2ZFWA

Crystal structure of pex from synechococcus sp. (strain pcc 7942) (anacystis nidulans r2)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
MDFEDIYRFFQDPPPHYLSKELAVCYVLAVLRHEDSYGTELIQHLETHWPNYRLSDTVLYTALKFLEDEQIISGYWKKVEGRGRPRRMYQLAQANDDRSRDLAQLWERYLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important structural elements of the cyanobacterial clock-related protein Pex.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Circadian clock protein
molecule keywords Pex
total genus 31
structure length 112
sequence length 112
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zfwA00
1S29A 2E1NA 3LA2A 4M6XA 4QLCU 2GAUA 4N9IA 1SFEA 3WTZA 4S05A 2IA2A 4WF2A 3B73A 4FX4A 1TNTA 2ZNZA 4BHPA 2JPBA 3F21A 1IXSB 5BS6A 4K2EA 5HLGA 2FBIA 5A2QK 3FMQA 5HOOA 4KNYA 3GFIA 5CVIA 3LSTA 3E6DA 4QWQA 1J0RA 1I5ZA 2OA4A 2ZO4A 1IUYA 4S04A 1EV7A 3KETA 4ZZDA 4A6DA 1GVJA 2G7UA 4O6JA 3I0TA 1U5TA 3CUQB 2EFWA 2H94A 2LF8A 3ABUA 5BMZA 1KU3A 3HUGA 1OYWA 3J80Z 4L18B 5LGNA 2DPUA 2A6EF 1RI7A 4BHCA 4LJZF 2VBYA 4CGZA 1IF1A 4ZYDA 4YG2F 3G3ZA 4MEYF 1B59A 2IT0A 1S8NA 3TKYA 3COAC 5HDKA 4YFKF 3CUOA 4L5IA 1USSA 3L09A 1WI9A 1D3YA 1KU7A 3HRUA 4HLYA 3Q5FA 2NNNA 2OAZA 1HXDA 3DV8A 3KZZA 3RDIA 1P4AA 3EQLF 2HWVA 2KIUA 1U78A 1ZRFA 1QGPA 3AAFA 1SAXA 1L0OC 3GVAA 1T38A 4LLLA 3FX3A 2EFNA 4MNUA 2ZBKA 3V8JA 1U3EM 4XSZF 1IN7A 3ZQ7A 3CUQC 2HS5A 4GXOA 3MEXA 2EFQA 4BHBA 1ZLJA 4MQVA 3GEZA 3ERED 4MEXF 2ZMEB 2FMLA 2XAFA 3GF2A 1MJAA 1FSHA 4HF0A 1XGSA 2BYVE 5DEQA 2XHKA 1K78B 1FYKA 2DBBA 2ESNA 2DI3A 5DD8A 2HDCA 2VT3A 3I58A 4ENMA 2FBHA 3EUHA 4KMUX 2RDPA 3CJNA 1KYZA 1ZH5A 4M74A 3E5QA 4OIPF 1AWCA 3R4KA 1ZARA 2DK8A 4KA4A 3RPQA 3F6OA 1YO5C 4HDUA 2D1HA 4Y15A 1K7AA 2F2EA 2X0LA 1XN7A 3K0LA 2L4AA 1ODDA 2VODA 1Z6TA 3WU1B 3WTXC 3QU6A 5D4SA 3RIRA 3F22A 1TW2A 2W24A 1QZZA 2EK5A 4G6QA 1Z9CA 4FX0A 3IHUA 3ZPLA 1R1UA 4A6EA 2IJLA 4OOIA 3V8LA 3QAHA 1OYIA 4I98B 3ZMSA 1HKTA 2GZWA 3HRMA 1FX7A 4WWCA 4LD5A 5LEJA 2FNPA 1BC7C 1UFMA 4Q47A 1O57A 3IRQA 4PDKA 5ICCA 3SXYA 5LHIA 5DD4A 1WSUA 5JVTA 1Y0UA 2QM3A 2P7CB 1FP2A 3DQVC 2CO5A 2L02A 5J6XA 5LGTA 2PG4A 3MQ0A 4Q5SF 2YR2A 2D1VA 1T2KA 1SMYF 4RAZA 2V9VA 1SFXA 3OV8A 3W6KB 2F5CA 1KQ9A 1BN5A 2IRFG 2OU2A 1HKQA 4RB0A 5EEHA 1J59A 3BPXA 3DXJF 3FHZA 2STTA 2GWRA 2LNBA 4L9TA 2FE3A 4MGRA 1CF7B 2GXBA 2EA2A 2LDUA 5D8LB 4L9VA 1FP1D 1L3LA 1F4KA 1U5TC 2BV6A 1P2FA 2L01A 1UHWA 3K1NA 2RN7A 3HSFA 3I54A 2HKOA 3TQNA 1D8KA 4KFCA 2PN6A 5DCFA 3WGHA 2JTVA 3HIFA 3GZ6A 1Z6RA 3CDHA 4KN4X 2M45A 4ASNA 3L2CA 3BP8A 2JRTA 2MC3A 1C0WA 3KP5A 1TW3A 2UXXA 2FOKA 4EV0A 1TTYA 3TO9A 2FA5A 4L9NA 2Y75A 3BY6A 2XASA 3LQRA 2PQ8A 1XD7A 4XLNF 1TBXA 3L00A 2QZ8A 4IVNA 3WTTC 4JBAA 2HGCA 3MWMA 2XAHA 3JTHA 4RB3C 1Z91A 2GQQA 1KQ8A 3BJOA 2FF4A 2TDXA 3ZN0A 2DQRA 1ZHFA 4YIFA 3GO5A 4CICA 4B09A 3F8MA 4LK1F 5F6FA 2A07F 1U5TB 3T5XA 3V7SA 3I64A 3IC7A 4P96A 4BXUA 3MZHA 1G3WA 4OU0A 2E7WA 4PGGA 4PZJA 2GIVA 1E2XA 4PGHA 1RUOA 2PLYA 2V1DA 3WGIA 1HW5A 3BWGA 2OQGA 2OZ6A 1XSDA 4FT8A 3R6SA 1F9NA 3RKXA 2MH2A 5DYMA 3J80K 3RKWA 3J81K 1WQ2A 2H6CA 3R0JA 1EH7A 4U88A 1RZ4A 3T0YA 2COMA 2IVMA 5CVRA 1LQ1A 2CYYA 2PMUA 1TQIA 2IA0A 2WV0A 1LDDA 2M5WA 4Y17A 4Q4ZF 2ZNYA 5FLXK 3PQJA 4ESJA 4DQ2A 3FXQA 2BBYA 4ENJA 3V8KA 1OPCA 3HRSA 4P9UA 2K7LA 2PJPA 4WX9A 2NYXA 3WTWC 1WKMA 3MCZA 4KT5C 5AONA 2A5YB 4EGZA 1FT9A 4U0VA 3VODA 4CXFA 2KJBA 2FXAA 4UVAA 4XSXF 1KA8A 2D2WA 1MGTA 2HOEA 5FB2A 2FBKA 4UHTA 4CDGA 1DPRA 1R23A 2F5DA 4KYWA 2CWEA 3HHGA 3KZYA 4LMYA 3V7CA 1HW2A 3W6JB 2K27A 5CVUA 1IRFA 2K4BA 1FY7A 3C7JA 2O03A 4UUVA 5BPIA 4AVPA 3E6MA 1USTA 5D4RA 1PP8F 3LFKA 2MH9A 1CGPA 1DPUA 3QRFF 3TDUC 1BI2A 2VT2A 1W7PD 4XRFA 3P9IA 4L9JA 3V4GA 3BJ6A 3GWZA 5H6QA 4BNCA 5E8IA 4A0YA 3EYIA 4P55A 3ZN1A 1D5VA 3GZ5A 1O7LA 2WTEA 4HDVA 2BEOA 2M30A 2EFOA 3JAMZ 1E17A 2STWA 1R00A 1YW7A 1YFHA 2H6BA 3GFMA 4E70A 4KIGA 4I09A 2P6TA 1KU2A 3ABTA 3RKYA 1HSTA 4L0YB 1R58A 2YX7A 4N0BA 2V79A 3L9FA 1SMTA 5ILUA 3IKVA 3U1DA 4HAMA 3VOEA 4UVBA 5DUIA 5E1ZB 4M9ZA 4A5NA 4Z2YA 1ZGAA 3KLNA 4KICA 4HV6A 2HQNA 2DAOA 3KP4A 3I4PA 3HHHA 4Q48A 2EA4A 3QP5A 2RNJA 4CZZA 1CF7A 1S3JA 1YQAA 2VE9A 1V4RA 2CSOA 1R22A 2DO7A 5FGMA 1MDMA 1SD6A 1O3RA 5D5UB 2O6GE 5HS7A 5BQTA 1BIBA 2IP2A 4GGGA 3SHFA 5HLHA 2EFPA 1LDJA 4RGXA 4U7DA 2P6SA 1XCBA 2QYOA 2RGVA 3LAJA 3LAPA 1XCVA 2W85A 3EETA 4ZH4F 4GO1A 2ZKZA 5IT9Z 1XGMA 2PI0A 2Q2EA 2VONA 4I0AA 3LA7A 3K1PA 3KFWX 3ISPA 1SD5A 1G6NA 1QPMA 4EGYA 1MJBA 5L3CA 5DUKA 3MZYA 4EMSA 5F1RA 2W25A 2HQRA 3TGNA 1SD7A 5D8KB 2Z5UA 4EM2A 3GX4X 3JSOA 1XMKA 2AS5F 2H09A 2E7XA 4HQEA 5D5VB 3H92A 4HLXA 2JSCA 2YPRA 4NHJA 5ICGA 1OMIA 5HLIA 2OD5A 4OIOF 3M1EA 2Z9OA 4A5MA 3J7AO 3SFZA 3ULQB 1DP7P 3I71A 3GLXA 4KIFA 4LK0F 4HA8A 2Q8KA 2IPQX 2ZCWA 2HZTA 3BPVA 4ZYEA 5CJ9A 2A69F 3KP2A 5HVQC 5BOXA 1S6LA 3RJPA 4RGRA 4OMYA 3M9AA 5LGUA 4H0EA 1R5HA 3WTYC 4AD9A 2KJCA 1QBJA 3NEUA 2RKHA 3U2RA 4G8XA 2V1XA 1G3YA 2LSOA 5E20A 4A2UA 5HDGA 5LEKA 5LLQA 2UXNA 1F1ZA 2Z3YA 1MZBA 4R1HA 3KEQA 2W84A 3CO6C 2GA2A 2JPCA 4D0PA 2GA1A 1FYLA 3E6CC 2NAZA 1RNLA 1SD4A 4HF2A 3I5UA 1B1BA 4R8HA 2RVCA 3F72A 3H3UA 4LG0B 2MLGA 5D5XB 5TRDA 3E5XA 2LKPA 3WODF 5LHGA 2XGXA 1ZG5A 4P9FA 2VC1A 2VBWA 5J8CA 3KE2A 2OZUA 1Z1DA 4M73A 1UHMA 1T98A 1TLHB 2DT5A 2MBFA 3K9TA 4EVIA 4KIBA 3RPUA 4M72A 4IF4A 5ERIA 1XGOA 2ZXJA 4YFXF 1PUEE 3TDZC 1MD0A 3HYIA 3HTSB 3SQNA 3M7GA 3F6VA 1FYMA 2MLKA 3EYYA 1J9IA 2FRHA 2QWWA 3DKWA 1QQIA 1DUXC 2EV5A 3FM3A 4IRHA 2BE5F 4L0ZB 2WC2A 4IXAA 4HZFA 5ED4A 1UB9A 3VFZA 1O7FA 3R61A 1ULYA 3U9GA 3WGGA 4Y13A 1R36A 1G3TA 2C6YA 2L3DA 3VEPA 1YYVA 4I02A 3FMRA 5HS8A 1TQMA 2F5FA 3P9KA 1H0MA 2Y48A 5H6RA 4A0ZA 2XV4S 4RS8A 5ILSA 2RV8A 1YW8A 3GUDA 3BJAA 1J2XA 4GCVA 2L4MA 1BI3A 2XIGA 2YU3A 2FSWA 4BQAA 4BH9A 1P4WA 1FBSA 1BM9A 3F8BA 3MFKA 3F8FA 1STZA 3DEUA 4I2OA 4UNOA 1LJ9A 4ETSA 3B02A 4G7OF 1IN6A 1LEAA 2RC4A 4WXDA 3CLOA 1U6GA 3FZVA 5CLSA 4HBLA 5TJJA 1IN5A 1YS7A 2DU9A 3F8CA 1D8JA 2DLLA 4IPAA 1FBQA 2XROA 2QBYB 1BI0A 3BZ6A 5KVRA 4ZZLA 5KK1A 1KQ0A 2NS0A 3WTVC 4EJWA 4GYIA 3GW2A 4HW0A 4R79A 1ZG1A 1ZG3A 5JFRA 5ICEA 1R7JA 2VN2A 3D0SA 1IXRC 1S7AA 1Z05A 4FHTA 2FEZA 1YW9A 1B4AA 3O3KA 2HTSA 4P5OA 1ZLKA 1MKMA 1FC3A 3KLOA 1TNSA 4ON0A 1KYWA 3FXUA 3KP7A 1MDMB 3ECHA 5JR3A 4BYYA 4LB6B 1BI1A 3QOPA 3CO7C 5L3DA 2NRAC 2E1CA 5EEGA 3E5UA 2W57A 4LFUA 1ZREA 5FO5A 1R1VA 4TV7A 2B0LA 3GXOA 2VXZA 2KKOA 4KMFA 2V6CA 2EV6A 3G73A 2KRFA 5L3BA 3HOTA 2X4HA 5JI6A 4WXCA 4AIJA 4U7BA 1O3TA 1REPC 4HX7A 5FLXZ 2QQ9A 2H27A 4WK8F 1B9MA 1X3UA 3EDPA 3KP6A 2ADUA 4CYDA 5K5QA 3D5LA 1J7KA 4HX4A 2MD5A 3WU0A 4DNCA 2FNAA 6PAXA 1EH8A 4LG0A 2R3SA 3SZTA 1DDNA 1WRJA 1OR7A 2QBYA 4IHSA 5DCMB 2K02A 1LDKB 2UZKA 2DQLA 2QQAA 3RYPA 1W5TA 1R5GA 5E8GA 1FPQA 2P8TA 2MA3A 1FLIA 4ENNA 2A3SA 5K5RA 3FXRA 5CVVA 3WE2A 1XMAA 4UXNA 4IRGA 3JTGA 2Y0MA 2EB7A 1FSEA 1A04A 5E17F 5DDGA 4CHUA 1KGSA 3SZPA 4PCQA 2QLZA 2ELHA 3ZMDA 5H20A 3F8NA 3IWFA 2CQKA 4YFNF 2R7DA 1KU9A 2KIMA 3V7RA 5D6EA 2ACJA 2BGCA 1O3QA 1BIAA 4YIIA 3KCCA 4A12A 1HBXG 1JXSA 2CG4A 3IRRA 3HTUA 3ZMVA 4ESBA 5E18F 2XAGA 1ZRDA 2M8EA 3O6BB 2VC0A 3HOSA 4HF1A 1IN4A 4B8XA 1ZGJA 1J75A 3VB2A 2D45A 2XVCA 4ESFA 1FBUA 3K69A 1G3SA 4M71A 2XAQA 1GXPA 4LB5A 4NB5A 2P7VB 5L3EA 3I59A 5E1XA 3IL2A 1ZN2A 4RB1A 2FQ3A 1Q1HA 3C18A 2FMYA 1HW1A 1JHHA 2Q0OA 3DPLC 4L5JA 4GYGA 4UV8A 4JK1X 3E97A 1B9NA 5HS9A 2OQRA 2Z99A 1U2WA 2ISZA 4ZYHA 3QPTA 1ZYRF 3E3VA 1HQCA 3O2PE 2EV0A 3K1MA 4O5VA 3JW4A 1IAWA 2DFIA 2VBXA 1IXCA 4EJUA 4M9SA 5FD6A 3L7WA 5AIPA 1U8RA 3BOQA 3KEOA 4ZYGA 4BAYA 2DW4A 5FD5A 5AIQA 3QPHA 4HV5A 3FF5A 2ISYA 4LLNA 5D6FA 1UCRA 5LHHA 1ON2A 3S2WA 3RYRA 2QQBA 3C3WA 3ML6A 4AIHA 2JZYA 2L54A 3E6BA 1S7OA 4EM0B 1PDNC 5BPDA 1J5YA 4MTEA 3LA3A 3REOA 2DPDA 5FFXA 3ZP5A 4NQWA 2AXLA 1P6RA 4O3MA 3C1DA 1F5TA 4JQFA 4HX8A 2VOOA 1W4MA 2NNYA 2RQPA 1QO0D 1HKSA 3ELKA 4G94A 2HYGD 2EJRA 5D5WB 2QVOA 1RUNA 3NRVA 3CTAA 3RI4A 4LLGF 2XKOA 1R1TA 5DV5A 5K5OA 2K4JA 2CW0F 1ZAOA 3J81Z 4WXHA 4I01A 4AIKA 1MJ9A 4EM1A 4XLPF 3K2ZA 1ZRCA 2LF7A 5LRRA 4WCGA 4EJOA 2F5EA 1BJAA 3DF8A 2HEOA 2YX4A 4A0XA 2VE8A 1I6XA 3T1BA 2DTRA 2OBPA 5HDNA 1I27A 4F7ZA 2O8XA 5LRSA 1G4DA 2CGPA 1FOKA 4OMZA 1LNWA 2O61A 5ILVA 1XB4A 2GXGA 1I1SA 5JHUA 3DPTA 5E1WA 4ENKA 2Z33A 1PP7U 1IW7F 1K78A 3FM5A 1XDSA 1IZ1A 5L3GA 1O3SA 4UV9A 1JHFA 2EWNA 2ZMEA 5IT3A 4OIQF 2QENA 1AOYA 1K79A 2ETHA 4MTDA 2QUFA 2P5VA 2XAJA 3MAJA 1NHAA 3R0AA 3DP7A 1H9TA 4G7HF 2YSRA 2XUBA 2HKXA 1LVAA 4UVCA 2PEXA 3T8TA 2A68F 4CO8A 4RGSA 3ECOA 3HSEA 3N97A 1YLFA 1GHCA 1XSXA 5CYVA 1ONVA 1FNNA 4I0BA 3P9CA 4KUMA 1LB2A 2HTJA 3Q9VA 4M9XA 1I1GA 2A6HF 1BOAA 3TO6A 4KDPA 3WTUC 3WG9A 4RAYA 2A61A 2K86A 3CUQA 2IW5A 4XBFA 2PFBA 4IJAA 2O3FA 1YTYA 3WTSC 5LBQA 1YIOA 5FFZA 3Q9SA 3HRTA 3PQKA 1H9GA 2DK5A 2PMHA 2HR3A 3WE3A 2ZJ2A 3F3XA 1IRGA 1P92A 1OKRA 1ON1A 2J5OA 3GFJA 1XDUA 4OIRF 3IKTA 5K1YA 2HYFA 1T0FA 3JSPA 3PFIA 4LGWA 4IRIA 3I53A 3BDDA 4N9HA 3M8FA 3DFGA 2PBIA 2VOPA 1WWXA 2IA1A 1T6SA 3ROUA 3R60A 3QU3A 4IHTA 4HOBA 1W5SA 3TO7A 1LEBA 4U0YA 3TOAA 1W7PB 1XGNA 1HSJA 5DCMA 1K6OA 3ZMZA 4HYEA 4G6DA 1V3FA 1TQPA 4MHGA 2G7HA 3QP6A 1BC8C 4G7ZF 4RGUA 3N4MA 3GFLA 1B6AA 2XKPA 1SFUA 3BROA 1IN8A 3KP3A 2J5PA 2G9WA 3LWFA 5ICFA 3RTRA 1P4XA 3IWZA 3HSRA 3TOBA 2P5LC 4OINF 4G9YA 5L3FA 2VBZA 3FMSA 2FU4A 5A2QZ 1W7PA 2P4WA 2HFHA 5F64A 3OOPA 2M1BA 4RB2C 1T39A 2XRNA 4KN7X 1QZYA 2ZFWA 2M87A 4EJVA 3P7NA 3FWEA 1QNTA 5IT9K 1JE8A 3I59B 4EQQA 1YS6A 1RIOH 4AWXB 2V1UA 3ZMUA 1YG2A 3ZMTA 1FZPB 1Z7UA 1FWZA 2WWYA 2UWMA 2CFXA 1BBYA 3LQQA 3H3ZA 4HQMA 1EH6A 2R7FA 5CVJA 4M6YA 4I7HA 3JAMK 1OYYA 4MQ9F 3T8RA 3F23A 3M8EA 1VTNC 1GXQA 4EJTA 5J8FA 4U0WA 1JGSA 2KIFA 2O0YA 3GYHX 2ESHA 2JT1A 2P5KA 3NQOA 1XSVA
chains in the Genus database with same CATH superfamily
1S29A 2E1NA 3LA2A 1GUUA 4M6XA 3AG4H 2ID3A 2A05A 4M3FA 4QLCU 3S14J 2GAUA 4A3BJ 3JRCA 1KONA 4N9IA 3AFHA 3JRIA 1SFEA 3WTZA 4S05A 2IA2A 2HZDA 4WF2A 4YELA 3B73A 4FX4A 1TNTA 2Y2ZA 2ZNZA 3TL4X 4BHPA 3TW7A 4CH7A 2CUJA 2OTJI 2I10A 1N77A 2FJ1A 2JPBA 3GCMA 3F21A 1IXSB 5BS6A 3HM5A 3K10A 4K2EA 3Q0WA 5HLGA 2FBIA 1R9TJ 4BBRJ 5A2QK 4UB6C 1YOVB 1LFPA 2CJJA 3FMQA 5HOOA 1G59A 4U87A 4KNYA 3GFIA 2JUGA 5CVIA 3LSTA 3E6DA 4FE4A 3BR2A 3AG2H 1Y0NA 4QWQA 4ITVA 1J0RA 1I5ZA 5IYCJ 3GTOJ 2OA4A 2ZO4A 1IUYA 1H8AC 4S04A 3OIQA 1HA8A 1EV7A 3CF2A 3KETA 4ZZDA 4A6DA 3MKLA 1GVJA 3LMMA 2G7UA 4B48A 1JI8A 1ZTRA 2LRDA 2DA6A 4O6JA 4BL0B 3I0TA 1P7IA 1U5TA 2VL8A 3CUQB 2EFWA 2H94A 2LF8A 3ABUA 5BMZA 2JA8J 2W48A 1KU3A 3RCOA 3HUGA 1JKPC 1A6QA 1DQUA 1OYWA 1RC9A 3J80Z 4L18B 4V2GA 5LGNA 4BGDA 2DPUA 2A6EF 1YRNB 1RI7A 1Y56A 2F4IA 2EH3A 4BHCA 1FOWA 4LJZF 4ZDPA 1MMAA 2VBYA 1JJ6C 4CGZA 1BOBA 1IF1A 3AG3H 2CH0A 3K4JA 4YG2F 4ZYDA 3G3ZA 4MEYF 3H3VK 1B59A 2ZJPF 5CPRB 2ME6A 2IT0A 2COBA 1S8NA 3TKYA 5B66C 4B3XA 4D5FA 3COAC 5HDKA 4YFKF 3CUOA 1F36A 4L5IA 1USSA 3L09A 1R71A 2VJ5A 4XQFA 3HOUJ 1WI9A 1D3YA 4M6VA 4RMNA 2V4JC 1VQ6I 1KU7A 3PUBA 3BG5A 1W36D 1RKWA 3HRUA 4RM3A 1TWHJ 2NVUB 4HLYA 3Q5FA 2NNNA 4JX4A 2OAZA 1HXDA 2VB6A 3DV8A 3KZZA 1TWGJ 3RDIA 2KDZA 1P4AA 3EQLF 3HOXJ 2ZXIA 2HWVA 2LVSA 2KIUA 4FQGA 3OYDA 1U78A 1ZRFA 1QGPA 3AAFA 4LIVA 1SAXA 2XGDA 1L0OC 3GVAA 3ZQLA 3FXLA 5M5YJ 5HNHA 3CJRB 2HI3A 4BEHB 3HL2A 3VYTB 2VJ4A 4XKBA 1T38A 1Z7LA 3EUAA 1WJBA 1EA3A 4LLLA 3FX3A 2EFNA 2BY0A 3ZOBA 1IJWC 1LVKA 5C4XJ 2LMDA 5E3OA 4MNUA 2ZBKA 2BOLA 3V8JA 5DM6F 1U3EM 1T8IA 4XSZF 1IN7A 2DA2A 2NOJB 3ZQ7A 3CUQC 1I3QJ 2HS5A 3B6CA 4GXOA 4BDZA 4BDYA 1S9HA 4C9YA 5J40A 1UHSA 3CCEI 3MEXA 4E7KA 2EFQA 1ETWA 4BHBA 2F4MB 1ZLJA 4MQVA 3GEZA 3ERED 2JWTA 3HOZJ 4MEXF 2ZMEB 5M5WJ 1ORKA 1UMQA 2FMLA 3GF2A 2XAFA 2DA7A 3SDBA 1FTTA 1MJAA 1U9OA 4A3MJ 1ETQA 1DP3A 1FSHA 2PMZA 5J3LA 3H5AA 4HF0A 5FLMJ 1XGSA 2BYVE 1I6HJ 5DEQA 2IGKA 2XHKA 3H5NA 5F04A 2XSDC 1K78B 1FYKA 4PK4A 2DBBA 3OYCA 2ESNA 2DI3A 5DD8A 2HDCA 1H89C 1YX5A 2VT3A 2E34A 3I58A 