2ZFTA

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zftA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zftA02
2NU4E 1A0HB 1UMAH 4UEHH 1WTGH 1ZHRA 1GPZA 2QA9E 2VIPA 1TABE 3URCA 2WYJA 5T3HA 5EW2H 8GCHF 3BTTE 4MLFB 1GL1A 2TGDA 3KEEA 2AMDA 4U01A 1P2NA 2TIOA 2ZCKP 1LHDH 1UHBB 1P3CA 2ZU3A 4JYUH 2DE8A 2ZFPH 1V2UT 1P2JA 1EJMA 1CA8B 5TCCA 4Y76A 3U8TH 2BQ6B 3MMGA 5TJXA 2XNIA 3GICB 1H9IE 4TPIZ 1O2LA 5BRRE 3E0PB 1P9SA 1X7AC 1HNEE 1K1NA 4B75A 2ILNA 5JB8S 1FN8A 1AFQC 2JETB 4DT7B 1BRCE 1T4UH 1ZPZA 3SJKA 1O36A 5EXNA 1O2XA 4BTIB 3RXQA 1LPKB 2BD7A 4FU7A 3K65B 1O3MA 3RU4T 1N6XA 2G5NA 4B1TA 1RXPA 1Y3XA 4BAMB 4X1PU 2BOKA 1FAXA 4TWWA 2Y5HA 4CR9A 1RTLA 4ABJA 3U1IB 3K2UA 1EAWA 3RXAA 3ZZ3A 1UVPA 2ZCHP 3RXJA 1SLXB 3SO3A 4KELA 2PSYA 2XBXA 5LGOA 3DHKH 1ZSJA 1ZZZA 1FY5A 5JPMH 3BSQA 2OUAA 3PMHB 4I8HA 1SLUB 2R9PA 3KQDA 1W12U 1JBUH 4UFDH 1OS8A 1C5MD 4NIVA 2Y80A 1PPBH 1UCYH 1MTWA 3UWIA 2OINA 5GWZA 2PLXA 2AGEX 1AVXA 2WV4A 9ESTA 1UTQA 1THSH 2AERH 2B5TB 1TX7A 3QUMP 1BTYA 1O2JA 1KSNA 2ZHWH 4ZXXH 3MNBA 3AW0A 2XRCA 1DUAA 3K6ZA 4Y7BA 1E0FD 1C2JA 1EAIA 5A8XA 1OX1A 1KLJH 2PV9B 1UTKA 2Z9IA 4NIWA 1DY8A 1L1JA 1Y3YA 1BBRE 1QIXB 2BLQA 3FVFB 2PGBB 3ODDA 2R3UA 2VINA 1NU7B 1P0SH 4FXGH 1NRQH 5K7RA 1GCTB 1KTTB 3S69A 1UJ1A 1GHAF 2CGAA 4ZMAH 1ELCA 1GBJA 2A7HA 3MNXA 3RC6A 2ZFRH 3ZZBA 2A5IA 3VGCC 1GBTA 1DVAH 1O5BB 1BUIA 1T32A 3P95A 1RS0A 3D23A 1AKSA 1H1BA 3ESTA 3KL6A 4GVUA 1NN6A 1C4U2 2B8OH 1YCPH 2BZ6H 1QGFA 3HK3B 2BQ7B 3MTYA 1BMNH 1O33A 2G8TA 1T8LA 2V3HH 3EGKH 4BOHA 1TBQH 4BXWA 3PMBB 1GI5A 3RXKA 4K8YA 1TNJA 1F0TA 2FP7B 2XBWA 1DWCH 2C8ZB 2K1QA 3TK5A 1GMCG 1RFNA 3M5MA 1BT7A 3VB4A 5EPYA 1BB0B 5B6OA 1UTLM 2F91A 4FUGA 1IQKA 4NWKA 4ABAA 2ZHFH 1TGTA 1CHGA 1XKBC 2BB4A 2NU0E 4MNYA 4IC5A 4DIIH 1AD8H 4OGYA 1IQHA 1L1GA 2F9NA 1UCYE 2TRMA 4FU8A 1KY9A 1LHCH 4F49A 1S84A 1IHSH 4CRDA 2P3UB 3EYDA 1YPKH 1SI5H 4CR5A 1SOTA 2BVRH 2ZPRA 3UNQA 5AHGH 1K1JA 3UR6A 3TVJB 1QRXA 1XKAC 1YCPM 2P59A 2CJIA 1TMTH 2C8XB 1FN6A 1S83A 1FIZA 2BM2A 3MOCA 4JK6A 2THFB 1O2RA 3GDSA 1OYTH 2WUBA 1ELVA 1ABJH 4SGAE 1WYKA 3RXGA 1GHAG 2J92A 2ZDAH 4FVDA 1F5LA 1GBAA 2ZIQH 4GAWA 3TH3H 1KIGH 1NFYA 3OY6U 3FFGA 5DP3A 4ESTE 3TJUA 2R3YA 3GYMA 1MUEB 2BD2A 2QIQA 3EA7A 2BLVA 5HMAA 1TIOA 5DP6A 3TJVA 1PQ7A 2BD4A 3K9XB 1C1UH 2XC5A 2STAE 1O2UA 2GT8A 1DT2A 4X2WA 3M35A 3QZRA 1KXEA 2Z7FE 4Z6AH 5C2ZA 1RIWB 2ZFFH 2FI4E 5JYIA 1NPMA 4GLYA 3GY2A 2HVXA 1FAKH 4IW4E 2ZDNA 1V2MT 3SNEA 1TAWA 1K21H 2JH6D 3PTBA 2PGQB 2RCEA 4BANB 1L4DA 2ZKSA 3Q76A 3SOSA 4Y71A 5ETXA 3LU9B 2H1UA 1FONA 3UREA 2ZHQH 3M3VA 2QYIA 4QT8C 1E37B 1ZGVA 1P2MA 3QK1A 2G52A 1V3XA 1AO5A 1NM6A 1OWHA 2ZDMA 3S9CA 3Q3YA 4MPXA 2JH0D 4NZLA 1ABIH 1C5LH 1KDQB 5FX5A 1A0LA 3UWJH 2H5DA 3BTME 1GHZA 4MNVA 1A4WH 3M7UA 2FS8A 4FVBA 3GY7A 1A5GH 3U69H 2ZTZA 1HJ9A 1SGYE 1EASA 4ZKRU 1WV7H 4O3UA 4INKA 3Q3KA 1TA2A 2Z9GA 3QZQA 5JDUB 2ZDKA 3VXFH 2ZGCA 3SI4H 3M3SA 2HALA 4I8GA 2FLRH 4Q80A 3O8CA 3QDZB 4GUXA 2BMGB 2ZDLA 4I8KA 3ZVDA 2HNTF 5IDKA 3SGBE 3EE0B 1MTNC 3RM2H 3TJOA 4INLA 1FLEE 1C1NA 1S6FA 4AB8A 2ODPA 1G2LA 1GBBA 3N7OA 4NSYA 1NU9A 4TYDA 3F1SB 1SGNE 2ZZUH 1MBMA 4BAKB 1O2PA 1S0RA 1F5KU 1OXGA 4YO9A 3BTFE 3SGQE 3ATWA 4RSPA 5FXLA 3FP7E 2BDAA 2PKSB 1GHXH 1O3CA 5G4BA 2VVUA 2BDBA 1DDJA 1NO9H 1AQ7A 5CHAC 5EU8A 3PWBA 3RXLA 1AE8H 1P09A 7GCHG 4KGAA 4OS6A 3RC5A 2A45B 1GMDG 1W8BH 4XBCA 1N8OC 1SBWA 1HJ8A 3SHCH 1OKXA 1DXWA 1GBEA 1GJ5H 1QJ6B 2C4FH 1FQ3A 1RJXB 2CF8H 2Z9LA 1N6YA 3LJJA 1O31A 1LKAA 2BD5A 3G01A 1C1RA 2HPPH 3A85A 1O5CB 2VU8E 1EAXA 3RXTA 3UPEA 3T28A 1XVOA 4X8TH 1WSSH 3F9GA 3SUEA 3SJ9A 3EA8A 3FZDA 4K60A 1K1OA 1WUNH 1ELDE 1EZQA 1AN1E 4LXBH 3LGIA 1G32B 4IN1A 1GI7B 1O2TA 1F0SA 4ABFA 1TFXA 1BA8B 1DITH 2OLGA 3BEIB 3LGUA 3NXPA 1O37A 1P57B 3H5CB 2HNTC 1NESE 1KYNA 1Y3WA 2BDGA 2GGVB 5DO4H 1KXAA 1O5AB 1GI1A 2Q6FA 3SU0A 1V2NT 1QL8A 1V6DA 1XUFA 4A1VA 1QA7A 1TB6H 3BV9B 4AFZA 2W5EA 1ZPBA 1O2OA 1ZGIA 1O3LA 2WYGA 3MO3A 2ZFQH 1C1PA 2XCFA 3STIA 1S85A 1P12E 2PW8H 3UR9A 5A0BA 1GHYH 3E91A 4FU9A 4Y8YA 5I46H 1DSTA 1DY9A 1EB2A 4UE7H 3BN9A 3H7OA 4CRBA 1DLKB 2UUKB 3ODFA 7LPRA 4Y10E 1ACBE 5EPNA 4X0WU 5EGMA 5EQRA 1JRSA 2BY5X 2A32A 3MH4A 2QV1A 4KTSA 1AU8A 1FY8E 1ZHPA 5DG6A 1T8NA 3SU5A 4H6SB 1MZAA 4D8NA 7GCHF 2GVFA 5JBAS 1GMDF 1LPZB 1BJUA 2F9UA 1GI6A 1JWTA 1LKBA 4LOYH 2OD3B 2FOGA 2ANYA 1VITF 1W0YH 2YNAA 1P06A 4CHAC 2NWNA 1ORFA 1O39A 3NPSA 4NZQA 1C2DA 2G4TA 4RKOB 4CH2B 1C2EA 2C8YB 3D49H 1CGHA 1HJAB 2Q6GA 1C2IA 1ZSKA 2QCYA 1GL0E 2CXVA 2BLOA 4B71A 3TH2H 1ELGA 3B23B 2O8MA 1CO7E 1PFXC 1E36B 3TGKE 1HAZB 2H6MA 3MH7A 1O5EH 1ZTKA 1FI8A 1ZPCA 1G3CA 1LVBA 1A3EH 3A84A 5E0GA 4YT7H 1UK2A 2FOCA 4ABHA 3KQBA 5JBTA 1W2KH 4IGDA 1Z8JB 2A5KA 1TGSZ 1QL9A 1C5RA 1Y3UA 3HGPA 3ZZ7A 1CT0E 2J9NA 2G51A 1O5DH 2HOBA 1ZSLA 3GDUA 2QXJA 1GJCB 4K69A 1OOKB 1HJAC 3OY5U 4ZHAA 1D3DB 1QB1A 1VCWA 4IBLH 1E35B 3SU3A 1CT4E 1QL7A 1PYTC 2BD3A 4KTUA 5EG4A 5A2MH 1NC6A 4LK4A 1WTHD 1O3KA 1HFDA 5FHTA 4NIXA 3VB3A 3HATH 2VH6A 3QO6A 4YOJA 3HGNA 2ANWA 2PTNA 1ELTA 2SGQE 1ANBA 1WCZA 2PFEA 1V2RT 5FAHA 5GCHF 3HKIB 2D1JA 2V35A 5HGGA 4WXIA 1C2HA 2W7SA 3SUDA 