2ZGDA

Asn-hydroxylation stabilises the ankyrin repeat domain fold
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
96
Chain Sequence
HHHHHSSGSDLGKKLLEAARAGQDDEVRILMANGADVAAKDKNGSTPLHLAARNGHLEVVKLLLEAGADVAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3 repeat synthetic ankyrin
publication title Asparagine beta-hydroxylation stabilizes the ankyrin repeat domain fold
pubmed doi rcsb
molecule tags De novo protein
total genus 28
structure length 96
sequence length 106
ec nomenclature
pdb deposition date 2008-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2zgdA00
1K1BA 4U96D 1MX6A 1IKND 1BI8B 4JB8P 3V30A 5HRYA 1TR4A 1QYMA 3J5PA 4YDYA 3JUEA 4TUMA 4RLYA 4G8KA 3TWUA 3UXGA 4HRMB 3HRAA 5EYLA 4N5QA 3AJIA 4GMRA 3AAAC 2ETBA 3W9FA 2Y1LE 4DX5D 1DC2A 4GPMA 3EHQA 1SVXA 2F37A 2Y0BG 3T8KA 4HNAD 1S70B 2KXPC 5ENQD 4LNUD 3TWTA 1BLXB 5CBNA 3T9KA 2J8SD 3V31A 1WG0A 4HB5A 5KNHD 4ATZD 3W9GA 4QFVA 3TWVA 4CYMD 4BESA 3C5RA 1YCSB 4BSZB 1NFIE 5EN5D 3D9HA 1G3NB 3B7BA 2XZTG 3HG0D 4QQIA 1K1AA 4ZHBA 4LG6A 5CEDB 3J5QB 4G8LA 4J7WA 2V5QC 5AQ9A 1MX2A 3UTMA 4BETA 1OT8A 4F6RD 2ETAA 3V2OA 2PNNA 3F6QA 2QYJA 3JXJA 4K5CA 3V79K 2DZNA 1OY3D 4U8VD 5FIOA 5JMND 2FO1E 2A5EA 2QC9A 1AP7A 5FINA 2F8YA 3DEOA 1YYHA 4A63B 5HKPA 4DX1A 4U8YD 2XEHA 4ZFHA 1SW6A 1YMPA 3DEPA 2JABA 4J8YA 5EIDA 2RFAA 2L6BA 1K3ZD 3ZU7B 1UOHA 3LJNA 5AAOA 4HRLA 5AQ7A 3ZUVB 5ITZF 2DVWA 5AQBA 4K5BA 2ETCA 5ENPD 2F8XK 3KEAA 3B95A 5EYPF 1IXVA 4Z68A 2XENA 4OAVB 2BKGA 5KNGA 5BXUA 4LSZE 5KBAA 5EILA 5ENRD 3SO8A 4HRNA 3ZNGA 4CZ2D 4YDWA 4HI8A 4BEPA 1MJ0A 4HLLA 4O1OA 3EHRA 2BKKB 2V4HC 2AJAA 1AWCB 1WDYA 1BI7B 2DZOA 5CECB 4HI9A 2KBXA 4BERA 5KWDA 5AQAA 4DX6D 2RFMA 4C48B 1DCQA 2VGEA 2P2CP 3NOGD 3TWXA 