4HNVA 4ENMA 2FBHA 3EUHA 4KMUX 2RDPA 2XAUA 3CJNA 1KYZA 3DEEA 3M07A 2IS4A 1ZH5A 2R0QC 1XS9A 4M74A 4C3IJ 3E5QA 4OIPF 2VKHA 3OS1A 1AWCA 3R4KA 2VQGA 1ETXA 3LL7A 2LFBA 1ZARA 2DK8A 4KA4A 3TEDA 3PJRA 3RPQA 3S15J 1NTCA 3F6OA 1ENHA 1YO5C 4HDUA 2D1HA 4Y15A 1K7AA 2F2EA 2X0LA 5EGOA 1XN7A 3K0LA 2L4AA 1ODDA 1X19A 3CCYA 2VODA 1Z6TA 5GAHJ 3WU1B 2EZIA 3WTXC 3QU6A 5D4SA 3RIRA 3F22A 1TW2A 2W24A 1QZZA 2EK5A 4G6QA 5IOZA 3W2AA 1Z9CA 2XB0X 1U0JA 3IHUA 4FX0A 4E7ZA 4W97A 3ZPLA 1R1UA 4A6EA 5M3FJ 5GTIC 2IJLA 3OY9A 4OOIA 1AKHB 2LP0A 3BQYA 3V8LA 3QAHA 1OYIA 4PFOA 3I4NJ 3ZQGA 4I98B 3CF5F 2DXIA 3ZMSA 1HKTA 2GZWA 3ZQHA 3HRMA 3P5JA 1FX7A 3GTQJ 4WWCA 4LD5A 1IDZA 1KZHA 1OCOH 5LEJA 2FNPA 1BC7C 3B6AA 1UFMA 4ZDOA 4Q47A 1O57A 3IRQA 4PDKA 4CSWA 2Y0SN 4RLQA 5M3MJ 5ICCA 3SXYA 3CC4I 5LHIA 5DD4A 4ZYAA 4DZJA 4A3CJ 2AHQA 1WSUA 3W2WA 3G1MA 4YEJA 5JVTA 1Y0UA 3SEQA 2QM3A 2P7CB 1FP2A 2K40A 1PUFA 2IGOA 3DQVC 4BJ5C 4L5EA 2CO5A 2L02A 3IUOA 1CQTA 3K4CA 5J6XA 1IV8A 5LGTA 2PG4A 2XPUA 3MQ0A 1AKHA 4Q5SF 2LLKA 2YR2A 2D1VA 4MFEA 2JA5J 1T2KA 1SMYF 4RAZA 3K4NA 2V9VA 1SFXA 3OV8A 3RPUD 3W6KB 2CW8A 1H88C 2F5CA 4RAGA 1YIJI 1KQ9A 2O5RA 1BN5A 2IRFG 3QPLA 2OU2A 1HKQA 4F91B 3BR1A 1K6YA 4RB0A 4E7HA 2LG4A 5EEHA 1J59A 3BPXA 3DXJF 4NC6A 2A5WA 2O7OA 3OOUA 3FHZA 2STTA 2GWRA 2LNBA 4L9TA 2ELJA 1T95A 2FE3A 4MGRA 2ZJRF 1CF7B 2GXBA 3GTLJ 2EA2A 2KRHA 2LDUA 3HBLA 1FEXA 5D8LB 1A6IA 4L9VA 1ZK8A 1FP1D 3HPHA 2NVQJ 1L3LA 1F4KA 1U5TC 3CP8A 4HG2A 1GV2A 4DGWB 4OWRB 2BV6A 4AM3A 1P2FA 2YU9J 2XPVA 5FKKA 2L01A 1UHWA 3PSFA 3K1NA 2RN7A 1T0FC 3OSFA 2ZFUA 4KITB 3HSFA 3I54A 4M3BA 2HKOA 3JRFA 3TQNA 2G0EA 1D8KA 5M5XJ 2VASA 3M8JA 4KFCA 4F55A 2PN6A 4Y4RA 1B8IB 2K9NA 2VKVA 5DCFA 4BXFA 3WGHA 2JTVA 3GLLA 3HIFA 3GZ6A 1Z6RA 3CDHA 4KN4X 2M45A 2GOMA 4ASNA 5IOYA 3L2CA 3BP8A 4FETA 4DYCA 4G12A 1ITYA 2JRTA 5GPAA 2MC3A 1C0WA 3KP5A 1TW3A 2PJRA 2UXXA 1E0EA 3IV5A 2FOKA 1GLNA 3VPRA 1TTYA 3TO9A 4EV0A 2Y9ZA 2FA5A 1GV5A 4L9NA 2L9VA 2Y75A 2HDDA 3BY6A 5HNFA 3ZGKA 4BJTA 2XASA 1LFBA 2E35A 4B1RA 1JT6A 3LQRA 4ZDLA 2PQ8A 1XD7A 4XLNF 3HOWJ 1TBXA 5J47A 3L00A 2QZ8A 3K4KA 4IVNA 3NWSA 2KPMA 3WTTC 4JBAA 3KIOA 2HGCA 3K7AJ 2PMZN 2EIMH 3MWMA 3S1QJ 2XAHA 3H1CA 1X3ZB 3JTHA 4RB3C 1Z91A 2GQQA 3JR9A 1KQ8A 3BJOA 2FF4A 2TDXA 2L5QA 5IP7J 3ZN0A 2MYSA 2JK3A 2DQRA 1ZHFA 4YIFA 3GO5A 4CICA 3VSKA 3F8MA 3CMMA 4B09A 4LK1F 1YI2I 5F6FA 3HG9A 4ZTFA 2A07F 3TP3A 5EZHA 3I55I 1U5TB 3T5XA 3V7SA 3I64A 2H1KA 1TP4A 3IC7A 2YUSA 2CQQA 4P96A 4BXUA 2JQ7A 3MZHA 1AU7A 1G3WA 4OU0A 2E7WA 4PGGA 4PZJA 4BXXJ 2GIVA 1E2XA 4PGHA 1IG7A 3IH4A 1BW5A 1RUOA 2PLYA 4J01A 2V1DA 3LSIA 1HW5A 4B3AA 3WGIA 2BVMA 3BWGA 2OQGA 1I39A 2OZ6A 2HOSA 5F0FA 1XSDA 4FT8A 2WAFA 1R5ID 2LC2A 3R6SA 5K7ZA 3KYCB 1WJDA 4M3GA 1F9NA 2X6OA 4PJJA 3Q3SA 3RKXA 2MH2A 2FOWA 3VYSB 5DYMA 2VIXA 4X1EA 1HOMA 3J80K 2EZKA 3RKWA 3RQIA 3J81K 3WHCA 3BR0A 3L2RA 1WQ2A 2FQ4A 4FASD 2ZMEC 2R7WA 2CW7A 2H6CA 4XK4A 4XIDA 2CFOA 3R0JA 2X1DA 1EH7A 4U88A 4Y52J 1RZ4A 3T0YA 2COMA 2IVMA 4D7MA 5CVRA 3HC7A 4A3LJ 3ESWB 4PSXA 1LQ1A 5F27A 2CYYA 2PMUA 1B72B 1HCRA 1TQIA 2IA0A 2WV0A 1LDDA 1G2HA 1IDYA 2DT6A 2M5WA 4Y17A 4Q4ZF 2ZNYA 5FLXK 3BR5A 3PQJA 4DBQA 1JKOC 4ESJA 4A3JJ 1LKXA 4DQ2A 2JA7J 3FXQA 1VQ4I 2BBYA 2DFFA 4BY7J 4ENJA 3V8KA 1N75A 3M1CA 1OPCA 2BY1A 1IO2A 3HRSA 3PL8A 4P9UA 4PUSA 2K7LA 2PJPA 3W2VA 4NUBA 2LY1A 4WX9A 2R92J 2NYXA 3WTWC 1WKMA 3MCZA 4KT5C 4XONA 3BG3A 1K83J 5AONA 3O8HA 5E79C 2A5YB 4EGZA 5CQEA 1FT9A 4D9JA 2LYCA 4DZPA 4A93J 4U0VA 3VODA 4CXFA 2NVTJ 2KJBA 2DOAA 2FXAA 4E7LA 4UVAA 1D1CA 4XSXF 3OR2C 1KA8A 5F0HA 2D2WA 2X85A 1MGTA 2HOEA 5FB2A 2FBKA 4UHTA 3DTEA 1DU0A 4CDGA 3GTJJ 1DPRA 1R23A 4JYKA 2F5DA 4KYWA 2CWEA 3I56I 1Y39A 3A4CA 3HHGA 3DBRB 5FROA 4E7JA 3KZYA 4LMYA 3V7CA 1HW2A 3W6JB 2DT7B 5LFAA 3MKYB 1WH5A 2K27A 5CVUA 1IRFA 1UG2A 2CU7A 4IO9F 2K4BA 1FY7A 2W7NA 3C7JA 4PJMA 2K5CA 2O03A 3BCBA 1JUSA 1BR4A 4BQQA 4XKVA 4UUVA 5BPIA 4AVPA 1BW6A 3E6MA 1USTA 5D4RA 3E1SA 1PP8F 3DU6A 3LFKA 1NG7A 2MH9A 1CGPA 1SANA 1DPUA 3QRFF 5EDNA 3M3YJ 1W36C 2R5YA 2DA5A 2L7FP 3IAM2 3TDUC 1BI2A 1MNMC 2VT2A 2JA6J 1W7PD 4B4CA 2DOEA 5DS9A 4XRFA 3P9IA 4L9JA 4PJ0C 4ABZA 3V4GA 3BJ6A 3GWZA 3PFYA 5H6QA 1OLTA 3I3LA 1Z21A 5E8IA 1GT0C 4BNCA 3HKZN 5IYDJ 3V42A 1S7EA 4UB8C 1P7JA 4ZTJA 4JOMA 1W0UA 2K3FA 4A0YA 3EYIA 2NVXJ 4KJZA 2LKXA 4P55A 3UNGC 2K85A 3ZN1A 2IBDA 1D5VA 2ID6A 1YJNI 2QSHX 1MMGA 3LSPA 3GZ5A 2JJ7A 1O7LA 3OYJA 2WTEA 2HU9A 4HDVA 2BEOA 2M30A 2EFOA 3JAMZ 1K4TA 1SFOJ 1E17A 3ZRGA 3A1YA 1Y1WJ 1MH3A 2GXAA 4IHXA 3DTKA 1QHGA 1WJFA 3O8GA 2STWA 1R00A 1YW7A 1YFHA 2H6BA 2Y0SA 3GFMA 4E70A 4KIGA 4GFBA 3KYDB 5IY5H 4I09A 2HPMA 2P6TA 4W1UA 4BY1J 5FLVA 1KU2A 2DYRH 3ABTA 3RKYA 1HSTA 4L0YB 1R58A 2YX7A 4C3HJ 2CMPA 4N0BA 4BKXA 2V79A 3L9FA 2QEXI 1SMTA 1WJAA 5ILUA 1XG1A 3IKVA 3U1DA 4HAMA 1T56A 3VOEA 2VJJA 4UVBA 4PSWA 4HNUA 1Z0XA 5E1ZB 5DUIA 1V54H 4M9ZA 4A5NA 4Z2YA 4EEFG 4J19A 1ZGAA 3KLNA 2RREA 4IHVA 4KICA 2L9RA 3PIOF 4HV6A 2HQNA 2DAOA 3KP4A 4XLEA 2QKLB 3I4PA 1MSEC 3HHHA 4Q48A 3FHNA 3HGGA 1V55H 2EA4A 3QP5A 3GTMJ 1AA7A 3LFUA 2RNJA 4CZZA 1CF7A 1S3JA 1WI3A 1YQAA 2VE9A 1WZ2A 3D5SC 2KHMA 1V4RA 2L2OA 2CSOA 4BEHA 1R22A 1ZQ3P 4IHWA 2DO7A 5B3SH 5H2FC 1MH4A 2GBYA 4AUXA 5FGMA 1MDMA 3BTCA 1SD6A 1O3RA 5D5UB 2O6GE 3ZQCA 5HS7A 5BQTA 3HZJA 1EF4A 1BIBA 4GDFA 2IP2A 3UKGA 2HNHA 1D0ZA 3L2UA 1VQ7I 4GGGA 4F52A 3SHFA 5HLHA 2EFPA 3KX2A 5GPCA 4C30A 2X9DA 1LDJA 3MZ8A 4RGXA 4U7DA 2P6SA 5EG0A 1XCBA 2QYOA 3QYBA 3FXJA 2E1MB 2RGVA 3LAJA 3LAPA 2VLAA 3HJEA 1X1BA 1XCVA 3UR3C 2W85A 3EETA 3CQZJ 4ZH4F 3C2HA 2VQCA 4GO1A 3CCSI 2DMTA 3EPZA 2ZKZA 1OCRH 3ZQFA 5IT9Z 2Z1DA 1XGMA 1E3OC 2PJRB 2PI0A 4CA0A 2Q2EA 2WY8Q 2LY2A 4BE0A 2CQ7A 3N05A 2VONA 4I0AA 1VQNI 4XORA 3W6VA 4IQJA 2GOXB 4FISA 3LA7A 1OR7C 1JUPA 4LIUA 3H9QA 3K1PA 1SAUA 3ISPA 3KFWX 1LFUP 2HQ5A 3CMAI 1SD5A 3OYHA 1R49A 3U1KA 1G6NA 1QPMA 4EGYA 1MJBA 5L3CA 3SDGA 5DUKA 3CZ6A 2XB5A 3MZYA 2IXSA 4EMSA 5F1RA 2W25A 1ETVA 3ZCOA 3RKQA 2ZC2A 2HQRA 3TGNA 4CCMA 1JKQC 4Y33A 1SD7A 5D8KB 1TC3C 1FIPA 1MMDA 2Z5UA 3OIOA 2UUZA 4EM2A 3BQZA 3JSOA 3GX4X 1XMKA 3MKZA 3CCMI 2HVRA 2AS5F 2K9MA 5C3EJ 4IX7A 2BHZA 2QCOA 2H09A 3K4MA 3I9V2 5FRNA 2E7XA 4XLFA 5IP6A 4HQEA 3S2DJ 3S1MJ 2BXYA 4XLAA 2R7VA 2M9HA 5D5VB 2OCEA 4XLHA 3H92A 1OFCX 1QA6A 4FTHA 2VPRA 4HLXA 2JSCA 2YPRA 3S3MA 2JMWA 4NHJA 1YX3A 5ICGA 1BA5A 1OMIA 5HLIA 2W82A 1VZ0A 2K9SA 2OD5A 1RR8C 3BZKA 5IP9J 1D5YA 3DU5A 5F08A 4OIOF 4P1WA 3M1EA 2ELKA 2VXDA 4JX5A 4A5MA 3KEYA 3LSHA 3SFZA 3ULQB 4BQNA 2Z9OA 3J7AO 4NDLA 1DP7P 1XTAA 3I71A 4IOAF 3GLXA 4IEJA 4KIFA 4LK0F 4HA8A 3ZXSA 1LUJB 3BTJA 3D5RC 2Q8KA 5EF6A 2IPQX 4CCKA 1GDTA 2ZCWA 2HZTA 2F4OB 4XKWA 2VJIA 4IQ4A 3BPVA 2P81A 5DTDA 1MBKA 4H4KC 2VQLA 3IH2A 3BZCA 3J7ZI 4AC0A 4ZYEA 5CJ9A 1QVTA 2Y30A 2A69F 2KL4A 3KP2A 4F92B 1PYVA 2M0CA 3GTGJ 2X1EA 1ACIA 2M34A 5HVQC 5BOXA 1S6LA 3RJPA 1FMWA 4RGRA 3I4MJ 4OMYA 2TCTA 3M9AA 5LGUA 4XOTA 2E60A 4H0EA 1A31A 1R5HA 4JX6A 2HOAA 3QYFA 3H5RA 3WTYC 4AD9A 4E7IA 2P0WA 2KJCA 1JTXA 3NEUA 1QBJA 4C2UA 5FKMA 2AQFA 2RKHA 1X1PA 3U2RA 4G8XA 1IRZA 5DM7F 2V1XA 1X58A 1G3YA 1RKTA 2V7FA 2LSOA 5E20A 3TBIA 4A2UA 5HDGA 3GMEA 5LEKA 3KZIC 5LLQA 2UXNA 4HRIA 1Y8QB 2L7ZA 1F1ZA 2HXIA 2Z3YA 1MZBA 3DBLB 4R1HA 5B1BH 3KEQA 1PUFB 3DBHB 2W84A 3CO6C 2GA2A 2JPCA 4MFDA 3OYAA 1D1AA 3OYKA 4D0PA 2GA1A 3K70D 1FYLA 3LSMA 3OR1C 3AG1H 4PFPA 3E6CC 5EGOB 2NAZA 1RNLA 2BY3A 2KRCA 1SD4A 3A03A 4HF2A 3I5UA 1B1BA 3FISA 4R8HA 2RVCA 3F72A 3H3UA 3QODA 2V9PA 2MLGA 5D5XB 4LG0B 2K3PA 5FJ8J 5TRDA 2IGMA 2LKPA 1MMNA 3E5XA 3WODF 1SC7A 5LHGA 3TP0A 2RQQA 3OYGA 3OSGA 3TW6A 3H9GA 3KPHA 2XGXA 1ZG5A 3S93A 1X2MA 4P9FA 2BW3B 2VBWA 2VC1A 2HVQA 5J8CA 1Z3XA 2IEKA 3KE2A 4F93B 2OZUA 1Z1DA 2XC7A 4M73A 3FXKA 1UHMA 3CCRI 2VI6A 1T98A 1TLHB 2ZB9A 3H0GJ 2DT5A 4QPQA 1BJZA 2MBFA 3K9TA 4NQWB 4EVIA 4KIBA 2TRTA 3RPUA 4NC7A 4XKCA 4M72A 4IF4A 3KYLA 2R93J 5ERIA 1XGOA 3Q0UA 2ZXJA 4YFXF 3DPUA 1PUEE 4FE7A 2KLOA 1V5FA 1ZKGA 3TDZC 1MD0A 3HYIA 3HTSB 3SQNA 3M7GA 1IC8A 3F6VA 1ZELA 1FYMA 2MLKA 1B72A 5K7HA 3EYYA 4RBOA 1J9IA 2CQNA 2FRHA 2QWWA 3DKWA 1QQIA 2IGNA 1DUXC 2EV5A 2Y31A 3FM3A 4IRHA 4I99C 4OAZA 1K61A 2BE5F 1NH3A 2KFDA 2Y69H 4L0ZB 2WC2A 4IXAA 2KISA 4HZFA 5ED4A 2VQHA 1IV6A 1UB9A 3BTIA 4X0GA 1Z3YA 3VFZA 1O7FA 1JT0A 1S72I 1WFXA 3R61A 1ULYA 4I6ZA 4IOCF 2H8RA 1OCZH 4XN0A 1X3WB 3U9GA 3WGGA 4Y13A 1R36A 2MC4A 3J7YJ 1G3TA 2C6YA 3G1OA 4LITA 2L3DA 4AU7A 3VEPA 1RPWA 1YYVA 4I02A 4RA2A 3FMRA 4MO7A 5HS8A 1TQMA 1MBJA 2F5FA 3NWTA 3RSNA 4XLCA 3P9KA 1H0MA 2V1NA 2Y48A 1D0YA 1QZEA 3CP2A 5H6RA 4A0ZA 2LREA 2RAEA 2R7UA 2XV4S 4PJLA 4RS8A 2LBFB 1TWFJ 4CYCA 5ILSA 2RV8A 2M2EA 1YW8A 3GUDA 3BJAA 3OYLA 1J2XA 4XMYA 2KZVA 3ASOH 3LSJA 3F0CA 2RNGA 3CDLA 4GCVA 3JRHA 2IAIA 1B8IA 2L4MA 3NARA 1BI3A 2XIGA 3IH3A 4OAYA 2YU3A 2M8GX 2F6CA 1YJ9I 2FSWA 4BQAA 1WJ5A 4BH9A 3CMEI 1P4WA 1FBSA 4C2MJ 1BM9A 3F8BA 3MFKA 1LE8B 2E1MC 3H9JA 3F8FA 1SVLA 3K2AA 2ZSIB 4XICA 3OYNA 1YE9A 2K9QA 2LBFA 4XNFA 1STZA 3DEUA 4I2OA 4UNOA 1LJ9A 4ETSA 3B02A 4G7OF 1IN6A 3VDXA 2DA3A 1LEAA 2RC4A 4WXDA 3OYIA 3CLOA 1U6GA 3FZVA 5CLSA 4HBLA 3S8PA 2BZTA 3JCUC 2XDVA 2X51A 5TJJA 1V5GA 5FKLA 1IN5A 1YS7A 2DU9A 3F8CA 4CCNA 4RDUA 2HVSA 2LK2A 1D8JA 3CCJI 1S5LC 2DLLA 2ME0A 2XGCA 4IPAA 2CRGA 4EATA 2ZXWH 1FBQA 3W3CA 2XROA 2QBYB 1UG0A 1X1CA 1BI0A 3BZ6A 5KVRA 4ZZLA 5KK1A 1KQ0A 2QQ8A 2VPLA 3E0JB 1MNEA 2R7RA 2NS0A 5CQGA 3WTVC 2R5ZA 4EJWA 4GYIA 3GW2A 2E71A 4CZCA 1EKEA 4HW0A 3CMYA 1VQ8I 2BXZA 4R79A 1ZG1A 1UJ8A 1ZG3A 2H1LA 2MD0A 1AHDP 5JFRA 1XPXA 5ICEA 1R7JA 1VF9A 2M4GA 2VN2A 3D0SA 1IXRC 1S7AA 1PJRA 2VKEA 2GM4A 1Z05A 4FHTA 2FEZA 1TWAJ 1YW9A 2CUFA 2FUG2 1B4AA 2ZXHA 2OUMA 3O3KA 2HTSA 4P5OA 2L0KA 2R7OA 2NXNB 1SEUA 1ZLKA 1MKMA 1FC3A 2CUEA 1TNSA 3KLOA 3PM1A 4ON0A 1KYWA 3FXUA 2Z2SB 2EIJH 3ABKH 2GIZA 3ERMA 3KP7A 1MDMB 3ECHA 3PO2J 2VUMJ 2FX0A 1SVOA 5JR3A 4BYYA 2NS7A 2JRMA 4LB6B 1QVUA 3GTKJ 1BI1A 3HGYA 3QOPA 2F48A 4A3EJ 1X4OA 1BL0A 2OTLI 2WY7Q 3CO7C 2OC6A 5L3DA 2NRAC 2LTPA 2DFEA 2QKMB 1DGRM 2CS3A 2ZJQF 3OYFA 2E1CA 2E36A 2VKDA 5EEGA 5TGTA 4XRSG 3E5UA 2DA4A 5E3LA 2W57A 4LFUA 4D1QA 1WJEA 1ZREA 2I5UA 5FO5A 1R1VA 4TV7A 1VQPI 2B0LA 3RZDJ 3GXOA 3TMOA 2ECCA 2L9NA 2VXZA 2KKOA 3QPSA 3VWBA 3IP4B 4KMFA 5KNLA 4UY8I 4UUSA 1NK2P 2V6CA 2EV6A 3G73A 2KRFA 5L3BA 3L2QA 3HOTA 4AYBN 2X4HA 5JI6A 2DJNA 1P9QC 4WXCA 1HDPA 4NBQA 4AIJA 4GRIA 4U7BA 5EZGA 1O3TA 3AL0B 2WADA 3VSLA 4A3DJ 1WVRA 1TT0A 1REPC 4HX7A 5FLXZ 1A5JA 2QQ9A 1TZLA 2Z16A 2H27A 4WK8F 1B9MA 3CDIA 4XL9A 1X3UA 5JHFA 1MW7A 3OYBA 3EDPA 3KP6A 2R7SA 2WV1A 2ADUA 4CYDA 3PUFA 3JRBA 2EZHA 5K5QA 3HDDA 3D5LA 1J7KA 4HX4A 2MD5A 3WU0A 3SJMA 5FKOA 4BS9A 4DNCA 2FNAA 6PAXA 1EH8A 4LG0A 2R3SA 3SZTA 1DDNA 2WA0A 1WRJA 1OR7A 2QBYA 4IHSA 5DCMB 2K02A 5EG0B 4YIRX 3ABMH 1LDKB 1X4PA 3A02A 1VI0A 4DW6A 2UZKA 3H36A 5F0CA 3HKZA 2DQLA 2HQAA 2QQAA 2ZSHB 3RYPA 3L1PA 1W5TA 2DTZA 1R5GA 5E8GA 4ZJZA 2BW3A 1FPQA 2P8TA 2IS1A 2MA3A 4M3EA 2XGEA 4ENNA 1FLIA 4D5CA 2DMQA 5KHDA 2AQEA 2A3SA 4DYRA 5K5RA 3FXRA 3PSIA 4NC8A 5CVVA 3CCVI 3WE2A 1XMAA 3QYEA 2M7BA 2W1OA 4UXNA 4I76A 4IRGA 3JTGA 1BR2A 3CCQI 1ETKA 2Y0MA 3S17J 2EB7A 1FSEA 2WAEA 1A04A 4MIMA 4QIWN 4BJ6C 3A01B 3S3OA 2R7XA 5E17F 3A0BC 5DDGA 4LG3A 2H8WA 2KQRA 2Q2EB 3BG6A 3ZQIA 3HUGB 4CHUA 3JRAA 1FOYA 1KGSA 1VNDA 3SZPA 1X1AA 1RETA 4PCQA 1XC5A 2AXTC 5EYRA 2BHYA 2QLZA 2ELHA 3ZMDA 1I50J 1FTZA 1UZCA 2Y9YA 5H20A 3F8NA 2DDAA 3IWFA 2NOGA 2XF6A 5BNGA 2CQKA 4YFNF 3F9KA 2R7DA 1KU9A 1V5EA 1ZR4A 1ZR2A 2KIMA 3V7RA 1N25A 4A69C 2EINH 3S1RJ 2DMUA 2AO9A 5D6EA 1TWCJ 1JGGA 3A0HC 2ACJA 2X6XA 2KMUA 2BGCA 3ABLH 4N4OB 3HOVJ 1O3QA 1BIAA 1BR1A 2EBIA 4RM2A 4YIIA 2A6TA 5LD2C 3EUHC 1QHHD 3KCCA 4HEA2 5J1UA 2OV7A 4NNJA 5E3NA 4A12A 1HBXG 2CG4A 1YHQI 1JXSA 4IL6C 3IRRA 1Q1VA 3HTUA 3ZMVA 4ESBA 1JUMA 5E18F 2XAGA 1ZRDA 3K4BA 2M8EA 3O6BB 2VC0A 3HOSA 4HF1A 4DBRA 1IN4A 4KT6A 4B8XA 1NG6A 1ZGJA 