3RXDA 4JZ1A 3OYPA 1LVYA 2VNTA 2FX6A 4YOIA 1B5GH 3BTHE 1G3BA 1AGJA 2FTMA 1Z8IB 3UTUH 3LGWA 1WQVH 1H9HE 4YLQH 1TRMA 4ZHLU 1D6RA 1XUHA 1BTPA 5C5NA 2BY7X 1QB6A 1IQEA 2VWMA 1S5SA 5DP9A 1ESBA 1SL3A 3MU5A 1K9OE 1UVTH 5JBBS 5F6MA 1HAVB 3M3TA 1LDTT 2GX4A 1V2WT 2OC1A 1ANDA 2C3SA 2WINI 4FUHA 2A7JA 1SB1H 3GYLB 2GCTB 2EI7A 1YYY1 2RA3A 1F7ZA 1MQ5A 4JK5A 5GDSH 3T29A 3P8NA 4CRCA 1NRNH 2C93B 2PWXA 3GOVB 3E3TA 3SI3H 4FUJA 1GVZA 5EQSA 4ZROA 2NU2E 4NA7A 1M9UA 1VJAU 3TJNA 2ALPA 1SGTA 3A86A 1DWEH 1YKTA 2GP9B 2O8LA 1P02A 3GCOA 8KME2 1CGIE 3MU1A 2GCTC 2AIPA 5L30H 1HAPH 2VVCA 3EDXB 1ELEE 4UFGH 4CH8B 1O3JA 1P04A 5AVDA 4RKJB 1VJ9U 1ESAA 2ZFSA 3QWCH 1GI8B 1XUJA 1OWJA 2ZTXA 1O3NA 1O3EA 1HYLA 1NFUA 2ZNKH 2KAIB 1EZXC 4ZKSU 2ASUB 1GVKB 3E1XB 1AWHB 4AYVB 4UFEH 3ENSB 4WJG2 2TGPZ 4I33A 4F4OC 3QGJA 2QF3A 3FZZA 1ZTLA 3F9HA 1T7CA 3UQOA 2PSXA 4AB9A 1HCGA 2OC7A 4ABEA 6ESTA 1MZDA 4GHQA 3TU7H 2AGGX 3S7KB 5FPTA 1AUJA 1BTWA 3W95A 2O9QA 2ZHDA 3SU6A 3T27A 2R2WU 1P2OA 4THNH 4ASHA 3AVZA 4AGKA 4INHA 3SJ8A 3B8JA 1BTZA 1G30B 4DG4A 2C90B 1LVOA 2GT7A 1J9CH 1TOMH 4BAOB 1OP2A 1EP5A 4X8UH 1KTSB 2M5TA 3DFLA 2BDHA 1W13U 1YPHE 1C5QA 3MO9A 1SPJA 5EOKA 4CRAA 2A4QA 1ID5H 1YLDA 2G5VA 1H4WA 1V2PT 1MTSA 1TGNA 3VB6A 2G00A 3M37A 4MNXA 4WXVA 2BY6X 3S9BA 1GCTC 2D2DA 1BBRK 4O3TA 1PPGE 3PROA 1IQFA 3E8LA 2Z3EA 3SJOA 1DWDH 3BEUA 2PTCE 3ZYDA 3HPTB 1G3DA 1LQDB 3PTNA 4Y6DA 2EI8A 2F83A 3DFJA 1BCUH 1SGIB 2ZWLH 4I32A 3A7YA 1MBQA 3PO1B 2Q1JA 3IWMA 1HAHH 1ARBA 3LDXH 4YT6H 4ZAEA 1NT1A 4VGCC 4ABIA 1AFQB 2SGDE 3SU4A 4YLUA 1VITH 2V6NA 1K22H 2HNTE 2P93A 3GY5A 1SMFE 2GZ8A 1TBRH 4XBDA 1TBZH 1AUTC 3DUXH 4Z0KA 1C1SA 3A7TA 4DJZB 3KIDU 3TITA 1DSUA 2QXIA 3WY8A 2AFQB 2PKAA 1SFIA 2TGTA 3PM3A 1Q31A 2A4GA 1VR1H 3FP6E 2FOHA 2BY8X 2CF9H 2FESH 1HAOH 3F68H 5HXFA 4AG2A 1V2KT 2Z9KA 4NFFA 1A5IA 1C4V2 1NFWA 5A8YA 1QRWA 4I7YH 2NU1E 2V0BA 5AFZH 3NZIA 2XXLA 4X8SH 3M7TA 1W11U 1FXYA 5DK1A 8LPRA 2XC4A 4I8JA 3DD2H 1MD8A 5C5OA 5DP4A 2VWLA 5A8ZA 1Y8TA 1RD3B 1DWBH 2FOFA 3RP2A 1KXDA 1ZLRA 3A88A 1XM1A 4XBBA 3BTWE 3EA9A 3UOUA 1DX5M 1GMHG 3C27B 5LH8A 4B2CA 2TBSA 5FBEA 5LPEA 5L2YH 2A31A 1NS3A 4DGJA 1O2VA 3LC3A 3ZV9A 3LGYA 5L2ZH 3ZZDA 2GMTB 2GZ9A 3A82A 2FMJA 2A4RA 4NG9H 4AORA 2R2MB 4JYVH 4GSOA 4BNRA 4MTBA 1A7SA 1EPTA 2VIQA 3VFEA 1TNKA 3E16B 1AY6H 3U98H 1TNLA 4ZUHA 4NCYA 5GPIB 2VH0A 1XX9A 5F8TA 3LGVA 2BQWB 2KAIA 4YTAA 3BF6H 4DOQA 3UUZA 1BITA 3GCTG 3QN7A 2GCHG 4XDEA 2BX3A 4K1SA 4XSKU 5GIBA 4DCDA 5SGAE 1LVMA 1VCQA 4A6LA 1MKXK 1NY22 2Z9JA 1LMWB 3ZZ8A 3M61U 3RXIA 1DE7H 1SGFA 3LC5A 3LPRA 4NA8A 3RXSA 1B7XB 2F9BH 4TPYA 1GDQA 2HGTH 3KF2A 3ZZ9A 3A7VA 3SNDA 1TPSA 2VWOA 1EXFA 1O3DA 1NROH 2IJOB 1QQUA 4ABGA 1ANEA 4TWYA 3SNBA 4HTCH 1JIMA 1UVSH 1XVMA 2ZEBA 3RXFA 4YZUA 2FEQH 1MMJN 1QCPA 3H7TA 4MPVA 1AZ8A 3P92A 1O3HA 1SGDE 3KHVA 3SV8A 1SQTA 2OC0A 2XC0A 1EJNA 2H2ZA 3LIWA 1O2GH 2ZU4A 1C1WH 3VPKA 4HI3A 2BHGA 1HXEH 4JZFH 1UVOA 3T5FH 3V13A 5FX6A 1YBWA 1D9IA 1EATA 2Y82A 2YNBA 3TNTA 1GJ4H 1O2SA 2TGAA 4FUIA 3RLWH 2UUJB 4HZHA 1SOZA 2B9LA 1O3AA 3AW1A 1O2QA 4ZKOU 2P95A 1E38B 3QLPH 1EPTC 5F8XA 2OCVB 1G9IE 3QGNB 1ZHMA 1SSXA 1O3BA 4BTTB 2QXGA 5FCKA 3UQVA 1FY1A 3ATLA 1CVWH 1OWDA 3GCTF 5T6DA 5ESTE 2QGRA 2XW9A 4D7FA 1CT2E 1EJAA 3LH1A 1GBDA 3PYHA 1S81A 5CHAB 3LT3A 1TRYA 1CA0C 1SQAA 1P2IA 1GI4A 1GCDA 3D62A 2Y5FA 1K2I1 1GG6B 4GCHG 3MNCA 2JKHA 3BTKE 1ETTH 1P11E 3I78A 4X6MA 1C1VH 1QTFA 4DY7B 1FMGA 3OTJE 2FYRA 1C2GA 1QA0A 2B7DH 3DT0H 4B73A 4UFFH 4CRFA 3LH3A 1YF4A 1LCYA 3E0NB 3JZ2B 4AFSA 1AFEH 2A5AA 2D26C 4IMQA 4O97A 3D65E 1CU1A 1K1MA 2O8WA 3GCHC 3KQEA 2R0KA 5DP5A 1GJDB 2J2UA 2JH5D 3TGIE 2V3OH 1HIAB 1NRRH 3MU4A 2RDLA 3VGCB 3AASA 2W3KA 1FIWA 4JZDH 4OS7A 1C1TA 4CBOA 2AMPA 4TY7A 3P70B 1ARCA 1GBFA 2SNWA 3VB5A 1O2KA 5GXPA 1ZJKA 4O9VA 1IQLA 2RG3A 4JCNA 4DIHH 2VJ1A 1LHEH 2I6SA 4AZ2B 1C5TA 2EA3A 1V2OT 1IQNA 3GCHB 4ISNA 1HIAA 2GV7A 1RTKA 2ZECA 1C5YB 1IHTH 4LZ4B 1O35A 3LONA 4J2YB 1W14U 1GI3A 4MNWA 1WAYB 2OTVA 4Q2KA 5HM2A 1TNGA 3RXHA 1ZOMA 3URDA 1W3CA 3UY9A 2VGCB 5L6NH 2B0FA 1BRBE 5F03A 1SGQE 2VIVA 3P8FA 2UWLA 1O32A 3A80A 3U1JB 3ZVGA 5A09A 3A8DA 1PPHE 2GDEH 3R0FA 6GCHG 1HRTH 1THPB 1TNHA 1MAXA 2AMQA 1IQJA 1VZQH 3T2NA 1OYQA 4NIYA 4OS4A 1DLEA 1SGRE 1S6HA 1TRNA 4OS2A 2HLCA 2I6QA 4X1RU 1F2SE 1NRPH 4IC6A 3R3GB 4A5TS 2J94A 5FPYA 1HUTH 1A46H 4WH6A 2BXTH 3MI4A 3P17H 4K2YA 4WVPE 1GI2A 3PO1C 3RUOA 1C5SA 2BDCA 2Y5GA 1N1LA 4H42U 4XFQA 2BYAX 1GJ7B 1BIOA 1VITG 2WPMS 1ZMLA 2OQ5A 1C4Y2 1GJ6A 1TLDA 4Y7AA 1DFPA 1BQYA 3RXOA 1BJVA 2LPRA 1TE0A 1GBLA 4KP0A 1DOJA 1LO6A 1MKWH 2FOEA 1UVUH 1C5XB 1Q3XA 3MO6A 2G55A 5BPEA 1GHVH 1O2WA 3CS7A 2QXHA 2C8WB 5AF9H 1O2IA 2GZ7A 2PKSC 2O8UA 3RMMH 3TIUA 1JRTA 1TX6A 1AHTH 1VGCB 4BXSA 1MTVA 4K5ZA 4X6OA 3S7HB 4K3JA 1NFXA 3BTQE 2VIOA 1KLTA 2P8OB 3SORA 3FP8E 2SGEE 2XCNA 1EOLA 4M7GA 1PYTD 3A83A 4AYYB 5CE1A 3E90B 1FY3A 6CHAC 1XUKA 1C1OA 3NCLA 3W94A 3TH4H 1TGBA 3P8OA 4X6NA 2ZGJA 2LNCA 2W7UA 1GWAA 5C20A 1SVPA 1D4PB 4E7NA 1ZMJA 1BDAA 3HK6B 1CBWB 1FZZA 4E05H 3KGPA 3MH6A 3SV7A 1TALA 3LGTA 1O2ZA 6GCHF 4KKDA 1O38A 5AFYH 1C9PA 1C5UA 3I77A 3Q77A 3UOPA 3FANA 