5ENTD 2XEEA 4DX7D 4B93B 5EIBE 1D9SA 2ZGGA 4HQDA 4NIKA 4HBDA 5ENSD 1A5EA 5CBOA 5HS0A 3TWSA 5D66A 2B0OE 2NYJA 3EU9A 3JXIA 5CERB 3TWWA 4O1PA 3NBNB 1BU9A 2HE0A 4DX2A 3IXEA 5ENOD 1MX4A 5JA4D 1N0RA 4OAUC 3TWRA 4U95D 4K5AB 3Q9NC 1BD8A 3V2XA 4F1PA 1MYOA 1N0QA 5CEAA 5AN8A 4UUCA 1IHBA 4DRXE 5AARA 4O60A 5BXOA 3NOCD 2ZGDA 3Q9UC 3UI2A 2XZDG 3TWQA 4DUIA 1N11A 2MYOA 2DWZA 3ZKJA
chains in the Genus database with same CATH superfamily
3HHMA 2QFCA 1ELWA 1W3BA 4J0UA 5EYLA 3L13A 4GMRA 1S0PA 3W9FA 4XKCA 3SF4A 3RRNB 4I6GA 4QFVA 3LS8A 2IOLA 4GA2A 2LXMA 4I2WA 4LG6A 2L6JA 1FVFA 4K5CA 1OY3D 4UWGA 4I1MA 2VSXE 3OTNA 4KVMA 3LPZA 4CCAA 3JCKC 2FI7A 2YNQA 3HVEA 4ILHB 3UQ3A 2DYRE 2XQ0A 4K03A 4AIFA 3RJVA 2A4ZA 2HO1A 5HQ8A 2DZOA 2I2OA 4FP7A 3ZXPA 3O48A 5AQAA 3ENEA 1DCQA 5FTPA 2P2CP 4OVUA 3FWVA 2IO2C 2WB2A 2Y3AA 3I3NA 1BU9A 1IQUA 4KZCA 4DI3A 1PY1A 5JA4D 2WXOA 3T5VA 2GRLA 3CHSA 2ZGDA 3GZ2A 3UMVA 4G8KA 1D8EA 3X2QE 4G1TA 3MV2B 4N39A 2F37A 3UINC 4FHKA 2KXPC 1S64A 4LNUD 4JVSA 3QARA 1EDUA 4ANVA 2R59A 4ATZD 3ZYQA 2P9PG 2H6FA 3S7DA 2GW1A 4I1OB 3LJ3A 5AJLA 4L23A 3Q15A 3NAWA 3ASDA 4UQYA 4RG9A 1NA0A 4U8YD 4U8HA 5CCLA 1UJKA 3ONLA 3BUAA 3AU5A 1L5JA 3FTUA 3QWWA 3ZUVB 4A3TA 4OYSA 3URZA 2XHEA 3U3WA 2R03A 4GZ5A 5CECB 1OWMA 3DSWA 4HI9A 2IU1A 2KCVA 3TJPA 2ZGGA 4GYOA 3FU6A 5J08A 3ZRHA 2C2LA 3NBNB 3LXUX 3R7RA 5FZQA 4BWRA 4N3BA 3EHNA 3SFYA 4O6FA 1N94A 4C9BB 4IN3B 4E6HA 4F53A 1FVHA 2P9NG 1K1BA 4U96D 3PS6A 3FTWA 1RZ4A 1S63A 2OEVA 4HFGA 3ZEFA 2XCBA 1O1SA 4N3CA 4TXRA 2FBNA 5BNWA 2WXFA 1N4QA 1TN8A 5BV1A 2WXGA 4CYMD 5BV0A 5FT9A 2ZIRA 3ULEG 4GCNA 4BT8A 5LOZA 3D9OA 3ZXSA 4KT6B 3ML9A 3T8MA 1KT1A 4LERA 3EDTB 2Y4UA 1OXJA 4DX1A 4BX9A 1E7UA 1KLXA 2I1JA 3C72A 3ZFWA 3PDNA 3QNKA 4HRLA 