2X1CA 1J75A 3FKJA 3VB2A 2D45A 3CCUI 4X6AJ 2F5VA 2XVCA 4ESFA 3SFIA 1FBUA 2IS6A 3K69A 3BG9A 1G3SA 1VFCA 4M71A 1IUFA 2XAQA 1GXPA 3DTIA 2HDWA 4LB5A 4NB5A 2P7VB 1GVDA 5HLTA 3A2KA 4XN3A 3BG7A 1I3AA 5L3EA 3VYUB 2Q1ZB 3I59A 5E1XA 3IL2A 2LY9A 1ZN2A 4RB1A 1UELB 1Q1HA 2FQ3A 3FK7A 3C18A 2E5NA 2DOFA 4G6TB 4CCOA 2FMYA 1HW1A 1JHHA 2Q0OA 3DPLC 3OL4A 4L5JA 5TISC 4GYGA 4FCYA 1RRJA 1Z77A 4UV8A 5C44J 2MW8A 3AKZA 4JK1X 3E97A 4Y7NJ 1U8BA 1B9NA 2B7EA 1JJ8C 1D0XA 1MBGA 5HS9A 4ANJA 1HF0A 2OCCH 3L2VA 2OQRA 2Z99A 3HPGA 4QTRA 3PIPF 1U2WA 3RQ4A 4BU2A 2ISZA 4ZYHA 2JVGA 3QPTA 3GZNB 1ZYRF 3OL3A 2EILH 3E3VA 1HQCA 3O2PE 2EV0A 2DMPA 3K1MA 1VQMI 4HPQA 2O8KA 4O5VA 2E5ZA 3JW4A 1IAWA 2DFIA 4BE1A 3ASNH 2VBXA 1IXCA 2HOTA 4EJUA 2XRLA 4M9SA 5FD6A 3L7WA 5AIPA 1U8RA 1FJLA 1MSFC 3VYRB 3NAUA 3BOQA 3KEOA 4ZYGA 4BAYA 2B63J 3U21A 2DW4A 1T33A 5FD5A 3QPHA 5AIQA 4HV5A 3G6EI 3FF5A 2ISYA 4LLNA 2DA1A 5D6FA 2KDOA 2X48A 1J09A 1UCRA 5LHHA 3MD2A 2M7AA 4RAFA 1ON2A 2WBMA 3S2WA 3RYRA 1WH7A 2QQBA 3C3WA 3ML6A 2LKSA 4AIHA 2JZYA 1OCPA 3QOEA 2L54A 1TT5B 2XSJC 3E6BA 1S7OA 4EM0B 1PDNC 2OPTA 2LD5A 5BPDA 4IZZA 1J5YA 4MTEA 1IRXA 3LA3A 3REOA 3J7AY 1X2NA 2B9SA 1Y1VJ 5GADJ 1HC8A 3CESA 2DPDA 3LOCA 5FFXA 3MMYB 3ZP5A 2LOOA 3D1NI 4NQWA 5GP9A 2AXLA 1P6RA 4O3MA 2X6YA 3PNTA 2BY2A 3C1DA 1F5TA 3QQAA 4JQFA 5J4YA 4RLFA 4E6KG 4HX8A 4B47A 2VOOA 2I8DA 2HPIA 1U9NA 1MBHA 2ECBA 1R4NB 2GLOA 1W4MA 1PVEA 2NNYA 2RQPA 1QO0D 1HKSA 3JRGA 4HNTA 2JSPA 4V2FA 1Z67A 3ELKA 4G94A 2HYGD 5GAEJ 1OJLA 2EJRA 3DLLF 5D5WB 4CYCB 2O9LA 2QVOA 1RUNA 4ZC3A 3H35A 3NRVA 3CTAA 1OCCH 5B5EC 3RI4A 5GTHC 4LLGF 2XKOA 1R1TA 5KCMA 5DV5A 5JLXA 5CKTA 5K5OA 3PNYA 1TL8A 2K4JA 2CW0F 3CJQB 4BE2A 2QF7A 1ZAOA 4QPOA 2XF7A 3HXLA 3OMYA 2V9KA 1Y6IA 3J81Z 2JA2A 3SEZA 4WXHA 4I01A 3LSRA 1ETOA 4S0HB 4AIKA 4BUPA 2DFHA 2L7KA 1MJ9A 1HDDC 4EM1A 3K6GA 4XLPF 5F1JA 2QA4I 3K2ZA 1ZRCA 2LF7A 4PJNA 3S3NA 5LRRA 1YRNA 4WCGA 2EZLA 1VQ5I 4A3FJ 1MBEA 4EJOA 2F5EA 5B1AH 3DKXA 4CCLA 1BJAA 2LH9A 3DF8A 2MSYA 4Z6YA 2HEOA 3CC2I 2X6WA 4HSRA 2DODA 2YX4A 3WG7H 4A0XA 2EQRA 3PNVA 3EUKL 3OYEA 5KAFC 2VE8A 5J1YA 4AVZA 1I6XA 3T1BA 5HODA 3L2WA 4AIDA 3AL0C 2DTRA 3BT9A 3FIWA 2QSGX 2E2HJ 2OBPA 5HDNA 2HYJA 2BVLA 1I27A 4F7ZA 2O8XA 5JLWA 3Q0VA 4DYQA 2QGUA 5LRSA 2L9SA 1G4DA 2DYSH 2CGPA 4HSTA 5EEAA 1RR7A 1FOKA 4OMZA 1LNWA 2R7TA 2MFZA 4UUTA 3S16J 2O61A 3HOYJ 1FMVA 3WHBA 1E3HA 5ILVA 1XB4A 2GXGA 2WB1A 1I1SA 5JHUA 3DPTA 2E19A 5E1WA 4ENKA 4XRSA 2Z33A 4DOZA 1QPIA 3G2BA 3K70C 5IYBJ 1PP7U 1IW7F 3OS2A 3BLYA 1D1BA 1SFKA 1K78A 2W00A 3FM5A 2M3AA 3DCFA 1XDSA 2WAQA 2JN6A 1IZ1A 5FKNA 1W1WE 5L3GA 1O3SA 4UV9A 1JHFA 4V19K 2EWNA 2ZMEA 5IT3A 4OIQF 2CV0A 3G4SI 2QENA 1AOYA 1K79A 1WCMJ 1LE8A 5FRMA 2ETHA 4MTDA 1DU6A 4F3QA 3BR6A 1QU3A 4M3DA 2QUFA 2P5VA 2XAJA 3M4OJ 3MAJA 2M4KA 1NHAA 1YITI 3R0AA 1T08B 3DP7A 2KIQA 5E3MA 2LR8A 1H9TA 4G7HF 2YSRA 2XUBA 2HKXA 1R6RA 1LVAA 2M0MA 4UVCA 1MBFA 3G71I 2PEXA 2JUCA 1WGXA 3T8TA 2A68F 4CO8A 4RGSA 1FOXA 4C2TA 3ECOA 3HSEA 1Y8RB 3N97A 1YLFA 3JRDA 2WB1N 1GHCA 1MIJA 1XSXA 2PX9A 2V6EA 5CYVA 1ONVA 2EPFA 1FNNA 2DCEA 1OISA 2KZGA 4I0BA 3P9CA 1XMXA 3DLAA 4KUMA 1ETYA 2IS2A 2MGQA 1LB2A 2HTJA 3FBIB 1EJ9A 3Q9VA 4M9XA 1I1GA 3BR3A 2NVYJ 2A6HF 2DMNA 1NK3P 1BOAA 4II3A 2OJED 3TO6A 4KDPA 2V26A 3WTUC 3WG9A 4XR6A 3CCLI 4RAYA 2QSFX 1VQLI 3OWTA 2XPWA 4MLOA 4A3IJ 2A61A 2K86A 3CUQA 2IW5A 4XBFA 4XRMA 2PFBA 3A01A 3OS0A 1JTYA 1X1DA 4IJAA 3OYMA 2O3FA 1YJWI 1FIAA 3G1LA 3H0DA 1YTYA 3WTSC 5LBQA 1WPKA 1QRYA 1YIOA 5FFZA 3SZGA 3Q9SA 1M1EB 3HRTA 3PQKA 1H9GA 2CUZA 2DK5A 2R5ZB 4IHYA 2PMHA 2HR3A 2FD5A 2JVHA 3WE3A 2ZJ2A 3F3XA 3FK6A 4BACA 1IGNA 4B43A 1IRGA 1P92A 1OKRA 1RESA 1O4XA 1ON1A 2J5OA 3GFJA 4A3GJ 1XDUA 3DWLE 4OIRF 4BQOA 3IKTA 3RZOJ 5K1YA 3FBNB 2HYFA 4A3KJ 3GBGA 3S32A 1T0FA 3JSPA 3PFIA 4LGWA 4DJAA 4LOCA 4IRIA 2CV1A 4CUGA 3I53A 2E2JJ 3BDDA 5J4VA 4N9HA 3DEWA 1DGWY 5J1RA 3M8FA 3DFGA 2PBIA 2VOPA 1POGA 1WWXA 1XX5A 2IA1A 1T6SA 3DKYA 3ROUA 3R60A 3E7LA 2MG4A 3QU3A 4HOBA 4IHTA 1JKRC 1W5SA 2OF7A 3TO7A 1LEBA 2HXOA 4U0YA 3TOAA 1MMSA 1W7PB 1WJCA 1XGNA 1HSJA 5DCMA 1ERDA 1K6OA 3ZMZA 4HYEA 3SYTA 3LSGA 4G6DA 5GAGJ 1V3FA 4II2A 1TQPA 3FKIJ 4MHGA 5KAIC 2G7HA 3PO3J 4N4NB 2D5VA 3QP6A 1BC8C 4G7ZF 4RGUA 3N4MA 2R4GA 4IKFA 1A36A 3ONQA 3GFLA 4UUSB 1B6AA 2K9LA 2XKPA 1SFUA 4BBSJ 1ZGWA 3BROA 1IN8A 1W0TA 5JVGF 3KP3A 2J5PA 3MKWB 2G9WA 3LWFA 5EJCA 5ICFA 3RTRA 3S2HJ 4KISA 1P4XA 2L7MP 2W4SA 3IWZA 4JP0A 3WU2C 3HSRA 3TOBA 4CCJA 2P5LC 3HB9A 3QWLA 2EIKH 4OINF 2N8GA 4G9YA 1VQKI 5L3FA 3CJTB 2VBZA 3FMSA 2FU4A 1G8XA 5A2QZ 2R7ZJ 1W7PA 2P4WA 2HFHA 5F64A 3OOPA 2M1BA 4C3JJ 2MABA 3CLQA 2CV2A 2R7QA 4RB2C 1R4MB 1T39A 2XRNA 2E1OA 4KN7X 1QZYA 2ZFWA 3HEFA 3LNQA 2M87A 3C2BA 1K4SA 3FXOA 2ICWG 4EJVA 2DDBA 1HLVA 3LSKA 3P7NA 3FWEA 1QNTA 1VQ9I 2NS8A 4XM3A 5IT9K 4E4HA 1JE8A 3I59B 2DJIA 4EQQA 3MN2A 1VQOI 1YS6A 1RIOH 4XOPA 3GTPJ 4AWXB 1W5CC 5C4JJ 3MVPA 1WHUA 2V1UA 2KP6A 1A35A 3ZMUA 1YG2A 3ZMTA 1FZPB 4J00A 3BCAA 1SVMA 3FXMA 1Z7UA 1FWZA 2R5YB 1N78A 2WWYA 2UWMA 2CFXA 1BBYA 4E7SA 1OCTC 1LPQA 3LQQA 3X2QH 3H3ZA 4HQMA 3C2GA 4DIQA 4B44A 1E3PA 3ZR8X 1EH6A 2R7FA 5CVJA 4M6YA 2CQXA 4I7HA 3JAMK 1OYYA 2E2IJ 1OQYA 4Y3OA 3ZQQA 3JREA 4QSHA 4MQ9F 4D7NA 2KT0A 3T8RA 2DN0A 3F23A 3M8EA 1VTNC 2WAQN 2UV1A 3IAS2 3BTLA 4YRVA 1F43A 3S1NJ 9ANTA 1MNDA 1GXQA 3OIPA 4EJTA 3K4LA 5J8FA 4U0WA 2XF5A 1JGSA 3BC8A 5IPAA 2YS9A 4AYBA 3CC7I 2KIFA 3FDYA 2O0YA 3GYHX 1APLC 1UAAA 5K7FA 2ESHA 2JT1A 2P5KA 3NQOA 3CD6I 1XSVA
chains in the Genus database with same CATH topology
1S29A 2E1NA 3LA2A 4M6XA 4QLCU 2GAUA 4N9IA 1SFEA 3WTZA 4S05A 2IA2A 4WF2A 3B73A 4FX4A 1TNTA 2ZNZA 4BHPA 2JPBA 3F21A 1IXSB 5BS6A 4K2EA 5HLGA 2FBIA 5A2QK 3FMQA 5HOOA 4KNYA 3GFIA 5CVIA 3LSTA 3E6DA 4QWQA 1J0RA 1I5ZA 2OA4A 2ZO4A 1IUYA 4S04A 1EV7A 3KETA 4ZZDA 4A6DA 1GVJA 2G7UA 4O6JA 3I0TA 1U5TA 3CUQB 2EFWA 2H94A 2LF8A 3ABUA 5BMZA 1KU3A 3HUGA 1OYWA 3J80Z 4L18B 5LGNA 2DPUA 2A6EF 1RI7A 4BHCA 4LJZF 2VBYA 4CGZA 1IF1A 4ZYDA 4YG2F 3G3ZA 4MEYF 1B59A 2IT0A 1S8NA 3TKYA 3COAC 5HDKA 4YFKF 3CUOA 4L5IA 1USSA 3L09A 1WI9A 1D3YA 1KU7A 3HRUA 4HLYA 3Q5FA 2NNNA 2OAZA 1HXDA 3DV8A 3KZZA 3RDIA 1P4AA 3EQLF 2HWVA 2KIUA 1U78A 1ZRFA 1QGPA 3AAFA 1SAXA 1L0OC 3GVAA 1T38A 4LLLA 3FX3A 2EFNA 4MNUA 2ZBKA 3V8JA 1U3EM 4XSZF 1IN7A 3ZQ7A 3CUQC 2HS5A 4GXOA 3MEXA 2EFQA 4BHBA 1ZLJA 4MQVA 3GEZA 3ERED 4MEXF 2ZMEB 2FMLA 2XAFA 3GF2A 1MJAA 1FSHA 4HF0A 1XGSA 2BYVE 5DEQA 2XHKA 1K78B 1FYKA 2DBBA 2ESNA 2DI3A 5DD8A 2HDCA 2VT3A 3I58A 4ENMA 2FBHA 3EUHA 4KMUX 2RDPA 3CJNA 1KYZA 1ZH5A 4M74A 3E5QA 4OIPF 1AWCA 3R4KA 1ZARA 2DK8A 4KA4A 3RPQA 3F6OA 1YO5C 4HDUA 2D1HA 4Y15A 1K7AA 2F2EA 2X0LA 1XN7A 3K0LA 2L4AA 1ODDA 2VODA 1Z6TA 3WU1B 3WTXC 3QU6A 5D4SA 3RIRA 3F22A 1TW2A 2W24A 1QZZA 2EK5A 4G6QA 1Z9CA 4FX0A 3IHUA 3ZPLA 1R1UA 4A6EA 2IJLA 4OOIA 3V8LA 3QAHA 1OYIA 4I98B 3ZMSA 1HKTA 2GZWA 3HRMA 1FX7A 4WWCA 4LD5A 5LEJA 2FNPA 1BC7C 1UFMA 4Q47A 1O57A 3IRQA 4PDKA 5ICCA 3SXYA 5LHIA 5DD4A 1WSUA 5JVTA 1Y0UA 2QM3A 2P7CB 1FP2A 3DQVC 2CO5A 2L02A 5J6XA 5LGTA 2PG4A 3MQ0A 4Q5SF 2YR2A 2D1VA 1T2KA 1SMYF 4RAZA 2V9VA 1SFXA 3OV8A 3W6KB 2F5CA 1KQ9A 1BN5A 2IRFG 2OU2A 1HKQA 4RB0A 5EEHA 1J59A 3BPXA 3DXJF 3FHZA 2STTA 2GWRA 2LNBA 4L9TA 2FE3A 4MGRA 1CF7B 2GXBA 2EA2A 2LDUA 5D8LB 4L9VA 1FP1D 1L3LA 1F4KA 1U5TC 2BV6A 1P2FA 2L01A 1UHWA 3K1NA 2RN7A 3HSFA 3I54A 2HKOA 3TQNA 1D8KA 4KFCA 2PN6A 5DCFA 3WGHA 2JTVA 3HIFA 3GZ6A 1Z6RA 3CDHA 4KN4X 2M45A 4ASNA 3L2CA 3BP8A 2JRTA 2MC3A 1C0WA 3KP5A 1TW3A 2UXXA 2FOKA 4EV0A 1TTYA 3TO9A 2FA5A 4L9NA 2Y75A 3BY6A 2XASA 3LQRA 2PQ8A 1XD7A 4XLNF 1TBXA 3L00A 2QZ8A 4IVNA 3WTTC 4JBAA 2HGCA 3MWMA 2XAHA 3JTHA 4RB3C 1Z91A 2GQQA 1KQ8A 3BJOA 2FF4A 2TDXA 3ZN0A 2DQRA 1ZHFA 4YIFA 3GO5A 4CICA 4B09A 3F8MA 4LK1F 5F6FA 2A07F 1U5TB 3T5XA 3V7SA 3I64A 3IC7A 4P96A 4BXUA 3MZHA 1G3WA 4OU0A 2E7WA 4PGGA 4PZJA 2GIVA 1E2XA 4PGHA 1RUOA 2PLYA 2V1DA 3WGIA 1HW5A 3BWGA 2OQGA 2OZ6A 1XSDA 4FT8A 3R6SA 1F9NA 3RKXA 2MH2A 5DYMA 3J80K 3RKWA 3J81K 1WQ2A 2H6CA 3R0JA 1EH7A 4U88A 1RZ4A 3T0YA 2COMA 2IVMA 5CVRA 1LQ1A 2CYYA 2PMUA 1TQIA 2IA0A 2WV0A 1LDDA 2M5WA 4Y17A 4Q4ZF 2ZNYA 5FLXK 3PQJA 4ESJA 4DQ2A 3FXQA 2BBYA 4ENJA 3V8KA 1OPCA 3HRSA 4P9UA 2K7LA 2PJPA 4WX9A 2NYXA 3WTWC 1WKMA 3MCZA 4KT5C 5AONA 2A5YB 4EGZA 1FT9A 4U0VA 3VODA 4CXFA 2KJBA 2FXAA 4UVAA 4XSXF 1KA8A 2D2WA 1MGTA 2HOEA 5FB2A 2FBKA 4UHTA 4CDGA 1DPRA 1R23A 2F5DA 4KYWA 2CWEA 3HHGA 3KZYA 4LMYA 3V7CA 1HW2A 3W6JB 2K27A 5CVUA 1IRFA 2K4BA 1FY7A 3C7JA 2O03A 4UUVA 5BPIA 4AVPA 3E6MA 1USTA 5D4RA 1PP8F 3LFKA 2MH9A 1CGPA 1DPUA 3QRFF 3TDUC 1BI2A 2VT2A 1W7PD 4XRFA 3P9IA 4L9JA 3V4GA 3BJ6A 3GWZA 5H6QA 4BNCA 5E8IA 4A0YA 3EYIA 4P55A 3ZN1A 1D5VA 3GZ5A 1O7LA 2WTEA 4HDVA 2BEOA 2M30A 2EFOA 3JAMZ 1E17A 2STWA 1R00A 1YW7A 1YFHA 2H6BA 3GFMA 4E70A 4KIGA 4I09A 2P6TA 1KU2A 3ABTA 3RKYA 1HSTA 4L0YB 1R58A 2YX7A 4N0BA 2V79A 3L9FA 1SMTA 5ILUA 3IKVA 3U1DA 4HAMA 3VOEA 4UVBA 5DUIA 5E1ZB 4M9ZA 4A5NA 4Z2YA 1ZGAA 3KLNA 4KICA 4HV6A 2HQNA 2DAOA 3KP4A 3I4PA 3HHHA 4Q48A 2EA4A 3QP5A 2RNJA 4CZZA 1CF7A 1S3JA 1YQAA 2VE9A 1V4RA 2CSOA 1R22A 2DO7A 5FGMA 1MDMA 1SD6A 1O3RA 5D5UB 2O6GE 5HS7A 5BQTA 1BIBA 2IP2A 4GGGA 3SHFA 5HLHA 2EFPA 1LDJA 4RGXA 4U7DA 2P6SA 1XCBA 2QYOA 2RGVA 3LAJA 3LAPA 1XCVA 2W85A 3EETA 4ZH4F 4GO1A 2ZKZA 5IT9Z 1XGMA 2PI0A 2Q2EA 2VONA 4I0AA 3LA7A 3K1PA 3KFWX 3ISPA 1SD5A 1G6NA 1QPMA 4EGYA 1MJBA 5L3CA 5DUKA 3MZYA 4EMSA 5F1RA 2W25A 2HQRA 3TGNA 1SD7A 5D8KB 2Z5UA 4EM2A 3GX4X 3JSOA 1XMKA 2AS5F 2H09A 2E7XA 4HQEA 5D5VB 3H92A 4HLXA 2JSCA 2YPRA 4NHJA 5ICGA 1OMIA 5HLIA 2OD5A 4OIOF 3M1EA 2Z9OA 4A5MA 3J7AO 3SFZA 3ULQB 1DP7P 3I71A 3GLXA 4KIFA 4LK0F 4HA8A 2Q8KA 2IPQX 2ZCWA 2HZTA 3BPVA 4ZYEA 5CJ9A 2A69F 3KP2A 5HVQC 5BOXA 1S6LA 3RJPA 4RGRA 4OMYA 3M9AA 5LGUA 4H0EA 1R5HA 3WTYC 4AD9A 2KJCA 1QBJA 3NEUA 2RKHA 3U2RA 4G8XA 2V1XA 1G3YA 2LSOA 5E20A 4A2UA 5HDGA 5LEKA 5LLQA 2UXNA 1F1ZA 2Z3YA 1MZBA 4R1HA 3KEQA 2W84A 3CO6C 2GA2A 2JPCA 4D0PA 2GA1A 1FYLA 3E6CC 2NAZA 1RNLA 1SD4A 4HF2A 3I5UA 1B1BA 4R8HA 2RVCA 3F72A 3H3UA 4LG0B 2MLGA 5D5XB 5TRDA 3E5XA 2LKPA 3WODF 5LHGA 2XGXA 1ZG5A 4P9FA 2VC1A 2VBWA 5J8CA 3KE2A 2OZUA 1Z1DA 4M73A 1UHMA 1T98A 1TLHB 2DT5A 2MBFA 3K9TA 4EVIA 4KIBA 3RPUA 4M72A 4IF4A 5ERIA 1XGOA 2ZXJA 4YFXF 1PUEE 3TDZC 1MD0A 3HYIA 3HTSB 3SQNA 3M7GA 3F6VA 1FYMA 2MLKA 3EYYA 1J9IA 2FRHA 2QWWA 3DKWA 1QQIA 1DUXC 2EV5A 3FM3A 4IRHA 2BE5F 4L0ZB 2WC2A 4IXAA 4HZFA 5ED4A 1UB9A 3VFZA 1O7FA 3R61A 1ULYA 3U9GA 3WGGA 4Y13A 1R36A 1G3TA 2C6YA 2L3DA 3VEPA 1YYVA 4I02A 3FMRA 5HS8A 1TQMA 2F5FA 3P9KA 1H0MA 2Y48A 5H6RA 4A0ZA 2XV4S 4RS8A 5ILSA 2RV8A 1YW8A 3GUDA 3BJAA 1J2XA 4GCVA 2L4MA 1BI3A 2XIGA 2YU3A 2FSWA 4BQAA 4BH9A 1P4WA 1FBSA 1BM9A 3F8BA 3MFKA 3F8FA 1STZA 3DEUA 4I2OA 4UNOA 1LJ9A 4ETSA 3B02A 4G7OF 1IN6A 1LEAA 2RC4A 4WXDA 3CLOA 1U6GA 3FZVA 5CLSA 4HBLA 5TJJA 1IN5A 1YS7A 2DU9A 3F8CA 1D8JA 2DLLA 4IPAA 1FBQA 2XROA 2QBYB 1BI0A 3BZ6A 5KVRA 4ZZLA 5KK1A 1KQ0A 2NS0A 3WTVC 4EJWA 4GYIA 3GW2A 4HW0A 4R79A 1ZG1A 1ZG3A 5JFRA 5ICEA 1R7JA 2VN2A 3D0SA 1IXRC 1S7AA 1Z05A 4FHTA 2FEZA 1YW9A 1B4AA 3O3KA 2HTSA 4P5OA 1ZLKA 1MKMA 1FC3A 3KLOA 1TNSA 4ON0A 1KYWA 3FXUA 3KP7A 1MDMB 3ECHA 5JR3A 4BYYA 4LB6B 1BI1A 3QOPA 3CO7C 5L3DA 2NRAC 2E1CA 5EEGA 3E5UA 2W57A 4LFUA 1ZREA 5FO5A 1R1VA 4TV7A 2B0LA 3GXOA 2VXZA 2KKOA 4KMFA 2V6CA 2EV6A 3G73A 2KRFA 5L3BA 3HOTA 2X4HA 5JI6A 4WXCA 4AIJA 4U7BA 1O3TA 1REPC 4HX7A 5FLXZ 2QQ9A 2H27A 4WK8F 1B9MA 1X3UA 3EDPA 3KP6A 2ADUA 4CYDA 5K5QA 3D5LA 1J7KA 4HX4A 2MD5A 3WU0A 4DNCA 2FNAA 6PAXA 1EH8A 4LG0A 2R3SA 3SZTA 1DDNA 1WRJA 1OR7A 2QBYA 4IHSA 5DCMB 2K02A 1LDKB 2UZKA 2DQLA 2QQAA 3RYPA 1W5TA 1R5GA 5E8GA 1FPQA 2P8TA 2MA3A 1FLIA 4ENNA 2A3SA 5K5RA 3FXRA 5CVVA 3WE2A 1XMAA 4UXNA 4IRGA 3JTGA 2Y0MA 2EB7A 1FSEA 1A04A 5E17F 5DDGA 4CHUA 1KGSA 3SZPA 4PCQA 2QLZA 2ELHA 3ZMDA 5H20A 3F8NA 3IWFA 2CQKA 4YFNF 2R7DA 1KU9A 