2F9PA 1CHOF 1YPLH 3A81A 2A4OA 2ZU5A 1TMBH 4YM9A 1MQ6A 3M36A 3CP7A 4B76A 1AWFH 2ESTE 5A0CA 1MH0A 3ZZ6A 1A3BH 2ZTYA 3M5NA 3RU4E 1IAUA 1XUIA 3EQ0H 1Z6JH 2ZU2A 1F5RA 5C3NA 1IQGA 1CGJE 1O0DH 1C9TA 1KXFA 1K1PA 2W3IA 2ZPQA 1SHYA 1MKWK 2F9VA 1C5OH 3A8AA 2VIWA 2XWAA 3SUGA 3MU0A 3SNCA 4WMEA 1FPCH 1ETRH 3GDVA 4BAQB 1UK3A 4D9RA 1B0FA 3S9AA 1EKBB 3ATMA 1PQ5A 3VEQB 2ANMH 4ISIH 1B0EA 1L0ZA 2GTBA 2WPJS 1OP8A 4X2VA 3MWIU 3TK9A 4RN6A 1TGCA 4MPWA 2XYAA 2PUQH 1NTPA 1O2NA 3ZZCA 1PPEE 2UWPA 5CMXH 1PPCE 1YCPK 1HAVA 3MYWA 3MHWU 2O8TA 4IMZA 5DPAA 1K1IA 3RMNH 5E0HA 4E06H 1XXFA 2BD9A 4JZIA 2WV5A 1IQMA 1YGCH 3PWCA 3NUMA 3O8RA 3KN2A 1HAGE 2G81E 1FNIA 5EW1H 1Y5UT 1D3TB 1TYNA 1WBGB 2ZF0H 2IPHA 1LHFH 8GCHG 1C2FA 4A1TA 2VB0A 3QTOH 1QB9A 1TQ0B 3BG4B 1LTOA 3PV4A 1H8IH 5FCRA 3F6UH 4FUFA 4ISHH 2BLWA 1J17T 2PHBA 2FXRA 2PR3A 1UO6A 1O2YA 1MTUA 1AKSB 1CHOG 5J4QA 1THRH 1ESTA 4OGXA 2VIDA 2FOBA 4O03A 4NWLA 2FI5E 3BIUH 1SR5C 5E2PA 1YPJH 4Y0YE 3T25A 1QURH 3Q00A 1EQ9A 1A61H 3SBKA 3RXVA 3UFAA 1BMMH 1GHBF 1CA0B 1L4ZA 1HAXB 4ZKNU 3ZVCA 1MTNB 2WPHS 1UCYK 3LKWA 1BRUP 1BMAA 2IN2A 2VGCC 4MPUA 2AYWA 1EZUC 1KXCA 4ZH8A 1CSOE 3A8BA 1AI8H 4KTCA 3QTVH 2WUCA 1MD7A 2ZU1A 2AH4X 2Y7ZA 3BTDE 1INCA 1W10U 3K6YA 2FDAA 2BTCE 3ZVFA 4R8TB 4XOJA 4X6PA 3Q3XA 1NZQH 1OWIA 1P01A 2H5CA 1EZSC 1PQAA 1GMCF 1AZZA 1K28D 1SLVB 2FPZA 4ABDA 1W7XH 1H9LB 4MQAA 1JXPA 2CHAC 2FX4A 2SNVA 3RXEA 3ZZ5A 2GCHF 3L33A 4FUBA 1C5VA 4X8VH 2Y81A 1MCTA 4OS5A 2A0QB 1OSSA 3V7TA 1QY6A 5HYOA 2DUCA 1TPOA 2P16A 3T62A 2D8WA 1KXBA 1YC0A 2ZG0H 5C67A 3RMOH 4AFQA 2DE9A 1J16A 1Z7KA 1YP9A 6LPRA 2CN0H 5ESBA 3STJA 1JIRA 1SG8B 5E8EH 4B2BA 2F9OA 4FUDA 4MDSA 4DW2U 1UHBA 1J15A 1EX3A 2Z3CA 2H9HA 1Z1JA 1GI9B 1GHBG 1Y3VA 3TNSA 2XBVA 4TY6A 3ZYEA 1S0QA 1YPGH 2VVVA 1DS2E 1RIWC 1HLTH 4D7GA 4LZ1H 3ZV8A 1UTJA 3GCNA 1G3EA 1TQ7B 2SFAA 5DJ7A 1C2KA 4X2YA 1O3IA 4K1EA 3ITIA 1AB9B 3TK6A 4MVNA 3PLKA 2FWWA 2FM2A 1K1LA 3RXUA 3BEFB 1V2QT 1P2KA 3TGJE 3EAJA 3SGAE 1HPGA 3A7WA 1QBVH 5TCAA 3SV6A 2J34A 3GY8A 3SV2H 3RMLH 2OQUA 1DXPA 1O3PB 3SV9A 4AGJA 1YPHC 4ZHMU 4R0IA 4D76A 3A7XA 2NU3E 2EI6A 4U30A 3SZNA 4SGBE 4Y8XA 4A7IB 1EUFA 2OXSA 5IYTA 2GMTC 1SFQB 1Y59T 1ZRBA 2QY0B 4UD9H 3KCGH 4X1NU 3ZVEA 3UIRA 1DPOA 3VXEH 1G2MA 3MNSA 4K8BA 3NWUA 1WQSA 3ZVBA 1RGQA 2HPQH 3SW2B 1RTFB 2OBQA 1DANH 1EB1H 1UTMA 1A5HA 1V2VT 1Z8RA 4BTUB 3S0NA 4CRGA 3M5LA 4JYTA 2EEKA 1YLCA 2ODQA 1O3FA 4GCHF 1AB9C 4U32A 2OBOA 3AAVA 1QHRB 2Z6BD 4I8LA 5T6FA 1FUJA 3F9EA 4MG3A 1WOFA 4ABBA 4H6TA 1TNIA 1GI0A 1GBMA 3SU1A 1EPTB 3DA9B 3L6PA 1QFKH 2PUXB 1BBRH 1KLIH 2Y6TA 2QF0A 1P3EA 4B2AA 1P10A 1YPMH 5EQQA 2ZCLP 1SQOA 3IITA 1CBWC 2UUYA 2FIRH 4Y0ZE 3SN8A 2XWBI 1QJ7B 4GHTA 1HV7A 2ODYB 2UUFB 1HAYB 4Y8ZA 1BZXE 1SLWB 1QRZA 3GY6A 2VWNA 3RU4D 2ZHEH 1DM4B 2ZQ2A 1UTOA 3OX7U 4XE4A 4UONA 3SJIA 3SQHE 2BXUH 1Z1IA 3GY4A 5E0JA 1G36A 1GVLA 3RXRA 2QN5T 3KQCA 1MU6B 2H9EH 3RXBA 1BHXB 4A1XA 1GMHF 3AAUA 1ZYOA 2BDYA 1GJ9B 2Q6DA 2BOHB 1SGFG 1NRSH 1SC8U 2FOMB 1O3GA 2ZGXH 1XXDA 2OC8A 1BHXF 2H9TH 4Q7ZA 4BAHB 1BTUA 2BVXH 1WU1A 2ANKH 3SQEE 3BG8A 5EODA 1GBHA 4YOGA 2FTLE 1KDQA 5T6GA 5FPSA 2GDDA 3A89A 3B9FH 3PMAB 3U8OH 3O8DA 3MFJA 2BD8A 1C5NH 3O8BA 3MH5A 3TLOA 3UNSA 4NSVA 1UTPA 1UTNA 1JOUB 4AX9H 1AIXH 7KMEH 2YOLA 4A92A 4K1TA 5H4IB 3IG6B 1CQQA 2G4UA 4AFUA 4Q7XA 1IOEA 1PJPA 1GDUA 1O2HA 1FDPA 1O30A 5DP8A 1S82A 2FOAA 2FODA 1TOCB 1C5WB 7ESTE 1FPHH 2OP9A 1GJAB 4X1QU 5EXLA 1GHWH 2ZFTA 1UK4A 1PPZA 3VB7A 2GD4B 3ZVAA 1GG6C 2ZI2H 1C1QA 3PLPA 3KNXA 1HXFH 1ELBA 1BOQA 4X1SU 1Z8GA 2P94A 1LHGH 1TPAE 4IN2A 4WMDA 4NFEA 1Q2WA 2GV6A 1P05A 3RDZA 1ELAA 1O5GH 1HB0B 2F3CE 5K0HA 2ALVA 2Z3DA 3BG4C 3OU0A 3TPIZ 1GGDB 1BTXA 3LOXA 3JZ1B 2Y7XA 1MCVA 4FUEA 3HKJB 2BVSH 5FBIA 1BRAA 2SGFE 2IOTA 4IS5A 4HFPB 1GBCA 4WH8A 4YESB 4ISLA 1EP6A 4WMFA 4AG1A 1QBOA 1J14A 1Y5BT 3A87A 4AN7A 1MU8B 2ZGBH 3V3MA 4AOQA 1OWEA 2FZZA 2XBYA 9LPRA 1ZMNA 5C1XA 3PMJA 3OSYA 2R0LA 3V12A 1AMHA 3I29A 1QJ1B 2ZGHA 3F9FA 2ZQ1A 2J4IA 3ATKA 2FS9A 2STBE 1EAUA 3M5OA 1AE5A 1V2ST 5I25A 4CBNA 5PTPA 3NK8A 1OPHB 2XTTB 3U9AH 3BIVH 1YM0A 1HDTH 3A7ZA 2ZO3H 1ELFA 6CHAB 1O3OA 3RC4A 1CE5A 3GISB 3RXMA 2SGPE 1F92A 1TA6A 4E7RG 1V2TT 3A8CA 1N8OB 2QC2A 4Q7YA 3V0XA 2AS9A 2FI3E 4HGCA 5LPFA 1A0JA 1GDNA 1W7GH 1ZRKA 1Z6EA 2JETC 3MU8A 1TX8A 5HM9A 1D3QB 5DGJA 1V2LT 2HWLB 2FYQA 1TWXB 1BTHH 1TMUH 1C2LA 1QBNA 1P8VC 1SGEE 3M7QA 4Y11E 3SUFA 1PQ8A 3LJOA 3GY3A 4ISOA 2QAAA 4B74A 2GKVE 1P2QA 3ZZAA 1Y5AT 1HAIH 1C5ZB 2AGIX 1FJSA 4JMYA 4I31A 1F0RA 1QR3E 5GJ4B 1ZR0A 1DICA 1E34B 3NKKA 5ABWA 2TPIZ 4GPGA 4PROA 1MAYA 5F8ZA 3CENA 1T8OA 2BY9X 2RA0A 1TPPA 1BMLA 2P3FH 2ZPSA 3BTGE 2ZDVH 3PLBA 3E6PH 4H4FA 3RXCA 1OP0A 1ETSH 2A1DB 4ZXYH 1OWKA 2J95A 3P6ZB 4JZEH 1V2JT 3P8GA 2ZC9H 5JBCS 1H8DH 3BTEE 1QQ4A 1C1MA 2P8OC 1RRKA 1Z71A 2ZP0H 4J1YA 1LQEA 2PKAB 1P9UA 3SHAH 2Z94A 1DUEA 2AIQA 1GGDC 4WF8A 1GBIA 4FUCA 1A1RA 1QNJA 5JB9S 1ANCA 4NGAH 2CMYA 2SGAA 1FY4A 1SHHB 2J38A 3ELAH 1D6WA 1D3PB 2HRVA 1HGTH 2BZAA 3RLYH 8ESTE 5DKMA 2WPIS 2BDIA 1C5PA 1T4VH 5GCHG 1AVWA 2WPKS 2A2XH 4Y79A 4DURA 1P03A 1F0UA 1PPFE 4DVAU 5C1UA 5LPRA 1L2EA 1XMNB 5J4SA 4X2XA 1A2CH 5EXMA 2EC9H 4CHAB 2A2QH 3QX5H 1HBTH 1SGCA 2W26A 2CHAB 1EOJA 4OS1A 3PB1E 3RM0H 2CV3A 3T26A 1GJBB 2ZA5A 3SNAA 1J8AA 1GJ8B 1ZJDA 4NA9H 2UWOA 1VGCC 1T31A 3C1KA 2FO9A 4U2WA 1G37A 1TONA 3UNRA 1SGPE 1LPGB 4UDWH 3RXPA 4WY3A 2FLBH 1O34A 2WPLS 2P3TB 1ZTJA 4WWYA 1IQIA 1AVGH 4D9QA 1FV9A 2ULLA 1JMOH 2AEIH 1VCPA 1L1NA 1O5FH 3SU2A 1YPEH 2BX4A 3ATIA 1MKXH 1U6QA 4VGCB 1O2MA 5DP7A 1GBKA 5A0AE 3FAOA 4CREA 3U8RH 3ZZ4A 5E2OA 1C2MA 1W0ZU 3L3TA 5C1YA 2A7CA 3CS0A 1XUGA 1T8MA