1H6KA 4WAFA 1TNYA 1UW4B 2IF4A 3ASNE 3CHRA 4YDOA 5ENPD 2WQHA 1IXVA 1X5BA 4CZ2D 3SY2A 3UT7A 4BEPA 1MJ0A 3CK8A 5B1AE 1N4SA 4L1BA 2EQXA 3NZUA 3FTVA 3TWXA 3ZPJA 4JHRA 2MHKA 2P58C 3Q79A 1VDYA 4HQDA 3ISMC 2P9IG 5CBOA 2P9LG 2LO6A 4EHMA 3EU9A 3JXIA 4O1PA 4ACKA 4DX2A 4URKA 2WXKA 3Q4AB 2X6KA 3G2TA 2DWZA 2A5UA 4G26A 1D8DA 5HRYA 4RLYA 3TWUA 4N5QA 2YINA 2BEDA 5ARGA 1HFAA 1E90A 1SVXA 5ENQD 1BLXB 5AJDA 1RW2A 1OCZE 3TWVA 3SZ7A 2HM8A 2CHWA 3PE3A 3CEQA 5LX8A 3MV3B 4W9RA 4GMLA 4J7WA 5FZRA 3V2OA 2PNNA 4JEUA 5LFAA 4G25A 3CIAA 5H7PA 5BT1A 3DEOA 5HI7A 1MQSA 1TNZA 3N71A 1FT2A 5DIZA 5EIDA 3PNLB 1HXIA 3BEEA 3ZU7B 2VSNA 4B0ZA 5B3SE 1OWPA 2XRYA 2UY1A 2X6IA 4I9CA 4Z68A 1E8XA 3D9IA 3HXCA 4AM9A 3KEZA 1TJFA 3CVVA 3ZNGA 4LNBA 2FEZA 4U04A 5A7DB 5M72A 2QY7A 3SFZA 2VGXB 2Y69E 3ABME 4RSYA 5EX0A 1OCRE 3Q9NC 3CK7A 3T5XA 1IHBA 3TWQA 3AS5A 4JXTA 3U64A 2CG3A 5JHBA 4E85A 1TNUA 4GTQA 1ZB1A 2X3MA 2JEKA 1NL4A 3AJIA 2ETBA 3DSSA 2Y1LE 3FUDA 2X38A 3DSXA 1S70B 2Y4TA 5G55A 3QAQA 3RKVA 1WG0A 1EF1C 4DLQA 4JPSA 1QZ2A 3ESLA 2XZTG 4AXHA 4ZHBA 4I43A 3R7QA 5D0QD 3AG4E 2LXLA 3QC1A 3S7JA 2NC9A 4B8AA 3FEYA 3S7FA 2VSOE 2XPZA 3E32A 4ZFHA 3CKBA 4TXPA 4N2QA 3MKQA 5FZSA 3DSUA 3QDNA 4AVXA 3Q7AA 2WXQA 3IEGA 3KEAA 3SFXA 1HU3A 5EILA 4N2SA 1E7VA 4WUYA 3Q78A 1ELKA 2PM7A 1IQRA 3CVLA 4Y6WA 3I5PA 3OAWA 5LP0A 2L0TB 5IY5E 2HE0A 3MZLB 5BPPA 4GTPA 1N0RA 1OUVA 1OWLA 3DPDA 3FUIA 1BD8A 4FLBA 1N54A 3HXBA 3LVQE 4L2YA 3FULA 3CV0A 1HZ4A 3EIJA 1IKND 1BI8B 2XRZA 1IHGA 1LD8A 1O1TA 4ANWA 4J8EA 3UXGA 3HRAA 2EIJE 2IONA 2ZU6B 1JCRA 2AXZA 1Q2ZA 4LNGA 4BSZB 4YVOA 3B7BA 3CVNA 3CVWA 3ASHA 4JC8A 4F7AA 4FADA 4GZ6A 2XCCA 3B7UX 1LF8A 3F6QA 3NF1A 5BUZA 2R02A 2XGSA 3SI5A 3RO3A 4G11A 5E75A 4YNDA 4C0EA 5FWQA 1YMPA 2JABA 