2FA 3VB7A 4BAMB 1SB1H 1NFXA 2QF3A 1TGCA 2PSXA 1JWTA 1K2I1 1SLWB 2QCYA 2Q6FA 1V2MT 2HPQH 4MVNA 2KCOA 2GT7A 2AERH 1D6RA 4GUXA 1GBTA 3I29A 4BAOB 2V3HH 1CHOF 1NM6A 1Y3XA 2OD3B 5FCRA 1XM1A 3BF6H 3P92A 5JDUB 3H7TA 2R3YA 3PMHB 3URDA 4XFQA 1CGJE 3DHKH 3ZZDA 1FIZA 1GMDF 1O33A 4NSYA 2J4IA 5GJ4B 3ZV8A 2EA3A 2GMTB 1EASA 5HM9A 1GBAA 5FBEA 2HNTE 3F2FA 1GI8B 3OTJE 2WYGA 2P94A 3F9GA 2PUQH 1AY6H 5K7RA 4NIYA 2ZFFH 2QN5T 3F0OA 3VGCB 1BTUA 2R0KA 2BM2A 1VJ9U 3LGIA 1PPFE 3NXPA 1DUAA 4K2YA 5EGMA 2P95A 1S5SA 1AZ8A 2ZDKA 1NT1A 1GDNA 2GX4A 3CNRA 3A89A 1P2KA 1BTXA 4GHQA 8ESTE 1Z71A 2ZDNA 5ESTE 4B6EA 1C2MA 1YY3A 3DSGA 1XUIA 5EQQA 2XXLA 2LPRA 4YOGA 1HRTH 1GI7B 1ZTJA 3SNDA 2WPLS 2XOKD 1C4V2 1CT2E 4OS4A 1TYNA 1Y3YA 1KMHB 2VBCA 2CV3A 4Y0YE 4ZAEA 1SGTA 2J98A 1GBLA 2SFAA 1F0SA 3LDXH 3M35A 1PPHE 3OE7D 1KLIH 1O2LA 2J97A 3NCLA 2HALA 2AGEX 1HAIH 2RDEA 4OS2A 1T31A 3BV9B 1GBIA 2JETC 1FIWA 4FUFA 4IN2A 1WV7H 3F6UH 1EZUC 3LGTA 3F9EA 1E1QD 4GHTA 1V2NT 1DXWA 1TNLA 1XUHA 1HDTH 3LGUA 4KELA 3LONA 3OSYA 2ANKH 1NFUA 1W11U 1BTZA 1LHEH 5FAHA 3HPTB 2ZCLP 1C5XB 3PWCA 1HAXB 3E8LA 1UW7A 1LDTT 2VGCB 2Z6BD 2WV5A 3QUMP 1C4Y2 5I25A 5HMAA 3ZZ5A 2FPZA 1O3GA 2STAE 1V2TT 1C9TA 1BDAA 2ZZUH 3BG4B 5FX6A 1OS8A 2F3CE 2BD2A 4YM9A 4FUJA 3PM3A 2DE8A 2ZGBH 4MPXA 2A4RA 1GGDB 4RI0A 2XNIA 4F49A 4WMDA 3SU0A 4Q63A 2BX3A 3QTVH 3MNCA 3T29A 3P8OA 1O3KA 1SGYE 2ZQ2A 5DP8A 2BMGB 2YNBA 1PQ5A 1V2OT 1YF4A 2OCVB 5CHAC 2BDBA 2D1JA 2ZPRA 3RM0H 4X8UH 1C2JA 1GDUA 1O3JA 2ALVA 3OAAD 1HYLA 5PTPA 3MH6A 3TGKE 3RLWH 1C2IA 1K28D 2ZGJA 2FMJA 4Y71A 2GDEH 5FX5A 1C1UH 1L1GA 1PPEE 3I78A 4DJZB 1HGTH 5B6OA 2ZU4A 2HRVA 5A09A 4X8SH 2CN0H 1EFRD 1EZSC 3SV9A 4YESB 3VXEH 3EGKH 2XC0A 4ACAA 2BZ6H 1UK2A 4NIWA 2ZDLA 3OEHD 3Q76A 1CBWC 3LU9B 4Q7ZA 3ZZBA 4I31A 2Z9KA 1UK3A 3L33A 1LVBA 1SR5C 1GBJA 1BOQA 1GMHG 4NWLA 2ANMH 1ELEE 2VIOA 5DG6A 1VGCB 4X6MA 3T62A 1YPEH 4CREA 1GI6A 2BLWA 1KYNA 3K65B 4AG2A 3PV2A 4NIXA 1NU9A 5AFYH 2ZHFH 1W0ZU 1A5IA 3PMAB 1VZQH 3OEED 5T6FA 1KXDA 1CHGA 5GCHG 4AYYB 1Q3XA 3STJA 3AAVA 1OWHA 5AF9H 1UTOA 1P2OA 3EDXB 3NWUA 2G51A 3F2HA 3UY9A 3SUFA 3HKIB 4ZKOU 5C1YA 1TGTA 1O3LA 4DIHH 3TITA 3UWIA 1F92A 1P3EA 1WDIA 2L6OA 4UONA 1F5KU 1BJVA 4IMZA 1TPPA 2PKSC 4CRAA 2Q1JA 2GCTC 3RXQA 1TLDA 1HIAA 3A8AA 2SGAA 4ISHH 1H9HE 3GCOA 5EJZA 2ODQA 2V7QD 3SV6A 3RM2H 1ESBA 1WTHD 5ETXA 2ZU1A 2A1DB 2FZZA 2ZHEH 2GVFA 4GCHG 1ZZZA 