chains in the Genus database with same CATH superfamily
2NU4E 1A0HB 1UMAH 4UEHH 1WTGH 1ZHRA 2J97A 1GPZA 2QA9E 2VIPA 1TABE 3URCA 2WYJA 5T3HA 5EW2H 8GCHF 3BTTE 4MLFB 2WV9A 1GL1A 2TGDA 3KEEA 2AMDA 4U01A 1P2NA 2TIOA 2ZCKP 1LHDH 1UHBB 1P3CA 2ZU3A 4JYUH 2DE8A 5FL7D 2ZFPH 1V2UT 1P2JA 1EJMA 1CA8B 5TCCA 4Y76A 3U8TH 2BQ6B 3MMGA 5TJXA 2XNIA 3GICB 1H9IE 4TPIZ 1O2LA 5BRRE 3E0PB 1P9SA 1X7AC 1YY3A 1HNEE 1K1NA 4B75A 2ILNA 5JB8S 1FN8A 1AFQC 2JETB 4DT7B 1BRCE 1T4UH 1ZPZA 3SJKA 1O36A 5EXNA 1O2XA 4BTIB 3RXQA 1LPKB 2BD7A 4FU7A 3K65B 1O3MA 3RU4T 1N6XA 2G5NA 4B1TA 1RXPA 1Y3XA 4BAMB 4X1PU 5KEDA 2BOKA 1FAXA 4TWWA 2Y5HA 5HIYA 4CR9A 1RTLA 4ABJA 3U1IB 3K2UA 1EAWA 3RXAA 3NRLA 3ZZ3A 1UVPA 2ZCHP 3RXJA 1SLXB 3DSPA 3SO3A 4KELA 2PSYA 2XBXA 5LGOA 3DHKH 1ZSJA 1ZZZA 1FY5A 5JPMH 3BSQA 2OUAA 3PMHB 4I8HA 1SLUB 2R9PA 3KQDA 1W12U 1JBUH 4UFDH 1OS8A 1C5MD 5DSFA 4NIVA 2Y80A 1PPBH 1UCYH 1MTWA 3UWIA 2OINA 5GWZA 2PLXA 2AGEX 1AVXA 2WV4A 9ESTA 1UTQA 1THSH 2AERH 2B5TB 1TX7A 3QUMP 1BTYA 1O2JA 1KSNA 2ZHWH 4ZXXH 3MNBA 3AW0A 2XRCA 1DUAA 3K6ZA 4Y7BA 1E0FD 3U28C 2KFWA 1C2JA 1EAIA 5A8XA 1OX1A 1KLJH 2PV9B 1UTKA 2Z9IA 4DT4A 4NIWA 1DY8A 1L1JA 1Y3YA 1BBRE 1H8ED 1QIXB 2BLQA 3FVFB 2PGBB 3ODDA 2R3UA 2VINA 1NU7B 1P0SH 4FXGH 1NRQH 5K7RA 5C94A 1GCTB 1KTTB 3S69A 1UJ1A 1GHAF 2CGAA 4ZMAH 1ELCA 1GBJA 2A7HA 3MNXA 3RC6A 2ZFRH 3ZZBA 2A5IA 4ACAA 3VGCC 1GBTA 1DVAH 1O5BB 1BUIA 1T32A 3KYGA 3P95A 1RS0A 3D23A 1AKSA 1H1BA 3ESTA 3KL6A 4GVUA 1NN6A 1C4U2 2B8OH 1YCPH 2BZ6H 1QGFA 3HK3B 2BQ7B 3MTYA 1BMNH 1O33A 2G8TA 1T8LA 2IPQX 2V3HH 3EGKH 1TBQH 4BOHA 4BXWA 3PMBB 1GI5A 3RXKA 4K8YA 1TNJA 1F0TA 2FP7B 2XBWA 1DWCH 2C8ZB 2K1QA 2OK5A 3TK5A 1GMCG 2J98A 1RFNA 3M5MA 1BT7A 3VB4A 5EPYA 1BB0B 5B6OA 1UTLM 2F91A 2KCPA 1IQKA 4FUGA 4NWKA 4ABAA 2ZHFH 1TGTA 1CHGA 1XKBC 2BB4A 2NU0E 4MNYA 4IC5A 4DIIH 1AD8H 4OGYA 1IQHA 1L1GA 2F9NA 1UCYE 2TRMA 4FU8A 1KY9A 1LHCH 4F49A 1S84A 1IHSH 4CRDA 2P3UB 3EYDA 1YPKH 1SI5H 4CR5A 3OEHD 3N99A 1SOTA 2BVRH 2ZPRA 3UNQA 5AHGH 3KQ5A 1K1JA 3UR6A 3TVJB 1QRXA 1XKAC 1YCPM 2P59A 2CJIA 1TMTH 2C8XB 1FN6A 1S83A 1BMFD 1FIZA 4TT3D 2BM2A 3MOCA 4JK6A 2THFB 1O2RA 1E79D 3GDSA 1OYTH 2KX4A 2WUBA 1ELVA 1ABJH 4SGAE 1WYKA 3RXGA 1GHAG 2J92A 2ZDAH 4FVDA 1F5LA 1GBAA 2ZIQH 4GAWA 2RFKC 3TH3H 1KIGH 1NFYA 3OY6U 3FFGA 5DP3A 4ESTE 3TJUA 2R3YA 3GYMA 4F48B 1MUEB 2BD2A 2QIQA 3EA7A 2BLVA 5HMAA 1TIOA 5DP6A 3TJVA 1PQ7A 2BD4A 3K9XB 1C1UH 2XC5A 2STAE 1O2UA 1K0HA 2GT8A 1DT2A 4X2WA 3M35A 3QZRA 1KXEA 2Z7FE 4Z6AH 5C2ZA 1RIWB 2ZFFH 2FI4E 3PV2A 1NPMA 5JYIA 4GLYA 3GY2A 2HVXA 1FAKH 4IW4E 2ZDNA 1V2MT 3CNRA 3SNEA 1TAWA 1K21H 2JH6D 3PTBA 2PGQB 2RCEA 4BANB 1L4DA 2ZKSA 3Q76A 3SOSA 4Y71A 5ETXA 3LU9B 2H1UA 1FONA 3UREA 2ZHQH 3M3VA 2QYIA 4QT8C 1E37B 1ZGVA 1P2MA 3QK1A 2G52A 1V3XA 1AO5A 1NM6A 1OWHA 2ZDMA 3S9CA 3Q3YA 4MPXA 2JH0D 4NZLA 1ABIH 1C5LH 1KDQB 5FX5A 1A0LA 3UWJH 2H5DA 3BTME 1GHZA 4MNVA 1A4WH 3M7UA 2FS8A 4FVBA 3GY7A 1A5GH 3U69H 2ZTZA 1HJ9A 1SGYE 1EASA 4ZKRU 1WV7H 4O3UA 4INKA 3Q3KA 1TA2A 2Z9GA 3QZQA 5JDUB 2ZDKA 3N7EA 3VXFH 2ZGCA 3SI4H 3M3SA 2HALA 4I8GA 2FLRH 4Q80A 3O8CA 3QDZB 4GUXA 2BMGB 2ZDLA 4I8KA 3ZVDA 2HNTF 5IDKA 3SGBE 3EE0B 1MTNC 3RM2H 3TJOA 4INLA 1FLEE 1C1NA 1S6FA 4AB8A 2ODPA 1G2LA 1GBBA 3N7OA 4NSYA 1NU9A 4TYDA 3ZIAD 3F1SB 1SGNE 2ZZUH 1MBMA 2V7QD 4BAKB 1O2PA 1S0RA 1F5KU 1OXGA 5F53A 4YO9A 3BTFE 3SGQE 3ATWA 4RSPA 5FXLA 3FP7E 2BDAA 2PKSB 1GHXH 1O3CA 5G4BA 2VVUA 1UW7A 2BDBA 1DDJA 1NO9H 1AQ7A 5CHAC 5EU8A 3PWBA 3RXLA 1AE8H 1P09A 5GNDA 7GCHG 4KGAA 4OS6A 3RC5A 2A45B 1GMDG 1W8BH 4XBCA 1N8OC 1SBWA 1HJ8A 3SHCH 1OKXA 1DXWA 1GBEA 1GJ5H 1QJ6B 2C4FH 1FQ3A 1RJXB 2KCOA 2CF8H 2Z9LA 1N6YA 3LJJA 1O31A 1LKAA 2BD5A 3G01A 1C1RA 2HPPH 3A85A 1O5CB 2VU8E 1EAXA 3RXTA 3UPEA 3T28A 1XVOA 4X8TH 1WSSH 2WZQA 3F9GA 3SUEA 3SJ9A 3EA8A 3FZDA 4K60A 1K1OA 1WUNH 1ELDE 1EZQA 1AN1E 4LXBH 3LGIA 1G32B 4IN1A 1GI7B 1O2TA 1F0SA 4ABFA 1TFXA 1BA8B 1DITH 2OLGA 3BEIB 3LGUA 3NXPA 1O37A 1P57B 3H5CB 2HNTC 1NESE 1KYNA 1Y3WA 2BDGA 2GGVB 5DO4H 1KXAA 1O5AB 1GI1A 2Q6FA 3SU0A 1V2NT 1QL8A 1V6DA 1XUFA 4FOUC 4A1VA 1QA7A 1TB6H 3BV9B 4AFZA 2W5EA 1ZPBA 2JJ2D 1O2OA 1ZGIA 1O3LA 2WYGA 3MO3A 2ZFQH 1C1PA 2XCFA 3STIA 1S85A 1P12E 2PW8H 3UR9A 5A0BA 1GHYH 3E91A 4FU9A 4Y8YA 5I46H 1DSTA 1DY9A 3WW7A 1EB2A 4UE7H 3BN9A 3H7OA 4CRBA 1DLKB 2UUKB 3ODFA 7LPRA 4Y10E 1ACBE 5EPNA 4X0WU 5EGMA 5EQRA 1JRSA 2BY5X 2L74A 2A32A 3MH4A 2QV1A 4KTSA 1AU8A 1FY8E 1ZHPA 3OTPA 5DG6A 1T8NA 3SU5A 4H6SB 1MZAA 4D8NA 7GCHF 2GVFA 5JBAS 1GMDF 1LPZB 1BJUA 2F9UA 1GI6A 1JWTA 1LKBA 4LOYH 2OD3B 2FOGA 2K0QA 2ANYA 1VITF 1W0YH 2YNAA 1P06A 4CHAC 2NWNA 1ORFA 1O39A 