2ZGDA

Asn-hydroxylation stabilises the ankyrin repeat domain fold
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
96
Chain Sequence
b'HHHHHSSGSDLGKKLLEAARAGQDDEVRILMANGADVAAKDKNGSTPLHLAARNGHLEVVKLLLEAGADVAQDKFGKTAFDISIDNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparagine beta-hydroxylation stabilizes the ankyrin repeat domain fold
pubmed doi rcsb
molecule keywords 3 repeat synthetic ankyrin
molecule tags De novo protein
total genus 28
structure length 96
sequence length 106
ec nomenclature
pdb deposition date 2008-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2zgdA00
3V2OA 5D66A 5CERB 4YDWA 3EHRA 5ITZF 3TWWA 4G8LA 4BETA 2B0OE 4HNAD 4BESA 2F8YA 2AJAA 5CBOA 1QYMA 2QC9A 4Z68A 1AP7A 1N0QA 5ENPD 5KNHD 5AARA 1MX6A 2DZOA 2XENA 3B7BA 4J7WA 5EIDA 4O1OA 1MYOA 3TWSA 3NBNB 4BSZB 1IHBA 2P2CP 1MX2A 3F6QA 1K1AA 5BXUA 3T8KA 2DVWA 3C5RA 5ENRD 3Q9UC 3T9KA 3ZKJA 2JABA 1N11A 1NFIE 3EU9A 1WG0A 2ETCA 1YCSB 1UOHA 4U95D 2DZNA 1WDYA 3J5PA 4HBDA 4BERA 5KBAA 3JXJA 3UTMA 2NYJA 2XZTG 4HB5A 1K3ZD 4HQDA 1IXVA 2HE0A 2XEHA 4U8YD 3TWQA 3NOCD 2J8SD 1BI8B 2ETBA 3JXIA 4F1PA 2VGEA 4CZ2D 5FINA 5BXOA 5EN5D 1SW6A 5AN8A 1TR4A 4DX6D 4ZFHA 4J8YA 2F37A 3AJIA 4UUCA 2FO1E 3KEAA 2KBXA 1IKND 3TWUA 1YMPA 2MYOA 5EYLA 4HRMB 3HRAA 5AQ9A 5HKPA 1K1BA 4B93B 3NOGD 3HG0D 3AAAC 4GMRA 4DX2A 1YYHA 1SVXA 5CBNA 5KWDA 2ZGDA 4TUMA 5CEAA 4RLYA 4DRXE 4YDYA 1AWCB 2V4HC 4LNUD 4HI8A 5EYPF 3TWVA 5AAOA 1A5EA 5ENTD 4HLLA 1OT8A 5AQBA 5EILA 3UI2A 4OAUC 3D9HA 3IXEA 3ZU7B 1DC2A 2XZDG 1OY3D 2QYJA 4LSZE 3LJNA 1DCQA 5CECB 5ENSD 3V31A 4DX7D 2BKGA 4ZHBA 3TWRA 4HRLA 4BEPA 2ETAA 4O60A 3TWXA 2Y1LE 1MX4A 4NIKA 4QFVA 4QQIA 5KNGA 5EIBE 2V5QC 4CYMD 4DX5D 2BKKB 2F8XK 1D9SA 4A63B 5ENQD 3W9FA 2RFMA 2DWZA 4N5QA 1MJ0A 4O1PA 3DEOA 3Q9NC 3J5QB 3JUEA 1BU9A 2XEEA 5JA4D 2KXPC 3DEPA 4GPMA 4HRNA 1BLXB 4K5BA 3ZUVB 4HI9A 5ENOD 3EHQA 3V2XA 4C48B 3UXGA 2ZGGA 5AQAA 5JMND 2L6BA 3W9GA 5FIOA 3V79K 2A5EA 2PNNA 2RFAA 5HRYA 1BD8A 1G3NB 1S70B 4LG6A 1BI7B 3B95A 4JB8P 3V30A 1N0RA 3SO8A 5AQ7A 5CEDB 4F6RD 4U8VD 3TWTA 5HS0A 4K5CA 4U96D 4OAVB 2Y0BG 4G8KA 4DX1A 4ATZD 3ZNGA 4DUIA 4K5AB
chains in the Genus database with same CATH superfamily
4I6JA 3UUXA 2V0PA 1BPOA 2R2LA 4TUUA 3D9LA 3SY2A 5BXUA 4P29A 4PUCA 4UQYA 5ENRD 2EQXA 3FUFA 3CKBA 2OEVA 4F53A 2L6JA 3FU0A 2EIME 3LDZA 2BTDA 1Z3YA 4XE0A 4AY5A 1SQMA 3DSUA 3UKRG 1HS6A 3TL5A 3KSLA 3ONKA 3R9AB 4W9RA 3AAAC 3UIOC 2PQRA 4TUMA 1H0AA 2DYSE 4Q69A 1QBQA 1NZNA 4L2YA 4OAUC 2KATA 3IXEA 3U66A 3AU5A 4CYMD 4XZ4A 2CHWA 3AG3E 2V4LA 3UM1A 4LERA 4GMJA 3JUEA 3RRUA 3DEPA 2OEWA 5ENOD 3IHVA 2IF4A 5JMND 3IHYA 3VLFA 5FIOA 1TN7A 5CEDB 5AENA 5ARFA 4AEZC 4K5CA 2HYZA 1E8YA 5AJLA 1KLXA 4YDEA 4UQXA 2PZIA 3TWWA 3QB2A 5AARA 3DPDA 5JJ7A 4NQ0A 3CR3A 1S0PA 4ANVA 4JW1A 3ZKJA 2HO1A 1JCRA 2XHEA 4UWFA 3PZ3A 4U95D 3ULYA 3CVPA 2NYJA 2KM4A 1ELWA 5IY5E 4GZ5A 3NOCD 4H7YA 4PS7A 4I9CA 2IU1A 2J49A 3U9WA 5AQ9A 2XCBA 3SFZA 5AIJA 3FULA 5CEAA 4DRXE 2CFUA 5EYPF 5EILA 3NZUA 3ZRHA 1FT2A 3QDNA 5D2MC 4JA9A 3V31A 4FJYA 2GRQB 2M63A 4CDMA 1W3BA 3U64A 2WXGA 3L16A 4GA0A 3CQCB 5AYWD 3CK9A 5FTPA 3ASHA 2WPVA 2WXQA 3UXGA 5FQ7A 2VSNA 2VSYA 1BI7B 4U7EB 3SFYA 3PEUB 3S7BA 1H2UA 4AVXA 2L0TB 3EHRA 4GYOA 3P2BA 1OCRE 4JL0A 2P9UG 3QJZA 3CHMA 1H6OA 2VYIA 2KCLA 1ZU2A 2VGXA 4DJAA 2XS8A 3KSQA 3NB2A 3ULQA 1UOHA 2E0IA 5ARGA 3TG5A 4HQDA 4TXQA 2P9NG 3RKVA 3FY4A 4PS3A 1MZCA 2ETBA 2EINE 3OAWA 5EN5D 4XIFA 3ABKE 2XRZA 1N4PA 3FWVA 3I4GA 4CDNA 4HRMB 5G05J 3OXFA 4ANXA 4GTOA 4JHJA 1E7VA 4ILGA 2CHXA 3E33A 4GYYA 4JEUA 2WXIA 3AG2E 5JJTA 2FF4A 3L6AA 4GZCA 4DX7D 4WWNA 4BEPA 3LXUX 3PDNA 4EECA 2C0LA 2GROB 1SZAA 2IONA 2J9QA 5B3SE 4B8CB 1BU9A 3PREA 1TNBA 3BUAA 1BLXB 4GTQA 4IRUA 4UWKA 1S63A 3V79K 1N0RA 2WXLA 1L5JA 2ZU6B 4YVOA 3I3NA 1N4SA 3RRMB 3AS5A 1HFAA 4GAAA 4AV7A 3EHNA 2CG2A 5H7PA 4B89A 