2FP7B 5C3NA 2HNTF 1V2WT 1N6XA 1RIWC 2XNDD 4BAKB 6CHAC 2ESTE 4YT6H 3PRBA 4MNVA 2Y7ZA 3QN7A 4E7RG 3ZVEA 1V3XA 6GCHF 1IQNA 3O8BA 1T4VH 5FHTA 3GCTF 3SU4A 3GDSA 1BZXE 4WJG2 3RXGA 3UNRA 2TGDA 1SLVB 4AORA 4B74A 1GG6B 3RC5A 1V2KT 1HB0B 4K8BA 3OY6U 5EW2H 2UWPA 4B76A 3HK6B 3F68H 1D3DB 4AB8A 4AOQA 3RP2A 4BTUB 1RTFB 1KXEA 1AVWA 1Y3UA 1O35A 1MKXH 2R9PA 1BBRK 4F55A 5JYIA 1ZOMA 3QO6A 2J2UA 3KEEA 5AHGH 1XUJA 4D9RA 5EOKA 3Q3KA 4A6LA 3ENSB 3GY5A 3P70B 1BMFD 1G37A 4NIVA 3FP6E 2ZNKH 1DPOA 2O8TA 1UVPA 3BIVH 3Q77A 1C5LH 1SQTA 2QF5A 4NZQA 1S6LA 2FM2A 4H4FA 3SBKA 3LKWA 1N6YA 2BHGA 3A84A 1UJ1A 2BDGA 4H42U 2OC8A 1C1VH 5C94A 1SHYA 5KGOA 2QIQA 1AFQC 1HPGA 3DD2H 2SGQE 1EX3A 3CENA 1GBDA 2FS9A 1VITF 3RLYH 3E0PB 3SJIA 1EJMA 1Q2WA 4XDEA 5HGGA 3TLOA 3UWJH 3WWBA 4X1PU 1UK4A 4DCDA 2YMSC 4ABHA 1NBMD 4KTUA 1U6QA 3MU0A 1NBME 2VVUA 1L1NA 1J14A 4UFFH 7GCHF 1QJ1B 1BHXF 2IJD1 3KQCA 1MQ5A 3MU5A 5JBAS 2J92A 2GCHG 1O3OA 3QTOH 4BTTB 1NY22 1YPKH 2ZQ1A 1Y5BT 1ZPBA 3FP8E 4JZIA 4Q7XA 1GHVH 3QK1A 1TBRH 3RXEA 2C90B 1JRTA 1T8NA 2F9PA 2OQUA 2WPHS 3LGVA 2WINI 1KSNA 1LPZB 3TJVA 3R0FA 2FX6A 1O5CB 1GCDA 3RDZA 2EC9H 2JJ1D 1IQKA 1JBUH 1HUTH 2KX4A 1SQAA 1KDQB 2JH0D 1OPHB 2PFEA 3L6PA 1AZZA 1TPOA 1A1RA 2OINA 2K8IA 2XBVA 1AIXH 1TMBH 2H9TH 5EG4A 4CRFA 2OC0A 2SGDE 4ASHA 3PRDA 1PQAA 3RXUA 1P05A 2BD4A 2THFB 2GZ9A 4FUIA 1G2LA 2OC7A 1HBTH 1QZ8A 3ZZ9A 3OY5U 4WVPE 2FESH 1EAWA 2IOTA 5C0UA 3U8TH 3KQEA 1GJ4H 1K1LA 1UCYH 2RFKC 3F9HA 1CQQA 3BTME 2IPQX 2ZGXH 4Z0KA 4ZH8A 3ZVFA 1CA0B 4UEHH 1UVSH 2P8OC 3SUDA 3M5MA 1GJ6A 1YLDA 2ZHQH 1SBWA 1D4PB 2JH5D 2BD5A 3SV2H 3A87A 2ZGCA 2AHME 3T26A 3MTYA 1C5OH 1ZTLA 2IPHA 2KAIA 2AYWA 3NKKA 5A0CA 2OBQA 4RN6A 2ZFQH 5EXNA 5IYTA 1PQ7A 1UVOA 5LGOA 1P03A 2AS9A 3CS0A 1FLEE 3D23A 1AB9B 1CVWH 1PPBH 1O32A 3M7TA 2W7SA 4Q2KA 3QZQA 2PGBB 1D3QB 4JYVH 4AG1A 4DIIH 1EAUA 1MAYA 1GBEA 3SQHE 1P2IA 4ABBA 1E34B 3O8RA 3PTNA 1FAKH 1ABIH 3NRLA 1VJAU 8GCHF 1DDJA 1JXPA 2FOAA 2GKVE 1W12U 1KXBA 2F43B 2AMPA 4HG6A 3B8JA 1GHBG 2EI8A 3KYFA 5A8XA 3T25A 2ANWA 3W1EA 4I86A 1QL7A 1PYTC 3ZIAD 1MTWA 1LMWB 1ZSKA 3SGAE 1HXEH 2J34A 3U1JB 3ATKA 4XSKU 2OK5A 1FPHH 3S9AA 1ELCA 3TU7H 3ODDA 1O3IA 2TPIZ 1QQUA 4A1VA 6ESTA 5IDKA 1ZSLA 1TBQH 3A8BA 4VGCC 5L30H 1GVZA 3SZEA 2A5IA 1ORFA 2BLVA 2HOBA 3DFLA 4Y76A 1C2HA 1V2UT 3VB6A 2AGGX 3TVJB 3A8CA 5ESBA 4DW2U 1G2MA 1SC8U 1ZSJA 2F9UA 1HXFH 1SGDE 1OP2A 