3NPSA 4NZQA 1C2DA 2G4TA 4RKOB 4CH2B 1C2EA 2F4LA 2C8YB 3D49H 1CGHA 1HJAB 1W0JD 1C2IA 1ZSKA 2QCYA 2Q6GA 1WXRA 1GL0E 2CXVA 2BLOA 4B71A 3TH2H 5EJLA 1ELGA 3B23B 2O8MA 1CO7E 1PFXC 1E36B 3TGKE 1HAZB 2H6MA 3MH7A 1O5EH 1ZTKA 1FI8A 1ZPCA 1G3CA 3DSOA 1LVBA 1A3EH 3A84A 5E0GA 4YT7H 1UK2A 2FOCA 4ABHA 3KQBA 5JBTA 1W2KH 4IGDA 1Z8JB 2A5KA 1TGSZ 1QL9A 1C5RA 2QF5A 1Y3UA 3HGPA 3ZZ7A 1CT0E 2J9NA 2G51A 1O5DH 2HOBA 1ZSLA 3GDUA 2QXJA 1GJCB 4K69A 1OOKB 1HJAC 3OY5U 4ZHAA 1D3DB 3WWFA 1QB1A 1VCWA 4IBLH 1E35B 3SU3A 1CT4E 1QL7A 1PYTC 2BD3A 4KTUA 5EG4A 5A2MH 3F3BA 1NC6A 4LK4A 1WTHD 1O3KA 1HFDA 5FHTA 4NIXA 3VB3A 3W1EA 3HATH 2VH6A 3QO6A 4YOJA 3HGNA 2ANWA 3KYFA 2PTNA 1ELTA 2SGQE 1ANBA 1WCZA 2PFEA 1V2RT 5FAHA 5GCHF 3HKIB 2D1JA 2V35A 5HGGA 4WXIA 1C2HA 2W7SA 3SUDA 3RXDA 4JZ1A 3OYPA 1LVYA 2VNTA 2FX6A 4YOIA 1B5GH 3BTHE 1G3BA 1AGJA 2FTMA 1Z8IB 3UTUH 3LGWA 1WQVH 1H9HE 4YLQH 1TRMA 4ZHLU 1D6RA 1XUHA 1BTPA 5C5NA 2BY7X 1QB6A 1IQEA 2VWMA 1S5SA 5DP9A 1ESBA 2J98B 1SL3A 3MU5A 1K9OE 1UVTH 5JBBS 5F6MA 1HAVB 3M3TA 4B6EA 1LDTT 2GX4A 2OC1A 1V2WT 1ANDA 2C3SA 4P02A 2WINI 4FUHA 2A7JA 1SB1H 3GYLB 2M2AA 2GCTB 2EI7A 1YYY1 2RA3A 1F7ZA 1MQ5A 4JK5A 5GDSH 3T29A 3P8NA 4CRCA 1NRNH 2C93B 2PWXA 3GOVB 3E3TA 3SI3H 4FUJA 1GVZA 5EQSA 4ZROA 2NU2E 4NA7A 1M9UA 1VJAU 2YMSC 3TJNA 2ALPA 1SGTA 3A86A 1DWEH 1H8HD 1YKTA 2O8LA 2GP9B 1P02A 3GCOA 2HVYB 8KME2 1CGIE 3MU1A 2GCTC 2AIPA 5L30H 1HAPH 2VVCA 3EDXB 5CHBA 1ELEE 3PV5A 4UFGH 4XD7D 4CH8B 1O3JA 1P04A 5AVDA 4RKJB 1VJ9U 1ESAA 2ZFSA 3QWCH 1GI8B 1XUJA 1OWJA 4RT0A 2ZTXA 1O3NA 1O3EA 1HYLA 1NFUA 2ZNKH 2KAIB 1EZXC 4ZKSU 2ASUB 1GVKB 3E1XB 1AWHB 4AYVB 3F2FA 4UFEH 3ENSB 4WJG2 2TGPZ 4I33A 4F4OC 3QGJA 2QF3A 3FZZA 1ZTLA 3F9HA 1T7CA 3UQOA 2PSXA 4AB9A 1HCGA 2OC7A 4ABEA 6ESTA 1MZDA 4GHQA 3TU7H 2AGGX 3S7KB 5FPTA 1AUJA 1BTWA 3W95A 2O9QA 2ZHDA 3SU6A 3T27A 2R2WU 1P2OA 4THNH 4ASHA 3AVZA 4AGKA 4INHA 3SJ8A 3B8JA 1BTZA 1G30B 4DG4A 2C90B 1LVOA 2GT7A 1J9CH 1TOMH 4BAOB 1OP2A 1EP5A 4X8UH 1KTSB 5T1VA 2M5TA 3DFLA 2BDHA 1W13U 1YPHE 1C5QA 3MO9A 1SPJA 2EY4C 5EOKA 4CRAA 2A4QA 1ID5H 1YLDA 2G5VA 1H4WA 1V2PT 1MTSA 1TGNA 3VB6A 2G00A 3M37A 4MNXA 4WXVA 2BY6X 2QF4A 3S9BA 1GCTC 2D2DA 1BBRK 4O3TA 1PPGE 3PROA 1IQFA 3E8LA 2Z3EA 3SJOA 1DWDH 3BEUA 2PTCE 3ZYDA 3HPTB 5KGOA 1G3DA 1LQDB 3PTNA 1OHHD 4Y6DA 2EI8A 2F83A 3DFJA 1BCUH 1SGIB 4HG6A 2ZWLH 4I32A 3A7YA 1MBQA 3PO1B 2Q1JA 3IWMA 1HAHH 1ARBA 2K8IA 2KZ4A 3LDXH 4YT6H 4ZAEA 1NT1A 4VGCC 4ABIA 1AFQB 2SGDE 3SU4A 4YLUA 2XOKD 1VITH 2V6NA 1K22H 2HNTE 2P93A 3GY5A 1SMFE 2GZ8A 3UB0A 1TBRH 4XBDA 1TBZH 1AUTC 3DUXH 4Z0KA 1C1SA 3A7TA 4DJZB 3KIDU 3TITA 1DSUA 2QXIA 3WY8A 2AFQB 2PKAA 1SFIA 2TGTA 3PM3A 1Q31A 2A4GA 1VR1H 2QE7D 2FOHA 3FP6E 2BY8X 2CF9H 4RI0A 2FESH 1HAOH 3F68H 5HXFA 4AG2A 1V2KT 2Z9KA 4NFFA 1A5IA 1C4V2 1NFWA 5A8YA 1QRWA 4I7YH 2NU1E 2V0BA 5AFZH 3NZIA 2XXLA 4X8SH 3M7TA 1W11U 1FXYA 5DK1A 8LPRA 2XC4A 4I8JA 3DD2H 1MD8A 5C5OA 5DP4A 2VWLA 5A8ZA 1SKYE 1Y8TA 1RD3B 5B6LA 1DWBH 2FOFA 3RP2A 1KXDA 1ZLRA 3A88A 1XM1A 4XBBA 3BTWE 3EA9A 3UOUA 1DX5M 1GMHG 3C27B 5LH8A 4B2CA 2TBSA 5FBEA 5LPEA 5L2YH 2A31A 1NS3A 4DGJA 1O2VA 3LC3A 3ZV9A 3LGYA 5L2ZH 3ZZDA 2GMTB 2GZ9A 3A82A 2FMJA 2A4RA 4NG9H 4AORA 2R2MB 4JYVH 4GSOA 4BNRA 3F0OA 1A7SA 1EPTA 4MTBA 3PRBA 2VIQA 3VFEA 1TNKA 3E16B 1AY6H 3U98H 1TNLA 4ZUHA 4NCYA 5GPIB 2VH0A 1XX9A 5F8TA 3LGVA 2BQWB 2KAIA 4YTAA 3BF6H 4DOQA 3UUZA 1BITA 3GCTG 3QN7A 2GCHG 3OFND 4XDEA 5C0UA 2BX3A 4K1SA 4XSKU 5GIBA 4DCDA 5SGAE 1LVMA 1VCQA 4A6LA 1MKXK 2JJ1D 1NY22 2Z9JA 1LMWB 3ZZ8A 3M61U 3RXIA 1DE7H 1SGFA 3LC5A 3LPRA 4NA8A 3RXSA 1B7XB 2F9BH 4TPYA 1GDQA 2HGTH 3KF2A 3ZZ9A 3A7VA 3SNDA 1TPSA 2VWOA 1EXFA 1O3DA 3OAAD 1NROH 2IJOB 1QQUA 4ABGA 1ANEA 1KMHB 4TWYA 3SNBA 4HTCH 1JIMA 1UVSH 1XVMA 2ZEBA 4RT1A 3RXFA 4YZUA 2FEQH 1MMJN 1QCPA 3H7TA 4MPVA 3F2HA 1AZ8A 2KM0A 3P92A 1O3HA 1SGDE 3FOAA 3KHVA 3SV8A 1SQTA 2OC0A 2XC0A 1EJNA 2H2ZA 3LIWA 1O2GH 2ZU4A 1C1WH 3VPKA 4HI3A 2BHGA 1HXEH 4JZFH 3SYJA 1UVOA 3T5FH 3V13A 5DN6D 5FX6A 1YBWA 1D9IA 1EATA 2Y82A 2YNBA 3TNTA 1GJ4H 1O2SA 3N7DA 1YLNA 2TGAA 4FUIA 3RLWH 2UUJB 4HZHA 1SOZA 2B9LA 1O3AA 3AW1A 3SZEA 1O2QA 4ZKOU 2P95A 1E38B 5CDFE 3QLPH 1EPTC 5EJ1A 5F8XA 2OCVB 1G9IE 3QGNB 2WHXA 1ZHMA 1SSXA 1O3BA 4BTTB 2QXGA 5FCKA 3UQVA 1FY1A 3ATLA 1CVWH 1OWDA 3OE7D 3GCTF 5T6DA 5ESTE 2QGRA 2XW9A 4D7FA 1CT2E 1EJAA 3LH1A 1GBDA 4XRNA 3PYHA 1S81A 5CHAB 3LT3A 1TRYA 1CA0C 1SQAA 1P2IA 1GI4A 1GCDA 3D62A 2Y5FA 1K2I1 1GG6B 4GCHG 3MNCA 1E1QD 4P00A 2JKHA 3BTKE 1ETTH 1P11E 3I78A 4X6MA 1C1VH 1QTFA 4DY7B 1FMGA 3OTJE 2FYRA 1C2GA 1QA0A 2B7DH 3DT0H 4B73A 4UFFH 4CRFA 3LH3A 1YF4A 1LCYA 3E0NB 3JZ2B 4AFSA 1AFEH 2A5AA 2D26C 4IMQA 4O97A 3D65E 1CU1A 1K1MA 2O8WA 3GCHC 3KQEA 2R0KA 5DP5A 1GJDB 2J2UA 2JH5D 5IK2D 3TGIE 2V3OH 1HIAB 1NRRH 3MU4A 2RDLA 3VGCB 3AASA 2W3KA 1FIWA 4JZDH 4OS7A 1C1TA 4CBOA 2AMPA 4TY7A 4YXWD 3P70B 1ARCA 1GBFA 2SNWA 3VB5A 1O2KA 5GXPA 1ZJKA 1W0KD 4O9VA 1IQLA 2RG3A 4JCNA 4DIHH 2VJ1A 1LHEH 2I6SA 4AZ2B 1C5TA 2EA3A 1V2OT 1IQNA 3GCHB 4ISNA 1HIAA 2GV7A 1RTKA 2ZECA 1QZ8A 1C5YB 1IHTH 4LZ4B 1VKYA 1O35A 3LONA 4J2YB 1W14U 1GI3A 4MNWA 1WAYB 2OTVA 