2KIMA 3V7RA 5D6EA 2ACJA 2BGCA 1O3QA 1BIAA 4YIIA 3KCCA 4A12A 1HBXG 1JXSA 2CG4A 3IRRA 3HTUA 3ZMVA 4ESBA 5E18F 2XAGA 1ZRDA 2M8EA 3O6BB 2VC0A 3HOSA 4HF1A 1IN4A 4B8XA 1ZGJA 1J75A 3VB2A 2D45A 2XVCA 4ESFA 1FBUA 3K69A 1G3SA 4M71A 2XAQA 1GXPA 4LB5A 4NB5A 2P7VB 5L3EA 3I59A 5E1XA 3IL2A 1ZN2A 4RB1A 2FQ3A 1Q1HA 3C18A 2FMYA 1HW1A 1JHHA 2Q0OA 3DPLC 4L5JA 4GYGA 4UV8A 4JK1X 3E97A 1B9NA 5HS9A 2OQRA 2Z99A 1U2WA 2ISZA 4ZYHA 3QPTA 1ZYRF 3E3VA 1HQCA 3O2PE 2EV0A 3K1MA 4O5VA 3JW4A 1IAWA 2DFIA 2VBXA 1IXCA 4EJUA 4M9SA 5FD6A 3L7WA 5AIPA 1U8RA 3BOQA 3KEOA 4ZYGA 4BAYA 2DW4A 5FD5A 5AIQA 3QPHA 4HV5A 3FF5A 2ISYA 4LLNA 5D6FA 1UCRA 5LHHA 1ON2A 3S2WA 3RYRA 2QQBA 3C3WA 3ML6A 4AIHA 2JZYA 2L54A 3E6BA 1S7OA 4EM0B 1PDNC 5BPDA 1J5YA 4MTEA 3LA3A 3REOA 2DPDA 5FFXA 3ZP5A 4NQWA 2AXLA 1P6RA 4O3MA 3C1DA 1F5TA 4JQFA 4HX8A 2VOOA 1W4MA 2NNYA 2RQPA 1QO0D 1HKSA 3ELKA 4G94A 2HYGD 2EJRA 5D5WB 2QVOA 1RUNA 3NRVA 3CTAA 3RI4A 4LLGF 2XKOA 1R1TA 5DV5A 5K5OA 2K4JA 2CW0F 1ZAOA 3J81Z 4WXHA 4I01A 4AIKA 1MJ9A 4EM1A 4XLPF 3K2ZA 1ZRCA 2LF7A 5LRRA 4WCGA 4EJOA 2F5EA 1BJAA 3DF8A 2HEOA 2YX4A 4A0XA 2VE8A 1I6XA 3T1BA 2DTRA 2OBPA 5HDNA 1I27A 4F7ZA 2O8XA 5LRSA 1G4DA 2CGPA 1FOKA 4OMZA 1LNWA 2O61A 5ILVA 1XB4A 2GXGA 1I1SA 5JHUA 3DPTA 5E1WA 4ENKA 2Z33A 1PP7U 1IW7F 1K78A 3FM5A 1XDSA 1IZ1A 5L3GA 1O3SA 4UV9A 1JHFA 2EWNA 2ZMEA 5IT3A 4OIQF 2QENA 1AOYA 1K79A 2ETHA 4MTDA 2QUFA 2P5VA 2XAJA 3MAJA 1NHAA 3R0AA 3DP7A 1H9TA 4G7HF 2YSRA 2XUBA 2HKXA 1LVAA 4UVCA 2PEXA 3T8TA 2A68F 4CO8A 4RGSA 3ECOA 3HSEA 3N97A 1YLFA 1GHCA 1XSXA 5CYVA 1ONVA 1FNNA 4I0BA 3P9CA 4KUMA 1LB2A 2HTJA 3Q9VA 4M9XA 1I1GA 2A6HF 1BOAA 3TO6A 4KDPA 3WTUC 3WG9A 4RAYA 2A61A 2K86A 3CUQA 2IW5A 4XBFA 2PFBA 4IJAA 2O3FA 1YTYA 3WTSC 5LBQA 1YIOA 5FFZA 3Q9SA 3HRTA 3PQKA 1H9GA 2DK5A 2PMHA 2HR3A 3WE3A 2ZJ2A 3F3XA 1IRGA 1P92A 1OKRA 1ON1A 2J5OA 3GFJA 1XDUA 4OIRF 3IKTA 5K1YA 2HYFA 1T0FA 3JSPA 3PFIA 4LGWA 4IRIA 3I53A 3BDDA 4N9HA 3M8FA 3DFGA 2PBIA 2VOPA 1WWXA 2IA1A 1T6SA 3ROUA 3R60A 3QU3A 4IHTA 4HOBA 1W5SA 3TO7A 1LEBA 4U0YA 3TOAA 1W7PB 1XGNA 1HSJA 5DCMA 1K6OA 3ZMZA 4HYEA 4G6DA 1V3FA 1TQPA 4MHGA 2G7HA 3QP6A 1BC8C 4G7ZF 4RGUA 3N4MA 3GFLA 1B6AA 2XKPA 1SFUA 3BROA 1IN8A 3KP3A 2J5PA 2G9WA 3LWFA 5ICFA 3RTRA 1P4XA 3IWZA 3HSRA 3TOBA 2P5LC 4OINF 4G9YA 5L3FA 2VBZA 3FMSA 2FU4A 5A2QZ 1W7PA 2P4WA 2HFHA 5F64A 3OOPA 2M1BA 4RB2C 1T39A 2XRNA 4KN7X 1QZYA 2ZFWA 2M87A 4EJVA 3P7NA 3FWEA 1QNTA 5IT9K 1JE8A 3I59B 4EQQA 1YS6A 1RIOH 4AWXB 2V1UA 3ZMUA 1YG2A 3ZMTA 1FZPB 1Z7UA 1FWZA 2WWYA 2UWMA 2CFXA 1BBYA 3LQQA 3H3ZA 4HQMA 1EH6A 2R7FA 5CVJA 4M6YA 4I7HA 3JAMK 1OYYA 4MQ9F 3T8RA 3F23A 3M8EA 1VTNC 1GXQA 4EJTA 5J8FA 4U0WA 1JGSA 2KIFA 2O0YA 3GYHX 2ESHA 2JT1A 2P5KA 3NQOA 1XSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S29 A;  2E1N A;  3LA2 A;  4M6X A;  4QLC U;  2GAU A;  4N9I A;  1SFE A;  3WTZ A;  4S05 A;  2IA2 A;  4WF2 A;  3B73 A;  4FX4 A;  1TNT A;  2ZNZ A;  4BHP A;  2JPB A;  3F21 A;  1IXS B;  5BS6 A;  4K2E A;  5HLG A;  2FBI A;  5A2Q K;  3FMQ A;  5HOO A;  4KNY A;  3GFI A;  5CVI A;  3LST A;  3E6D A;  4QWQ A;  1J0R A;  1I5Z A;  2OA4 A;  2ZO4 A;  1IUY A;  4S04 A;  1EV7 A;  3KET A;  4ZZD A;  4A6D A;  1GVJ A;  2G7U A;  4O6J A;  3I0T A;  1U5T A;  3CUQ B;  2EFW A;  2H94 A;  2LF8 A;  3ABU A;  5BMZ A;  1KU3 A;  3HUG A;  1OYW A;  3J80 Z;  4L18 B;  5LGN A;  2DPU A;  2A6E F;  1RI7 A;  4BHC A;  4LJZ F;  2VBY A;  4CGZ A;  1IF1 A;  4ZYD A;  4YG2 F;  3G3Z A;  4MEY F;  1B59 A;  2IT0 A;  1S8N A;  3TKY A;  3COA C;  5HDK A;  4YFK F;  3CUO A;  4L5I A;  1USS A;  3L09 A;  1WI9 A;  1D3Y A;  1KU7 A;  3HRU A;  4HLY A;  3Q5F A;  2NNN A;  2OAZ A;  1HXD A;  3DV8 A;  3KZZ A;  3RDI A;  1P4A A;  3EQL F;  2HWV A;  2KIU A;  1U78 A;  1ZRF A;  1QGP A;  3AAF A;  1SAX A;  1L0O C;  3GVA A;  1T38 A;  4LLL A;  3FX3 A;  2EFN A;  4MNU A;  2ZBK A;  3V8J A;  1U3E M;  4XSZ F;  1IN7 A;  3ZQ7 A;  3CUQ C;  2HS5 A;  4GXO A;  3MEX A;  2EFQ A;  4BHB A;  1ZLJ A;  4MQV A;  3GEZ A;  3ERE D;  4MEX F;  2ZME B;  2FML A;  2XAF A;  3GF2 A;  1MJA A;  1FSH A;  4HF0 A;  1XGS A;  2BYV E;  5DEQ A;  2XHK A;  1K78 B;  1FYK A;  2DBB A;  2ESN A;  2DI3 A;  5DD8 A;  2HDC A;  2VT3 A;  3I58 A;  4ENM A;  2FBH A;  3EUH A;  4KMU X;  2RDP A;  3CJN A;  1KYZ A;  1ZH5 A;  4M74 A;  3E5Q A;  4OIP F;  1AWC A;  3R4K A;  1ZAR A;  2DK8 A;  4KA4 A;  3RPQ A;  3F6O A;  1YO5 C;  4HDU A;  2D1H A;  4Y15 A;  1K7A A;  2F2E A;  2X0L A;  1XN7 A;  3K0L A;  2L4A A;  1ODD A;  2VOD A;  1Z6T A;  3WU1 B;  3WTX C;  3QU6 A;  5D4S A;  3RIR A;  3F22 A;  1TW2 A;  2W24 A;  1QZZ A;  2EK5 A;  4G6Q A;  1Z9C A;  4FX0 A;  3IHU A;  3ZPL A;  1R1U A;  4A6E A;  2IJL A;  4OOI A;  3V8L A;  3QAH A;  1OYI A;  4I98 B;  3ZMS A;  1HKT A;  2GZW A;  3HRM A;  1FX7 A;  4WWC A;  4LD5 A;  5LEJ A;  2FNP A;  1BC7 C;  1UFM A;  4Q47 A;  1O57 A;  3IRQ A;  4PDK A;  5ICC A;  3SXY A;  5LHI A;  5DD4 A;  1WSU A;  5JVT A;  1Y0U A;  2QM3 A;  2P7C B;  1FP2 A;  3DQV C;  2CO5 A;  2L02 A;  5J6X A;  5LGT A;  2PG4 A;  3MQ0 A;  4Q5S F;  2YR2 A;  2D1V A;  1T2K A;  1SMY F;  4RAZ A;  2V9V A;  1SFX A;  3OV8 A;  3W6K B;  2F5C A;  1KQ9 A;  1BN5 A;  2IRF G;  2OU2 A;  1HKQ A;  4RB0 A;  5EEH A;  1J59 A;  3BPX A;  3DXJ F;  3FHZ A;  2STT A;  2GWR A;  2LNB A;  4L9T A;  2FE3 A;  4MGR A;  1CF7 B;  2GXB A;  2EA2 A;  2LDU A;  5D8L B;  4L9V A;  1FP1 D;  1L3L A;  1F4K A;  1U5T C;  2BV6 A;  1P2F A;  2L01 A;  1UHW A;  3K1N A;  2RN7 A;  3HSF A;  3I54 A;  2HKO A;  3TQN A;  1D8K A;  4KFC A;  2PN6 A;  5DCF A;  3WGH A;  2JTV A;  3HIF A;  3GZ6 A;  1Z6R A;  3CDH A;  4KN4 X;  2M45 A;  4ASN A;  3L2C A;  3BP8 A;  2JRT A;  2MC3 A;  1C0W A;  3KP5 A;  1TW3 A;  2UXX A;  2FOK A;  4EV0 A;  1TTY A;  3TO9 A;  2FA5 A;  4L9N A;  2Y75 A;  3BY6 A;  2XAS A;  3LQR A;  2PQ8 A;  1XD7 A;  4XLN F;  1TBX A;  3L00 A;  2QZ8 A;  4IVN A;  3WTT C;  4JBA A;  2HGC A;  3MWM A;  2XAH A;  3JTH A;  4RB3 C;  1Z91 A;  2GQQ A;  1KQ8 A;  3BJO A;  2FF4 A;  2TDX A;  3ZN0 A;  2DQR A;  1ZHF A;  4YIF A;  3GO5 A;  4CIC A;  4B09 A;  3F8M A;  4LK1 F;  5F6F A;  2A07 F;  1U5T B;  3T5X A;  3V7S A;  3I64 A;  3IC7 A;  4P96 A;  4BXU A;  3MZH A;  1G3W A;  4OU0 A;  2E7W A;  4PGG A;  4PZJ A;  2GIV A;  1E2X A;  4PGH A;  1RUO A;  2PLY A;  2V1D A;  3WGI A;  1HW5 A;  3BWG A;  2OQG A;  2OZ6 A;  1XSD A;  4FT8 A;  3R6S A;  1F9N A;  3RKX A;  2MH2 A;  5DYM A;  3J80 K;  3RKW A;  3J81 K;  1WQ2 A;  2H6C A;  3R0J A;  1EH7 A;  4U88 A;  1RZ4 A;  3T0Y A;  2COM A;  2IVM A;  5CVR A;  1LQ1 A;  2CYY A;  2PMU A;  1TQI A;  2IA0 A;  2WV0 A;  1LDD A;  2M5W A;  4Y17 A;  4Q4Z F;  2ZNY A;  5FLX K;  3PQJ A;  4ESJ A;  4DQ2 A;  3FXQ A;  2BBY A;  4ENJ A;  3V8K A;  1OPC A;  3HRS A;  4P9U A;  2K7L A;  2PJP A;  4WX9 A;  2NYX A;  3WTW C;  1WKM A;  3MCZ A;  4KT5 C;  5AON A;  2A5Y B;  4EGZ A;  1FT9 A;  4U0V A;  3VOD A;  4CXF A;  2KJB A;  2FXA A;  4UVA A;  4XSX F;  1KA8 A;  2D2W A;  1MGT A;  2HOE A;  5FB2 A;  2FBK A;  4UHT A;  4CDG A;  1DPR A;  1R23 A;  2F5D A;  4KYW A;  2CWE A;  3HHG A;  3KZY A;  4LMY A;  3V7C A;  1HW2 A;  3W6J B;  2K27 A;  5CVU A;  1IRF A;  2K4B A;  1FY7 A;  3C7J A;  2O03 A;  4UUV A;  5BPI A;  4AVP A;  3E6M A;  1UST A;  5D4R A;  1PP8 F;  3LFK A;  2MH9 A;  1CGP A;  1DPU A;  3QRF F;  3TDU C;  1BI2 A;  2VT2 A;  1W7P D;  4XRF A;  3P9I A;  4L9J A;  3V4G A;  3BJ6 A;  3GWZ A;  5H6Q A;  4BNC A;  5E8I A;  4A0Y A;  3EYI A;  4P55 A;  3ZN1 A;  1D5V A;  3GZ5 A;  1O7L A;  2WTE A;  4HDV A;  2BEO A;  2M30 A;  2EFO A;  3JAM Z;  1E17 A;  2STW A;  1R00 A;  1YW7 A;  1YFH A;  2H6B A;  3GFM A;  4E70 A;  4KIG A;  4I09 A;  2P6T A;  1KU2 A;  3ABT A;  3RKY A;  1HST A;  4L0Y B;  1R58 A;  2YX7 A;  4N0B A;  2V79 A;  3L9F A;  1SMT A;  5ILU A;  3IKV A;  3U1D A;  4HAM A;  3VOE A;  4UVB A;  5DUI A;  5E1Z B;  4M9Z A;  4A5N A;  4Z2Y A;  1ZGA A;  3KLN A;  4KIC A;  4HV6 A;  2HQN A;  2DAO A;  3KP4 A;  3I4P A;  3HHH A;  4Q48 A;  2EA4 A;  3QP5 A;  2RNJ A;  4CZZ A;  1CF7 A;  1S3J A;  1YQA A;  2VE9 A;  1V4R A;  2CSO A;  1R22 A;  2DO7 A;  5FGM A;  1MDM A;  1SD6 A;  1O3R A;  5D5U B;  2O6G E;  5HS7 A;  5BQT A;  1BIB A;  2IP2 A;  4GGG A;  3SHF A;  5HLH A;  2EFP A;  1LDJ A;  4RGX A;  4U7D A;  2P6S A;  1XCB A;  2QYO A;  2RGV A;  3LAJ A;  3LAP A;  1XCV A;  2W85 A;  3EET A;  4ZH4 F;  4GO1 A;  2ZKZ A;  5IT9 Z;  1XGM A;  2PI0 A;  2Q2E A;  2VON A;  4I0A A;  3LA7 A;  3K1P A;  3KFW X;  3ISP A;  1SD5 A;  1G6N A;  1QPM A;  4EGY A;  1MJB A;  5L3C A;  5DUK A;  3MZY A;  4EMS A;  5F1R A;  2W25 A;  2HQR A;  3TGN A;  1SD7 A;  5D8K B;  2Z5U A;  4EM2 A;  3GX4 X;  3JSO A;  1XMK A;  2AS5 F;  2H09 A;  2E7X A;  4HQE A;  5D5V B;  3H92 A;  4HLX A;  2JSC A;  2YPR A;  4NHJ A;  5ICG A;  1OMI A;  5HLI A;  2OD5 A;  4OIO F;  3M1E A;  2Z9O A;  4A5M A;  3J7A O;  3SFZ A;  3ULQ B;  1DP7 P;  3I71 A;  3GLX A;  4KIF A;  4LK0 F;  4HA8 A;  2Q8K A;  2IPQ X;  2ZCW A;  2HZT A;  3BPV A;  4ZYE A;  5CJ9 A;  2A69 F;  3KP2 A;  5HVQ C;  5BOX A;  1S6L A;  3RJP A;  4RGR A;  4OMY A;  3M9A A;  5LGU A;  4H0E A;  1R5H A;  3WTY C;  4AD9 A;  2KJC A;  1QBJ A;  3NEU A;  2RKH A;  3U2R A;  4G8X A;  2V1X A;  1G3Y A;  2LSO A;  5E20 A;  4A2U A;  5HDG A;  5LEK A;  5LLQ A;  2UXN A;  1F1Z A;  2Z3Y A;  1MZB A;  4R1H A;  3KEQ A;  2W84 A;  3CO6 C;  2GA2 A;  2JPC A;  4D0P A;  2GA1 A;  1FYL A;  3E6C C;  2NAZ A;  1RNL A;  1SD4 A;  4HF2 A;  3I5U A;  1B1B A;  4R8H A;  2RVC A;  3F72 A;  3H3U A;  4LG0 B;  2MLG A;  5D5X B;  5TRD A;  3E5X A;  2LKP A;  3WOD F;  5LHG A;  2XGX A;  1ZG5 A;  4P9F A;  2VC1 A;  2VBW A;  5J8C A;  3KE2 A;  2OZU A;  1Z1D A;  4M73 A;  1UHM A;  1T98 A;  1TLH B;  2DT5 A;  2MBF A;  3K9T A;  4EVI A;  4KIB A;  3RPU A;  4M72 A;  4IF4 A;  5ERI A;  1XGO A;  2ZXJ A;  4YFX F;  1PUE E;  3TDZ C;  1MD0 A;  3HYI A;  3HTS B;  3SQN A;  3M7G A;  3F6V A;  1FYM A;  2MLK A;  3EYY A;  1J9I A;  2FRH A;  2QWW A;  3DKW A;  1QQI A;  1DUX C;  2EV5 A;  3FM3 A;  4IRH A;  2BE5 F;  4L0Z B;  2WC2 A;  4IXA A;  4HZF A;  5ED4 A;  1UB9 A;  3VFZ A;  1O7F A;  3R61 A;  1ULY A;  3U9G A;  3WGG A;  4Y13 A;  1R36 A;  1G3T A;  2C6Y A;  2L3D A;  3VEP A;  1YYV A;  4I02 A;  3FMR A;  5HS8 A;  1TQM A;  2F5F A;  3P9K A;  1H0M A;  2Y48 A;  5H6R A;  4A0Z A;  2XV4 S;  4RS8 A;  5ILS A;  2RV8 A;  1YW8 A;  3GUD A;  3BJA A;  1J2X A;  4GCV A;  2L4M A;  1BI3 A;  2XIG A;  2YU3 A;  2FSW A;  4BQA A;  4BH9 A;  1P4W A;  1FBS A;  1BM9 A;  3F8B A;  3MFK A;  3F8F A;  1STZ A;  3DEU A;  4I2O A;  4UNO A;  1LJ9 A;  4ETS A;  3B02 A;  4G7O F;  1IN6 A;  1LEA A;  2RC4 A;  4WXD A;  3CLO A;  1U6G A;  3FZV A;  5CLS A;  4HBL A;  5TJJ A;  1IN5 A;  1YS7 A;  2DU9 A;  3F8C A;  1D8J A;  2DLL A;  4IPA A;  1FBQ A;  2XRO A;  2QBY B;  1BI0 A;  3BZ6 A;  5KVR A;  4ZZL A;  5KK1 A;  1KQ0 A;  2NS0 A;  3WTV C;  4EJW A;  4GYI A;  3GW2 A;  4HW0 A;  4R79 A;  1ZG1 A;  1ZG3 A;  5JFR A;  5ICE A;  1R7J A;  2VN2 A;  3D0S A;  1IXR C;  1S7A A;  1Z05 A;  4FHT A;  2FEZ A;  1YW9 A;  1B4A A;  3O3K A;  2HTS A;  4P5O A;  1ZLK A;  1MKM A;  1FC3 A;  3KLO A;  1TNS A;  4ON0 A;  1KYW A;  3FXU A;  3KP7 A;  1MDM B;  3ECH A;  5JR3 A;  4BYY A;  4LB6 B;  1BI1 A;  3QOP A;  3CO7 C;  5L3D A;  2NRA C;  2E1C A;  5EEG A;  3E5U A;  2W57 A;  4LFU A;  1ZRE A;  5FO5 A;  1R1V A;  4TV7 A;  2B0L A;  3GXO A;  2VXZ A;  2KKO A;  4KMF A;  2V6C A;  2EV6 A;  3G73 A;  2KRF A;  5L3B A;  3HOT A;  2X4H A;  5JI6 A;  4WXC A;  4AIJ A;  4U7B A;  1O3T A;  1REP C;  4HX7 A;  5FLX Z;  2QQ9 A;  2H27 A;  4WK8 F;  1B9M A;  1X3U A;  3EDP A;  3KP6 A;  2ADU A;  4CYD A;  5K5Q A;  3D5L A;  1J7K A;  4HX4 A;  2MD5 A;  3WU0 A;  4DNC A;  2FNA A;  6PAX A;  1EH8 A;  4LG0 A;  2R3S A;  3SZT A;  1DDN A;  1WRJ A;  1OR7 A;  2QBY A;  4IHS A;  5DCM B;  2K02 A;  1LDK B;  