1NO9H 1TA6A 2JDID 1SG8B 2RG3A 1EATA 1KY9A 3M3VA 5HIYA 1H4WA 3GYLB 1EZXC 1YCPM 1O2OA 2FYQA 3UFAA 2VWLA 1XXDA 3A7WA 2G81E 2F91A 1FQ3A 4INLA 2J38A 2ZCKP 3BTTE 1TRYA 5JBBS 3BSQA 3RXJA 1GI4A 4QT8C 3OU0A 4Z1MD 1F7ZA 2FWWA 1XUKA 1W14U 5EODA 4A1TA 2OQ5A 1NFYA 1P04A 3P95A 1O37A 4LZ4B 2B0FA 2VJ1A 2M5TA 3GCHB 1T7CA 1F5RA 4B75A 1FY5A 1SPJA 1O2IA 4JZDH 2ZDMA 1YCPH 3M37A 2ZECA 4AFUA 2WZQA 4AFQA 1OHHD 1B0FA 1TIOA 1XXFA 3RU4D 4YT7H 3MU4A 3HGPA 1ETTH 2UUYA 1LVYA 4B2CA 1W2KH 2LNCA 3QWCH 2L74A 5F53A 1O2JA 2A31A 1O2NA 3MO9A 2BDIA 3H5CB 4DVAU 1QCPA 1SKYE 2C8WB 2OBOA 2UUFB 1B5GH 1TOMH 4SGAE 1YWUA 3SU2A 3IWMA 1O3MA 4ZHLU 1BTYA 3KGPA 1SGNE 2WUCA 1FN8A 2H6MA 3SJ8A 3RXDA 1DT2A 2KM0A 1DANH 1IQGA 4I8LA 5GPIB 4TT3D 1E37B 1QHRB 1QBOA 1W7XH 3D49H 2WPMS 4Y8XA 1RXPA 2A2QH 2H9HA 2XBXA 2H5CA 1SMFE 4TY6A 4Y8YA 2A5KA 1LHDH 2Z7FE 5CHBA 1EKBB 2DUCA 5A2MH 3EE7A 4MNWA 4IMQA 2Y5HA 2XC5A 1K1IA 1TQ7B 1ID5H 1C5QA 2YOLA 3D62A 1HFDA 3DCLA 3E91A 3ZVDA 1XMNB 4GLYA 3A7VA 3VEQB 4CRCA 2I6QA 1C1PA 2Z9JA 1O2SA 1P02A 2SGPE 1SVPA 1K1NA 2PV9B 4FOUC 3TJNA 4YOJA 4HFPB 1WQSA 1KXCA 4Z6AH 3LH1A 1DVAH 5TCAA 1OKXA 2JJ2D 1O38A 2C93B 5HYOA 2A32A 3MH5A 1C9PA 1ZRBA 3E0NB 5GCHF 1LCYA 4Y0ZE 3V0XA 5EJLA 2OP9A 5EIYA 1C1RA 1KLJH 3ESTA 4FVBA 1MZDA 2C8XB 8LPRA 3KNXA 1QA7A 2ZU5A 7ESTE 2VB0A 4KP0A 1BITA 3NUMA 1SOZA 1W13U 1WCZA 2BDCA 3SV8A 1V2ST 3C27B 4ZHAA 1O2WA 1LQEA 3KQ5A 3R3GB 3ODFA 1WUNH 3T27A 1F0RA 1UTPA 5LH8A 1EPTC 3T2NA 1UHBA 3BEFB 4WWYA 5FPTA 3ATMA 4JK6A 1OWDA 1ANDA 1PJPA 1A3EH 1L1JA 3FN8A 5LPRA 4AGJA 2ZFSA 4Y7BA 5T1VA 4ZCNA 1TMTH 1RS0A 2ZPSA 4GCHF 1K1MA 4BAHB 4B73A 5DP3A 1GPZA 2K1QA 4XD7D 3RXHA 1EPTA 1M9UA 4I8KA 3UNSA 2B5TB 4FVDA 2ZC9H 4ABIA 4ACBA 4BNRA 1TAWA 1THPB 2V3MA 3RC4A 1PYTD 2R3UA 1A46H 3LJJA 2CF8H 1ZJDA 1RTKA 5FPYA 3PLBA 1GMCG 3L3TA 1L0ZA 2W5EA 5E2PA 2BY9X 1DWBH 1C5VA 2G8TA 2XRCA 3O8DA 1QL8A 3STIA 1O2UA 1WXRA 2NU0E 3UUZA 1DWEH 3SJOA 1GCTB 1H9LB 3E1XB 3MWIU 4I8JA 4AFSA 1O2GH 3A83A 2FOEA 4OS5A 3CS7A 2GDDA 2Z9LA 4R0IA 4RKJB 1NN6A 1J16A 3M5LA 4X6NA 1IQLA 4D8NA 3T5FH 2K0QA 2FLRH 1PPZA 1GBCA 2WPDD 4ABAA 1BMMH 1TGBA 3A82A 1C1TA 1MABB 4Y10E 5A8ZA 1PPCE 3LPRA 4K1SA 1CA8B 1ESTA 2J5UA 3QGJA 4X1QU 1BTPA 1GBFA 1K21H 7LPRA 5T3HA 1DWDH 5L2ZH 1SGQE 1SHHB 4BXSA 4OM9A 3GICB 1P0SH 4I8HA 1L2EA 5CDFE 3MO3A 2HPPH 3V3MA 3WWFA 8KME2 1WTGH 5K0HA 2W3KA 2JIZD 1Y59T 3D65E 3RMOH 1P10A 