4Z68A 2AVPA 3RO2A 4ACKA 1IYGA 2YHCA 3PUKA 5T3RA 5M72A 2H6HA 2OVBA 4O6FA 4U8HA 4CEMA 3J5PA 4JA7A 1Y8MA 2ILRA 3CSTA 2BEDA 2KZTA 2Y3AA 1OWNA 2X3MA 5EX0A 4ZFHA 1IKND 3QK0A 3HG0D 3C3RA 4I17A 5KWDA 3C3OA 1A5EA 1HO8A 4N39A 4MLPA 4WWOA 5LCWC 4Q94A 1OY3D 1DCQA 2WXOA 2ZISA 1FVFA 3E37A 4UWHA 2IQCA 4DLQA 5C2YA 4N5QA 3FEXA 3FUDA 4N3CA 2XEEA 5FZSA 1NL4A 3B7TA 4GPMA 3DXKG 5FQ6A 2C0MA 2ZGGA 3IEGA 3FUMA 3AG4E 1UN9A 2RFAA 2IO3C 1HZ4A 1TEZA 3V30A 5B1AE 3ESKA 2XS1A 2HM8A 4I2WA 2BUGA 3Q75A 2DIWA 4JVSA 1O1TA 4TV3A 4BESA 3B7UX 3FH8A 3TG4A 2PQNA 3SGHA 4GTTA 3B7BA 3GW4A 4KT6B 3FTXA 4LCTA 1JPLA 2AXVA 3RRNB 4LRZA 3UPVA 5G04C 4YDOA 4B0ZA 3MX3A 3MYVA 1TNZA 5CHEE 2J8SD 3RSEG 1LF8A 5FINA 1KPSB 3TWUA 5HQ8A 5EYLA 4C9BB 2LSVA 3I4RB 1K1BA 4L1BA 3UKUG 3CVQA 4Y6CA 3PNLB 2UY1B 3DSVA 1N4QA 3B13A 5EX3A 2LO6A 3U4TA 2FULA 4GTRA 1NA3A 3PNTB 4IN3B 2V5FA 4A3TA 3HHMA 4ZHBA 1H6PA 1MX4A 4QFVA 4GZ3A 2H6FA 1D9SA 3CK8A 3PRZA 1MJ0A 3NQPA 4GU5A 4HRNA 3ZUVB 3R7QA 2MRIA 2I9CA 2L6BA 3BU8A 5LOZA 4Q96A 4LNGA 4BT9A 2P9PG 3QOUA 1K8KG 3BG0B 3HXDA 3PZDA 2WB2A 4JHKA 4R7LA 5CRVA 1MX2A 4G1TA 4I43A 2DVWA 1OCZE 2VTBA 2PL2A 2B6CA 3DSTA 2RD0A 4HB5A 2R02A 3FEYA 4EQFA 2WM9A 3QAQA 5LX8A 1TN6A 3OTNA 2F37A 2FEZA 2FO1E 3ABLE 5ANRA 3ZN3A 2WXKA 2P58C 3L08A 4FLHA 4WNDA 2H6IA 4WNEA 1EDUA 3D9MA 2XZDG 1TYQG 2QYJA 5HI7A 3RK6A 3BEEA 4TRQA 3Q79A 3TWRA 3KEZA 4BTAA 4BTBA 3MKQA 2BKKB 2Y4TA 5CMWA 3HVEA 4E85A 2HR2A 3FTZA 3S2AA 2IY0C 5DBKA 1P5QA 4LG6A 3GZ2A 2CFZA 2AXZA 4U8VD 3TWTA 2Y69E 5HS0A 4F3VA 2Y0BG 1JWFA 4N3BA 1O5MA 2PM7A 4K5AB 4KZ0A 5BNWA 3BQOA 4I6GA 4KXKB 4IYPA 2VQ2A 4J7WA 4I6EA 3PH0C 1KZOA 2RG8A 1QZ2A 3T9KA 4RG9A 3L9TA 5B1BE 4BERA 2J4DA 5G04J 2XEHA 3E4BA 3FUEA 4J8YA 2MHKA 5E76A 3VLEA 2J07A 3FDHA 4GTVA 3S7FA 1MHQA 2WXJA 2ONDA 5CBNA 2ZGDA 3RIBA 1E8XA 4RLYA 1XGWA 5BT1A 3UT7A 3UI2A 3D9HA 3ZU7B 3Q7FA 2X6IA 3UINC 1E7UA 3JYSA 4C0MA 3PE3A 2ETAA 3EIJA 3DSXA 2OCCE 4O1PA 4GZDA 3E34A 4AOFA 4HI9A 3ZXSA 3NZSA 1WY6A 3FU5A 3W9GA 1V55E 3FUJA 2VGXB 2WXRA 3URZA 1MQSA 3LVQE 2AXUA 4EBAA 4C0EA 2A4ZA 2DBAA 4AJWA 4L7TA 4JEHA 4GA1A 4J8EA 4HOQA 1ZBPA 2C2LA 2LUHA 3MJWA 4YDWA 3CK7A 4BETA 3AS4A 2AJAA 3L13A 4GCNA 5ANLA 4U0UA 4BWRA 4J8DA 3TWSA 3VTXA 1VDYA 1DVPA 3FTYA 3HXEA 1OXJA 2JABA 1OWMA 2WXHA 3Q78A 3SI5A 3RO3A 2GW1A 4XI9A 3VTYA 1E96B 3JXIA 1UJKA 1TR4A 3ZHEA 2IJGX 4U04A 3LY7A 4KMOA 4UWLA 3HRAA 2WQHA 4EBAG 3ZW3A 4DX2A 1SVXA 4CT4A 3FTUA 2YINA 2X38A 1INZA 4A3VA 2J09A 3UT8A 4JPSA 1PY1A 4G24A 3I5PA 3T5VA 4KBQA 5G2NA 1JCSA 1HG5A 3AS8A 1TJFA 4URKA 2A5UA 3Q7AA 2WMNA 1S64A 2R5SA 3D9KA 3KAEA 1GW6A 4G23A 4WNGA 4DI4A 4OAVB 4J0UA 4FC8A 2XPYA 4F7AA 2KZTB 5BUZA 3LY8A 1Z6TA 3ULEG 1MYOA 3GZ1A 4NRHB 1X5BA 3G2UA 4XX5A 3C5RA 1UG3A 4CGVA 4UQZA 3ZVVA 3MCXA 1K3ZD 3HIZA 4F1SA 4ATGA 3CEQA 3SQVA 3AJIA 2KC7A 5EDSA 1OUVA 2MYOA 4XI0A 2WXPA 4I2ZA 2XGOA 1RZ4A 3LYAA 3MA5A 5CCMA 1H2TC 3TWVA 4V3IA 3K9IA 2I6HA 3CLJA 4BY6A 2EILE 4RSYA 2XPIA 2WVIA 3T8MA 1ELKA 4O60A 2VJ8A 4GCOA 4QQIA 1OCCE 5JHAA 1LD7A 4G25A 4RQIA 3L22A 4MRUA 2DWZA 3FU6A 3QWVA 4M3OA 5JA4D 3LVRE 3CVWA 4MKTA 1TNOA 4C48B 5BV0A 2KCVA 1UN8A 4GTSA 4HXIA 4F6RD 2WXMA 2X6HA 4DI3A 4DX1A 4NACA 5CERB 5ITZF 3KD7A 5FQ4A 2J4BA 1IHGA 1N95A 2IEJA 3FHEA 2I1JA 3B7RL 4B8AA 5JHBA 3MV2B 3RAUA 1WDYA 4HBDA 3CGHA 3R7RA 3L82A 4U8YD 3Q47B 1FCHA 4CZ2D 3PZ2A 4J6IA 4BX9A 3CV0A 4DX6D 2L9BA 2IFUA 2PM6A 3T5XA 3VLDA 3D9JA 4GMRA 4PS8A 3MGBA 2JLBA 2VGYA 4HI8A 1SZ9A 3ZFWA 3CVYA 3TXMA 5BW8C 2IOLA 3MKRA 1UJJA 2WQ7A 2I1KA 4FU3A 3G2VA 3QWPA 3DRAA 1KT0A 2CHZA 4DX5D 3D9PA 4A55A 2RFMA 3UIPC 4K03A 3JQ1A 4LNBA 3EHQA 3Q73A 3S7DA 3HDXA 1H19A 2A5EA 2LAHA 1G3NB 2Q7FA 3JQ0A 4FULA 5A7DB 2X6JA 3LKUA 3D9NA 3ASOE 4WUYA 4EPZA 3ASNE 2VSXE 3G2TA 2B0OE 3IKOB 1AP7A 1N0QA 5ENPD 4YVQC 4BSZB 4GTMA 3CVUA 1X81A 2R59A 4E6HA 1NFIE 3ISMC 1HE8A 3JXJA 2XZTG 5E75A 4HOSA 4AIFA 2EIKE 4AM9A 5LP0A 