2UZK A;  2DQL A;  2QQA A;  3RYP A;  1W5T A;  1R5G A;  5E8G A;  1FPQ A;  2P8T A;  2MA3 A;  1FLI A;  4ENN A;  2A3S A;  5K5R A;  3FXR A;  5CVV A;  3WE2 A;  1XMA A;  4UXN A;  4IRG A;  3JTG A;  2Y0M A;  2EB7 A;  1FSE A;  1A04 A;  5E17 F;  5DDG A;  4CHU A;  1KGS A;  3SZP A;  4PCQ A;  2QLZ A;  2ELH A;  3ZMD A;  5H20 A;  3F8N A;  3IWF A;  2CQK A;  4YFN F;  2R7D A;  1KU9 A;  2KIM A;  3V7R A;  5D6E A;  2ACJ A;  2BGC A;  1O3Q A;  1BIA A;  4YII A;  3KCC A;  4A12 A;  1HBX G;  1JXS A;  2CG4 A;  3IRR A;  3HTU A;  3ZMV A;  4ESB A;  5E18 F;  2XAG A;  1ZRD A;  2M8E A;  3O6B B;  2VC0 A;  3HOS A;  4HF1 A;  1IN4 A;  4B8X A;  1ZGJ A;  1J75 A;  3VB2 A;  2D45 A;  2XVC A;  4ESF A;  1FBU A;  3K69 A;  1G3S A;  4M71 A;  2XAQ A;  1GXP A;  4LB5 A;  4NB5 A;  2P7V B;  5L3E A;  3I59 A;  5E1X A;  3IL2 A;  1ZN2 A;  4RB1 A;  2FQ3 A;  1Q1H A;  3C18 A;  2FMY A;  1HW1 A;  1JHH A;  2Q0O A;  3DPL C;  4L5J A;  4GYG A;  4UV8 A;  4JK1 X;  3E97 A;  1B9N A;  5HS9 A;  2OQR A;  2Z99 A;  1U2W A;  2ISZ A;  4ZYH A;  3QPT A;  1ZYR F;  3E3V A;  1HQC A;  3O2P E;  2EV0 A;  3K1M A;  4O5V A;  3JW4 A;  1IAW A;  2DFI A;  2VBX A;  1IXC A;  4EJU A;  4M9S A;  5FD6 A;  3L7W A;  5AIP A;  1U8R A;  3BOQ A;  3KEO A;  4ZYG A;  4BAY A;  2DW4 A;  5FD5 A;  5AIQ A;  3QPH A;  4HV5 A;  3FF5 A;  2ISY A;  4LLN A;  5D6F A;  1UCR A;  5LHH A;  1ON2 A;  3S2W A;  3RYR A;  2QQB A;  3C3W A;  3ML6 A;  4AIH A;  2JZY A;  2L54 A;  3E6B A;  1S7O A;  4EM0 B;  1PDN C;  5BPD A;  1J5Y A;  4MTE A;  3LA3 A;  3REO A;  2DPD A;  5FFX A;  3ZP5 A;  4NQW A;  2AXL A;  1P6R A;  4O3M A;  3C1D A;  1F5T A;  4JQF A;  4HX8 A;  2VOO A;  1W4M A;  2NNY A;  2RQP A;  1QO0 D;  1HKS A;  3ELK A;  4G94 A;  2HYG D;  2EJR A;  5D5W B;  2QVO A;  1RUN A;  3NRV A;  3CTA A;  3RI4 A;  4LLG F;  2XKO A;  1R1T A;  5DV5 A;  5K5O A;  2K4J A;  2CW0 F;  1ZAO A;  3J81 Z;  4WXH A;  4I01 A;  4AIK A;  1MJ9 A;  4EM1 A;  4XLP F;  3K2Z A;  1ZRC A;  2LF7 A;  5LRR A;  4WCG A;  4EJO A;  2F5E A;  1BJA A;  3DF8 A;  2HEO A;  2YX4 A;  4A0X A;  2VE8 A;  1I6X A;  3T1B A;  2DTR A;  2OBP A;  5HDN A;  1I27 A;  4F7Z A;  2O8X A;  5LRS A;  1G4D A;  2CGP A;  1FOK A;  4OMZ A;  1LNW A;  2O61 A;  5ILV A;  1XB4 A;  2GXG A;  1I1S A;  5JHU A;  3DPT A;  5E1W A;  4ENK A;  2Z33 A;  1PP7 U;  1IW7 F;  1K78 A;  3FM5 A;  1XDS A;  1IZ1 A;  5L3G A;  1O3S A;  4UV9 A;  1JHF A;  2EWN A;  2ZME A;  5IT3 A;  4OIQ F;  2QEN A;  1AOY A;  1K79 A;  2ETH A;  4MTD A;  2QUF A;  2P5V A;  2XAJ A;  3MAJ A;  1NHA A;  3R0A A;  3DP7 A;  1H9T A;  4G7H F;  2YSR A;  2XUB A;  2HKX A;  1LVA A;  4UVC A;  2PEX A;  3T8T A;  2A68 F;  4CO8 A;  4RGS A;  3ECO A;  3HSE A;  3N97 A;  1YLF A;  1GHC A;  1XSX A;  5CYV A;  1ONV A;  1FNN A;  4I0B A;  3P9C A;  4KUM A;  1LB2 A;  2HTJ A;  3Q9V A;  4M9X A;  1I1G A;  2A6H F;  1BOA A;  3TO6 A;  4KDP A;  3WTU C;  3WG9 A;  4RAY A;  2A61 A;  2K86 A;  3CUQ A;  2IW5 A;  4XBF A;  2PFB A;  4IJA A;  2O3F A;  1YTY A;  3WTS C;  5LBQ A;  1YIO A;  5FFZ A;  3Q9S A;  3HRT A;  3PQK A;  1H9G A;  2DK5 A;  2PMH A;  2HR3 A;  3WE3 A;  2ZJ2 A;  3F3X A;  1IRG A;  1P92 A;  1OKR A;  1ON1 A;  2J5O A;  3GFJ A;  1XDU A;  4OIR F;  3IKT A;  5K1Y A;  2HYF A;  1T0F A;  3JSP A;  3PFI A;  4LGW A;  4IRI A;  3I53 A;  3BDD A;  4N9H A;  3M8F A;  3DFG A;  2PBI A;  2VOP A;  1WWX A;  2IA1 A;  1T6S A;  3ROU A;  3R60 A;  3QU3 A;  4IHT A;  4HOB A;  1W5S A;  3TO7 A;  1LEB A;  4U0Y A;  3TOA A;  1W7P B;  1XGN A;  1HSJ A;  5DCM A;  1K6O A;  3ZMZ A;  4HYE A;  4G6D A;  1V3F A;  1TQP A;  4MHG A;  2G7H A;  3QP6 A;  1BC8 C;  4G7Z F;  4RGU A;  3N4M A;  3GFL A;  1B6A A;  2XKP A;  1SFU A;  3BRO A;  1IN8 A;  3KP3 A;  2J5P A;  2G9W A;  3LWF A;  5ICF A;  3RTR A;  1P4X A;  3IWZ A;  3HSR A;  3TOB A;  2P5L C;  4OIN F;  4G9Y A;  5L3F A;  2VBZ A;  3FMS A;  2FU4 A;  5A2Q Z;  1W7P A;  2P4W A;  2HFH A;  5F64 A;  3OOP A;  2M1B A;  4RB2 C;  1T39 A;  2XRN A;  4KN7 X;  1QZY A;  2ZFW A;  2M87 A;  4EJV A;  3P7N A;  3FWE A;  1QNT A;  5IT9 K;  1JE8 A;  3I59 B;  4EQQ A;  1YS6 A;  1RIO H;  4AWX B;  2V1U A;  3ZMU A;  1YG2 A;  3ZMT A;  1FZP B;  1Z7U A;  1FWZ A;  2WWY A;  2UWM A;  2CFX A;  1BBY A;  3LQQ A;  3H3Z A;  4HQM A;  1EH6 A;  2R7F A;  5CVJ A;  4M6Y A;  4I7H A;  3JAM K;  1OYY A;  4MQ9 F;  3T8R A;  3F23 A;  3M8E A;  1VTN C;  1GXQ A;  4EJT A;  5J8F A;  4U0W A;  1JGS A;  2KIF A;  2O0Y A;  3GYH X;  2ESH A;  2JT1 A;  2P5K A;  3NQO A;  1XSV A; 
#chains in the Genus database with same CATH topology
 1S29 A;  2E1N A;  3LA2 A;  1GUU A;  4M6X A;  3AG4 H;  2ID3 A;  2A05 A;  4M3F A;  4QLC U;  3S14 J;  2GAU A;  4A3B J;  3JRC A;  1KON A;  4N9I A;  3AFH A;  3JRI A;  1SFE A;  3WTZ A;  4S05 A;  2IA2 A;  2HZD A;  4WF2 A;  4YEL A;  3B73 A;  4FX4 A;  1TNT A;  2Y2Z A;  2ZNZ A;  3TL4 X;  4BHP A;  3TW7 A;  4CH7 A;  2CUJ A;  2OTJ I;  2I10 A;  1N77 A;  2FJ1 A;  2JPB A;  3GCM A;  3F21 A;  1IXS B;  5BS6 A;  3HM5 A;  3K10 A;  4K2E A;  3Q0W A;  5HLG A;  2FBI A;  1R9T J;  4BBR J;  5A2Q K;  4UB6 C;  1YOV B;  1LFP A;  2CJJ A;  3FMQ A;  5HOO A;  1G59 A;  4U87 A;  4KNY A;  3GFI A;  2JUG A;  5CVI A;  3LST A;  3E6D A;  4FE4 A;  3BR2 A;  3AG2 H;  1Y0N A;  4QWQ A;  4ITV A;  1J0R A;  1I5Z A;  5IYC J;  3GTO J;  2OA4 A;  2ZO4 A;  1IUY A;  1H8A C;  4S04 A;  3OIQ A;  1HA8 A;  1EV7 A;  3CF2 A;  3KET A;  4ZZD A;  4A6D A;  3MKL A;  1GVJ A;  3LMM A;  2G7U A;  4B48 A;  1JI8 A;  1ZTR A;  2LRD A;  2DA6 A;  4O6J A;  4BL0 B;  3I0T A;  1P7I A;  1U5T A;  2VL8 A;  3CUQ B;  2EFW A;  2H94 A;  2LF8 A;  3ABU A;  5BMZ A;  2JA8 J;  2W48 A;  1KU3 A;  3RCO A;  3HUG A;  1JKP C;  1A6Q A;  1DQU A;  1OYW A;  1RC9 A;  3J80 Z;  4L18 B;  4V2G A;  5LGN A;  4BGD A;  2DPU A;  2A6E F;  1YRN B;  1RI7 A;  1Y56 A;  2F4I A;  2EH3 A;  4BHC A;  1FOW A;  4LJZ F;  4ZDP A;  1MMA A;  2VBY A;  1JJ6 C;  4CGZ A;  1BOB A;  1IF1 A;  3AG3 H;  2CH0 A;  3K4J A;  4YG2 F;  4ZYD A;  3G3Z A;  4MEY F;  3H3V K;  1B59 A;  2ZJP F;  5CPR B;  2ME6 A;  2IT0 A;  2COB A;  1S8N A;  3TKY A;  5B66 C;  4B3X A;  4D5F A;  3COA C;  5HDK A;  4YFK F;  3CUO A;  1F36 A;  4L5I A;  1USS A;  3L09 A;  1R71 A;  2VJ5 A;  4XQF A;  3HOU J;  1WI9 A;  1D3Y A;  4M6V A;  4RMN A;  2V4J C;  1VQ6 I;  1KU7 A;  3PUB A;  3BG5 A;  1W36 D;  1RKW A;  3HRU A;  4RM3 A;  1TWH J;  2NVU B;  4HLY A;  3Q5F A;  2NNN A;  4JX4 A;  2OAZ A;  1HXD A;  2VB6 A;  3DV8 A;  3KZZ A;  1TWG J;  3RDI A;  2KDZ A;  1P4A A;  3EQL F;  3HOX J;  2ZXI A;  2HWV A;  2LVS A;  2KIU A;  4FQG A;  3OYD A;  1U78 A;  1ZRF A;  1QGP A;  3AAF A;  4LIV A;  1SAX A;  2XGD A;  1L0O C;  3GVA A;  3ZQL A;  3FXL A;  5M5Y J;  5HNH A;  3CJR B;  2HI3 A;  4BEH B;  3HL2 A;  3VYT B;  2VJ4 A;  4XKB A;  1T38 A;  1Z7L A;  3EUA A;  1WJB A;  1EA3 A;  4LLL A;  3FX3 A;  2EFN A;  2BY0 A;  3ZOB A;  1IJW C;  1LVK A;  5C4X J;  2LMD A;  5E3O A;  4MNU A;  2ZBK A;  2BOL A;  3V8J A;  5DM6 F;  1U3E M;  1T8I A;  4XSZ F;  1IN7 A;  2DA2 A;  2NOJ B;  3ZQ7 A;  3CUQ C;  1I3Q J;  2HS5 A;  3B6C A;  4GXO A;  4BDZ A;  4BDY A;  1S9H A;  4C9Y A;  5J40 A;  1UHS A;  3CCE I;  3MEX A;  4E7K A;  2EFQ A;  1ETW A;  4BHB A;  2F4M B;  1ZLJ A;  4MQV A;  3GEZ A;  3ERE D;  2JWT A;  3HOZ J;  4MEX F;  2ZME B;  5M5W J;  1ORK A;  1UMQ A;  2FML A;  3GF2 A;  2XAF A;  2DA7 A;  3SDB A;  1FTT A;  1MJA A;  1U9O A;  4A3M J;  1ETQ A;  1DP3 A;  1FSH A;  2PMZ A;  5J3L A;  3H5A A;  4HF0 A;  5FLM J;  1XGS A;  2BYV E;  1I6H J;  5DEQ A;  2IGK A;  2XHK A;  3H5N A;  5F04 A;  2XSD C;  1K78 B;  1FYK A;  4PK4 A;  2DBB A;  3OYC A;  2ESN A;  2DI3 A;  5DD8 A;  2HDC A;  1H89 C;  1YX5 A;  2VT3 A;  2E34 A;  3I58 A;  4HNV A;  4ENM A;  2FBH A;  3EUH A;  4KMU X;  2RDP A;  2XAU A;  3CJN A;  1KYZ A;  3DEE A;  3M07 A;  2IS4 A;  1ZH5 A;  2R0Q C;  1XS9 A;  4M74 A;  4C3I J;  3E5Q A;  4OIP F;  2VKH A;  3OS1 A;  1AWC A;  3R4K A;  2VQG A;  1ETX A;  3LL7 A;  2LFB A;  1ZAR A;  2DK8 A;  4KA4 A;  3TED A;  3PJR A;  3RPQ A;  3S15 J;  1NTC A;  3F6O A;  1ENH A;  1YO5 C;  4HDU A;  2D1H A;  4Y15 A;  1K7A A;  2F2E A;  2X0L A;  5EGO A;  1XN7 A;  3K0L A;  2L4A A;  1ODD A;  1X19 A;  3CCY A;  2VOD A;  1Z6T A;  5GAH J;  3WU1 B;  2EZI A;  3WTX C;  3QU6 A;  5D4S A;  3RIR A;  3F22 A;  1TW2 A;  2W24 A;  1QZZ A;  2EK5 A;  4G6Q A;  5IOZ A;  3W2A A;  1Z9C A;  2XB0 X;  1U0J A;  3IHU A;  4FX0 A;  4E7Z A;  4W97 A;  3ZPL A;  1R1U A;  4A6E A;  5M3F J;  5GTI C;  2IJL A;  3OY9 A;  4OOI A;  1AKH B;  2LP0 A;  3BQY A;  3V8L A;  3QAH A;  1OYI A;  4PFO A;  3I4N J;  3ZQG A;  4I98 B;  3CF5 F;  2DXI A;  3ZMS A;  1HKT A;  2GZW A;  3ZQH A;  3HRM A;  3P5J A;  1FX7 A;  3GTQ J;  4WWC A;  4LD5 A;  1IDZ A;  1KZH A;  1OCO H;  5LEJ A;  2FNP A;  1BC7 C;  3B6A A;  1UFM A;  4ZDO A;  4Q47 A;  1O57 A;  3IRQ A;  4PDK A;  4CSW A;  2Y0S N;  4RLQ A;  5M3M J;  5ICC A;  3SXY A;  3CC4 I;  5LHI A;  5DD4 A;  4ZYA A;  4DZJ A;  4A3C J;  2AHQ A;  1WSU A;  3W2W A;  3G1M A;  4YEJ A;  5JVT A;  1Y0U A;  3SEQ A;  2QM3 A;  2P7C B;  1FP2 A;  2K40 A;  1PUF A;  2IGO A;  3DQV C;  4BJ5 C;  4L5E A;  2CO5 A;  2L02 A;  3IUO A;  1CQT A;  3K4C A;  5J6X A;  1IV8 A;  5LGT A;  2PG4 A;  2XPU A;  3MQ0 A;  1AKH A;  4Q5S F;  2LLK A;  2YR2 A;  2D1V A;  4MFE A;  2JA5 J;  1T2K A;  1SMY F;  4RAZ A;  3K4N A;  2V9V A;  1SFX A;  3OV8 A;  3RPU D;  3W6K B;  2CW8 A;  1H88 C;  2F5C A;  4RAG A;  1YIJ I;  1KQ9 A;  2O5R A;  1BN5 A;  2IRF G;  3QPL A;  2OU2 A;  1HKQ A;  4F91 B;  3BR1 A;  1K6Y A;  4RB0 A;  4E7H A;  2LG4 A;  5EEH A;  1J59 A;  3BPX A;  3DXJ F;  4NC6 A;  2A5W A;  2O7O A;  3OOU A;  3FHZ A;  2STT A;  2GWR A;  2LNB A;  4L9T A;  2ELJ A;  1T95 A;  2FE3 A;  4MGR A;  2ZJR F;  1CF7 B;  2GXB A;  3GTL J;  2EA2 A;  2KRH A;  2LDU A;  3HBL A;  1FEX A;  5D8L B;  1A6I A;  4L9V A;  1ZK8 A;  1FP1 D;  3HPH A;  2NVQ J;  1L3L A;  1F4K A;  1U5T C;  3CP8 A;  4HG2 A;  1GV2 A;  4DGW B;  4OWR B;  2BV6 A;  4AM3 A;  1P2F A;  2YU9 J;  2XPV A;  5FKK A;  2L01 A;  1UHW A;  3PSF A;  3K1N A;  2RN7 A;  1T0F C;  3OSF A;  2ZFU A;  4KIT B;  3HSF A;  3I54 A;  4M3B A;  2HKO A;  3JRF A;  3TQN A;  2G0E A;  1D8K A;  5M5X J;  2VAS A;  3M8J A;  4KFC A;  4F55 A;  2PN6 A;  4Y4R A;  1B8I B;  2K9N A;  2VKV A;  5DCF A;  4BXF A;  3WGH A;  2JTV A;  3GLL A;  3HIF A;  3GZ6 A;  1Z6R A;  3CDH A;  4KN4 X;  2M45 A;  2GOM A;  4ASN A;  5IOY A;  3L2C A;  3BP8 A;  4FET A;  4DYC A;  4G12 A;  1ITY A;  2JRT A;  5GPA A;  2MC3 A;  1C0W A;  3KP5 A;  1TW3 A;  2PJR A;  2UXX A;  1E0E A;  3IV5 A;  2FOK A;  1GLN A;  3VPR A;  1TTY A;  3TO9 A;  4EV0 A;  2Y9Z A;  2FA5 A;  1GV5 A;  4L9N A;  2L9V A;  2Y75 A;  2HDD A;  3BY6 A;  5HNF A;  3ZGK A;  4BJT A;  2XAS A;  1LFB A;  2E35 A;  4B1R A;  1JT6 A;  3LQR A;  4ZDL A;  2PQ8 A;  1XD7 A;  4XLN F;  3HOW J;  1TBX A;  5J47 A;  3L00 A;  2QZ8 A;  3K4K A;  4IVN A;  3NWS A;  2KPM A;  3WTT C;  4JBA A;  3KIO A;  2HGC A;  3K7A J;  2PMZ N;  2EIM H;  3MWM A;  3S1Q J;  2XAH A;  3H1C A;  1X3Z B;  3JTH A;  4RB3 C;  1Z91 A;  2GQQ A;  3JR9 A;  1KQ8 A;  3BJO A;  2FF4 A;  2TDX A;  2L5Q A;  5IP7 J;  3ZN0 A;  2MYS A;  2JK3 A;  2DQR A;  1ZHF A;  4YIF A;  3GO5 A;  4CIC A;  3VSK A;  3F8M A;  3CMM A;  4B09 A;  4LK1 F;  1YI2 I;  5F6F A;  3HG9 A;  4ZTF A;  2A07 F;  3TP3 A;  5EZH A;  3I55 I;  1U5T B;  3T5X A;  3V7S A;  3I64 A;  2H1K A;  1TP4 A;  3IC7 A;  2YUS A;  2CQQ A;  4P96 A;  4BXU A;  2JQ7 A;  3MZH A;  1AU7 A;  1G3W A;  4OU0 A;  2E7W A;  4PGG A;  4PZJ A;  4BXX J;  2GIV A;  1E2X A;  4PGH A;  1IG7 A;  3IH4 A;  1BW5 A;  1RUO A;  2PLY A;  4J01 A;  2V1D A;  3LSI A;  1HW5 A;  4B3A A;  3WGI A;  2BVM A;  3BWG A;  2OQG A;  1I39 A;  2OZ6 A;  2HOS A;  5F0F A;  1XSD A;  4FT8 A;  2WAF A;  1R5I D;  2LC2 A;  3R6S A;  5K7Z A;  3KYC B;  1WJD A;  4M3G A;  