4Q2KA 5HM2A 1TNGA 3RXHA 1ZOMA 3URDA 1W3CA 3UY9A 1WDIA 4I86A 2VGCB 5L6NH 2B0FA 1BRBE 5F03A 1SGQE 2VIVA 3P8FA 2UWLA 1O32A 3A80A 3U1JB 3ZVGA 5A09A 3A8DA 1PPHE 2GDEH 3R0FA 6GCHG 1HRTH 1THPB 1TNHA 1MAXA 2AMQA 1IQJA 1VZQH 3T2NA 1OYQA 4NIYA 4OS4A 1DLEA 1SGRE 1S6HA 1TRNA 4OS2A 2HLCA 2I6QA 4X1RU 1F2SE 1NRPH 4IC6A 3R3GB 4A5TS 2J94A 5FPYA 1HUTH 1A46H 4WH6A 2BXTH 3MI4A 3P17H 4K2YA 4WVPE 1GI2A 3PO1C 3RUOA 1C5SA 2BDCA 2Y5GA 1N1LA 4H42U 4XFQA 2BYAX 1GJ7B 1BIOA 2L6OA 1VITG 2WPMS 1ZMLA 2OQ5A 1C4Y2 1GJ6A 1TLDA 4Y7AA 1DFPA 1BQYA 2LP6A 3RXOA 1BJVA 2LPRA 1TE0A 1GBLA 4KP0A 1DOJA 1LO6A 1MKWH 2FOEA 1UVUH 5C17A 1C5XB 1Q3XA 3MO6A 2G55A 5BPEA 1GHVH 1O2WA 3CS7A 4ACBA 2QXHA 2C8WB 5AF9H 3FO8D 1O2IA 2GZ7A 2PKSC 2O8UA 3RMMH 3TIUA 1JRTA 1TX6A 1AHTH 1VGCB 4BXSA 1MTVA 4K5ZA 4X6OA 3S7HB 4K3JA 1NFXA 3BTQE 2VIOA 1KLTA 2P8OB 3SORA 3FP8E 2SGEE 2XCNA 1EOLA 4M7GA 1PYTD 3A83A 4AYYB 5CE1A 3E90B 1FY3A 6CHAC 2XNDD 1XUKA 1C1OA 3NCLA 4Q63A 3W94A 3TH4H 1TGBA 3P8OA 4X6NA 2ZGJA 2LNCA 2W7UA 1GWAA 5C20A 1SVPA 1D4PB 4E7NA 1ZMJA 1BDAA 3HK6B 4Q4LA 1CBWB 1FZZA 4E05H 3KGPA 3MH6A 3SV7A 1TALA 3LGTA 1O2ZA 6GCHF 4KKDA 1O38A 5AFYH 1C9PA 1C5UA 3I77A 3Q77A 3UOPA 3FANA 1MABB 2F9PA 1CHOF 1YPLH 3A81A 2A4OA 2ZU5A 1TMBH 4YM9A 1MQ6A 3M36A 3CP7A 4B76A 1AWFH 2ESTE 5A0CA 1MH0A 3ZZ6A 1A3BH 2ZTYA 3M5NA 2AHME 3RU4E 1IAUA 1XUIA 3EQ0H 1Z6JH 2ZU2A 1F5RA 5C3NA 1IQGA 1CGJE 1O0DH 1C9TA 1KXFA 1K1PA 2W3IA 2ZPQA 1SHYA 1MKWK 2F9VA 1C5OH 3A8AA 2VIWA 2XWAA 3SUGA 3MU0A 3SNCA 3F0PA 4WMEA 1FPCH 1ETRH 3GDVA 4BAQB 1UK3A 4D9RA 1B0FA 3S9AA 1EKBB 3ATMA 1PQ5A 3VEQB 2ANMH 4ISIH 1B0EA 2GTBA 1L0ZA 2WPJS 1OP8A 4X2VA 3MWIU 3TK9A 4RN6A 1TGCA 4MPWA 3H09A 2XYAA 2VBCA 2PUQH 1NTPA 1O2NA 3ZZCA 1PPEE 2UWPA 5CMXH 1PPCE 1YCPK 1HAVA 3MYWA 3MHWU 2O8TA 4IMZA 5DPAA 1K1IA 3RMNH 5E0HA 4E06H 1XXFA 2BD9A 4JZIA 2F43B 2WV5A 1IQMA 1YGCH 3PWCA 3NUMA 3O8RA 3KN2A 1HAGE 2G81E 1FNIA 5EW1H 1SQRA 1Y5UT 1D3TB 1TYNA 1WBGB 2ZF0H 1NBME 2IPHA 1LHFH 8GCHG 1C2FA 4A1TA 2VB0A 4TSFD 3QTOH 1QB9A 1TQ0B 4FETA 3BG4B 1LTOA 3PV4A 1H8IH 5FCRA 3F6UH 4FUFA 4ISHH 2BLWA 1J17T 2PHBA 2FXRA 1FX0B 2PR3A 1UO6A 1O2YA 1MTUA 1AKSB 1CHOG 5J4QA 1THRH 1COWD 1ESTA 4OGXA 2VIDA 2FOBA 4O03A 2JDID 4NWLA 2FI5E 3BIUH 1SR5C 5E2PA 4AC9A 1YPJH 4Y0YE 3T25A 1QURH 3Q00A 1EQ9A 3EE7A 1A61H 3SBKA 3RXVA 3UFAA 1BMMH 1GHBF 2EQNA 1CA0B 1HAXB 1L4ZA 4ZKNU 3ZVCA 1MTNB 2WPHS 1UCYK 3LKWA 1BRUP 1BMAA 2IN2A 2VGCC 4MPUA 3AK5A 2AYWA 1EZUC 1KXCA 4ZH8A 1CSOE 3A8BA 1AI8H 4KTCA 3QTVH 2WUCA 1MD7A 2ZU1A 2AH4X 2Y7ZA 5HKKD 3BTDE 1INCA 1W10U 3K6YA 2FDAA 2BTCE 3ZVFA 4R8TB 4XOJA 4X6PA 3Q3XA 4Z1MD 1NZQH 1OWIA 1P01A 2H5CA 1EZSC 1PQAA 1GMCF 1AZZA 1K28D 1SLVB 2FPZA 4ABDA 1W7XH 1H9LB 4MQAA 1JXPA 2CHAC 2FX4A 2SNVA 3RXEA 2LELA 2GCHF 3ZZ5A 3L33A 4FUBA 1C5VA 4X8VH 2Y81A 1MCTA 2KR7A 4OS5A 2A0QB 1OSSA 3V7TA 1QY6A 4B6FA 5HYOA 2DUCA 1TPOA 2P16A 3T62A 2D8WA 1KXBA 1YC0A 2ZG0H 5C67A 3RMOH 4AFQA 2DE9A 1J16A 1Z7KA 1YP9A 6LPRA 2CN0H 5ESBA 3STJA 1JIRA 1SG8B 5E8EH 4B2BA 2F9OA 4FUDA 4MDSA 4DW2U 1UHBA 1J15A 1EX3A 2Z3CA 1S6LA 2H9HA 1Z1JA 1GI9B 1GHBG 1Y3VA 3TNSA 2XBVA 4TY6A 3ZYEA 1S0QA 1YPGH 2VVVA 1DS2E 1RIWC 1HLTH 4D7GA 4LZ1H 3ZV8A 1UTJA 3GCNA 1G3EA 1TQ7B 2SFAA 5DJ7A 1C2KA 4X2YA 1O3IA 4K1EA 3ITIA 1AB9B 3TK6A 4MVNA 3PLKA 2FWWA 2FM2A 1K1LA 3RXUA 3BEFB 1V2QT 1P2KA 3TGJE 3EAJA 3SGAE 1HPGA 3A7WA 1QBVH 5TCAA 3SV6A 2J34A 3GY8A 3SV2H 3RMLH 2OQUA 1DXPA 1O3PB 3SV9A 4AGJA 1YPHC 4ZHMU 4R0IA 5EIYA 4D76A 3A7XA 2NU3E 2EI6A 4U30A 3SZNA 4SGBE 4Y8XA 4A7IB 1EUFA 2OXSA 5IYTA 2GMTC 1SFQB 1Y59T 1ZRBA 2QY0B 4UD9H 3KCGH 4X1NU 3ZVEA 3UIRA 1DPOA 3VXEH 1G2MA 3MNSA 4K8BA 3NWUA 1WQSA 3ZVBA 1RGQA 2HPQH 3SW2B 1RTFB 2OBQA 1DANH 1EB1H 1UTMA 4OM9A 1A5HA 1V2VT 1Z8RA 4BTUB 3S0NA 4CRGA 3M5LA 4JYTA 2EEKA 1YLCA 2ODQA 1O3FA 4GCHF 1AB9C 4U32A 2OBOA 3AAVA 1QHRB 2Z6BD 4I8LA 5T6FA 1FUJA 3F9EA 4MG3A 1WOFA 4ABBA 4H6TA 1TNIA 1GI0A 1GBMA 4ZCNA 3SU1A 1EPTB 3DA9B 3L6PA 1QFKH 2PUXB 1BBRH 1KLIH 2Y6TA 2QF0A 1P3EA 4B2AA 1P10A 1YPMH 5EQQA 2ZCLP 1SQOA 3IITA 1CBWC 2UUYA 2FIRH 4Y0ZE 3SN8A 2XWBI 1QJ7B 4GHTA 1HV7A 2ODYB 2UUFB 1HAYB 4Y8ZA 1BZXE 1SLWB 1QRZA 3GY6A 2VWNA 3RU4D 2ZHEH 1DM4B 2ZQ2A 1UTOA 3DCLA 3OX7U 4XE4A 4UONA 3SJIA 3SQHE 2BXUH 1Z1IA 3GY4A 5E0JA 1G36A 1GVLA 3RXRA 2QN5T 3KQCA 1MU6B 2H9EH 3RXBA 1BHXB 4A1XA 1GMHF 3AAUA 1ZYOA 2BDYA 1GJ9B 2KCAA 2BOHB 1SGFG 2Q6DA 1NRSH 1SC8U 2FOMB 1O3GA 5HIZA 2ZGXH 1XXDA 2OC8A 1BHXF 2H9TH 3GS9A 4Q7ZA 1BTUA 4BAHB 2BVXH 1WU1A 2ANKH 3SQEE 3BG8A 5EODA 1GBHA 4YOGA 2FTLE 1KDQA 5T6GA 5FPSA 2GDDA 3A89A 3B9FH 3PMAB 3U8OH 3O8DA 3MFJA 2BD8A 1C5NH 2PP6A 3MH5A 3O8BA 3TLOA 3UNSA 4NSVA 1UTPA 1UTNA 1JOUB 4AX9H 1AIXH 7KMEH 2YOLA 4A92A 4K1TA 2KCYA 5H4IB 3IG6B 1CQQA 2G4UA 4AFUA 4Q7XA 1IOEA 1PJPA 1GDUA 1O2HA 1FDPA 1O30A 5DP8A 1S82A 3F2GA 2FOAA 2FODA 2W6JD 1TOCB 1C5WB 7ESTE 1FPHH 2OP9A 1GJAB 4X1QU 5EXLA 1GHWH 2ZFTA 1UK4A 1PPZA 3VB7A 2GD4B 3ZVAA 1GG6C 2ZI2H 1C1QA 3FN8A 3PLPA 3KNXA 1HXFH 1ELBA 1BOQA 4X1SU 1Z8GA 2P94A 1LHGH 1TPAE 4IN2A 4WMDA 4NFEA 1Q2WA 2GV6A 1P05A 3RDZA 2F3CE 1ELAA 1O5GH 1HB0B 5K0HA 2ALVA 2Z3DA 3BG4C 3OEED 3OU0A 3TPIZ 1GGDB 1BTXA 