2ALPA 2F9NA 4ZUHA 1BMLA 4NSVA 2VIQA 2ASUB 2BOKA 1MKXK 1SI5H 5DP6A 4DOQA 4X8TH 3UQOA 1IQJA 2EY4C 5DN6D 1W0KD 2BDYA 1CHOG 4FU9A 4CR5A 3F0PA 4Q7YA 2R0LA 2ZDVH 1N8OC 4DGJA 2EEKA 3ITIA 1MTNC 4AYVB 1EOJA 1GI2A 3RUOA 2Z9GA 4CHAB 4I7YH 2GCHF 3ZVBA 1GMDG 3ELAH 1O34A 1C5SA 2FYRA 2PHBA 3ZVAA 1G32B 3BTKE 1RRKA 4Y6DA 3PYHA 4NA8A 1Z6EA 3ZZ8A 2G4UA 1SGEE 1K0HA 2P3TB 2Z9IA 3LOXA 3M61U 4JYTA 2QY0B 2BY6X 3UREA 1OWKA 3V7TA 1AWHB 1H8IH 1GI3A 4X1NU 2FOHA 1A4WH 5FXLA 1NC6A 2FEQH 2WPIS 1NS3A 1BB0B 4ZMAH 2GMTC 3TGJE 3TGIE 1C2EA 1VCQA 3FZDA 1YYY1 5A0AE 1B0EA 2ZG0H 1BRAA 1O5BB 3KF2A 5TCCA 1ZHRA 3E16B 3VGCC 2ODYB 4SGBE 2BLQA 4OGXA 1Y8TA 2FTMA 2PR3A 1EXFA 2UUJB 4YZUA 3MI4A 2AFQB 2LP6A 2CXVA 1V2RT 1C2LA 1WAYB 4JYUH 2SGEE 2Z3DA 5EJ1A 3RXKA 1GJ5H 1BIOA 1BBRE 5BRRE 3KQDA 4Y7AA 1GBBA 4F4OC 3SU5A 4RSPA 1FY4A 2A7JA 1HAVB 2OLGA 3M5OA 3IG6B 1SSXA 3M5NA 3PO1B 2WUBA 2B7DH 2UWLA 2VIVA 3SI3H 1QTFA 1FAXA 3SNBA 2BX4A 3HKJB 1AKSB 3FAOA 2PTNA 2C3SA 1TNKA 1YKTA 1TALA 1E79D 1J17T 4X1SU 2Y7XA 3K9XB 1LHCH 1BTWA 4TWWA 1TA2A 4ZKNU 1GL1A 4TY7A 2R2WU 3DT0H 1HJAB 1UCYK 3MMGA 3ATLA 3M3SA 5FBIA 9LPRA 2VGCC 3K6ZA 1C5ZB 1OWIA 1G9IE 4D9QA 1HCGA 2ZCHP 2QF0A 2WHXA 1EOLA 2P16A 4AX9H 3SGQE 3GDUA 4AGKA 4Q80A 4U2WA 1IQIA 3BG4C 4X2WA 1Z6JH 1ZRKA 2BXUH 2PWXA 1P11E 1UTNA 3N7EA 4X6PA 4Y11E 2VVCA 1T32A 1BHXB 1QR3E 1MQ6A 2CHAB 1A2CH 1GGDC 4ABFA 3UQVA 5EQSA 1C2GA 1H8DH 2EI6A 3ZZ6A 3U69H 4DY7B 1O3NA 2ZU2A 1FY3A 4IGDA 1TNJA 1UTLM 3DUXH 1YGCH 2F83A 2FS8A 4WH6A 5DP5A 4KTSA 2AEIH 2B9LA 1D3TB 4ISLA 3UR6A 1ELGA 1VKYA 1O2HA 3SYJA 1LPGB 3AASA 1TONA 1KTTB 2AMDA 1PPGE 4CRGA 4THNH 3UOUA 1GDQA 1NTPA 1O2RA 5DK1A 1ANCA 1QL9A 3PWBA 2QXIA 1GI9B 5FPSA 4D76A 1V2VT 1WSSH 2FOBA 4WMFA 1GJ7B 2GZ7A 1Y5AT 2GP9B 3MU1A 1D6WA 2PGQB 3RXBA 5KEDA 3K6YA 4JCNA 3GY4A 4LK4A 2VWOA 1CSOE 1XVMA 5C5NA 2F9VA 3M7UA 3Q3YA 1O2TA 3GISB 2BY5X 1T8MA 3TH3H 2GD4B 2PKAB 2BLOA 1TE0A 2V0BA 1MU8B 1QIXB 2H5DA 1VGCC 2BD8A 1A5GH 2ZHWH 3BTWE 4BAQB 2QE7D 1FY8E 1EP5A 2WV4A 1YLCA 2G52A 2XTTB 4MPUA 1BA8B 1A3BH 1S0RA 2XCFA 2FODA 3CP7A 3A85A 5C20A 1C5NH 1K9OE 1EQ9A 1TX7A 2KCPA 1AN1E 3BTGE 1LKBA 2BVSH 3O8CA 3TIUA 3UNQA 2ANYA 1HAYB 3KCGH 1S6HA 1CO7E 1MTUA 3K2UA 2W7UA 4YLUA 2ZEBA 1YPLH 2BZAA 1GBKA 1F0TA 1S6FA 2STBE 4DURA 1O2PA 1A0LA 1V2JT 3OX7U 2AMQA 1COWD 1ETRH 3U28C 1O3AA 3OTPA 1MCVA 3BN9A 1YPMH 1ARCA 3HGNA 1ZLRA 5L2YH 3H09A 2O8LA 