1F9N A;  2X6O A;  4PJJ A;  3Q3S A;  3RKX A;  2MH2 A;  2FOW A;  3VYS B;  5DYM A;  2VIX A;  4X1E A;  1HOM A;  3J80 K;  2EZK A;  3RKW A;  3RQI A;  3J81 K;  3WHC A;  3BR0 A;  3L2R A;  1WQ2 A;  2FQ4 A;  4FAS D;  2ZME C;  2R7W A;  2CW7 A;  2H6C A;  4XK4 A;  4XID A;  2CFO A;  3R0J A;  2X1D A;  1EH7 A;  4U88 A;  4Y52 J;  1RZ4 A;  3T0Y A;  2COM A;  2IVM A;  4D7M A;  5CVR A;  3HC7 A;  4A3L J;  3ESW B;  4PSX A;  1LQ1 A;  5F27 A;  2CYY A;  2PMU A;  1B72 B;  1HCR A;  1TQI A;  2IA0 A;  2WV0 A;  1LDD A;  1G2H A;  1IDY A;  2DT6 A;  2M5W A;  4Y17 A;  4Q4Z F;  2ZNY A;  5FLX K;  3BR5 A;  3PQJ A;  4DBQ A;  1JKO C;  4ESJ A;  4A3J J;  1LKX A;  4DQ2 A;  2JA7 J;  3FXQ A;  1VQ4 I;  2BBY A;  2DFF A;  4BY7 J;  4ENJ A;  3V8K A;  1N75 A;  3M1C A;  1OPC A;  2BY1 A;  1IO2 A;  3HRS A;  3PL8 A;  4P9U A;  4PUS A;  2K7L A;  2PJP A;  3W2V A;  4NUB A;  2LY1 A;  4WX9 A;  2R92 J;  2NYX A;  3WTW C;  1WKM A;  3MCZ A;  4KT5 C;  4XON A;  3BG3 A;  1K83 J;  5AON A;  3O8H A;  5E79 C;  2A5Y B;  4EGZ A;  5CQE A;  1FT9 A;  4D9J A;  2LYC A;  4DZP A;  4A93 J;  4U0V A;  3VOD A;  4CXF A;  2NVT J;  2KJB A;  2DOA A;  2FXA A;  4E7L A;  4UVA A;  1D1C A;  4XSX F;  3OR2 C;  1KA8 A;  5F0H A;  2D2W A;  2X85 A;  1MGT A;  2HOE A;  5FB2 A;  2FBK A;  4UHT A;  3DTE A;  1DU0 A;  4CDG A;  3GTJ J;  1DPR A;  1R23 A;  4JYK A;  2F5D A;  4KYW A;  2CWE A;  3I56 I;  1Y39 A;  3A4C A;  3HHG A;  3DBR B;  5FRO A;  4E7J A;  3KZY A;  4LMY A;  3V7C A;  1HW2 A;  3W6J B;  2DT7 B;  5LFA A;  3MKY B;  1WH5 A;  2K27 A;  5CVU A;  1IRF A;  1UG2 A;  2CU7 A;  4IO9 F;  2K4B A;  1FY7 A;  2W7N A;  3C7J A;  4PJM A;  2K5C A;  2O03 A;  3BCB A;  1JUS A;  1BR4 A;  4BQQ A;  4XKV A;  4UUV A;  5BPI A;  4AVP A;  1BW6 A;  3E6M A;  1UST A;  5D4R A;  3E1S A;  1PP8 F;  3DU6 A;  3LFK A;  1NG7 A;  2MH9 A;  1CGP A;  1SAN A;  1DPU A;  3QRF F;  5EDN A;  3M3Y J;  1W36 C;  2R5Y A;  2DA5 A;  2L7F P;  3IAM 2;  3TDU C;  1BI2 A;  1MNM C;  2VT2 A;  2JA6 J;  1W7P D;  4B4C A;  2DOE A;  5DS9 A;  4XRF A;  3P9I A;  4L9J A;  4PJ0 C;  4ABZ A;  3V4G A;  3BJ6 A;  3GWZ A;  3PFY A;  5H6Q A;  1OLT A;  3I3L A;  1Z21 A;  5E8I A;  1GT0 C;  4BNC A;  3HKZ N;  5IYD J;  3V42 A;  1S7E A;  4UB8 C;  1P7J A;  4ZTJ A;  4JOM A;  1W0U A;  2K3F A;  4A0Y A;  3EYI A;  2NVX J;  4KJZ A;  2LKX A;  4P55 A;  3UNG C;  2K85 A;  3ZN1 A;  2IBD A;  1D5V A;  2ID6 A;  1YJN I;  2QSH X;  1MMG A;  3LSP A;  3GZ5 A;  2JJ7 A;  1O7L A;  3OYJ A;  2WTE A;  2HU9 A;  4HDV A;  2BEO A;  2M30 A;  2EFO A;  3JAM Z;  1K4T A;  1SFO J;  1E17 A;  3ZRG A;  3A1Y A;  1Y1W J;  1MH3 A;  2GXA A;  4IHX A;  3DTK A;  1QHG A;  1WJF A;  3O8G A;  2STW A;  1R00 A;  1YW7 A;  1YFH A;  2H6B A;  2Y0S A;  3GFM A;  4E70 A;  4KIG A;  4GFB A;  3KYD B;  5IY5 H;  4I09 A;  2HPM A;  2P6T A;  4W1U A;  4BY1 J;  5FLV A;  1KU2 A;  2DYR H;  3ABT A;  3RKY A;  1HST A;  4L0Y B;  1R58 A;  2YX7 A;  4C3H J;  2CMP A;  4N0B A;  4BKX A;  2V79 A;  3L9F A;  2QEX I;  1SMT A;  1WJA A;  5ILU A;  1XG1 A;  3IKV A;  3U1D A;  4HAM A;  1T56 A;  3VOE A;  2VJJ A;  4UVB A;  4PSW A;  4HNU A;  1Z0X A;  5E1Z B;  5DUI A;  1V54 H;  4M9Z A;  4A5N A;  4Z2Y A;  4EEF G;  4J19 A;  1ZGA A;  3KLN A;  2RRE A;  4IHV A;  4KIC A;  2L9R A;  3PIO F;  4HV6 A;  2HQN A;  2DAO A;  3KP4 A;  4XLE A;  2QKL B;  3I4P A;  1MSE C;  3HHH A;  4Q48 A;  3FHN A;  3HGG A;  1V55 H;  2EA4 A;  3QP5 A;  3GTM J;  1AA7 A;  3LFU A;  2RNJ A;  4CZZ A;  1CF7 A;  1S3J A;  1WI3 A;  1YQA A;  2VE9 A;  1WZ2 A;  3D5S C;  2KHM A;  1V4R A;  2L2O A;  2CSO A;  4BEH A;  1R22 A;  1ZQ3 P;  4IHW A;  2DO7 A;  5B3S H;  5H2F C;  1MH4 A;  2GBY A;  4AUX A;  5FGM A;  1MDM A;  3BTC A;  1SD6 A;  1O3R A;  5D5U B;  2O6G E;  3ZQC A;  5HS7 A;  5BQT A;  3HZJ A;  1EF4 A;  1BIB A;  4GDF A;  2IP2 A;  3UKG A;  2HNH A;  1D0Z A;  3L2U A;  1VQ7 I;  4GGG A;  4F52 A;  3SHF A;  5HLH A;  2EFP A;  3KX2 A;  5GPC A;  4C30 A;  2X9D A;  1LDJ A;  3MZ8 A;  4RGX A;  4U7D A;  2P6S A;  5EG0 A;  1XCB A;  2QYO A;  3QYB A;  3FXJ A;  2E1M B;  2RGV A;  3LAJ A;  3LAP A;  2VLA A;  3HJE A;  1X1B A;  1XCV A;  3UR3 C;  2W85 A;  3EET A;  3CQZ J;  4ZH4 F;  3C2H A;  2VQC A;  4GO1 A;  3CCS I;  2DMT A;  3EPZ A;  2ZKZ A;  1OCR H;  3ZQF A;  5IT9 Z;  2Z1D A;  1XGM A;  1E3O C;  2PJR B;  2PI0 A;  4CA0 A;  2Q2E A;  2WY8 Q;  2LY2 A;  4BE0 A;  2CQ7 A;  3N05 A;  2VON A;  4I0A A;  1VQN I;  4XOR A;  3W6V A;  4IQJ A;  2GOX B;  4FIS A;  3LA7 A;  1OR7 C;  1JUP A;  4LIU A;  3H9Q A;  3K1P A;  1SAU A;  3ISP A;  3KFW X;  1LFU P;  2HQ5 A;  3CMA I;  1SD5 A;  3OYH A;  1R49 A;  3U1K A;  1G6N A;  1QPM A;  4EGY A;  1MJB A;  5L3C A;  3SDG A;  5DUK A;  3CZ6 A;  2XB5 A;  3MZY A;  2IXS A;  4EMS A;  5F1R A;  2W25 A;  1ETV A;  3ZCO A;  3RKQ A;  2ZC2 A;  2HQR A;  3TGN A;  4CCM A;  1JKQ C;  4Y33 A;  1SD7 A;  5D8K B;  1TC3 C;  1FIP A;  1MMD A;  2Z5U A;  3OIO A;  2UUZ A;  4EM2 A;  3BQZ A;  3JSO A;  3GX4 X;  1XMK A;  3MKZ A;  3CCM I;  2HVR A;  2AS5 F;  2K9M A;  5C3E J;  4IX7 A;  2BHZ A;  2QCO A;  2H09 A;  3K4M A;  3I9V 2;  5FRN A;  2E7X A;  4XLF A;  5IP6 A;  4HQE A;  3S2D J;  3S1M J;  2BXY A;  4XLA A;  2R7V A;  2M9H A;  5D5V B;  2OCE A;  4XLH A;  3H92 A;  1OFC X;  1QA6 A;  4FTH A;  2VPR A;  4HLX A;  2JSC A;  2YPR A;  3S3M A;  2JMW A;  4NHJ A;  1YX3 A;  5ICG A;  1BA5 A;  1OMI A;  5HLI A;  2W82 A;  1VZ0 A;  2K9S A;  2OD5 A;  1RR8 C;  3BZK A;  5IP9 J;  1D5Y A;  3DU5 A;  5F08 A;  4OIO F;  4P1W A;  3M1E A;  2ELK A;  2VXD A;  4JX5 A;  4A5M A;  3KEY A;  3LSH A;  3SFZ A;  3ULQ B;  4BQN A;  2Z9O A;  3J7A O;  4NDL A;  1DP7 P;  1XTA A;  3I71 A;  4IOA F;  3GLX A;  4IEJ A;  4KIF A;  4LK0 F;  4HA8 A;  3ZXS A;  1LUJ B;  3BTJ A;  3D5R C;  2Q8K A;  5EF6 A;  2IPQ X;  4CCK A;  1GDT A;  2ZCW A;  2HZT A;  2F4O B;  4XKW A;  2VJI A;  4IQ4 A;  3BPV A;  2P81 A;  5DTD A;  1MBK A;  4H4K C;  2VQL A;  3IH2 A;  3BZC A;  3J7Z I;  4AC0 A;  4ZYE A;  5CJ9 A;  1QVT A;  2Y30 A;  2A69 F;  2KL4 A;  3KP2 A;  4F92 B;  1PYV A;  2M0C A;  3GTG J;  2X1E A;  1ACI A;  2M34 A;  5HVQ C;  5BOX A;  1S6L A;  3RJP A;  1FMW A;  4RGR A;  3I4M J;  4OMY A;  2TCT A;  3M9A A;  5LGU A;  4XOT A;  2E60 A;  4H0E A;  1A31 A;  1R5H A;  4JX6 A;  2HOA A;  3QYF A;  3H5R A;  3WTY C;  4AD9 A;  4E7I A;  2P0W A;  2KJC A;  1JTX A;  3NEU A;  1QBJ A;  4C2U A;  5FKM A;  2AQF A;  2RKH A;  1X1P A;  3U2R A;  4G8X A;  1IRZ A;  5DM7 F;  2V1X A;  1X58 A;  1G3Y A;  1RKT A;  2V7F A;  2LSO A;  5E20 A;  3TBI A;  4A2U A;  5HDG A;  3GME A;  5LEK A;  3KZI C;  5LLQ A;  2UXN A;  4HRI A;  1Y8Q B;  2L7Z A;  1F1Z A;  2HXI A;  2Z3Y A;  1MZB A;  3DBL B;  4R1H A;  5B1B H;  3KEQ A;  1PUF B;  3DBH B;  2W84 A;  3CO6 C;  2GA2 A;  2JPC A;  4MFD A;  3OYA A;  1D1A A;  3OYK A;  4D0P A;  2GA1 A;  3K70 D;  1FYL A;  3LSM A;  3OR1 C;  3AG1 H;  4PFP A;  3E6C C;  5EGO B;  2NAZ A;  1RNL A;  2BY3 A;  2KRC A;  1SD4 A;  3A03 A;  4HF2 A;  3I5U A;  1B1B A;  3FIS A;  4R8H A;  2RVC A;  3F72 A;  3H3U A;  3QOD A;  2V9P A;  2MLG A;  5D5X B;  4LG0 B;  2K3P A;  5FJ8 J;  5TRD A;  2IGM A;  2LKP A;  1MMN A;  3E5X A;  3WOD F;  1SC7 A;  5LHG A;  3TP0 A;  2RQQ A;  3OYG A;  3OSG A;  3TW6 A;  3H9G A;  3KPH A;  2XGX A;  1ZG5 A;  3S93 A;  1X2M A;  4P9F A;  2BW3 B;  2VBW A;  2VC1 A;  2HVQ A;  5J8C A;  1Z3X A;  2IEK A;  3KE2 A;  4F93 B;  2OZU A;  1Z1D A;  2XC7 A;  4M73 A;  3FXK A;  1UHM A;  3CCR I;  2VI6 A;  1T98 A;  1TLH B;  2ZB9 A;  3H0G J;  2DT5 A;  4QPQ A;  1BJZ A;  2MBF A;  3K9T A;  4NQW B;  4EVI A;  4KIB A;  2TRT A;  3RPU A;  4NC7 A;  4XKC A;  4M72 A;  4IF4 A;  3KYL A;  2R93 J;  5ERI A;  1XGO A;  3Q0U A;  2ZXJ A;  4YFX F;  3DPU A;  1PUE E;  4FE7 A;  2KLO A;  1V5F A;  1ZKG A;  3TDZ C;  1MD0 A;  3HYI A;  3HTS B;  3SQN A;  3M7G A;  1IC8 A;  3F6V A;  1ZEL A;  1FYM A;  2MLK A;  1B72 A;  5K7H A;  3EYY A;  4RBO A;  1J9I A;  2CQN A;  2FRH A;  2QWW A;  3DKW A;  1QQI A;  2IGN A;  1DUX C;  2EV5 A;  2Y31 A;  3FM3 A;  4IRH A;  4I99 C;  4OAZ A;  1K61 A;  2BE5 F;  1NH3 A;  2KFD A;  2Y69 H;  4L0Z B;  2WC2 A;  4IXA A;  2KIS A;  4HZF A;  5ED4 A;  2VQH A;  1IV6 A;  1UB9 A;  3BTI A;  4X0G A;  1Z3Y A;  3VFZ A;  1O7F A;  1JT0 A;  1S72 I;  1WFX A;  3R61 A;  1ULY A;  4I6Z A;  4IOC F;  2H8R A;  1OCZ H;  4XN0 A;  1X3W B;  3U9G A;  3WGG A;  4Y13 A;  1R36 A;  2MC4 A;  3J7Y J;  1G3T A;  2C6Y A;  3G1O A;  4LIT A;  2L3D A;  4AU7 A;  3VEP A;  1RPW A;  1YYV A;  4I02 A;  4RA2 A;  3FMR A;  4MO7 A;  5HS8 A;  1TQM A;  1MBJ A;  2F5F A;  3NWT A;  3RSN A;  4XLC A;  3P9K A;  1H0M A;  2V1N A;  2Y48 A;  1D0Y A;  1QZE A;  3CP2 A;  5H6R A;  4A0Z A;  2LRE A;  2RAE A;  2R7U A;  2XV4 S;  4PJL A;  4RS8 A;  2LBF B;  1TWF J;  4CYC A;  5ILS A;  2RV8 A;  2M2E A;  1YW8 A;  3GUD A;  3BJA A;  3OYL A;  1J2X A;  4XMY A;  2KZV A;  3ASO H;  3LSJ A;  3F0C A;  2RNG A;  3CDL A;  4GCV A;  3JRH A;  2IAI A;  1B8I A;  2L4M A;  3NAR A;  1BI3 A;  2XIG A;  3IH3 A;  4OAY A;  2YU3 A;  2M8G X;  2F6C A;  1YJ9 I;  2FSW A;  4BQA A;  1WJ5 A;  4BH9 A;  3CME I;  1P4W A;  1FBS A;  4C2M J;  1BM9 A;  3F8B A;  3MFK A;  1LE8 B;  2E1M C;  3H9J A;  3F8F A;  1SVL A;  3K2A A;  2ZSI B;  4XIC A;  3OYN A;  1YE9 A;  2K9Q A;  2LBF A;  4XNF A;  1STZ A;  3DEU A;  4I2O A;  4UNO A;  1LJ9 A;  4ETS A;  3B02 A;  4G7O F;  1IN6 A;  3VDX A;  2DA3 A;  1LEA A;  2RC4 A;  4WXD A;  3OYI A;  3CLO A;  1U6G A;  3FZV A;  5CLS A;  4HBL A;  3S8P A;  2BZT A;  3JCU C;  2XDV A;  2X51 A;  5TJJ A;  1V5G A;  5FKL A;  1IN5 A;  1YS7 A;  2DU9 A;  3F8C A;  4CCN A;  4RDU A;  2HVS A;  2LK2 A;  1D8J A;  3CCJ I;  1S5L C;  2DLL A;  2ME0 A;  2XGC A;  4IPA A;  2CRG A;  4EAT A;  2ZXW H;  1FBQ A;  3W3C A;  2XRO A;  2QBY B;  1UG0 A;  1X1C A;  1BI0 A;  3BZ6 A;  5KVR A;  4ZZL A;  5KK1 A;  1KQ0 A;  2QQ8 A;  2VPL A;  3E0J B;  1MNE A;  2R7R A;  2NS0 A;  5CQG A;  3WTV C;  2R5Z A;  4EJW A;  4GYI A;  3GW2 A;  2E71 A;  4CZC A;  1EKE A;  4HW0 A;  3CMY A;  1VQ8 I;  2BXZ A;  4R79 A;  1ZG1 A;  1UJ8 A;  1ZG3 A;  2H1L A;  2MD0 A;  1AHD P;  5JFR A;  1XPX A;  5ICE A;  1R7J A;  1VF9 A;  2M4G A;  2VN2 A;  3D0S A;  1IXR C;  1S7A A;  1PJR A;  2VKE A;  2GM4 A;  1Z05 A;  4FHT A;  2FEZ A;  1TWA J;  1YW9 A;  2CUF A;  2FUG 2;  1B4A A;  2ZXH A;  2OUM A;  3O3K A;  2HTS A;  4P5O A;  2L0K A;  2R7O A;  2NXN B;  1SEU A;  1ZLK A;  1MKM A;  1FC3 A;  2CUE A;  1TNS A;  3KLO A;  3PM1 A;  4ON0 A;  1KYW A;  3FXU A;  2Z2S B;  2EIJ H;  3ABK H;  2GIZ A;  3ERM A;  3KP7 A;  1MDM B;  3ECH A;  3PO2 J;  2VUM J;  2FX0 A;  1SVO A;  5JR3 A;  4BYY A;  2NS7 A;  2JRM A;  4LB6 B;  1QVU A;  3GTK J;  1BI1 A;  3HGY A;  3QOP A;  2F48 A;  4A3E J;  1X4O A;  1BL0 A;  2OTL I;  2WY7 Q;  3CO7 C;  2OC6 A;  5L3D A;  2NRA C;  2LTP A;  2DFE A;  2QKM B;  1DGR M;  2CS3 A;  2ZJQ F;  3OYF A;  2E1C A;  2E36 A;  2VKD A;  5EEG A;  5TGT A;  4XRS G;  3E5U A;  2DA4 A;  5E3L A;  2W57 A;  4LFU A;  4D1Q A;  1WJE A;  1ZRE A;  2I5U A;  5FO5 A;  1R1V A;  4TV7 A;  1VQP I;  2B0L A;  3RZD J;  3GXO A;  3TMO A;  2ECC A;  2L9N A;  2VXZ A;  2KKO A;  3QPS A;  3VWB A;  3IP4 B;  4KMF A;  5KNL A;  4UY8 I;  4UUS A;  1NK2 P;  2V6C A;  2EV6 A;  3G73 A;  2KRF A;  5L3B A;  3L2Q A;  3HOT A;  4AYB N;  2X4H A;  5JI6 A;  2DJN A;  1P9Q C;  4WXC A;  1HDP A;  4NBQ A;  4AIJ A;  4GRI A;  4U7B A;  5EZG A;  1O3T A;  3AL0 B;  2WAD A;  3VSL A;  4A3D J;  1WVR A;  1TT0 A;  1REP C;  4HX7 A;  5FLX Z;  1A5J A;  2QQ9 A;  1TZL A;  2Z16 A;  2H27 A;  4WK8 F;  1B9M A;  3CDI A;  4XL9 A;  1X3U A;  5JHF A;  1MW7 A;  3OYB A;  3EDP A;  3KP6 A;  2R7S A;  2WV1 A;  2ADU A;  4CYD A;  3PUF A;  3JRB A;  2EZH A;  5K5Q A;  3HDD A;  3D5L A;  1J7K A;  4HX4 A;  2MD5 A;  3WU0 A;  3SJM A;  5FKO A;  4BS9 A;  4DNC A;  2FNA A;  6PAX A;  1EH8 A;  4LG0 A;  2R3S