4N5CA 2RFAA 3SQVA 2VGYA 3LEWA 1UOHA 3D9KA 3ULQA 4B89A 4X8QA 1HX8A 2EIKE 3TG4A 3FUMA 5KNGA 3ZHEB 3Q5MA 3PNTB 2V4HC 4AY5A 3CSTA 3CQGB 4LEUA 4PS7A 4GB9A 4ACLA 4B93B 3AG1E 1TEZA 4I1AA 4FU3A 1H0AA 3TWSA 3L6AA 2RD0A 5EX3A 1MX4A 3CLJA 2PM6A 4OAUC 4RG6A 3TWRA 5ENNA 2WM9A 5BXOA 2XZDG 4I6EA 2OCCE 3AG3E 3CVXA 3J5PA 2Q7FA 4BTBA 5CMYA 3EHQA 4TXQA 3HXEA 3OXLA 2V0PA 3FEXA 4R7LA 4LUNU 1UG3A 4U7EB 3C5RA 1DNPA 3TG5A 2M63A 3EUVA 2XS1A 1KZPA 1H6OA 1MX2A 2RKKA 2J9QA 1N52A 2ETAA 3WG7E 3E4BA 2FO1E 2WXJA 5DBKA 1LTXA 3FUKA 3AS8A 4XIFA 3AS4A 5FJYA 3DEPA 1PC2A 1NI1A 5T3RA 3Q75A 4U0SA 4CDRA 4KXKB 3U66A 4DPRA 2KC7A 5G2NA 1DCEA 3S7BA 4AEZC 4BY6A 4U63A 2C0LA 4MKTA 1JUQA 3ABLE 3KAEA 4FHJA 2X6FA 4MRUA 5HS0A 4HOSA 2ILRA 3LVRE 2DCPA 2XS8A 3VTYA 2OV8A 4JA7A 3QK0A 2MYOA 4ANUA 3ZGQA 3PEUB 4JHJA 1N9AA 2CFZA 1TR4A 4NURA 2L0IA 3L82A 3VLEA 2GRRB 1H19A 4PH4B 4A3VA 5FQ4A 4C0MA 3C3OA 2J07A 3V31A 1O1RA 3FUNA 4GA1A 3L9TA 2V8SE 3D9HA 4EBAG 4AY6A 3UIOC 4EQFA 3SBSA 2E0IA 3CHOA 3LDZA 2KZTB 2QZAA 2X6JA 1AP7A 5FINA 1UJJA 3GZSA 3DPYA 2WXMA 1YYHA 3E37A 4EPZA 1BPOA 4V3IA 4NRHB 4GTTA 2WMNA 1K3ZD 2VYIA 2WPVA 2EILE 5AQ7A 3MCXA 2J4DA 2CG2A 5EYPF 4OAVB 3L54A 4HOUA 3UKRG 4L9PA 1TN6A 3K9IA 3D9JA 3E30A 3APCA 3EHRA 2KCKA 3PZ1A 3IBEA 5KWDA 5EDSA 4H7YA 2RG8A 4C48B 2I1KA 3B7RL 3EU5A 5ENSD 4N3AA 4XZ4A 3ML8A 4AJWA 2VQ2A 4APOA 4UWHA 2YHCA 4PUCA 4KVOA 5A23A 4UUCA 3ZIMA 3ZW3A 2EIME 5J90A 1ZBPA 1MX6A 4G2VA 3UX4A 3JUEA 2QYUA 3ZVVA 3AG2E 4UQZA 1H6PA 3T8KA 2GRMA 4DLOA 3QJZA 2J8SD 4WNFA 3PEVB 1B89A 3L08A 1ZU2A 4GYWA 2IOSA 3HIZA 4HXIA 2R17C 4GPKA 4U8VD 5FIOA 3Q73A 4RVBA 3E34A 1OWOA 4JEHA 4U0ZA 1XGWA 3OXFA 4M7CA 2VTBB 4F3VA 5JJ7A 5KJKA 2BF0X 3JQ1A 2C0MA 1UN8A 4FULA 3L22A 2F8XK 1HG5A 4U0UA 