2NU3E 5DO4H 1LVMA 2JH6D 3QLPH 1HNEE 1Z1JA 1ZHMA 3A80A 3SNEA 1A0HB 1C1MA 1O5DH 1SL3A 3BTDE 3DSOA 2SNWA 2ZFPH 4X6OA 2GJGA 4FUBA 1XUFA 1ZJKA 1DFPA 1ETSH 3A81A 4B2BA 1V2PT 1XUGA 1G3CA 4OS7A 1Z1IA 3WY8A 1QGFA 1AUTC 2D8WA 1JIRA 2XW9A 1O3FA 2FI4E 2J98B 1DSUA 3MNSA 3SZNA 3FKSD 1AVGH 5F03A 5C67A 1EB1H 3NK8A 5ABWA 2Y80A 2Y81A 1P9SA 2SGFE 1RD3B 2PSYA 3QZRA 3RXPA 1AU8A 2XYAA 2M2AA 2BD7A 2G5VA 1E35B 1GG6C 2OC1A 5HXFA 4HGCA 4K1TA 2VWMA 3SV7A 2FOGA 2BOHB 4AB9A 4NFFA 5J4SA 2VIDA 1GHWH 1K1PA 5DP9A 2ZHDA 1SGRE 4I33A 4TPIZ 2JETB 1JOUB 1Z7KA 5HIZA 1AVXA 1IHTH 2J95A 1HJ9A 4NA9H 6LPRA 5CMXH 1W0YH 1QB1A 4IC6A 3ZYEA 1MCTA 3RXLA 1HAHH 3A88A 1GL0E 2Y6TA 4U01A 1P12E 1P2QA 3BTQE 2IN2A 5G4BA 2VINA 3ZZ4A 2NU4E 2BQ6B 1ZPZA 1O2KA 3GY6A 5GDSH 1ZGIA 1EAXA 4ZKRU 2G4TA 1QY6A 1QBNA 1O2VA 1T8LA 1G3BA 1LO6A 2G00A 3IITA 3PTBA 2HVXA 4NGAH 4O3TA 4AC9A 3EYDA 5E0JA 5FL7D 1DS2E 2GV6A 1A61H 1J8AA 1EAIA 2ZKSA 7GCHG 1AE5A 3UOPA 4MNYA 1N1LA 2BY8X 1MTSA 2Y5GA 2BXTH 4M9FA 5JBTA 1O2MA 1HJ8A 2KR7A 4WH8A 2VNTA 2QXJA 2OTVA 5CHAB 3U98H 1VCWA 1DUEA 3DSPA 1ESAA 1Z8JB 1Y3WA 4YTAA 1SGCA 2EQNA 4UFDH 5EXLA 2YNAA 1DSTA 1MAXA 1QB9A 4WF8A 1GHAG 4BXWA 1GMCF 3S7KB 3KL6A 2RCEA 3SU6A 1GJ8B 1TFXA 5DGJA 1TNHA 3VB4A 3U8OH 4F48B 4TPYA 3RU4E 2A7HA 1V2QT 3F9FA 2C4FH 1X7AC 4ZHMU 3BTEE 3GDVA 1O3CA 3BTHE 3W94A 3HK3B 4TSFD 1ZPCA 2FTLE 1FNIA 1OXGA 2KFWA 1OOKB 3DA9B 3SNAA 1SLUB 1O2ZA 2XBWA 1FDPA 1OP0A 1WU1A 2ZWLH 2BY7X 1KLTA 3RXOA 1IHSH 1SGFG 4RKOB 2D2DA 2ZTZA
chains in the Genus database with same CATH topology
5JB9S 2AH4X 1CBWB 4KGAA 1ZR0A 3PV4A 3AAUA 1O3PB 1GI5A 1IQMA 1C1QA 2W26A 1TNIA 1DLEA 1SGFA 1O2YA 1P9UA 2XCNA 1WBGB 3LT3A 1PFXC 1Q31A 1IOEA 3U8RH 1KDQA 1BTHH 3M7QA 4JMYA 4CH2B 1UTKA 2ZU3A 3PMJA 2VVVA 4HI3A 4HTCH 1ELVA 1TQ0B 1YPGH 1SFQB 4HZHA 2Z3CA 5A0BA 5C1XA 1MBQA 1GBMA 1GJDB 1MKWH 4Y8ZA 1DM4B 4WXVA 4XBBA 1O5AB 1CA0C 1VR1H 2BTCE 4ZXYH 4MDSA 4FUCA 1B7XB 2ZF0H 5C5OA 1GMHF 5E8EH 4NZLA 1O5GH 2ZFRH 3BTFE 1XX9A 1RFNA 5EPYA 1HIAB 4YLQH 5T6GA 1P2JA 4XOJA 1AE8H 1EB2A 3A8DA 1DX5M 2ZA5A 1FXYA 3UPEA 1C5MD 2OXSA 2G5NA 1G3DA 5EQRA 4MG3A 3ZZAA 2XWBI 4KTCA 2QAAA 3SO3A 4MPVA 2PKSB 2BQWB 2GCTB 1D9IA 3LGYA 4JZFH 3TK6A 8GCHG 4IS5A 1GI0A 1AB9C 1K22H 2PW8H 3UIRA 2BDHA 3AVZA 2UWOA 2AIQA 2VIPA 2WPKS 1WOFA 5E0GA 3TH2H 3GY7A 2VH6A 4MTBA 1RIWB 2ZP0H 1ACBE 3VXFH 3S69A 1C1OA 6CHAB 3TNTA 3F1SB 1YPJH 4TWYA 