1EYHA 4XEIG 1D8DA 1IQUA 2RKKA 1DCEA 5FWQA 5BXOA 4HFGA 4LUNU 1XNFA 4KYOB 2KBXA 3QARA 2CG3A 4EZKA 3ZYLA 3X2QE 3NOGD 2XEVA 3KS2A 4ACLA 2QFCA 1AWCB 2V4HC 2UY1A 3WXXA 2DYRE 3DSWA 3CHRA 2DCPA 3ASGA 2IO2C 2R03A 4X8QA 4I1OB 1OCOE 4BFRA 5CECB 5ENSD 3DXMG 3FUKA 5FZRA 3TWXA 3WG7E 3HYMB 5CRUA 3QC1A 4APFA 1DNPA 3DEOA 1NA0A 3LPZA 4UI9K 3UMVA 2OOEA 1WM5A 5LCWJ 3ASDA 1O1RA 3OXLA 4IULA 1BD8A 4JB8P 5AQ7A 2OV8A 3ASFA 4PDXA 3Q4AB 4KVMA 3APCA 4EZJA 4ATZD 3E30A 1NP7A 3HXBA 4I1MA 4DK5A 3GYZA 4N2QA 4U63A 4G8LA 4MBGA 2UWJG 4PH4B 3LS8A 3EU5A 5BV1A 2DZOA 3ZXPA 5EIDA 1PAQA 4YNDA 5G05C 3CHOA 4OYSA 3G2SA 3EU9A 2ETCA 4G2VA 2EIJE 3P1UA 4A1SA 3TWQA 1EF1C 3EJNA 4RG6A 4AY6A 1SW6A 3PZ4A 3UM2A 3UM3A 4GB9A 1SA4A 4GMLA 2GRMA 2LXMA 3RU0A 5HKPA 5T8IA 2J08A 3OXGA 4UI9C 4U07A 5AAOA 2LSUA 1OT8A 3SFXA 2FI7A 2XGSA 4LSZE 3SF4A 2BKGA 5A23A 2GGFA 4HRLA 5JJ6A 4ILIA 3ZGQA 5DIZA 3GZSA 4WWPA 3S7JA 1B89A 1KZPA 3APFA 2P9IG 3J5QB 2KXPC 3V2XA 2OVFA 4CDRA 4HOTA 3JCKC 3SBSA 5HRYA 4JD2G 5FZQA 2KCKA 4HS2A 4AP2A 2E2EA 4Y6WA 2QYUA 4N5CA 3FH7A 1LTXA 3CVLA 4GZ6A 1OWOA 2QC9A 3ZHEB 5KNHD 1UW4B 4O1OA 4FP7A 3FTSA 3B7SA 3C72A 4FHJA 1N11A 3O4ZA 3G2WA 4G26A 1HG2A 1TN8A 4LEUA 2HE0A 1JCQA 1Q2ZA 5AN8A 4L23A 5FQ8A 1TJCA 3KEAA 4J8SA 1YMPA 5D0QD 4N3AA 3QWWA 1YYHA 3EUVA 3U3WA 4J8FA 2IOSA 5C1DA 1FT1A 4GYWA 1DC2A 3RJVA 2Y4UA 5KJKA 2JEKA 1JUQA 5KJLA 5KJMA 1H2VC 4MS6A 2Y1LE 4A63B 3E32A 3W9FA 1U3DA 1LD8A 3R9MA 4FLBA 4FADA 3IV0A 4OVVA 2X6FA 3SNXA 2NXPA 1HU3A 1PC2A 4U0SA 2PNNA 4WNFA 1V54E 1TNYA 4NURA 3DWLG 4JXTA 4K0RA 2LNIA 3PEVB 4G8KA 4DUIA 2MOWA 1OWPA 1O1SA 3D9IA 2F8YA 1ZB1A 1QYMA 3N71A 1MX6A 3ENEA 1H6KA 5D0OD 3NBNB 1IHBA 3CSFA 1N9AA 5KCMA 3PE4A 3PUJA 3T8KA 4KZCA 3Q9UC 4HOUA 1WG0A 3PVLA 1YCSB 3ZYQA 3QKYA 3UTMA 3LCAA 3ZYMA 3EHMA 3MV3B 4ANWA 3TGOA 4APOA 1E8ZA 4TXRA 4KVOA 3UT4A 5AJDA 1HXIA 2P9SG 4UUCA 1U2VG 3C98A 3EDTB 3TAXA 3FTVA 3QNKA 3FU3A 5FJYA 3ONLA 3PS6A 2AWIA 4FHKA 4UI9J 4HLLA 1HH8A 3DBSA 5CMYA 4CRWA 3FP3A 3UM0A 3ABME 1YA0A 3SD5A 4FA6A 5KNGA 2ZIRA 5KJNA 1KT1A 4CGWA 2I2OA 5ENQD 2XRYA 1N4RA 4I9EA 4HVBA 3Q9NC 4G11A 5BPPA 4BT8A 5FT9A 1ELRA 2YHEA 2X6KA 2L0IA 1N94A 3EIQC 3D9OA 1Z5SC 3HXCA 4AXHA 2FO7A 4U0ZA 5D66A 3SBTB 2XCCA 4HNAD 2R05A 5CBOA 2GRRB 2BF0X 5J08A 4ME2A 2P2CP 3F6QA 1E90A 3ZPJA 2DZNA 2FBNA 3TJPA 1NI1A 1RW2A 4HLEA 2NSZA 2WMOA 4GTPA 4F1PA 3AU4A 2XQ0A 2VGEA 4RVBA 1Y6IA 3CKCA 1A17A 4WAFA 4B93B 1U3CA 2GRPB 4TXPA 2VSOE 3CHSA 4A1GA 3DSSA 4DLOA 3ZEFA 5A6CA 4YDYA 2GRNB 3CVNA 5AQBA 4OVUA 4ABNA 3ZYKA 1WAO1 3FTWA 2P9KG 3MEKA 3DPYA 3ML8A 4JZYA 2XPZA 5EIBE 4N2SA 2GRLA 4EZLA 4H7XA 3LY9A 5ENNA 1OWLA 1EPUA 3Q15A 4M7CA 2LAIA 3CHPA 3NF1A 3IBEA 5AQAA 4FJZA 3UX4A 4L2LA 2F0YA 3B95A 2WQ6A 2YNQA 4EHMA 2WXNA 4D10C 3O48A 3ZNGA 3V2OA 3JUIA 3ZIMA 3Q5MA 2LXLA 3CIAA 2QZAA 2XENA 3L17A 2XGMA 3BG1B 1K1AA 5EKQD 1E8WA 1SA5A 2VTBB 3FUNA 2YQ8A 1N54A 5KBAA 3ML9A 4XKBA 4L9PA 3L54A 1IXVA 4JC8A 1BI8B 3AG1E 3FUIA 4JHRA 4UWGA 3UQ3A 2P9LG 4GPKA 3ESLA 3C3QA 4XKCA 4ANUA 1HX8A 3D3MA 3FUHA 4BSXA 1N52A 1Z3XA 2ZXWE 3TXNA 1QQEA 4HORA 3NAWA 4LNUD 5ENTD 1HF8A 3LEWA 2NC9A 3CQGB 1FVHA 2WXFA 2H6GA 3LJNA 3LJ3A 2R17C 2V8SE 3PZ1A 3SZ7A 4GA2A 4CT0A 4I1AA 2QY7A 4ILHB 3CVVA 1FPPA 4NIKA 3MKQB 3HVEB 2V5QC 2F8XK 3MZLB 3HXFA 1D8EA 3Q49B 3APDA 3CVXA 2AW6A 1QNFA 1IQRA 4K5BA 4CCAA 5LFAA 3FFLA 5G55A 4DPRA 5T4YA 4B94A 1S70B 4BX8A 3SO8A 3SHFA 1TNUA 5CCLA 4U96D 3CHQA 1JWGA 3FH5A 5J90A
chains in the Genus database with same CATH topology