A;  3SZT A;  1DDN A;  2WA0 A;  1WRJ A;  1OR7 A;  2QBY A;  4IHS A;  5DCM B;  2K02 A;  5EG0 B;  4YIR X;  3ABM H;  1LDK B;  1X4P A;  3A02 A;  1VI0 A;  4DW6 A;  2UZK A;  3H36 A;  5F0C A;  3HKZ A;  2DQL A;  2HQA A;  2QQA A;  2ZSH B;  3RYP A;  3L1P A;  1W5T A;  2DTZ A;  1R5G A;  5E8G A;  4ZJZ A;  2BW3 A;  1FPQ A;  2P8T A;  2IS1 A;  2MA3 A;  4M3E A;  2XGE A;  4ENN A;  1FLI A;  4D5C A;  2DMQ A;  5KHD A;  2AQE A;  2A3S A;  4DYR A;  5K5R A;  3FXR A;  3PSI A;  4NC8 A;  5CVV A;  3CCV I;  3WE2 A;  1XMA A;  3QYE A;  2M7B A;  2W1O A;  4UXN A;  4I76 A;  4IRG A;  3JTG A;  1BR2 A;  3CCQ I;  1ETK A;  2Y0M A;  3S17 J;  2EB7 A;  1FSE A;  2WAE A;  1A04 A;  4MIM A;  4QIW N;  4BJ6 C;  3A01 B;  3S3O A;  2R7X A;  5E17 F;  3A0B C;  5DDG A;  4LG3 A;  2H8W A;  2KQR A;  2Q2E B;  3BG6 A;  3ZQI A;  3HUG B;  4CHU A;  3JRA A;  1FOY A;  1KGS A;  1VND A;  3SZP A;  1X1A A;  1RET A;  4PCQ A;  1XC5 A;  2AXT C;  5EYR A;  2BHY A;  2QLZ A;  2ELH A;  3ZMD A;  1I50 J;  1FTZ A;  1UZC A;  2Y9Y A;  5H20 A;  3F8N A;  2DDA A;  3IWF A;  2NOG A;  2XF6 A;  5BNG A;  2CQK A;  4YFN F;  3F9K A;  2R7D A;  1KU9 A;  1V5E A;  1ZR4 A;  1ZR2 A;  2KIM A;  3V7R A;  1N25 A;  4A69 C;  2EIN H;  3S1R J;  2DMU A;  2AO9 A;  5D6E A;  1TWC J;  1JGG A;  3A0H C;  2ACJ A;  2X6X A;  2KMU A;  2BGC A;  3ABL H;  4N4O B;  3HOV J;  1O3Q A;  1BIA A;  1BR1 A;  2EBI A;  4RM2 A;  4YII A;  2A6T A;  5LD2 C;  3EUH C;  1QHH D;  3KCC A;  4HEA 2;  5J1U A;  2OV7 A;  4NNJ A;  5E3N A;  4A12 A;  1HBX G;  2CG4 A;  1YHQ I;  1JXS A;  4IL6 C;  3IRR A;  1Q1V A;  3HTU A;  3ZMV A;  4ESB A;  1JUM A;  5E18 F;  2XAG A;  1ZRD A;  3K4B A;  2M8E A;  3O6B B;  2VC0 A;  3HOS A;  4HF1 A;  4DBR A;  1IN4 A;  4KT6 A;  4B8X A;  1NG6 A;  1ZGJ A;  2X1C A;  1J75 A;  3FKJ A;  3VB2 A;  2D45 A;  3CCU I;  4X6A J;  2F5V A;  2XVC A;  4ESF A;  3SFI A;  1FBU A;  2IS6 A;  3K69 A;  3BG9 A;  1G3S A;  1VFC A;  4M71 A;  1IUF A;  2XAQ A;  1GXP A;  3DTI A;  2HDW A;  4LB5 A;  4NB5 A;  2P7V B;  1GVD A;  5HLT A;  3A2K A;  4XN3 A;  3BG7 A;  1I3A A;  5L3E A;  3VYU B;  2Q1Z B;  3I59 A;  5E1X A;  3IL2 A;  2LY9 A;  1ZN2 A;  4RB1 A;  1UEL B;  1Q1H A;  2FQ3 A;  3FK7 A;  3C18 A;  2E5N A;  2DOF A;  4G6T B;  4CCO A;  2FMY A;  1HW1 A;  1JHH A;  2Q0O A;  3DPL C;  3OL4 A;  4L5J A;  5TIS C;  4GYG A;  4FCY A;  1RRJ A;  1Z77 A;  4UV8 A;  5C44 J;  2MW8 A;  3AKZ A;  4JK1 X;  3E97 A;  4Y7N J;  1U8B A;  1B9N A;  2B7E A;  1JJ8 C;  1D0X A;  1MBG A;  5HS9 A;  4ANJ A;  1HF0 A;  2OCC H;  3L2V A;  2OQR A;  2Z99 A;  3HPG A;  4QTR A;  3PIP F;  1U2W A;  3RQ4 A;  4BU2 A;  2ISZ A;  4ZYH A;  2JVG A;  3QPT A;  3GZN B;  1ZYR F;  3OL3 A;  2EIL H;  3E3V A;  1HQC A;  3O2P E;  2EV0 A;  2DMP A;  3K1M A;  1VQM I;  4HPQ A;  2O8K A;  4O5V A;  2E5Z A;  3JW4 A;  1IAW A;  2DFI A;  4BE1 A;  3ASN H;  2VBX A;  1IXC A;  2HOT A;  4EJU A;  2XRL A;  4M9S A;  5FD6 A;  3L7W A;  5AIP A;  1U8R A;  1FJL A;  1MSF C;  3VYR B;  3NAU A;  3BOQ A;  3KEO A;  4ZYG A;  4BAY A;  2B63 J;  3U21 A;  2DW4 A;  1T33 A;  5FD5 A;  3QPH A;  5AIQ A;  4HV5 A;  3G6E I;  3FF5 A;  2ISY A;  4LLN A;  2DA1 A;  5D6F A;  2KDO A;  2X48 A;  1J09 A;  1UCR A;  5LHH A;  3MD2 A;  2M7A A;  4RAF A;  1ON2 A;  2WBM A;  3S2W A;  3RYR A;  1WH7 A;  2QQB A;  3C3W A;  3ML6 A;  2LKS A;  4AIH A;  2JZY A;  1OCP A;  3QOE A;  2L54 A;  1TT5 B;  2XSJ C;  3E6B A;  1S7O A;  4EM0 B;  1PDN C;  2OPT A;  2LD5 A;  5BPD A;  4IZZ A;  1J5Y A;  4MTE A;  1IRX A;  3LA3 A;  3REO A;  3J7A Y;  1X2N A;  2B9S A;  1Y1V J;  5GAD J;  1HC8 A;  3CES A;  2DPD A;  3LOC A;  5FFX A;  3MMY B;  3ZP5 A;  2LOO A;  3D1N I;  4NQW A;  5GP9 A;  2AXL A;  1P6R A;  4O3M A;  2X6Y A;  3PNT A;  2BY2 A;  3C1D A;  1F5T A;  3QQA A;  4JQF A;  5J4Y A;  4RLF A;  4E6K G;  4HX8 A;  4B47 A;  2VOO A;  2I8D A;  2HPI A;  1U9N A;  1MBH A;  2ECB A;  1R4N B;  2GLO A;  1W4M A;  1PVE A;  2NNY A;  2RQP A;  1QO0 D;  1HKS A;  3JRG A;  4HNT A;  2JSP A;  4V2F A;  1Z67 A;  3ELK A;  4G94 A;  2HYG D;  5GAE J;  1OJL A;  2EJR A;  3DLL F;  5D5W B;  4CYC B;  2O9L A;  2QVO A;  1RUN A;  4ZC3 A;  3H35 A;  3NRV A;  3CTA A;  1OCC H;  5B5E C;  3RI4 A;  5GTH C;  4LLG F;  2XKO A;  1R1T A;  5KCM A;  5DV5 A;  5JLX A;  5CKT A;  5K5O A;  3PNY A;  1TL8 A;  2K4J A;  2CW0 F;  3CJQ B;  4BE2 A;  2QF7 A;  1ZAO A;  4QPO A;  2XF7 A;  3HXL A;  3OMY A;  2V9K A;  1Y6I A;  3J81 Z;  2JA2 A;  3SEZ A;  4WXH A;  4I01 A;  3LSR A;  1ETO A;  4S0H B;  4AIK A;  4BUP A;  2DFH A;  2L7K A;  1MJ9 A;  1HDD C;  4EM1 A;  3K6G A;  4XLP F;  5F1J A;  2QA4 I;  3K2Z A;  1ZRC A;  2LF7 A;  4PJN A;  3S3N A;  5LRR A;  1YRN A;  4WCG A;  2EZL A;  1VQ5 I;  4A3F J;  1MBE A;  4EJO A;  2F5E A;  5B1A H;  3DKX A;  4CCL A;  1BJA A;  2LH9 A;  3DF8 A;  2MSY A;  4Z6Y A;  2HEO A;  3CC2 I;  2X6W A;  4HSR A;  2DOD A;  2YX4 A;  3WG7 H;  4A0X A;  2EQR A;  3PNV A;  3EUK L;  3OYE A;  5KAF C;  2VE8 A;  5J1Y A;  4AVZ A;  1I6X A;  3T1B A;  5HOD A;  3L2W A;  4AID A;  3AL0 C;  2DTR A;  3BT9 A;  3FIW A;  2QSG X;  2E2H J;  2OBP A;  5HDN A;  2HYJ A;  2BVL A;  1I27 A;  4F7Z A;  2O8X A;  5JLW A;  3Q0V A;  4DYQ A;  2QGU A;  5LRS A;  2L9S A;  1G4D A;  2DYS H;  2CGP A;  4HST A;  5EEA A;  1RR7 A;  1FOK A;  4OMZ A;  1LNW A;  2R7T A;  2MFZ A;  4UUT A;  3S16 J;  2O61 A;  3HOY J;  1FMV A;  3WHB A;  1E3H A;  5ILV A;  1XB4 A;  2GXG A;  2WB1 A;  1I1S A;  5JHU A;  3DPT A;  2E19 A;  5E1W A;  4ENK A;  4XRS A;  2Z33 A;  4DOZ A;  1QPI A;  3G2B A;  3K70 C;  5IYB J;  1PP7 U;  1IW7 F;  3OS2 A;  3BLY A;  1D1B A;  1SFK A;  1K78 A;  2W00 A;  3FM5 A;  2M3A A;  3DCF A;  1XDS A;  2WAQ A;  2JN6 A;  1IZ1 A;  5FKN A;  1W1W E;  5L3G A;  1O3S A;  4UV9 A;  1JHF A;  4V19 K;  2EWN A;  2ZME A;  5IT3 A;  4OIQ F;  2CV0 A;  3G4S I;  2QEN A;  1AOY A;  1K79 A;  1WCM J;  1LE8 A;  5FRM A;  2ETH A;  4MTD A;  1DU6 A;  4F3Q A;  3BR6 A;  1QU3 A;  4M3D A;  2QUF A;  2P5V A;  2XAJ A;  3M4O J;  3MAJ A;  2M4K A;  1NHA A;  1YIT I;  3R0A A;  1T08 B;  3DP7 A;  2KIQ A;  5E3M A;  2LR8 A;  1H9T A;  4G7H F;  2YSR A;  2XUB A;  2HKX A;  1R6R A;  1LVA A;  2M0M A;  4UVC A;  1MBF A;  3G71 I;  2PEX A;  2JUC A;  1WGX A;  3T8T A;  2A68 F;  4CO8 A;  4RGS A;  1FOX A;  4C2T A;  3ECO A;  3HSE A;  1Y8R B;  3N97 A;  1YLF A;  3JRD A;  2WB1 N;  1GHC A;  1MIJ A;  1XSX A;  2PX9 A;  2V6E A;  5CYV A;  1ONV A;  2EPF A;  1FNN A;  2DCE A;  1OIS A;  2KZG A;  4I0B A;  3P9C A;  1XMX A;  3DLA A;  4KUM A;  1ETY A;  2IS2 A;  2MGQ A;  1LB2 A;  2HTJ A;  3FBI B;  1EJ9 A;  3Q9V A;  4M9X A;  1I1G A;  3BR3 A;  2NVY J;  2A6H F;  2DMN A;  1NK3 P;  1BOA A;  4II3 A;  2OJE D;  3TO6 A;  4KDP A;  2V26 A;  3WTU C;  3WG9 A;  4XR6 A;  3CCL I;  4RAY A;  2QSF X;  1VQL I;  3OWT A;  2XPW A;  4MLO A;  4A3I J;  2A61 A;  2K86 A;  3CUQ A;  2IW5 A;  4XBF A;  4XRM A;  2PFB A;  3A01 A;  3OS0 A;  1JTY A;  1X1D A;  4IJA A;  3OYM A;  2O3F A;  1YJW I;  1FIA A;  3G1L A;  3H0D A;  1YTY A;  3WTS C;  5LBQ A;  1WPK A;  1QRY A;  1YIO A;  5FFZ A;  3SZG A;  3Q9S A;  1M1E B;  3HRT A;  3PQK A;  1H9G A;  2CUZ A;  2DK5 A;  2R5Z B;  4IHY A;  2PMH A;  2HR3 A;  2FD5 A;  2JVH A;  3WE3 A;  2ZJ2 A;  3F3X A;  3FK6 A;  4BAC A;  1IGN A;  4B43 A;  1IRG A;  1P92 A;  1OKR A;  1RES A;  1O4X A;  1ON1 A;  2J5O A;  3GFJ A;  4A3G J;  1XDU A;  3DWL E;  4OIR F;  4BQO A;  3IKT A;  3RZO J;  5K1Y A;  3FBN B;  2HYF A;  4A3K J;  3GBG A;  3S32 A;  1T0F A;  3JSP A;  3PFI A;  4LGW A;  4DJA A;  4LOC A;  4IRI A;  2CV1 A;  4CUG A;  3I53 A;  2E2J J;  3BDD A;  5J4V A;  4N9H A;  3DEW A;  1DGW Y;  5J1R A;  3M8F A;  3DFG A;  2PBI A;  2VOP A;  1POG A;  1WWX A;  1XX5 A;  2IA1 A;  1T6S A;  3DKY A;  3ROU A;  3R60 A;  3E7L A;  2MG4 A;  3QU3 A;  4HOB A;  4IHT A;  1JKR C;  1W5S A;  2OF7 A;  3TO7 A;  1LEB A;  2HXO A;  4U0Y A;  3TOA A;  1MMS A;  1W7P B;  1WJC A;  1XGN A;  1HSJ A;  5DCM A;  1ERD A;  1K6O A;  3ZMZ A;  4HYE A;  3SYT A;  3LSG A;  4G6D A;  5GAG J;  1V3F A;  4II2 A;  1TQP A;  3FKI J;  4MHG A;  5KAI C;  2G7H A;  3PO3 J;  4N4N B;  2D5V A;  3QP6 A;  1BC8 C;  4G7Z F;  4RGU A;  3N4M A;  2R4G A;  4IKF A;  1A36 A;  3ONQ A;  3GFL A;  4UUS B;  1B6A A;  2K9L A;  2XKP A;  1SFU A;  4BBS J;  1ZGW A;  3BRO A;  1IN8 A;  1W0T A;  5JVG F;  3KP3 A;  2J5P A;  3MKW B;  2G9W A;  3LWF A;  5EJC A;  5ICF A;  3RTR A;  3S2H J;  4KIS A;  1P4X A;  2L7M P;  2W4S A;  3IWZ A;  4JP0 A;  3WU2 C;  3HSR A;  3TOB A;  4CCJ A;  2P5L C;  3HB9 A;  3QWL A;  2EIK H;  4OIN F;  2N8G A;  4G9Y A;  1VQK I;  5L3F A;  3CJT B;  2VBZ A;  3FMS A;  2FU4 A;  1G8X A;  5A2Q Z;  2R7Z J;  1W7P A;  2P4W A;  2HFH A;  5F64 A;  3OOP A;  2M1B A;  4C3J J;  2MAB A;  3CLQ A;  2CV2 A;  2R7Q A;  4RB2 C;  1R4M B;  1T39 A;  2XRN A;  2E1O A;  4KN7 X;  1QZY A;  2ZFW A;  3HEF A;  3LNQ A;  2M87 A;  3C2B A;  1K4S A;  3FXO A;  2ICW G;  4EJV A;  2DDB A;  1HLV A;  3LSK A;  3P7N A;  3FWE A;  1QNT A;  1VQ9 I;  2NS8 A;  4XM3 A;  5IT9 K;  4E4H A;  1JE8 A;  3I59 B;  2DJI A;  4EQQ A;  3MN2 A;  1VQO I;  1YS6 A;  1RIO H;  4XOP A;  3GTP J;  4AWX B;  1W5C C;  5C4J J;  3MVP A;  1WHU A;  2V1U A;  2KP6 A;  1A35 A;  3ZMU A;  1YG2 A;  3ZMT A;  1FZP B;  4J00 A;  3BCA A;  1SVM A;  3FXM A;  1Z7U A;  1FWZ A;  2R5Y B;  1N78 A;  2WWY A;  2UWM A;  2CFX A;  1BBY A;  4E7S A;  1OCT C;  1LPQ A;  3LQQ A;  3X2Q H;  3H3Z A;  4HQM A;  3C2G A;  4DIQ A;  4B44 A;  1E3P A;  3ZR8 X;  1EH6 A;  2R7F A;  5CVJ A;  4M6Y A;  2CQX A;  4I7H A;  3JAM K;  1OYY A;  2E2I J;  1OQY A;  4Y3O A;  3ZQQ A;  3JRE A;  4QSH A;  4MQ9 F;  4D7N A;  2KT0 A;  3T8R A;  2DN0 A;  3F23 A;  3M8E A;  1VTN C;  2WAQ N;  2UV1 A;  3IAS 2;  3BTL A;  4YRV A;  1F43 A;  3S1N J;  9ANT A;  1MND A;  1GXQ A;  3OIP A;  4EJT A;  3K4L A;  5J8F A;  4U0W A;  2XF5 A;  1JGS A;  3BC8 A;  5IPA A;  2YS9 A;  4AYB A;  3CC7 I;  2KIF A;  3FDY A;  2O0Y A;  3GYH X;  1APL C;  1UAA A;  5K7F A;  2ESH A;  2JT1 A;  2P5K A;  3NQO A;  3CD6 I;  1XSV A; 
#chains in the Genus database with same CATH homology