3NZIA 1O5FH 1WQVH 1QRZA 2QYIA 4MNXA 2ZIQH 5EW1H 1NROH 4U32A 2Q6DA 1CGHA 3A7ZA 1KXAA 2FDAA 4B1TA 4UFGH 1LKAA 4O97A 5HM2A 3JZ2B 3P8FA 1TWXB 2CGAA 4ZXXH 2H2ZA 2QC2A 1GJAB 3MFJA 1C1SA 2PLXA 1O3BA 1HLTH 3VB5A 1S84A 1P57B 1OX1A 1CU1A 1FN6A 5BPEA 1GI1A 2FXRA 2HGTH 2IJOB 3MNXA 1UVTH 2C8ZB 1XVOA 1ZMJA 3M3TA 1YC0A 1TGNA 3PB1E 1HAOH 2SNVA 1OSSA 2ZDAH 3P8GA 2GV7A 2TRMA 3ZZ3A 4CBOA 1NRSH 1T4UH 1AFQB 1P06A 4I32A 2CJIA 1AFEH 2BDAA 4FUHA 4K3JA 3SGBE 3LC5A 1AQ7A 3E6PH 3LJOA 3EA8A 2V3OH 4CH8B 3GCHC 1DLKB 4PROA 2BB4A 3MOCA 4IW4E 1KXFA 4LOYH 2ZPQA 2J94A 1DOJA 3FP7E 4I8GA 4ISIH 3SOSA 1TGSZ 2QA9E 2A7CA 2FOFA 1C2KA 3A7TA 4KKDA 3BEUA 3A7XA 1LQDB 1JIMA 3RXAA 3SORA 4B2AA 1DY8A 1O2QA 1TPAE 5GIBA 3AW0A 1OYTH 1J15A 1QFKH 2TGPZ 3OYPA 1YM0A 1NRQH 3E90B 1J9CH 3KN2A 2BYAX 2VWNA 1GVLA 4MPWA 1QA0A 5F6MA 1OYQA 4CRBA 1TBZH 2OUAA 2V6NA 1CT4E 4X8VH 3ZVCA 4FUGA 1Z8RA 3JZ1B 2WYJA 4UFEH 1LPKB 4CBNA 1ELDE 1L4DA 1LHGH 1BCUH 1TRNA 4DG4A 2R2MB 3EA9A 1AMHA 1K1JA 3RXCA 1F0UA 1SGPE 1S83A 3TNSA 2H1UA 1NPMA 4WMEA 1LTOA 2DE9A 1LHFH 4E05H 3RC6A 5SGAE 4XBDA 2P59A 5E0HA 1GJCB 2A2XH 3GOVB 1CGIE 1FI8A 3EQ0H 1SGIB 3MO6A 1DE7H 4X2XA 3C1KA 3SUGA 2KAIB 2P8OB 4O9VA 1FMGA 2F9OA 2HLCA 4O3UA 2ZI2H 4GVUA 3LC3A 3VPKA 2V35A 1FONA 3Q3XA 1W7GH 1G30B 3MYWA 1T8OA 1FJSA 1SQOA 1AO5A 3QGNB 4FUEA 3VB3A 1UCYE 4J1YA 1P8VC 4K69A 1EJNA 2FLBH 5TJXA 1BMAA 1P09A 3SHAH 1NZQH 3AW1A 5L6NH 3S7HB 1O0DH 4ESTE 3NPSA 1ZGVA 1IQFA 1UMAH 1MTVA 2AIPA 4GAWA 2BVRH 3RMNH 5JB8S 2G55A 2GZ8A 3GY2A 1O5EH 2P93A 3U9AH 1S82A 1Y3VA 3LIWA 3V13A 1EJAA 1W10U 9ESTA 3RU4T 3TK5A 4JK5A 4JZ1A 4M7GA 1VITH 4CRDA 1YPHC 1O30A 7KMEH 1MBMA 2A4QA 3GYMA 1AWFH 1E38B 2O8WA 2F9BH 2WPJS 1OP8A 4OS6A 1O3DA 1WYKA 4FUDA 2I6SA 3SUEA 2BD3A 2VIWA 3SU3A 3SHCH 3ZYDA 3Q00A 1UTMA 4LZ1H 3KIDU 1ANBA 1DXPA 1CE5A 5JPMH 3RXIA 3KQBA 2ILNA 3TK9A 1O3EA 4O03A 3TJOA 3VFEA 1P2NA 1BT7A 4NG9H 1GJ9B 1GHBF 1HAZB 1QURH 1QRWA 3A7YA 4OS1A 4VGCB 1PQ8A 3LH3A 3HATH 1S0QA 3TPIZ 3URCA 4NCYA 3BIUH 2HWLB 1INCA 3P17H 5EXMA 3SI4H 1GVKB 5DP4A 3U1IB 2O8UA 1GCTC 1BRUP 2FI3E 2Z3EA 1TMUH 5F8ZA 5CE1A 1H9IE 2FOMB 4A7IB 4H6SB 1GJBB 3V12A 1QJ7B 4UD9H 1C1NA 3B9FH 5I46H 3FFGA 2ZTXA 4ZROA 4BTIB 1K1OA 1RJXB 4LXBH 1MUEB 1QQ4A 2TGAA 4JZEH 4X2VA 1C5YB 2QXHA 1TX6A 3BEIB 4BANB 1QB6A 2RA0A 3RXFA 5EU8A 4ABEA 3EAJA 4FXGH 1MU6B 1HAPH 2FOCA 2O9QA 2AGIX 1G36A 4IN1A 1AGJA 3E3TA 4IC5A 