3V2OA 5D66A 5CERB 4YDWA 3EHRA 5ITZF 3TWWA 4G8LA 4BETA 2B0OE 4HNAD 4BESA 2F8YA 2AJAA 5CBOA 1QYMA 2QC9A 4Z68A 1AP7A 1N0QA 5ENPD 5KNHD 5AARA 1MX6A 2DZOA 2XENA 3B7BA 4J7WA 5EIDA 4O1OA 1MYOA 3TWSA 3NBNB 4BSZB 1IHBA 2P2CP 1MX2A 3F6QA 1K1AA 5BXUA 3T8KA 2DVWA 3C5RA 5ENRD 3Q9UC 3T9KA 3ZKJA 2JABA 1N11A 1NFIE 3EU9A 1WG0A 2ETCA 1YCSB 1UOHA 4U95D 2DZNA 1WDYA 3J5PA 4HBDA 4BERA 5KBAA 3JXJA 3UTMA 2NYJA 2XZTG 4HB5A 1K3ZD 4HQDA 1IXVA 2HE0A 2XEHA 4U8YD 3TWQA 3NOCD 2J8SD 1BI8B 2ETBA 3JXIA 4F1PA 2VGEA 4CZ2D 5FINA 5BXOA 5EN5D 1SW6A 5AN8A 1TR4A 4DX6D 4ZFHA 4J8YA 2F37A 3AJIA 4UUCA 2FO1E 3KEAA 2KBXA 1IKND 3TWUA 1YMPA 2MYOA 5EYLA 4HRMB 3HRAA 5AQ9A 5HKPA 1K1BA 4B93B 3NOGD 3HG0D 3AAAC 4GMRA 4DX2A 1YYHA 1SVXA 5CBNA 5KWDA 2ZGDA 4TUMA 5CEAA 4RLYA 4DRXE 4YDYA 1AWCB 2V4HC 4LNUD 4HI8A 5EYPF 3TWVA 5AAOA 1A5EA 5ENTD 4HLLA 1OT8A 5AQBA 5EILA 3UI2A 4OAUC 3D9HA 3IXEA 3ZU7B 1DC2A 2XZDG 1OY3D 2QYJA 4LSZE 3LJNA 1DCQA 5CECB 5ENSD 3V31A 4DX7D 2BKGA 4ZHBA 3TWRA 4HRLA 4BEPA 2ETAA 4O60A 3TWXA 2Y1LE 1MX4A 4NIKA 4QFVA 4QQIA 5KNGA 5EIBE 2V5QC 4CYMD 4DX5D 2BKKB 2F8XK 1D9SA 4A63B 5ENQD 3W9FA 2RFMA 2DWZA 4N5QA 1MJ0A 4O1PA 3DEOA 3Q9NC 3J5QB 3JUEA 1BU9A 2XEEA 5JA4D 2KXPC 3DEPA 4GPMA 4HRNA 1BLXB 4K5BA 3ZUVB 4HI9A 5ENOD 3EHQA 3V2XA 4C48B 3UXGA 2ZGGA 5AQAA 5JMND 2L6BA 3W9GA 5FIOA 3V79K 2A5EA 2PNNA 2RFAA 5HRYA 1BD8A 1G3NB 1S70B 4LG6A 1BI7B 3B95A 4JB8P 3V30A 1N0RA 3SO8A 5AQ7A 5CEDB 4F6RD 4U8VD 3TWTA 5HS0A 4K5CA 4U96D 4OAVB 2Y0BG 4G8KA 4DX1A 4ATZD 3ZNGA 4DUIA 4K5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2O A;  5D66 A;  5CER B;  4YDW A;  3EHR A;  5ITZ F;  3TWW A;  4G8L A;  4BET A;  2B0O E;  4HNA D;  4BES A;  2F8Y A;  2AJA A;  5CBO A;  1QYM A;  2QC9 A;  4Z68 A;  1AP7 A;  1N0Q A;  5ENP D;  5KNH D;  5AAR A;  1MX6 A;  2DZO A;  2XEN A;  3B7B A;  4J7W A;  5EID A;  4O1O A;  1MYO A;  3TWS A;  3NBN B;  4BSZ B;  1IHB A;  2P2C P;  1MX2 A;  3F6Q A;  1K1A A;  5BXU A;  3T8K A;  2DVW A;  3C5R A;  5ENR D;  3Q9U C;  3T9K A;  3ZKJ A;  2JAB A;  1N11 A;  1NFI E;  3EU9 A;  1WG0 A;  2ETC A;  1YCS B;  1UOH A;  4U95 D;  2DZN A;  1WDY A;  3J5P A;  4HBD A;  4BER A;  5KBA A;  3JXJ A;  3UTM A;  2NYJ A;  2XZT G;  4HB5 A;  1K3Z D;  4HQD A;  1IXV A;  2HE0 A;  2XEH A;  4U8Y D;  3TWQ A;  3NOC D;  2J8S D;  1BI8 B;  2ETB A;  3JXI A;  4F1P A;  2VGE A;  4CZ2 D;  5FIN A;  5BXO A;  5EN5 D;  1SW6 A;  5AN8 A;  1TR4 A;  4DX6 D;  4ZFH A;  4J8Y A;  2F37 A;  3AJI A;  4UUC A;  2FO1 E;  3KEA A;  2KBX A;  1IKN D;  3TWU A;  1YMP A;  2MYO A;  5EYL A;  4HRM B;  3HRA A;  5AQ9 A;  5HKP A;  1K1B A;  4B93 B;  3NOG D;  3HG0 D;  3AAA C;  4GMR A;  4DX2 A;  1YYH A;  1SVX A;  5CBN A;  5KWD A;  2ZGD A;  4TUM A;  5CEA A;  4RLY A;  4DRX E;  4YDY A;  1AWC B;  2V4H C;  4LNU D;  4HI8 A;  5EYP F;  3TWV A;  5AAO A;  1A5E A;  5ENT D;  4HLL A;  1OT8 A;  5AQB A;  5EIL A;  3UI2 A;  4OAU C;  3D9H A;  3IXE A;  3ZU7 B;  1DC2 A;  2XZD G;  1OY3 D;  2QYJ A;  4LSZ E;  3LJN A;  1DCQ A;  5CEC B;  5ENS D;  3V31 A;  4DX7 D;  2BKG A;  4ZHB A;  3TWR A;  4HRL A;  4BEP A;  2ETA A;  4O60 A;  3TWX A;  2Y1L E;  1MX4 A;  4NIK A;  4QFV A;  4QQI A;  5KNG A;  5EIB E;  2V5Q C;  4CYM D;  4DX5 D;  2BKK B;  2F8X K;  1D9S A;  4A63 B;  5ENQ D;  3W9F A;  2RFM A;  2DWZ A;  4N5Q A;  1MJ0 A;  4O1P A;  3DEO A;  3Q9N C;  3J5Q B;  3JUE A;  1BU9 A;  2XEE A;  5JA4 D;  2KXP C;  3DEP A;  4GPM A;  4HRN A;  1BLX B;  4K5B A;  3ZUV B;  4HI9 A;  5ENO D;  3EHQ A;  3V2X A;  4C48 B;  3UXG A;  2ZGG A;  5AQA A;  5JMN D;  2L6B A;  3W9G A;  5FIO A;  3V79 K;  2A5E A;  2PNN A;  2RFA A;  5HRY A;  1BD8 A;  1G3N B;  1S70 B;  4LG6 A;  1BI7 B;  3B95 A;  4JB8 P;  3V30 A;  1N0R A;  3SO8 A;  5AQ7 A;  5CED B;  4F6R D;  4U8V D;  3TWT A;  5HS0 A;  4K5C A;  4U96 D;  4OAV B;  2Y0B G;  4G8K A;  4DX1 A;  4ATZ D;  3ZNG A;  4DUI A;  4K5A B; 
#chains in the Genus database with same CATH topology