2J5UA 3LOXA 3JZ1B 2Y7XA 1MCVA 4FUEA 3HKJB 2BVSH 5FBIA 1BRAA 2SGFE 2IOTA 4IS5A 4HFPB 1GBCA 4WH8A 4YESB 4ISLA 1EP6A 4WMFA 4AG1A 1QBOA 1J14A 1Y5BT 3A87A 4AN7A 1MU8B 2ZGBH 3V3MA 4AOQA 1OWEA 2FZZA 2XBYA 9LPRA 1ZMNA 5C1XA 3PMJA 3OSYA 2R0LA 3V12A 1AMHA 3I29A 1QJ1B 2ZGHA 3F9FA 2ZQ1A 2J4IA 3ATKA 2FS9A 2STBE 1EAUA 3M5OA 1AE5A 1E1RD 1V2ST 5I25A 4CBNA 5PTPA 3NK8A 1OPHB 2CK3D 2XTTB 2YMSD 3U9AH 3BIVH 1YM0A 1HDTH 3A7ZA 2ZO3H 1ELFA 6CHAB 1O3OA 3VG8A 3RC4A 4ASUD 1CE5A 3GISB 3RXMA 2SGPE 1F92A 1TA6A 4E7RG 1V2TT 3A8CA 1N8OB 2QC2A 4Q7YA 3V0XA 2RDEA 2AS9A 2FI3E 4HGCA 5LPFA 1A0JA 1GDNA 1W7GH 1ZRKA 1Z6EA 2JETC 3MU8A 1TX8A 5HM9A 1D3QB 5DGJA 1V2LT 2HWLB 2FYQA 1TWXB 1BTHH 1TMUH 1C2LA 1QBNA 1P8VC 1SGEE 3M7QA 4Y11E 3SUFA 2JIZD 3UAIC 1PQ8A 3LJOA 3GY3A 4ISOA 2QAAA 4B74A 2GKVE 1P2QA 3ZZAA 1Y5AT 1HAIH 5KECA 1C5ZB 2AGIX 1FJSA 4JMYA 2IJD1 4I31A 1F0RA 1QR3E 5GJ4B 1ZR0A 3FKSD 1DICA 1E34B 3NKKA 5ABWA 2TPIZ 4GPGA 4PROA 1MAYA 5F8ZA 3CENA 1T8OA 2BY9X 3PRDA 2RA0A 1TPPA 1BMLA 2P3FH 2ZPSA 3BTGE 2ZDVH 3PLBA 3E6PH 4H4FA 3RXCA 1OP0A 1ETSH 2A1DB 4ZXYH 1OWKA 2J95A 3P6ZB 4JZEH 3DSGA 1V2JT 3P8GA 2ZC9H 5JBCS 1H8DH 3BTEE 1QQ4A 1C1MA 2P8OC 1RRKA 1Z71A 2ZP0H 4J1YA 1LQEA 1NBMD 4M9FA 5EJZA 2PKAB 1P9UA 3SHAH 2Z94A 1DUEA 2AIQA 1GGDC 4WF8A 1GBIA 4FUCA 1A1RA 1QNJA 2W6ID 5JB9S 1ANCA 4NGAH 2CMYA 2SGAA 1FY4A 1SHHB 2J38A 3ELAH 1D6WA 1D3PB 2HRVA 1HGTH 2BZAA 2HLDD 3RLYH 8ESTE 5DKMA 2WPIS 2BDIA 1C5PA 1T4VH 5C0TA 1YWUA 5GCHG 1AVWA 2WPKS 2A2XH 4Y79A 4DURA 1P03A 1F0UA 2GJGA 1PPFE 4F55A 2WPDD 4DVAU 5C1UA 5LPRA 1EFRD 1L2EA 1XMNB 5J4SA 4X2XA 1A2CH 5EXMA 2EC9H 4CHAB 2A2QH 3QX5H 1HBTH 1SGCA 2W26A 2CHAB 2YMSB 1EOJA 4OS1A 3PB1E 3RM0H 2CV3A 3T26A 1GJBB 2ZA5A 3SNAA 1J8AA 1GJ8B 1ZJDA 4NA9H 2UWOA 1VGCC 1T31A 3C1KA 2FO9A 4U2WA 1G37A 1TONA 3UNRA 1SGPE 1LPGB 4UDWH 3RXPA 4WY3A 2FLBH 1O34A 2WPLS 2P3TB 1ZTJA 4WWYA 1IQIA 1AVGH 4D9QA 1FV9A 2ULLA 1JMOH 2AEIH 1VCPA 1L1NA 1O5FH 3SU2A 1YPEH 2BX4A 3ATIA 3MQKC 1MKXH 1U6QA 4VGCB 1O2MA 5DP7A 1GBKA 3WWBA 5A0AE 3FAOA 4CREA 3U8RH 3ZZ4A 2V3MA 5E2OA 1C2MA 1W0ZU 3L3TA 5C1YA 2A7CA 2WSSD 3CS0A 1XUGA 1T8MA
chains in the Genus database with same CATH topology
2NU4E 1A0HB 1UMAH 4UEHH 1WTGH 1ZHRA 1GPZA 2QA9E 2VIPA 1TABE 3URCA 2WYJA 5T3HA 5EW2H 8GCHF 3BTTE 4MLFB 1GL1A 2TGDA 3KEEA 2AMDA 4U01A 1P2NA 2TIOA 2ZCKP 1LHDH 1UHBB 1P3CA 2ZU3A 4JYUH 2DE8A 2ZFPH 1V2UT 1P2JA 1EJMA 1CA8B 5TCCA 4Y76A 3U8TH 2BQ6B 3MMGA 5TJXA 2XNIA 3GICB 1H9IE 4TPIZ 1O2LA 5BRRE 3E0PB 1P9SA 1X7AC 1HNEE 1K1NA 4B75A 2ILNA 5JB8S 1FN8A 1AFQC 2JETB 4DT7B 1BRCE 1T4UH 1ZPZA 3SJKA 1O36A 5EXNA 1O2XA 4BTIB 3RXQA 1LPKB 2BD7A 4FU7A 3K65B 1O3MA 3RU4T 1N6XA 2G5NA 4B1TA 1RXPA 1Y3XA 4BAMB 4X1PU 2BOKA 1FAXA 4TWWA 2Y5HA 4CR9A 1RTLA 4ABJA 3U1IB 3K2UA 1EAWA 3RXAA 3ZZ3A 1UVPA 2ZCHP 3RXJA 1SLXB 3SO3A 4KELA 2PSYA 2XBXA 5LGOA 3DHKH 1ZSJA 1ZZZA 1FY5A 5JPMH 3BSQA 2OUAA 3PMHB 4I8HA 1SLUB 2R9PA 3KQDA 1W12U 1JBUH 4UFDH 1OS8A 1C5MD 4NIVA 2Y80A 1PPBH 1UCYH 1MTWA 3UWIA 2OINA 5GWZA 2PLXA 2AGEX 1AVXA 2WV4A 9ESTA 1UTQA 1THSH 2AERH 2B5TB 1TX7A 3QUMP 1BTYA 1O2JA 1KSNA 2ZHWH 4ZXXH 3MNBA 3AW0A 2XRCA 1DUAA 3K6ZA 4Y7BA 1E0FD 1C2JA 1EAIA 5A8XA 1OX1A 1KLJH 2PV9B 1UTKA 2Z9IA 4NIWA 1DY8A 1L1JA 1Y3YA 1BBRE 1QIXB 2BLQA 3FVFB 2PGBB 3ODDA 2R3UA 2VINA 1NU7B 1P0SH 4FXGH 1NRQH 5K7RA 1GCTB 1KTTB 3S69A 1UJ1A 1GHAF 2CGAA 4ZMAH 1ELCA 1GBJA 2A7HA 3MNXA 3RC6A 2ZFRH 3ZZBA 2A5IA 3VGCC 1GBTA 1DVAH 1O5BB 1BUIA 1T32A 3P95A 1RS0A 3D23A 1AKSA 1H1BA 3ESTA 3KL6A 4GVUA 1NN6A 1C4U2 2B8OH 1YCPH 2BZ6H 1QGFA 3HK3B 2BQ7B 3MTYA 1BMNH 1O33A 2G8TA 1T8LA 2V3HH 3EGKH 4BOHA 1TBQH 4BXWA 3PMBB 1GI5A 3RXKA 4K8YA 1TNJA 1F0TA 2FP7B 2XBWA 1DWCH 2C8ZB 2K1QA 3TK5A 1GMCG 1RFNA 3M5MA 1BT7A 3VB4A 5EPYA 1BB0B 5B6OA 1UTLM 2F91A 4FUGA 1IQKA 4NWKA 4ABAA 2ZHFH 1TGTA 1CHGA 1XKBC 2BB4A 2NU0E 4MNYA 4IC5A 4DIIH 1AD8H 4OGYA 1IQHA 1L1GA 2F9NA 1UCYE 2TRMA 4FU8A 1KY9A 1LHCH 4F49A 1S84A 1IHSH 4CRDA 2P3UB 3EYDA 1YPKH 1SI5H 4CR5A 1SOTA 2BVRH 2ZPRA 3UNQA 5AHGH 1K1JA 3UR6A 3TVJB 1QRXA 1XKAC 1YCPM 2P59A 2CJIA 1TMTH 2C8XB 1FN6A 1S83A 1FIZA 2BM2A 3MOCA 4JK6A 2THFB 1O2RA 3GDSA 1OYTH 2WUBA 1ELVA 1ABJH 4SGAE 1WYKA 3RXGA 1GHAG 2J92A 2ZDAH 4FVDA 1F5LA 1GBAA 2ZIQH 4GAWA 3TH3H 1KIGH 1NFYA 3OY6U 3FFGA 5DP3A 4ESTE 3TJUA 2R3YA 3GYMA 1MUEB 2BD2A 2QIQA 3EA7A 2BLVA 5HMAA 1TIOA 5DP6A 3TJVA 1PQ7A 2BD4A 3K9XB 1C1UH 2XC5A 2STAE 1O2UA 2GT8A 1DT2A 4X2WA 3M35A 3QZRA 1KXEA 2Z7FE 4Z6AH 5C2ZA 1RIWB 2ZFFH 2FI4E 5JYIA 1NPMA 4GLYA 3GY2A 2HVXA 1FAKH 4IW4E 2ZDNA 1V2MT 3SNEA 1TAWA 1K21H 2JH6D 3PTBA 2PGQB 2RCEA 4BANB 1L4DA 2ZKSA 3Q76A 3SOSA 4Y71A 5ETXA 3LU9B 2H1UA 1FONA 3UREA 2ZHQH 3M3VA 2QYIA 4QT8C 1E37B 1ZGVA 1P2MA 3QK1A 2G52A 1V3XA 1AO5A 1NM6A 1OWHA 2ZDMA 3S9CA 3Q3YA 4MPXA 2JH0D 4NZLA 1ABIH 1C5LH 1KDQB 5FX5A 1A0LA 3UWJH 2H5DA 3BTME 1GHZA 4MNVA 1A4WH 3M7UA 2FS8A 4FVBA 3GY7A 1A5GH 3U69H 2ZTZA 1HJ9A 1SGYE 1EASA 4ZKRU 1WV7H 4O3UA 4INKA 3Q3KA 1TA2A 2Z9GA 3QZQA 5JDUB 2ZDKA 3VXFH 2ZGCA 3SI4H 3M3SA 2HALA 4I8GA 2FLRH 4Q80A 3O8CA 3QDZB 4GUXA 2BMGB 2ZDLA 4I8KA 3ZVDA 2HNTF 5IDKA 3SGBE 3EE0B 1MTNC 3RM2H 3TJOA 4INLA 1FLEE 1C1NA 