1LVOA 4ABDA 1C5WB 1OWJA 1V2LT 1YBWA 1C5UA 1JRSA 1SOTA 1Z8GA 5F8TA 3FANA 2ZTYA 2O8MA 3A86A 1GHZA 1BQYA 1MD8A 3H7OA 3S9BA 4MQAA 4E06H 2QV1A 5AVDA 3RMLH 1O3HA 1OWEA 5F8XA 2NWNA 4UE7H 3SQEE 4IBLH 1DICA 4AN7A 1NRRH 1H1BA 4UDWH 3ZZCA 1ARBA 1NRPH 3P6ZB 1TRMA 1MZAA 3KHVA 4A1XA 1W3CA 1GHAF 4CHAC 1C2DA 4X2YA 2BQ7B 1W8BH 4X0WU 4AZ2B 4GPGA 3TH4H 2NU1E 1QNJA 3SN8A 1QJ6B 1BJUA 2VU8E 1BUIA 1NRNH 1XKBC 1TOCB 2RA3A 1ZMNA 4FU8A 4WY3A 1FY1A 5LPFA 1THSH 5DJ7A 3PROA 4YO9A 4FU7A 1NU7B 2HNTC 2Y82A 1SFIA 4TYDA 1E36B 4K8YA 1FZZA 2A5AA 3EE0B 2BD9A 1Z8IB 2GTBA 3T28A 4WXIA 1THRH 1P01A 1G3EA 1BBRH 1JMOH 4ISNA 2TIOA 1L4ZA 1VCPA 3RXTA 2ZGHA 3RXSA 4ABGA 4DT7B 5T6DA 3SJ9A 4INHA 4J2YB 1AUJA 2B8OH 2J9NA 1YCPK 1S85A 3BG8A 5DPAA 2FX4A 3MNBA 4CR9A 6GCHG 1AHTH 2P3FH 3GCTG 2GT8A 2PUXB 5J4QA 5AFZH 1UO6A 2BVXH 1HV7A 4NWKA 5EPNA 4AFZA 2H9EH 4XE4A 3ATIA 2NU2E 3RXVA 1D3PB 1O39A 4GSOA 1CT0E 3DFJA 3I77A 2A0QB 2P3UB 4Y79A 1O2XA 5DP7A 1ELTA 5LPEA 4X1RU 2ZFTA 4K5ZA 4NFEA 1GHXH 2FIRH 1FPCH 1F5LA 2ODPA 3PO1C 4A92A 5DKMA 3SNCA 3EA7A 2ULLA 1UHBB 2W3IA 4H6TA 1O31A 5C1UA 1A0JA 1BRBE 2JKHA 1ZTKA 1HAVA 2TBSA 3PLKA 3TJUA 2A4GA 1EPTB 1O36A 1ANEA 4K1EA 1ZHPA 1QBVH 1HJAC 1YP9A 1AKSA 1GBHA 1P2MA 1S81A 3S0NA 1KIGH 1MKWK 1F2SE 2FI5E 3FVFB 3N7OA 1GHYH 1C4U2 1C5RA 4YOIA 1BRCE 1VITG 1IAUA 4D7GA 1AD8H 1DWCH 1V6DA 1ZMLA 3ZVGA 3ATWA 1YPHE 2Y5FA 5GWZA 3MH4A 2Z94A 4MLFB 1RGQA 4INKA 3S9CA 1SLXB 1TX8A 2CHAC 1TABE 1A7SA 4E7NA 4B71A 1Y5UT 3FZZA 5A8YA 3UTUH 1KTSB 3GCNA 1E0FD 1RTLA 1UTJA 2TGTA 1QRXA 4A5TS 4ISOA 3PLPA 1C1WH 4BOHA 5E2OA 4XBCA 1C5PA 5H4IB 1EP6A 3PMBB 3MH7A 2EI7A 1DITH 3G01A 4U30A 4ZKSU 2C8YB 3SJKA 2QXGA 2XBYA 5GXPA 2XWAA 3RXRA 1ELAA 1C5TA 1FUJA 3LGWA 5FCKA 2A45B 2D26C 2VH0A 3QDZB 5C2ZA 2CMYA 4ABJA 2A4OA 2UUKB 1BMNH 1TNGA 1EUFA 1UTQA 1MMJN 3SU1A 3ZV9A 3GY8A 1NFWA 4D7FA 1ABJH 1ELFA 2XC4A 3RMMH 2CF9H 1AI8H 2FO9A 3M36A 1P3CA 1IQEA 1TPSA 1A5HA 3SW2B 3P8NA 3RXMA 1UVUH 1ZYOA 1XKAC 1EZQA 2RDLA 2QGRA 5JBCS 1HAGE 1TB6H 2ZO3H 2Q6GA 3MHWU 3W95A 1MD7A 4OGYA 1DY9A 1IQHA 2GGVB 4R8TB 3B23B 2PTCE 2PKAA 1GWAA 4NA7A 1MH0A 1ELBA 1FV9A 3GY3A 1N8OB 4K60A 3UR9A 3QX5H 3MU8A 3ZZ7A 1MTNB 1NESE 1C2FA 3VB7A 4BAMB 1SB1H 1NFXA 2QF3A 1TGCA 2PSXA 1JWTA 1K2I1 1SLWB 2QCYA 2Q6FA 1V2MT 2HPQH 4MVNA 2GT7A 2AERH 1D6RA 4GUXA 1GBTA 3I29A 4BAOB 2V3HH 1CHOF 1NM6A 1Y3XA 2OD3B 5FCRA 1XM1A 3BF6H 3P92A 5JDUB 3H7TA 