 4I6J A;  3UUX A;  2V0P A;  1BPO A;  2R2L A;  4TUU A;  3D9L A;  3SY2 A;  5BXU A;  4P29 A;  4PUC A;  4UQY A;  5ENR D;  2EQX A;  3FUF A;  3CKB A;  2OEV A;  4F53 A;  2L6J A;  3FU0 A;  2EIM E;  3LDZ A;  2BTD A;  1Z3Y A;  4XE0 A;  4AY5 A;  1SQM A;  3DSU A;  3UKR G;  1HS6 A;  3TL5 A;  3KSL A;  3ONK A;  3R9A B;  4W9R A;  3AAA C;  3UIO C;  2PQR A;  4TUM A;  1H0A A;  2DYS E;  4Q69 A;  1QBQ A;  1NZN A;  4L2Y A;  4OAU C;  2KAT A;  3IXE A;  3U66 A;  3AU5 A;  4CYM D;  4XZ4 A;  2CHW A;  3AG3 E;  2V4L A;  3UM1 A;  4LER A;  4GMJ A;  3JUE A;  3RRU A;  3DEP A;  2OEW A;  5ENO D;  3IHV A;  2IF4 A;  5JMN D;  3IHY A;  3VLF A;  5FIO A;  1TN7 A;  5CED B;  5AEN A;  5ARF A;  4AEZ C;  4K5C A;  2HYZ A;  1E8Y A;  5AJL A;  1KLX A;  4YDE A;  4UQX A;  2PZI A;  3TWW A;  3QB2 A;  5AAR A;  3DPD A;  5JJ7 A;  4NQ0 A;  3CR3 A;  1S0P A;  4ANV A;  4JW1 A;  3ZKJ A;  2HO1 A;  1JCR A;  2XHE A;  4UWF A;  3PZ3 A;  4U95 D;  3ULY A;  3CVP A;  2NYJ A;  2KM4 A;  1ELW A;  5IY5 E;  4GZ5 A;  3NOC D;  4H7Y A;  4PS7 A;  4I9C A;  2IU1 A;  2J49 A;  3U9W A;  5AQ9 A;  2XCB A;  3SFZ A;  5AIJ A;  3FUL A;  5CEA A;  4DRX E;  2CFU A;  5EYP F;  5EIL A;  3NZU A;  3ZRH A;  1FT2 A;  3QDN A;  5D2M C;  4JA9 A;  3V31 A;  4FJY A;  2GRQ B;  2M63 A;  4CDM A;  1W3B A;  3U64 A;  2WXG A;  3L16 A;  4GA0 A;  3CQC B;  5AYW D;  3CK9 A;  5FTP A;  3ASH A;  2WPV A;  2WXQ A;  3UXG A;  5FQ7 A;  2VSN A;  2VSY A;  1BI7 B;  4U7E B;  3SFY A;  3PEU B;  3S7B A;  1H2U A;  4AVX A;  2L0T B;  3EHR A;  4GYO A;  3P2B A;  1OCR E;  4JL0 A;  2P9U G;  3QJZ A;  3CHM A;  1H6O A;  2VYI A;  2KCL A;  1ZU2 A;  2VGX A;  4DJA A;  2XS8 A;  3KSQ A;  3NB2 A;  3ULQ A;  1UOH A;  2E0I A;  5ARG A;  3TG5 A;  4HQD A;  4TXQ A;  2P9N G;  3RKV A;  3FY4 A;  4PS3 A;  1MZC A;  2ETB A;  2EIN E;  3OAW A;  5EN5 D;  4XIF A;  3ABK E;  2XRZ A;  1N4P A;  3FWV A;  3I4G A;  4CDN A;  4HRM B;  5G05 J;  3OXF A;  4ANX A;  4GTO A;  4JHJ A;  1E7V A;  4ILG A;  2CHX A;  3E33 A;  4GYY A;  4JEU A;  2WXI A;  3AG2 E;  5JJT A;  2FF4 A;  3L6A A;  4GZC A;  4DX7 D;  4WWN A;  4BEP A;  3LXU X;  3PDN A;  4EEC A;  2C0L A;  2GRO B;  1SZA A;  2ION A;  2J9Q A;  5B3S E;  4B8C B;  1BU9 A;  3PRE A;  1TNB A;  3BUA A;  1BLX B;  4GTQ A;  4IRU A;  4UWK A;  1S63 A;  3V79 K;  1N0R A;  2WXL A;  1L5J A;  2ZU6 B;  4YVO A;  3I3N A;  1N4S A;  3RRM B;  3AS5 A;  1HFA A;  4GAA A;  4AV7 A;  3EHN A;  2CG2 A;  5H7P A;  4B89 A;  4Z68 A;  2AVP A;  3RO2 A;  4ACK A;  1IYG A;  2YHC A;  3PUK A;  5T3R A;  5M72 A;  2H6H A;  2OVB A;  4O6F A;  4U8H A;  4CEM A;  3J5P A;  4JA7 A;  1Y8M A;  2ILR A;  3CST A;  2BED A;  2KZT A;  2Y3A A;  1OWN A;  2X3M A;  5EX0 A;  4ZFH A;  1IKN D;  3QK0 A;  3HG0 D;  3C3R A;  4I17 A;  5KWD A;  3C3O A;  1A5E A;  1HO8 A;  4N39 A;  4MLP A;  4WWO A;  5LCW C;  4Q94 A;  1OY3 D;  1DCQ A;  2WXO A;  2ZIS A;  1FVF A;  3E37 A;  4UWH A;  2IQC A;  4DLQ A;  5C2Y A;  4N5Q A;  3FEX A;  3FUD A;  4N3C A;  2XEE A;  5FZS A;  1NL4 A;  3B7T A;  4GPM A;  3DXK G;  5FQ6 A;  2C0M A;  2ZGG A;  3IEG A;  3FUM A;  3AG4 E;  1UN9 A;  2RFA A;  2IO3 C;  1HZ4 A;  1TEZ A;  3V30 A;  5B1A E;  3ESK A;  2XS1 A;  2HM8 A;  4I2W A;  2BUG A;  3Q75 A;  2DIW A;  4JVS A;  1O1T A;  4TV3 A;  4BES A;  3B7U X;  3FH8 A;  3TG4 A;  2PQN A;  3SGH A;  4GTT A;  3B7B A;  3GW4 A;  4KT6 B;  3FTX A;  4LCT A;  1JPL A;  2AXV A;  3RRN B;  4LRZ A;  3UPV A;  5G04 C;  4YDO A;  4B0Z A;  3MX3 A;  3MYV A;  1TNZ A;  5CHE E;  2J8S D;  3RSE G;  1LF8 A;  5FIN A;  1KPS B;  3TWU A;  5HQ8 A;  5EYL A;  4C9B B;  2LSV A;  3I4R B;  1K1B A;  4L1B A;  3UKU G;  3CVQ A;  4Y6C A;  3PNL B;  2UY1 B;  3DSV A;  1N4Q A;  3B13 A;  5EX3 A;  2LO6 A;  3U4T A;  2FUL A;  4GTR A;  1NA3 A;  3PNT B;  4IN3 B;  2V5F A;  4A3T A;  3HHM A;  4ZHB A;  1H6P A;  1MX4 A;  4QFV A;  4GZ3 A;  2H6F A;  1D9S A;  3CK8 A;  3PRZ A;  1MJ0 A;  3NQP A;  4GU5 A;  4HRN A;  3ZUV B;  3R7Q A;  2MRI A;  2I9C A;  2L6B A;  3BU8 A;  5LOZ A;  4Q96 A;  4LNG A;  4BT9 A;  2P9P G;  3QOU A;  1K8K G;  3BG0 B;  3HXD A;  3PZD A;  2WB2 A;  4JHK A;  4R7L A;  5CRV A;  1MX2 A;  4G1T A;  4I43 A;  2DVW A;  1OCZ E;  2VTB A;  2PL2 A;  2B6C A;  3DST