1S6FA 4AB8A 2ODPA 1G2LA 1GBBA 3N7OA 4NSYA 1NU9A 4TYDA 3F1SB 1SGNE 2ZZUH 1MBMA 4BAKB 1O2PA 1S0RA 1F5KU 1OXGA 4YO9A 3BTFE 3SGQE 3ATWA 4RSPA 5FXLA 3FP7E 2BDAA 2PKSB 1GHXH 1O3CA 5G4BA 2VVUA 2BDBA 1DDJA 1NO9H 1AQ7A 5CHAC 5EU8A 3PWBA 3RXLA 1AE8H 1P09A 7GCHG 4KGAA 4OS6A 3RC5A 2A45B 1GMDG 1W8BH 4XBCA 1N8OC 1SBWA 1HJ8A 3SHCH 1OKXA 1DXWA 1GBEA 1GJ5H 1QJ6B 2C4FH 1FQ3A 1RJXB 2CF8H 2Z9LA 1N6YA 3LJJA 1O31A 1LKAA 2BD5A 3G01A 1C1RA 2HPPH 3A85A 1O5CB 2VU8E 1EAXA 3RXTA 3UPEA 3T28A 1XVOA 4X8TH 1WSSH 3F9GA 3SUEA 3SJ9A 3EA8A 3FZDA 4K60A 1K1OA 1WUNH 1ELDE 1EZQA 1AN1E 4LXBH 3LGIA 1G32B 4IN1A 1GI7B 1O2TA 1F0SA 4ABFA 1TFXA 1BA8B 1DITH 2OLGA 3BEIB 3LGUA 3NXPA 1O37A 1P57B 3H5CB 2HNTC 1NESE 1KYNA 1Y3WA 2BDGA 2GGVB 5DO4H 1KXAA 1O5AB 1GI1A 2Q6FA 3SU0A 1V2NT 1QL8A 1V6DA 1XUFA 4A1VA 1QA7A 1TB6H 3BV9B 4AFZA 2W5EA 1ZPBA 1O2OA 1ZGIA 1O3LA 2WYGA 3MO3A 2ZFQH 1C1PA 2XCFA 3STIA 1S85A 1P12E 2PW8H 3UR9A 5A0BA 1GHYH 3E91A 4FU9A 4Y8YA 5I46H 1DSTA 1DY9A 1EB2A 4UE7H 3BN9A 3H7OA 4CRBA 1DLKB 2UUKB 3ODFA 7LPRA 4Y10E 1ACBE 5EPNA 4X0WU 5EGMA 5EQRA 1JRSA 2BY5X 2A32A 3MH4A 2QV1A 4KTSA 1AU8A 1FY8E 1ZHPA 5DG6A 1T8NA 3SU5A 4H6SB 1MZAA 4D8NA 7GCHF 2GVFA 5JBAS 1GMDF 1LPZB 1BJUA 2F9UA 1GI6A 1JWTA 1LKBA 4LOYH 2OD3B 2FOGA 2ANYA 1VITF 1W0YH 2YNAA 1P06A 4CHAC 2NWNA 1ORFA 1O39A 3NPSA 4NZQA 1C2DA 2G4TA 4RKOB 4CH2B 1C2EA 2C8YB 3D49H 1CGHA 1HJAB 2Q6GA 1C2IA 1ZSKA 2QCYA 1GL0E 2CXVA 2BLOA 4B71A 3TH2H 1ELGA 3B23B 2O8MA 1CO7E 1PFXC 1E36B 3TGKE 1HAZB 2H6MA 3MH7A 1O5EH 1ZTKA 1FI8A 1ZPCA 1G3CA 1LVBA 1A3EH 3A84A 5E0GA 4YT7H 1UK2A 2FOCA 4ABHA 3KQBA 5JBTA 1W2KH 4IGDA 1Z8JB 2A5KA 1TGSZ 1QL9A 1C5RA 1Y3UA 3HGPA 3ZZ7A 1CT0E 2J9NA 2G51A 1O5DH 2HOBA 1ZSLA 3GDUA 2QXJA 1GJCB 4K69A 1OOKB 1HJAC 3OY5U 4ZHAA 1D3DB 1QB1A 1VCWA 4IBLH 1E35B 3SU3A 1CT4E 1QL7A 1PYTC 2BD3A 4KTUA 5EG4A 5A2MH 1NC6A 4LK4A 1WTHD 1O3KA 1HFDA 5FHTA 4NIXA 3VB3A 3HATH 2VH6A 3QO6A 4YOJA 3HGNA 2ANWA 2PTNA 1ELTA 2SGQE 1ANBA 1WCZA 2PFEA 1V2RT 5FAHA 5GCHF 3HKIB 2D1JA 2V35A 5HGGA 4WXIA 1C2HA 2W7SA 3SUDA 3RXDA 4JZ1A 3OYPA 1LVYA 2VNTA 2FX6A 4YOIA 1B5GH 3BTHE 1G3BA 1AGJA 2FTMA 1Z8IB 3UTUH 3LGWA 1WQVH 1H9HE 4YLQH 1TRMA 4ZHLU 1D6RA 1XUHA 1BTPA 5C5NA 2BY7X 1QB6A 1IQEA 2VWMA 1S5SA 5DP9A 1ESBA 1SL3A 3MU5A 1K9OE 1UVTH 5JBBS 5F6MA 1HAVB 3M3TA 1LDTT 2GX4A 1V2WT 2OC1A 1ANDA 2C3SA 2WINI 4FUHA 2A7JA 1SB1H 3GYLB 2GCTB 2EI7A 1YYY1 2RA3A 1F7ZA 1MQ5A 4JK5A 5GDSH 3T29A 3P8NA 4CRCA 1NRNH 2C93B 2PWXA 3GOVB 3E3TA 3SI3H 4FUJA 1GVZA 5EQSA 4ZROA 2NU2E 4NA7A 1M9UA 1VJAU 3TJNA 2ALPA 1SGTA 3A86A 1DWEH 1YKTA 2GP9B 2O8LA 1P02A 3GCOA 8KME2 1CGIE 3MU1A 2GCTC 2AIPA 5L30H 1HAPH 2VVCA 3EDXB 1ELEE 4UFGH 4CH8B 1O3JA 1P04A 5AVDA 4RKJB 1VJ9U 1ESAA 2ZFSA 3QWCH 1GI8B 1XUJA 1OWJA 2ZTXA 1O3NA 1O3EA 1HYLA 1NFUA 2ZNKH 2KAIB 1EZXC 4ZKSU 2ASUB 1GVKB 3E1XB 1AWHB 4AYVB 4UFEH 3ENSB 4WJG2 2TGPZ 4I33A 4F4OC 3QGJA 2QF3A 3FZZA 1ZTLA 3F9HA 1T7CA 3UQOA 2PSXA 4AB9A 1HCGA 2OC7A 4ABEA 6ESTA 1MZDA 4GHQA 3TU7H 2AGGX 3S7KB 5FPTA 1AUJA 1BTWA 3W95A 2O9QA 2ZHDA 3SU6A 3T27A 2R2WU 1P2OA 4THNH 4ASHA 3AVZA 4AGKA 4INHA 3SJ8A 3B8JA 1BTZA 1G30B 4DG4A 2C90B 1LVOA 2GT7A 1J9CH 1TOMH 4BAOB 1OP2A 1EP5A 4X8UH 1KTSB 2M5TA 3DFLA 2BDHA 1W13U 1YPHE 1C5QA 3MO9A 1SPJA 5EOKA 4CRAA 2A4QA 1ID5H 1YLDA 2G5VA 1H4WA 1V2PT 1MTSA 1TGNA 3VB6A 2G00A 3M37A 4MNXA 4WXVA 2BY6X 3S9BA 1GCTC 2D2DA 1BBRK 4O3TA 1PPGE 3PROA 1IQFA 3E8LA 2Z3EA 3SJOA 1DWDH 3BEUA 2PTCE 3ZYDA 3HPTB 1G3DA 1LQDB 3PTNA 4Y6DA 2EI8A 2F83A 3DFJA 1BCUH 1SGIB 2ZWLH 4I32A 3A7YA 1MBQA 3PO1B 2Q1JA 3IWMA 1HAHH 1ARBA 3LDXH 4YT6H 4ZAEA 1NT1A 4VGCC 4ABIA 1AFQB 2SGDE 3SU4A 4YLUA 1VITH 2V6NA 1K22H 2HNTE 2P93A 3GY5A 1SMFE 2GZ8A 1TBRH 4XBDA 1TBZH 1AUTC 3DUXH 4Z0KA 1C1SA 3A7TA 4DJZB 3KIDU 3TITA 1DSUA 2QXIA 3WY8A 2AFQB 2PKAA 1SFIA 2TGTA 3PM3A 1Q31A 2A4GA 1VR1H 3FP6E 2FOHA 2BY8X 2CF9H 2FESH 1HAOH 3F68H 5HXFA 4AG2A 1V2KT 2Z9KA 4NFFA 1A5IA 1C4V2 1NFWA 5A8YA 1QRWA 4I7YH 2NU1E 2V0BA 5AFZH 3NZIA 2XXLA 4X8SH 3M7TA 1W11U 1FXYA 5DK1A 8LPRA 2XC4A 4I8JA 3DD2H 1MD8A 5C5OA 5DP4A 2VWLA 5A8ZA 1Y8TA 1RD3B 1DWBH 2FOFA 3RP2A 1KXDA 1ZLRA 3A88A 1XM1A 4XBBA 3BTWE 3EA9A 3UOUA 1DX5M 1GMHG 3C27B 5LH8A 4B2CA 2TBSA 5FBEA 5LPEA 5L2YH 2A31A 1NS3A 4DGJA 1O2VA 3LC3A 3ZV9A 3LGYA 5L2ZH 3ZZDA 2GMTB 2GZ9A 3A82A 2FMJA 2A4RA 4NG9H 4AORA 2R2MB 4JYVH 4GSOA 4BNRA 4MTBA 1A7SA 1EPTA 2VIQA 3VFEA 1TNKA 3E16B 1AY6H 3U98H 1TNLA 4ZUHA 4NCYA 5GPIB 2VH0A 1XX9A 5F8TA 3LGVA 2BQWB 2KAIA 4YTAA 3BF6H 4DOQA 3UUZA 1BITA 3GCTG 3QN7A 2GCHG 4XDEA 2BX3A 4K1SA 4XSKU 5GIBA 4DCDA 5SGAE 1LVMA 1VCQA 4A6LA 1MKXK 1NY22 2Z9JA 1LMWB 3ZZ8A 3M61U 3RXIA 1DE7H 1SGFA 3LC5A 3LPRA 4NA8A 3RXSA 1B7XB 2F9BH 4TPYA 1GDQA 2HGTH 3KF2A 3ZZ9A 3A7VA 3SNDA 1TPSA 2VWOA 1EXFA 1O3DA 1NROH 2IJOB 1QQUA 4ABGA 1ANEA 4TWYA 3SNBA 4HTCH 1JIMA 1UVSH 1XVMA 2ZEBA 3RXFA 4YZUA 2FEQH 1MMJN 1QCPA 3H7TA 4MPVA 1AZ8A 3P92A 1O3HA 1SGDE 3KHVA 3SV8A 1SQTA 2OC0A 2XC0A 1EJNA 2H2ZA 3LIWA 1O2GH 2ZU4A 1C1WH 3VPKA 4HI3A 2BHGA 1HXEH 4JZFH 1UVOA 3T5FH 3V13A 5FX6A 1YBWA 1D9IA 1EATA 2Y82A 2YNBA 3TNTA 1GJ4H 1O2SA 2TGAA 4FUIA 3RLWH 2UUJB 4HZHA 1SOZA 2B9LA 1O3AA 3AW1A