2R3YA 3PMHB 3URDA 4XFQA 1CGJE 3DHKH 3ZZDA 1FIZA 1GMDF 1O33A 4NSYA 2J4IA 5GJ4B 3ZV8A 2EA3A 2GMTB 1EASA 5HM9A 1GBAA 5FBEA 2HNTE 1GI8B 3OTJE 2WYGA 2P94A 3F9GA 2PUQH 1AY6H 5K7RA 4NIYA 2ZFFH 2QN5T 3VGCB 1BTUA 2R0KA 2BM2A 1VJ9U 3LGIA 1PPFE 3NXPA 1DUAA 4K2YA 5EGMA 2P95A 1S5SA 1AZ8A 2ZDKA 1NT1A 1GDNA 2GX4A 3A89A 1P2KA 1BTXA 4GHQA 8ESTE 1Z71A 2ZDNA 5ESTE 1C2MA 1XUIA 5EQQA 2XXLA 2LPRA 4YOGA 1HRTH 1GI7B 1ZTJA 3SNDA 2WPLS 1C4V2 1CT2E 4OS4A 1TYNA 1Y3YA 2CV3A 4Y0YE 4ZAEA 1SGTA 1GBLA 2SFAA 1F0SA 3LDXH 3M35A 1PPHE 1KLIH 1O2LA 3NCLA 2HALA 2AGEX 1HAIH 4OS2A 1T31A 3BV9B 1GBIA 2JETC 1FIWA 4FUFA 4IN2A 1WV7H 3F6UH 1EZUC 3LGTA 3F9EA 4GHTA 1V2NT 1DXWA 1TNLA 1XUHA 1HDTH 3LGUA 4KELA 3LONA 3OSYA 2ANKH 1NFUA 1W11U 1BTZA 1LHEH 5FAHA 3HPTB 2ZCLP 1C5XB 3PWCA 1HAXB 3E8LA 1LDTT 2VGCB 2Z6BD 2WV5A 3QUMP 1C4Y2 5I25A 5HMAA 3ZZ5A 2FPZA 1O3GA 2STAE 1V2TT 1C9TA 1BDAA 2ZZUH 3BG4B 5FX6A 1OS8A 2F3CE 2BD2A 4YM9A 4FUJA 3PM3A 2DE8A 2ZGBH 4MPXA 2A4RA 1GGDB 4WMDA 2XNIA 4F49A 3SU0A 2BX3A 3QTVH 3MNCA 3T29A 3P8OA 1O3KA 1SGYE 2ZQ2A 5DP8A 2BMGB 2YNBA 1PQ5A 1V2OT 1YF4A 2OCVB 5CHAC 2BDBA 2D1JA 2ZPRA 3RM0H 4X8UH 1C2JA 1GDUA 1O3JA 2ALVA 1HYLA 5PTPA 3MH6A 3TGKE 3RLWH 1C2IA 1K28D 2ZGJA 2FMJA 4Y71A 2GDEH 5FX5A 1C1UH 1L1GA 1PPEE 3I78A 4DJZB 1HGTH 5B6OA 2ZU4A 2HRVA 5A09A 4X8SH 2CN0H 1EZSC 3SV9A 4YESB 3VXEH 3EGKH 2XC0A 2BZ6H 1UK2A 4NIWA 2ZDLA 3Q76A 1CBWC 3LU9B 4Q7ZA 3ZZBA 4I31A 2Z9KA 1UK3A 3L33A 1LVBA 1SR5C 1GBJA 1BOQA 1GMHG 4NWLA 2ANMH 1ELEE 2VIOA 5DG6A 1VGCB 4X6MA 3T62A 1YPEH 4CREA 1GI6A 2BLWA 1KYNA 3K65B 4AG2A 4NIXA 1NU9A 5AFYH 2ZHFH 1W0ZU 1A5IA 3PMAB 1VZQH 5T6FA 1KXDA 1CHGA 5GCHG 4AYYB 1Q3XA 3STJA 3AAVA 1OWHA 5AF9H 1UTOA 1P2OA 3EDXB 3NWUA 2G51A 3UY9A 3SUFA 3HKIB 4ZKOU 5C1YA 1TGTA 1O3LA 4DIHH 3TITA 3UWIA 1F92A 1P3EA 4UONA 1F5KU 1BJVA 4IMZA 1TPPA 2PKSC 4CRAA 2Q1JA 2GCTC 3RXQA 1TLDA 1HIAA 3A8AA 2SGAA 4ISHH 1H9HE 3GCOA 2ODQA 3SV6A 3RM2H 1ESBA 1WTHD 5ETXA 2ZU1A 2A1DB 2FZZA 2ZHEH 2GVFA 4GCHG 1ZZZA 2FP7B 5C3NA 2HNTF 1V2WT 1N6XA 1RIWC 4BAKB 6CHAC 2ESTE 4YT6H 4MNVA 2Y7ZA 3QN7A 4E7RG 3ZVEA 1V3XA 6GCHF 1IQNA 3O8BA 1T4VH 5FHTA 3GCTF 3SU4A 3GDSA 1BZXE 4WJG2 3RXGA 3UNRA 2TGDA 1SLVB 4AORA 4B74A 1GG6B 3RC5A 1V2KT 1HB0B 4K8BA 3OY6U 5EW2H 2UWPA 4B76A 3HK6B 3F68H 1D3DB 4AB8A 4AOQA 3RP2A 4BTUB 1RTFB 1KXEA 1AVWA 1Y3UA 1O35A 1MKXH 2R9PA 1BBRK 5JYIA 1ZOMA 3QO6A 2J2UA 3KEEA 5AHGH