A;  2RD0 A;  4HB5 A;  2R02 A;  3FEY A;  4EQF A;  2WM9 A;  3QAQ A;  5LX8 A;  1TN6 A;  3OTN A;  2F37 A;  2FEZ A;  2FO1 E;  3ABL E;  5ANR A;  3ZN3 A;  2WXK A;  2P58 C;  3L08 A;  4FLH A;  4WND A;  2H6I A;  4WNE A;  1EDU A;  3D9M A;  2XZD G;  1TYQ G;  2QYJ A;  5HI7 A;  3RK6 A;  3BEE A;  4TRQ A;  3Q79 A;  3TWR A;  3KEZ A;  4BTA A;  4BTB A;  3MKQ A;  2BKK B;  2Y4T A;  5CMW A;  3HVE A;  4E85 A;  2HR2 A;  3FTZ A;  3S2A A;  2IY0 C;  5DBK A;  1P5Q A;  4LG6 A;  3GZ2 A;  2CFZ A;  2AXZ A;  4U8V D;  3TWT A;  2Y69 E;  5HS0 A;  4F3V A;  2Y0B G;  1JWF A;  4N3B A;  1O5M A;  2PM7 A;  4K5A B;  4KZ0 A;  5BNW A;  3BQO A;  4I6G A;  4KXK B;  4IYP A;  2VQ2 A;  4J7W A;  4I6E A;  3PH0 C;  1KZO A;  2RG8 A;  1QZ2 A;  3T9K A;  4RG9 A;  3L9T A;  5B1B E;  4BER A;  2J4D A;  5G04 J;  2XEH A;  3E4B A;  3FUE A;  4J8Y A;  2MHK A;  5E76 A;  3VLE A;  2J07 A;  3FDH A;  4GTV A;  3S7F A;  1MHQ A;  2WXJ A;  2OND A;  5CBN A;  2ZGD A;  3RIB A;  1E8X A;  4RLY A;  1XGW A;  5BT1 A;  3UT7 A;  3UI2 A;  3D9H A;  3ZU7 B;  3Q7F A;  2X6I A;  3UIN C;  1E7U A;  3JYS A;  4C0M A;  3PE3 A;  2ETA A;  3EIJ A;  3DSX A;  2OCC E;  4O1P A;  4GZD A;  3E34 A;  4AOF A;  4HI9 A;  3ZXS A;  3NZS A;  1WY6 A;  3FU5 A;  3W9G A;  1V55 E;  3FUJ A;  2VGX B;  2WXR A;  3URZ A;  1MQS A;  3LVQ E;  2AXU A;  4EBA A;  4C0E A;  2A4Z A;  2DBA A;  4AJW A;  4L7T A;  4JEH A;  4GA1 A;  4J8E A;  4HOQ A;  1ZBP A;  2C2L A;  2LUH A;  3MJW A;  4YDW A;  3CK7 A;  4BET A;  3AS4 A;  2AJA A;  3L13 A;  4GCN A;  5ANL A;  4U0U A;  4BWR A;  4J8D A;  3TWS A;  3VTX A;  1VDY A;  1DVP A;  3FTY A;  3HXE A;  1OXJ A;  2JAB A;  1OWM A;  2WXH A;  3Q78 A;  3SI5 A;  3RO3 A;  2GW1 A;  4XI9 A;  3VTY A;  1E96 B;  3JXI A;  1UJK A;  1TR4 A;  3ZHE A;  2IJG X;  4U04 A;  3LY7 A;  4KMO A;  4UWL A;  3HRA A;  2WQH A;  4EBA G;  3ZW3 A;  4DX2 A;  1SVX A;  4CT4 A;  3FTU A;  2YIN A;  2X38 A;  1INZ A;  4A3V A;  2J09 A;  3UT8 A;  4JPS A;  1PY1 A;  4G24 A;  3I5P A;  3T5V A;  4KBQ A;  5G2N A;  1JCS A;  1HG5 A;  3AS8 A;  1TJF A;  4URK A;  2A5U A;  3Q7A A;  2WMN A;  1S64 A;  2R5S A;  3D9K A;  3KAE A;  1GW6 A;  4G23 A;  4WNG A;  4DI4 A;  4OAV B;  4J0U A;  4FC8 A;  2XPY A;  4F7A A;  2KZT B;  5BUZ A;  3LY8 A;  1Z6T A;  3ULE G;  1MYO A;  3GZ1 A;  4NRH B;  1X5B A;  3G2U A;  4XX5 A;  3C5R A;  1UG3 A;  4CGV A;  4UQZ A;  3ZVV A;  3MCX A;  1K3Z D;  3HIZ A;  4F1S A;  4ATG A;  3CEQ A;  3SQV A;  3AJI A;  2KC7 A;  5EDS A;  1OUV A;  2MYO A;  4XI0 A;  2WXP A;  4I2Z A;  2XGO A;  1RZ4 A;  3LYA A;  3MA5 A;  5CCM A;  1H2T C;  3TWV A;  4V3I A;  3K9I A;  2I6H A;  3CLJ A;  4BY6 A;  2EIL E;  4RSY A;  2XPI A;  2WVI A;  3T8M A;  1ELK A;  4O60 A;  2VJ8 A;  4GCO A;  4QQI A;  1OCC E;  5JHA A;  1LD7 A;  4G25 A;  4RQI A;  3L22 A;  4MRU A;  2DWZ A;  3FU6 A;  3QWV A;  4M3O A;  5JA4 D;  3LVR E;  3CVW A;  4MKT A;  1TNO A;  4C48 B;  5BV0 A;  2KCV A;  1UN8 A;  4GTS A;  4HXI A;  4F6R D;  2WXM A;  2X6H A;  4DI3 A;  4DX1 A;  4NAC A;  5CER B;  5ITZ F;  3KD7 A;  5FQ4 A;  2J4B A;  1IHG A;  1N95 A;  2IEJ A;  3FHE A;  2I1J A;  3B7R L;  4B8A A;  5JHB A;  3MV2 B;  3RAU A;  1WDY A;  4HBD A;  3CGH A;  3R7R A;  3L82 A;  4U8Y D;  3Q47 B;  1FCH A;  4CZ2 D;  3PZ2 A;  4J6I A;  4BX9 A;  3CV0 A;  4DX6 D;  2L9B A;  2IFU A;  2PM6 A;  3T5X A;  3VLD A;  3D9J A;  4GMR A;  4PS8 A;  3MGB A;  2JLB A;  2VGY A;  4HI8 A;  1SZ9 A;  3ZFW A;  3CVY A;  3TXM A;  5BW8 C;  2IOL A;  3MKR A;  1UJJ A;  2WQ7 A;  2I1K A;  4FU3 A;  3G2V A;  3QWP A;  3DRA A;  1KT0 A;  2CHZ A;  4DX5 D;  3D9P A;  4A55 A;  2RFM A;  3UIP C;  4K03 A;  3JQ1 A;  4LNB A;  3EHQ A;  3Q73 A;  3S7D A;  3HDX A;  1H19 A;  2A5E A;  2LAH A;  1G3N B;  2Q7F A;  3JQ0 A;  4FUL A;  5A7D B;  2X6J A;  3LKU A;  3D9N A;  3ASO E;  4WUY A;  4EPZ A;  3ASN E;  2VSX E;  3G2T A;  2B0O E;  3IKO B;  1AP7 