 1S29 A;  2E1N A;  3LA2 A;  4M6X A;  4QLC U;  2GAU A;  4N9I A;  1SFE A;  3WTZ A;  4S05 A;  2IA2 A;  4WF2 A;  3B73 A;  4FX4 A;  1TNT A;  2ZNZ A;  4BHP A;  2JPB A;  3F21 A;  1IXS B;  5BS6 A;  4K2E A;  5HLG A;  2FBI A;  5A2Q K;  3FMQ A;  5HOO A;  4KNY A;  3GFI A;  5CVI A;  3LST A;  3E6D A;  4QWQ A;  1J0R A;  1I5Z A;  2OA4 A;  2ZO4 A;  1IUY A;  4S04 A;  1EV7 A;  3KET A;  4ZZD A;  4A6D A;  1GVJ A;  2G7U A;  4O6J A;  3I0T A;  1U5T A;  3CUQ B;  2EFW A;  2H94 A;  2LF8 A;  3ABU A;  5BMZ A;  1KU3 A;  3HUG A;  1OYW A;  3J80 Z;  4L18 B;  5LGN A;  2DPU A;  2A6E F;  1RI7 A;  4BHC A;  4LJZ F;  2VBY A;  4CGZ A;  1IF1 A;  4ZYD A;  4YG2 F;  3G3Z A;  4MEY F;  1B59 A;  2IT0 A;  1S8N A;  3TKY A;  3COA C;  5HDK A;  4YFK F;  3CUO A;  4L5I A;  1USS A;  3L09 A;  1WI9 A;  1D3Y A;  1KU7 A;  3HRU A;  4HLY A;  3Q5F A;  2NNN A;  2OAZ A;  1HXD A;  3DV8 A;  3KZZ A;  3RDI A;  1P4A A;  3EQL F;  2HWV A;  2KIU A;  1U78 A;  1ZRF A;  1QGP A;  3AAF A;  1SAX A;  1L0O C;  3GVA A;  1T38 A;  4LLL A;  3FX3 A;  2EFN A;  4MNU A;  2ZBK A;  3V8J A;  1U3E M;  4XSZ F;  1IN7 A;  3ZQ7 A;  3CUQ C;  2HS5 A;  4GXO A;  3MEX A;  2EFQ A;  4BHB A;  1ZLJ A;  4MQV A;  3GEZ A;  3ERE D;  4MEX F;  2ZME B;  2FML A;  2XAF A;  3GF2 A;  1MJA A;  1FSH A;  4HF0 A;  1XGS A;  2BYV E;  5DEQ A;  2XHK A;  1K78 B;  1FYK A;  2DBB A;  2ESN A;  2DI3 A;  5DD8 A;  2HDC A;  2VT3 A;  3I58 A;  4ENM A;  2FBH A;  3EUH A;  4KMU X;  2RDP A;  3CJN A;  1KYZ A;  1ZH5 A;  4M74 A;  3E5Q A;  4OIP F;  1AWC A;  3R4K A;  1ZAR A;  2DK8 A;  4KA4 A;  3RPQ A;  3F6O A;  1YO5 C;  4HDU A;  2D1H A;  4Y15 A;  1K7A A;  2F2E A;  2X0L A;  1XN7 A;  3K0L A;  2L4A A;  1ODD A;  2VOD A;  1Z6T A;  3WU1 B;  3WTX C;  3QU6 A;  5D4S A;  3RIR A;  3F22 A;  1TW2 A;  2W24 A;  1QZZ A;  2EK5 A;  4G6Q A;  1Z9C A;  4FX0 A;  3IHU A;  3ZPL A;  1R1U A;  4A6E A;  2IJL A;  4OOI A;  3V8L A;  3QAH A;  1OYI A;  4I98 B;  3ZMS A;  1HKT A;  2GZW A;  3HRM A;  1FX7 A;  4WWC A;  4LD5 A;  5LEJ A;  2FNP A;  1BC7 C;  1UFM A;  4Q47 A;  1O57 A;  3IRQ A;  4PDK A;  5ICC A;  3SXY A;  5LHI A;  5DD4 A;  1WSU A;  5JVT A;  1Y0U A;  2QM3 A;  2P7C B;  1FP2 A;  3DQV C;  2CO5 A;  2L02 A;  5J6X A;  5LGT A;  2PG4 A;  3MQ0 A;  4Q5S F;  2YR2 A;  2D1V A;  1T2K A;  1SMY F;  4RAZ A;  2V9V A;  1SFX A;  3OV8 A;  3W6K B;  2F5C A;  1KQ9 A;  1BN5 A;  2IRF G;  2OU2 A;  1HKQ A;  4RB0 A;  5EEH A;  1J59 A;  3BPX A;  3DXJ F;  3FHZ A;  2STT A;  2GWR A;  2LNB A;  4L9T A;  2FE3 A;  4MGR A;  1CF7 B;  2GXB A;  2EA2 A;  2LDU A;  5D8L B;  4L9V A;  1FP1 D;  1L3L A;  1F4K A;  1U5T C;  2BV6 A;  1P2F A;  2L01 A;  1UHW A;  3K1N A;  2RN7 A;  3HSF A;  3I54 A;  2HKO A;  3TQN A;  1D8K A;  4KFC A;  2PN6 A;  5DCF A;  3WGH A;  2JTV A;  3HIF A;  3GZ6 A;  1Z6R A;  3CDH A;  4KN4 X;  2M45 A;  4ASN A;  3L2C A;  3BP8 A;  2JRT A;  2MC3 A;  1C0W A;  3KP5 A;  1TW3 A;  2UXX A;  2FOK A;  4EV0 A;  1TTY A;  3TO9 A;  2FA5 A;  4L9N A;  2Y75 A;  3BY6 A;  2XAS A;  3LQR A;  2PQ8 A;  1XD7 A;  4XLN F;  1TBX A;  3L00 A;  2QZ8 A;  4IVN A;  3WTT C;  4JBA A;  2HGC A;  3MWM A;  2XAH A;  3JTH A;  4RB3 C;  1Z91 A;  2GQQ A;  1KQ8 A;  3BJO A;  2FF4 A;  2TDX A;  3ZN0 A;  2DQR A;  1ZHF A;  4YIF A;  3GO5 A;  4CIC A;  4B09 A;  3F8M A;  4LK1 F;  5F6F A;  2A07 F;  1U5T B;  3T5X A;  3V7S A;  3I64 A;  3IC7 A;  4P96 A;  4BXU A;  3MZH A;  1G3W A;  4OU0 A;  2E7W A;  4PGG A;  4PZJ A;  2GIV A;  1E2X A;  4PGH A;  1RUO A;  2PLY A;  2V1D A;  3WGI A;  1HW5 A;  3BWG A;  2OQG A;  2OZ6 A;  1XSD A;  4FT8 A;  3R6S A;  1F9N A;  3RKX A;  2MH2 A;  5DYM A;  3J80 K;  3RKW A;  3J81 K;  1WQ2 A;  2H6C A;  3R0J A;  1EH7 A;  4U88 A;  1RZ4 A;  3T0Y A;  2COM A;  2IVM A;  5CVR A;  1LQ1 A;  2CYY A;  2PMU A;  1TQI A;  2IA0 A;  2WV0 A;  1LDD A;  2M5W A;  4Y17 A;  4Q4Z F;  2ZNY A;  5FLX K;  3PQJ A;  4ESJ A;  4DQ2 A;  3FXQ A;  2BBY A;  4ENJ A;  3V8K A;  1OPC A;  3HRS A;  4P9U A;  2K7L A;  2PJP A;  4WX9 A;  2NYX A;  3WTW C;  1WKM A;  3MCZ A;  4KT5 C;  5AON A;  2A5Y B;  4EGZ A;  1FT9 A;  4U0V A;  3VOD A;  4CXF A;  2KJB A;  2FXA A;  4UVA A;  4XSX F;  1KA8 A;  2D2W A;  1MGT A;  2HOE A;  5FB2 A;  2FBK A;  4UHT A;  4CDG A;  1DPR A;  1R23 A;  2F5D A;  4KYW A;  2CWE A;  3HHG A;  3KZY A;  4LMY A;  3V7C A;  1HW2 A;  3W6J B;  2K27 A;  5CVU A;  1IRF A;  2K4B A;  1FY7 A;  3C7J A;  2O03 A;  4UUV A;  5BPI A;  4AVP A;  3E6M A;  1UST A;  5D4R A;  1PP8 F;  3LFK A;  2MH9 A;  1CGP A;  1DPU A;  3QRF F;  3TDU C;  1BI2 A;  2VT2 A;  1W7P D;  4XRF A;  3P9I A;  4L9J A;  3V4G A;  3BJ6 A;  3GWZ A;  5H6Q A;  4BNC A;  5E8I A;  4A0Y A;  3EYI A;  4P55 A;  3ZN1 A;  1D5V A;  3GZ5 A;  1O7L A;  2WTE A;  4HDV A;  2BEO A;  2M30 A;  2EFO A;  3JAM Z;  1E17 A;  2STW A;  1R00 A;  1YW7 A;  1YFH A;  2H6B A;  3GFM A;  4E70 A;  4KIG A;  4I09 A;  2P6T A;  1KU2 A;  3ABT A;  3RKY A;  1HST A;  4L0Y B;  1R58 A;  2YX7 A;  4N0B A;  2V79 A;  3L9F A;  1SMT A;  5ILU A;  3IKV A;  3U1D A;  4HAM A;  3VOE A;  4UVB A;  5DUI A;  5E1Z B;  4M9Z A;  4A5N A;  4Z2Y A;  1ZGA A;  3KLN A;  4KIC A;  4HV6 A;  2HQN A;  2DAO A;  3KP4 A;  3I4P A;  3HHH A;  4Q48 A;  2EA4 A;  3QP5 A;  2RNJ A;  4CZZ A;  1CF7 A;  1S3J A;  1YQA A;  2VE9 A;  1V4R A;  2CSO A;  1R22 A;  2DO7 A;  5FGM A;  1MDM A;  1SD6 A;  1O3R A;  5D5U B;  2O6G E;  5HS7 A;  5BQT A;  1BIB A;  2IP2 A;  4GGG A;  3SHF A;  5HLH A;  2EFP A;  1LDJ A;  4RGX A;  4U7D A;  2P6S A;  1XCB A;  2QYO A;  2RGV A;  3LAJ A;  3LAP A;  1XCV A;  2W85 A;  3EET A;  4ZH4 F;  4GO1 A;  2ZKZ A;  5IT9 Z;  1XGM A;  2PI0 A;  2Q2E A;  2VON A;  4I0A A;  3LA7 A;  3K1P A;  3KFW X;  3ISP A;  1SD5 A;  1G6N A;  1QPM A;  4EGY A;  1MJB A;  5L3C A;  5DUK A;  3MZY A;  4EMS A;  5F1R A;  2W25 A;  2HQR A;  3TGN A;  1SD7 A;  5D8K B;  2Z5U A;  4EM2 A;  3GX4 X;  3JSO A;  1XMK A;  2AS5 F;  2H09 A;  2E7X A;  4HQE A;  5D5V B;  3H92 A;  4HLX A;  2JSC A;  2YPR A;  4NHJ A;  5ICG A;  1OMI A;  5HLI A;  2OD5 A;  4OIO F;  3M1E A;  2Z9O A;  4A5M A;  3J7A O;  3SFZ A;  3ULQ B;  1DP7 P;  3I71 A;  3GLX A;  4KIF A;  4LK0 F;  4HA8 A;  2Q8K A;  2IPQ X;  2ZCW A;  2HZT A;  3BPV A;  4ZYE A;  5CJ9 A;  2A69 F;  3KP2 A;  5HVQ C;  5BOX A;  1S6L A;  3RJP A;  4RGR A;  4OMY A;  3M9A A;  5LGU A;  4H0E A;  1R5H A;  3WTY C;  4AD9 A;  2KJC A;  1QBJ A;  3NEU A;  2RKH A;  3U2R A;  4G8X A;  2V1X A;  1G3Y A;  2LSO A;  5E20 A;  4A2U A;  5HDG A;  5LEK A;  5LLQ A;  2UXN A;  1F1Z A;  2Z3Y A;  1MZB A;  4R1H A;  3KEQ A;  2W84 A;  3CO6 C;  2GA2 A;  2JPC A;  4D0P A;  2GA1 A;  1FYL A;  3E6C C;  2NAZ A;  1RNL A;  1SD4 A;  4HF2 A;  3I5U A;  1B1B A;  4R8H A;  2RVC A;  3F72 A;  3H3U A;  4LG0 B;  2MLG A;  5D5X B;  5TRD A;  3E5X A;  2LKP A;  3WOD F;  5LHG A;  2XGX A;  1ZG5 A;  4P9F A;  2VC1 A;  2VBW A;  5J8C A;  3KE2 A;  2OZU A;  1Z1D A;  4M73 A;  1UHM A;  1T98 A;  1TLH B;  2DT5 A;  2MBF A;  3K9T A;  4EVI A;  4KIB A;  3RPU A;  4M72 A;  4IF4 A;  5ERI A;  1XGO A;  2ZXJ A;  4YFX F;  1PUE E;  3TDZ C;  1MD0 A;  3HYI A;  3HTS B;  3SQN A;  3M7G A;  3F6V A;  1FYM A;  2MLK A;  3EYY A;  1J9I A;  2FRH A;  2QWW A;  3DKW A;  1QQI A;  1DUX C;  2EV5 A;  3FM3 A;  4IRH A;  2BE5 F;  4L0Z B;  2WC2 A;  4IXA A;  4HZF A;  5ED4 A;  1UB9 A;  3VFZ A;  1O7F A;  3R61 A;  1ULY A;  3U9G A;  3WGG A;  4Y13 A;  1R36 A;  1G3T A;  2C6Y A;  2L3D A;  3VEP A;  1YYV A;  4I02 A;  3FMR A;  5HS8 A;  1TQM A;  2F5F A;  3P9K A;  1H0M A;  2Y48 A;  5H6R A;  4A0Z A;  2XV4 S;  4RS8 A;  5ILS A;  2RV8 A;  1YW8 A;  3GUD A;  3BJA A;  1J2X A;  4GCV A;  2L4M A;  1BI3 A;  2XIG A;  2YU3 A;  2FSW A;  4BQA A;  4BH9 A;  1P4W A;  1FBS A;  1BM9 A;  3F8B A;  3MFK A;  3F8F A;  1STZ A;  3DEU A;  4I2O A;  4UNO A;  1LJ9 A;  4ETS A;  3B02 A;  4G7O F;  1IN6 A;  1LEA A;  2RC4 A;  4WXD A;  3CLO A;  1U6G A;  3FZV A;  5CLS A;  4HBL A;  5TJJ A;  1IN5 A;  1YS7 A;  2DU9 A;  3F8C A;  1D8J A;  2DLL A;  4IPA A;  1FBQ A;  2XRO A;  2QBY B;  1BI0 A;  3BZ6 A;  5KVR A;  4ZZL A;  5KK1 A;  1KQ0 A;  2NS0 A;  3WTV C;  4EJW A;  4GYI A;  3GW2 A;  4HW0 A;  4R79 A;  1ZG1 A;  1ZG3 A;  5JFR A;  5ICE A;  1R7J A;  2VN2 A;  3D0S A;  1IXR C;  1S7A A;  1Z05 A;  4FHT A;  2FEZ A;  1YW9 A;  1B4A A;  3O3K A;  2HTS A;  4P5O A;  1ZLK A;  1MKM A;  1FC3 A;  3KLO A;  1TNS A;  4ON0 A;  1KYW A;  3FXU A;  3KP7 A;  1MDM B;  3ECH A;  5JR3 A;  4BYY A;  4LB6 B;  1BI1 A;  3QOP A;  3CO7 C;  5L3D A;  2NRA C;  2E1C A;  5EEG A;  3E5U A;  2W57 A;  4LFU A;  1ZRE A;  5FO5 A;  1R1V A;  4TV7 A;  2B0L A;  3GXO A;  2VXZ A;  2KKO A;  4KMF A;  2V6C A;  2EV6 A;  3G73 A;  2KRF A;  5L3B A;  3HOT A;  2X4H A;  5JI6 A;  4WXC A;  4AIJ A;  4U7B A;  1O3T A;  1REP C;  4HX7 A;  5FLX Z;  2QQ9 A;  2H27 A;  4WK8 F;  1B9M A;  1X3U A;  3EDP A;  3KP6 A;  2ADU A;  4CYD A;  5K5Q A;  3D5L A;  1J7K A;  4HX4 A;  2MD5 A;  3WU0 A;  4DNC A;  2FNA A;  6PAX A;  1EH8 A;  4LG0 A;  2R3S A;  3SZT A;  1DDN A;  1WRJ A;  1OR7 A;  2QBY A;  4IHS A;  5DCM B;  2K02 A;  1LDK B;  2UZK A;  2DQL A;  2QQA A;  3RYP A;  1W5T A;  1R5G A;  5E8G A;  1FPQ A;  2P8T A;  2MA3 A;  1FLI A;  4ENN A;  2A3S A;  5K5R A;  3FXR A;  5CVV A;  3WE2 A;  1XMA A;  4UXN A;  4IRG A;  3JTG A;  2Y0M A;  2EB7 A;  1FSE A;  1A04 A;  5E17 F;  5DDG A;  4CHU A;  1KGS A;  3SZP A;  4PCQ A;  2QLZ A;  2ELH A;  3ZMD A;  5H20 A;  3F8N A;  3IWF A;  2CQK A;  4YFN F;  2R7D A;  1KU9 A;  2KIM A;  3V7R A;  5D6E A;  2ACJ A;  2BGC A;  1O3Q A;  1BIA A;  4YII A;  3KCC A;  4A12 A;  1HBX G;  1JXS A;  2CG4 A;  3IRR A;  3HTU A;  3ZMV A;  4ESB A;  5E18 F;  2XAG A;  1ZRD A;  2M8E A;  3O6B B;  2VC0 A;  3HOS A;  4HF1 A;  1IN4 A;  4B8X A;  1ZGJ A;  1J75 A;  3VB2 A;  2D45 A;  2XVC A;  4ESF A;  1FBU A;  3K69 A;  1G3S A;  4M71 A;  2XAQ A;  1GXP A;  4LB5 A;  4NB5 A;  2P7V B;  5L3E A;  3I59 A;  5E1X A;  3IL2 A;  1ZN2 A;  4RB1 A;  2FQ3 A;  1Q1H A;  3C18 A;  2FMY A;  1HW1 A;  1JHH A;  2Q0O A;  3DPL C;  4L5J A;  4GYG A;  4UV8 A;  4JK1 X;  3E97 A;  1B9N A;  5HS9 A;  2OQR A;  2Z99 A;  1U2W A;  2ISZ A;  4ZYH A;  3QPT A;  1ZYR F;  3E3V A;  1HQC A;  3O2P E;  2EV0 A;  3K1M A;  4O5V A;  3JW4 A;  1IAW A;  2DFI A;  2VBX A;  1IXC A;  4EJU A;  4M9S A;  5FD6 A;  3L7W A;  5AIP A;  1U8R A;  3BOQ A;  3KEO A;  4ZYG A;  4BAY A;  2DW4 A;  5FD5 A;  5AIQ A;  3QPH A;  4HV5 A;  3FF5 A;  2ISY A;  4LLN A;  5D6F A;  1UCR A;  5LHH A;  1ON2 A;  3S2W A;  3RYR A;  2QQB A;  3C3W A;  3ML6 A;  4AIH A;  2JZY A;  2L54 A;  3E6B A;  1S7O A;  4EM0 B;  1PDN C;  5BPD A;  1J5Y A;  4MTE A;  3LA3 A;  3REO A;  2DPD A;  5FFX A;  3ZP5 A;  4NQW A;  2AXL A;  1P6R A;  4O3M A;  3C1D A;  1F5T A;  4JQF A;  4HX8 A;  2VOO A;  1W4M A;  2NNY A;  2RQP A;  1QO0 D;  1HKS A;  3ELK A;  4G94 A;  2HYG D;  2EJR A;  5D5W B;  2QVO A;  1RUN A;  3NRV A;  3CTA A;  3RI4 A;  4LLG F;  2XKO A;  1R1T A;  5DV5 A;  5K5O A;  2K4J A;  2CW0 F;  1ZAO A;  3J81 Z;  4WXH A;  4I01 A;  4AIK A;  1MJ9 A;  4EM1 A;  4XLP F;  3K2Z A;  1ZRC A;  2LF7 A;  5LRR A;  4WCG A;  4EJO A;  2F5E A;  1BJA A;  3DF8 A;  2HEO A;  2YX4 A;  4A0X A;  2VE8 A;  1I6X A;  3T1B A;  2DTR A;  2OBP A;  5HDN A;  1I27 A;  4F7Z A;  2O8X A;  5LRS A;  1G4D A;  2CGP A;  1FOK A;  4OMZ A;  1LNW A;  2O61 A;  5ILV A;  1XB4 A;  2GXG A;  1I1S A;  5JHU A;  3DPT A;  5E1W A;  4ENK A;  2Z33 A;  1PP7 U;  1IW7 F;  1K78 A;  3FM5 A;  1XDS A;  1IZ1 A;  5L3G A;  1O3S A;  4UV9 A;  1JHF A;  2EWN A;  2ZME A;  5IT3 A;  4OIQ F;  2QEN A;  1AOY A;  1K79 A;  2ETH A;  4MTD A;  2QUF A;  2P5V A;  2XAJ A;  3MAJ A;  1NHA A;  3R0A A;  3DP7 A;  1H9T A;  4G7H F;  2YSR A;  2XUB A;  2HKX A;  1LVA A;  4UVC A;  2PEX A;  3T8T A;  2A68 F;  4CO8 A;  4RGS A;  3ECO A;  3HSE A;  3N97 A;  1YLF A;  1GHC A;  1XSX A;  5CYV A;  1ONV A;  1FNN A;  4I0B A;  3P9C A;  4KUM A;  1LB2 A;  2HTJ A;  3Q9V A;  4M9X A;  1I1G A;  2A6H F;  1BOA A;  3TO6 A;  4KDP A;  3WTU C;  3WG9 A;  4RAY A;  2A61 A;  2K86 A;  3CUQ A;  2IW5 A;  4XBF A;  2PFB A;  4IJA A;  2O3F A;  1YTY A;  3WTS C;  5LBQ A;  1YIO A;  5FFZ A;  3Q9S A;  3HRT A;  3PQK A;  1H9G A;  2DK5 A;  2PMH A;  2HR3 A;  3WE3 A;  2ZJ2 A;  3F3X A;  1IRG A;  1P92 A;  1OKR A;  1ON1 A;  2J5O A;  3GFJ A;  1XDU A;  4OIR F;  3IKT A;  5K1Y A;  2HYF A;  1T0F A;  3JSP A;  3PFI A;  4LGW A;  4IRI A;  3I53 A;  3BDD A;  4N9H A;  3M8F A;  3DFG A;  2PBI A;  2VOP A;  1WWX A;  2IA1 A;  1T6S A;  3ROU A;  3R60 A;  3QU3 A;  4IHT A;  4HOB A;  1W5S A;  3TO7 A;  1LEB A;  4U0Y A;  3TOA A;  1W7P B;  1XGN A;  1HSJ A;  5DCM A;  1K6O A;  3ZMZ A;  4HYE A;  4G6D A;  1V3F A;  1TQP A;  4MHG A;  2G7H A;  3QP6 A;  1BC8 C;  4G7Z F;  4RGU A;  3N4M A;  3GFL A;  1B6A A;  2XKP A;  1SFU A;  3BRO A;  1IN8 A;  3KP3 A;  2J5P A;  2G9W A;  3LWF A;  5ICF A;  3RTR A;  1P4X A;  3IWZ A;  3HSR A;  3TOB A;  2P5L C;  4OIN F;  4G9Y A;  5L3F A;  2VBZ A;  3FMS A;  2FU4 A;  5A2Q Z;  1W7P A;  2P4W A;  2HFH A;  5F64 A;  3OOP A;  2M1B A;  4RB2 C;  1T39 A;  2XRN A;  4KN7 X;  1QZY A;  2ZFW A;  2M87 A;  4EJV A;  3P7N A;  3FWE A;  1QNT A;  5IT9 K;  1JE8 A;  3I59 B;  4EQQ A;  1YS6 A;  1RIO H;  4AWX B;  2V1U A;  3ZMU A;  1YG2 A;  3ZMT A;  1FZP B;  1Z7U A;  1FWZ A;  2WWY A;  2UWM A;  2CFX A;  1BBY A;  3LQQ A;  3H3Z A;  4HQM A;  1EH6 A;  2R7F A;  5CVJ A;  4M6Y A;  4I7H A;  3JAM K;  1OYY A;  4MQ9 F;  3T8R A;  3F23 A;  3M8E A;  1VTN C;  1GXQ A;  4EJT A;  5J8F A;  4U0W A;  1JGS A;  2KIF A;  2O0Y A;  3GYH X;  2ESH A;  2JT1 A;  2P5K A;  3NQO A;  1XSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...