A;  1N0Q A;  5ENP D;  4YVQ C;  4BSZ B;  4GTM A;  3CVU A;  1X81 A;  2R59 A;  4E6H A;  1NFI E;  3ISM C;  1HE8 A;  3JXJ A;  2XZT G;  5E75 A;  4HOS A;  4AIF A;  2EIK E;  4AM9 A;  5LP0 A;  1EYH A;  4XEI G;  1D8D A;  1IQU A;  2RKK A;  1DCE A;  5FWQ A;  5BXO A;  4HFG A;  4LUN U;  1XNF A;  4KYO B;  2KBX A;  3QAR A;  2CG3 A;  4EZK A;  3ZYL A;  3X2Q E;  3NOG D;  2XEV A;  3KS2 A;  4ACL A;  2QFC A;  1AWC B;  2V4H C;  2UY1 A;  3WXX A;  2DYR E;  3DSW A;  3CHR A;  2DCP A;  3ASG A;  2IO2 C;  2R03 A;  4X8Q A;  4I1O B;  1OCO E;  4BFR A;  5CEC B;  5ENS D;  3DXM G;  3FUK A;  5FZR A;  3TWX A;  3WG7 E;  3HYM B;  5CRU A;  3QC1 A;  4APF A;  1DNP A;  3DEO A;  1NA0 A;  3LPZ A;  4UI9 K;  3UMV A;  2OOE A;  1WM5 A;  5LCW J;  3ASD A;  1O1R A;  3OXL A;  4IUL A;  1BD8 A;  4JB8 P;  5AQ7 A;  2OV8 A;  3ASF A;  4PDX A;  3Q4A B;  4KVM A;  3APC A;  4EZJ A;  4ATZ D;  3E30 A;  1NP7 A;  3HXB A;  4I1M A;  4DK5 A;  3GYZ A;  4N2Q A;  4U63 A;  4G8L A;  4MBG A;  2UWJ G;  4PH4 B;  3LS8 A;  3EU5 A;  5BV1 A;  2DZO A;  3ZXP A;  5EID A;  1PAQ A;  4YND A;  5G05 C;  3CHO A;  4OYS A;  3G2S A;  3EU9 A;  2ETC A;  4G2V A;  2EIJ E;  3P1U A;  4A1S A;  3TWQ A;  1EF1 C;  3EJN A;  4RG6 A;  4AY6 A;  1SW6 A;  3PZ4 A;  3UM2 A;  3UM3 A;  4GB9 A;  1SA4 A;  4GML A;  2GRM A;  2LXM A;  3RU0 A;  5HKP A;  5T8I A;  2J08 A;  3OXG A;  4UI9 C;  4U07 A;  5AAO A;  2LSU A;  1OT8 A;  3SFX A;  2FI7 A;  2XGS A;  4LSZ E;  3SF4 A;  2BKG A;  5A23 A;  2GGF A;  4HRL A;  5JJ6 A;  4ILI A;  3ZGQ A;  5DIZ A;  3GZS A;  4WWP A;  3S7J A;  1B89 A;  1KZP A;  3APF A;  2P9I G;  3J5Q B;  2KXP C;  3V2X A;  2OVF A;  4CDR A;  4HOT A;  3JCK C;  3SBS A;  5HRY A;  4JD2 G;  5FZQ A;  2KCK A;  4HS2 A;  4AP2 A;  2E2E A;  4Y6W A;  2QYU A;  4N5C A;  3FH7 A;  1LTX A;  3CVL A;  4GZ6 A;  1OWO A;  2QC9 A;  3ZHE B;  5KNH D;  1UW4 B;  4O1O A;  4FP7 A;  3FTS A;  3B7S A;  3C72 A;  4FHJ A;  1N11 A;  3O4Z A;  3G2W A;  4G26 A;  1HG2 A;  1TN8 A;  4LEU A;  2HE0 A;  1JCQ A;  1Q2Z A;  5AN8 A;  4L23 A;  5FQ8 A;  1TJC A;  3KEA A;  4J8S A;  1YMP A;  5D0Q D;  4N3A A;  3QWW A;  1YYH A;  3EUV A;  3U3W A;  4J8F A;  2IOS A;  5C1D A;  1FT1 A;  4GYW A;  1DC2 A;  3RJV A;  2Y4U A;  5KJK A;  2JEK A;  1JUQ A;  5KJL A;  5KJM A;  1H2V C;  4MS6 A;  2Y1L E;  4A63 B;  3E32 A;  3W9F A;  1U3D A;  1LD8 A;  3R9M A;  4FLB A;  4FAD A;  3IV0 A;  4OVV A;  2X6F A;  3SNX A;  2NXP A;  1HU3 A;  1PC2 A;  4U0S A;  2PNN A;  4WNF A;  1V54 E;  1TNY A;  4NUR A;  3DWL G;  4JXT A;  4K0R A;  2LNI A;  3PEV B;  4G8K A;  4DUI A;  2MOW A;  1OWP A;  1O1S A;  3D9I A;  2F8Y A;  1ZB1 A;  1QYM A;  3N71 A;  1MX6 A;  3ENE A;  1H6K A;  5D0O D;  3NBN B;  1IHB A;  3CSF A;  1N9A A;  5KCM A;  3PE4 A;  3PUJ A;  3T8K A;  4KZC A;  3Q9U C;  4HOU A;  1WG0 A;  3PVL A;  1YCS B;  3ZYQ A;  3QKY A;  3UTM A;  3LCA A;  3ZYM A;  3EHM A;  3MV3 B;  4ANW A;  3TGO A;  4APO A;  1E8Z A;  4TXR A;  4KVO A;  3UT4 A;  5AJD A;  1HXI A;  2P9S G;  4UUC A;  1U2V G;  3C98 A;  3EDT B;  3TAX A;  3FTV A;  3QNK A;  3FU3 A;  5FJY A;  3ONL A;  3PS6 A;  2AWI A;  4FHK A;  4UI9 J;  4HLL A;  1HH8 A;  3DBS A;  5CMY A;  4CRW A;  3FP3 A;  3UM0 A;  3ABM E;  1YA0 A;  3SD5 A;  4FA6 A;  5KNG A;  2ZIR A;  5KJN A;  1KT1 A;  4CGW A;  2I2O A;  5ENQ D;  2XRY A;  1N4R A;  4I9E A;  4HVB A;  3Q9N C;  4G11 A;  5BPP A;  4BT8 A;  5FT9 A;  1ELR A;  2YHE A;  2X6K A;  2L0I A;  1N94 A;  3EIQ C;  3D9O A;  1Z5S C;  3HXC A;  4AXH A;  2FO7 A;  4U0Z A;  5D66 A;  3SBT B;  2XCC A;  4HNA D;  2R05 A;  5CBO A;  2GRR B;  2BF0 X;  5J08 A;  4ME2 A;  2P2C P;  3F6Q A;  1E90 A;  3ZPJ A;  2DZN A;  2FBN A;  3TJP A;  1NI1 A;  1RW2 A;  4HLE A;  2NSZ A;  2WMO A;  4GTP A;  4F1P A;  3AU4 A;  2XQ0 A;  2VGE A;  4RVB A;  1Y6I A;  3CKC A;  1A17 A;  4WAF A;  4B93 B;  1U3C A;  2GRP B;  4TXP A;  2VSO E;  3CHS A;  4A1G A;  3DSS A;  4DLO A;  3ZEF A;  5A6C A;  4YDY A;  2GRN B;  3CVN A;  5AQB A;  4OVU A;  4ABN A;  3ZYK A;  1WAO 1;  3FTW A;  2P9K G;  3MEK A;  3DPY A;  3ML8 A;  4JZY A;  2XPZ A;  5EIB E;  4N2S A;  2GRL A;  4EZL A;  4H7X A;  3LY9 A;  5ENN A;  1OWL A;  1EPU A;  3Q15 A;  4M7C A;  2LAI A;  3CHP A;  3NF1 A;  3IBE A;  5AQA A;  4FJZ A;  3UX4 A;  4L2L A;  2F0Y A;  3B95 A;  2WQ6 A;  2YNQ A;  4EHM A;  2WXN A;  4D10 C;  3O48 A;  3ZNG A;  3V2O A;  3JUI A;  3ZIM A;  3Q5M A;  2LXL A;  3CIA A;  2QZA A;  2XEN A;  3L17 A;  2XGM A;  3BG1 B;  1K1A A;  5EKQ D;  1E8W A;  1SA5 A;  2VTB B;  3FUN A;  2YQ8 A;  1N54 A;  5KBA A;  3ML9 A;  4XKB A;  4L9P A;  3L54 A;  1IXV A;  4JC8 A;  1BI8 B;  3AG1 E;  3FUI A;  4JHR A;  4UWG A;  3UQ3 A;  2P9L G;  4GPK A;  3ESL A;  3C3Q A;  4XKC A;  4ANU A;  1HX8 A;  3D3M A;  3FUH A;  4BSX A;  1N52 A;  1Z3X A;  2ZXW E;  3TXN A;  1QQE A;  4HOR A;  3NAW A;  4LNU D;  5ENT D;  1HF8 A;  3LEW A;  2NC9 A;  3CQG B;  1FVH A;  2WXF A;  2H6G A;  3LJN A;  3LJ3 A;  2R17 C;  2V8S E;  3PZ1 A;  3SZ7 A;  4GA2 A;  4CT0 A;  4I1A A;  2QY7 A;  4ILH B;  3CVV A;  1FPP A;  4NIK A;  3MKQ B;  3HVE B;  2V5Q C;  2F8X K;  3MZL B;  3HXF A;  1D8E A;  3Q49 B;  3APD A;  3CVX A;  2AW6 A;  1QNF A;  1IQR A;  4K5B A;  4CCA A;  5LFA A;  3FFL A;  5G55 A;  4DPR A;  5T4Y A;  4B94 A;  1S70 B;  4BX8 A;  3SO8 A;  3SHF A;  1TNU A;  5CCL A;  4U96 D;  3CHQ A;  1JWG A;  3FH5 A;  5J90 A; 
#chains in the Genus database with same CATH homology
 3V2O A;  5D66 A;  5CER B;  4YDW A;  3EHR A;  5ITZ F;  3TWW A;  4G8L A;  4BET A;  2B0O E;  4HNA D;  4BES A;  2F8Y A;  2AJA A;  5CBO A;  1QYM A;  2QC9 A;  4Z68 A;  1AP7 A;  1N0Q A;  5ENP D;  5KNH D;  5AAR A;  1MX6 A;  2DZO A;  2XEN A;  3B7B A;  4J7W A;  5EID A;  4O1O A;  1MYO A;  3TWS A;  3NBN B;  4BSZ B;  1IHB A;  2P2C P;  1MX2 A;  3F6Q A;  1K1A A;  5BXU A;  3T8K A;  2DVW A;  3C5R A;  5ENR D;  3Q9U C;  3T9K A;  3ZKJ A;  2JAB A;  1N11 A;  1NFI E;  3EU9 A;  1WG0 A;  2ETC A;  1YCS B;  1UOH A;  4U95 D;  2DZN A;  1WDY A;  3J5P A;  4HBD A;  4BER A;  5KBA A;  3JXJ A;  3UTM A;  2NYJ A;  2XZT G;  4HB5 A;  1K3Z D;  4HQD A;  1IXV A;  2HE0 A;  2XEH A;  4U8Y D;  3TWQ A;  3NOC D;  2J8S D;  1BI8 B;  2ETB A;  3JXI A;  4F1P A;  2VGE A;  4CZ2 D;  5FIN A;  5BXO A;  5EN5 D;  1SW6 A;  5AN8 A;  1TR4 A;  4DX6 D;  4ZFH A;  4J8Y A;  2F37 A;  3AJI A;  4UUC A;  2FO1 E;  3KEA A;  2KBX A;  1IKN D;  3TWU A;  1YMP A;  2MYO A;  5EYL A;  4HRM B;  3HRA A;  5AQ9 A;  5HKP A;  1K1B A;  4B93 B;  3NOG D;  3HG0 D;  3AAA C;  4GMR A;  4DX2 A;  1YYH A;  1SVX A;  5CBN A;  5KWD A;  2ZGD A;  4TUM A;  5CEA A;  4RLY A;  4DRX E;  4YDY A;  1AWC B;  2V4H C;  4LNU D;  4HI8 A;  5EYP F;  3TWV A;  5AAO A;  1A5E A;  5ENT D;  4HLL A;  1OT8 A;  5AQB A;  5EIL A;  3UI2 A;  4OAU C;  3D9H A;  3IXE A;  3ZU7 B;  1DC2 A;  2XZD G;  1OY3 D;  2QYJ A;  4LSZ E;  3LJN A;  1DCQ A;  5CEC B;  5ENS D;  3V31 A;  4DX7 D;  2BKG A;  4ZHB A;  3TWR A;  4HRL A;  4BEP A;  2ETA A;  4O60 A;  3TWX A;  2Y1L E;  1MX4 A;  4NIK A;  4QFV A;  4QQI A;  5KNG A;  5EIB E;  2V5Q C;  4CYM D;  4DX5 D;  2BKK B;  2F8X K;  1D9S A;  4A63 B;  5ENQ D;  3W9F A;  2RFM A;  2DWZ A;  4N5Q A;  1MJ0 A;  4O1P A;  3DEO A;  3Q9N C;  3J5Q B;  3JUE A;  1BU9 A;  2XEE A;  5JA4 D;  2KXP C;  3DEP A;  4GPM A;  4HRN A;  1BLX B;  4K5B A;  3ZUV B;  4HI9 A;  5ENO D;  3EHQ A;  3V2X A;  4C48 B;  3UXG A;  2ZGG A;  5AQA A;  5JMN D;  2L6B A;  3W9G A;  5FIO A;  3V79 K;  2A5E A;  2PNN A;  2RFA A;  5HRY A;  1BD8 A;  1G3N B;  1S70 B;  4LG6 A;  1BI7 B;  3B95 A;  4JB8 P;  3V30 A;  1N0R A;  3SO8 A;  5AQ7 A;  5CED B;  4F6R D;  4U8V D;  3TWT A;  5HS0 A;  4K5C A;  4U96 D;  4OAV B;  2Y0B G;  4G8K A;  4DX1 A;  4ATZ D;  3ZNG A;  4DUI A;  4K5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...