4ATGA 2H6IA 3PE4A 3DXKG 3UM1A 1HF8A 4HLLA 3D9MA 1NZNA 4XI0A 4JL0A 2RFMA 1GW6A 1XNFA 3FUHA 2WXLA 4CEMA 2NXPA 4NIKA 2OEWA 3GZ1A 3FH5A 4FC8A 5CERB 5KCMA 2H6GA 2BTDA 4EZKA 3TL5A 4U95D 1OCOE 3NB2A 3IKOB 3ZKJA 1FPPA 4HVBA 4A1GA 2CFUA 4DX5D 2DYSE 4GPMA 4JZYA 3CVQA 3TAXA 1YCSB 4DI4A 2XEVA 4GZ3A 4HLEA 3B7TA 3MEKA 3UTMA 1OT8A 3Q49B 2PZIA 3DXMG 5CCMA 2IJGX 4WNEA 3MGBA 3EJNA 4CDMA 4CGWA 2GRNB 4Q69A 3HYMB 2OVFA 4ILIA 1SA4A 1O5MA 4I9EA 3JUIA 1E8YA 4PDXA 5ITZF 4MS6A 3SHFA 3FU0A 4FJZA 2R2LA 3ULYA 2BKGA 5LCWC 4LSZE 2R5SA 2I6HA 3SO8A 3R9AB 1H2VC 3P1UA 2GRQB 3HVEB 1EYHA 2I9CA 4GYYA 4DX6D 4K0RA 3HXFA 2OVBA 2IEJA 4CT4A 1E8ZA 2B0OE 2NYJA 1E8WA 4O60A 5JJTA 3KD7A 2JLBA 1V54E 4ANXA 4YDEA 3AU4A 3IHYA 2IO3C 4UI9K 2ONDA 2HR2A 4WWPA 4HRMB 1ELRA 3G2SA 5ANRA 5KJLA 5CBNA 4IRUA 3T9KA 3D9LA 3GYZA 3W9GA 2XGOA 1H2TC 3L16A 1NFIE 3CKCA 3LY9A 3BG0B 3Q47B 5G04C 4UWKA 3HXDA 5KJMA 4KMOA 3ZYMA 3JQ0A 1QQEA 3CK9A 1TN7A 5JMND 2A5EA 1SZ9A 4GTRA 2V5FA 1JCQA 2UWJG 3G2WA 4J8YA 3DSTA 5C2YA 2E2EA 3TXNA 3FY4A 4CGVA 3FH7A 5AQBA 4K5BA 3UIPC 2VGXA 4FJYA 3B95A 4JA9A 3VLFA 1LD7A 4CRWA 2XENA 1U2VG 5EKQD 5B1BE 3PUKA 5BXUA 4Q96A 2LNIA 1MZCA 3HDXA 1X81A 1U3DA 4G24A 2J09A 1WDYA 3L17A 3FU3A 3RO2A 4GTSA 2WXHA 3E33A 5ENTD 2DBAA 3D9PA 3FU5A 4XX5A 4JD2G 1Z5SC 3R9MA 3QKYA 4G23A 3V2XA 4ABNA 2P9KG 3RIBA 1FT1A 5AARA 5JHAA 3NQPA 4TRQA 5G05C 4DUIA 4F1SA 1WM5A 2GROB 3EIQC 4GU5A 4BTAA 3VTXA 4YDYA 1SZAA 4GMJA 1Y8MA 3ABKE 4IULA 4LRZA 3SGHA 3FUEA 2PL2A 5KNHD 4BESA 4L2LA 1NP7A 3MX3A 3CR3A 4D10C 3CQCB 3HG0D 3SBTB 2WQ6A 2KCLA 2V4LA 5FQ8A 4B8CB 1TYQG 3B13A 3OXGA 2NSZA 2QYJA 3V79K 2AW6A 4MLPA 3MA5A 4U07A 2DIWA 4A63B 3UM0A 1PAQA 1N4PA 2KM4A 3ONKA 3NZSA 4J8DA 5AYWD 1N4RA 1Z6TA 3DSVA 4PS8A 3JYSA 4PS3A 2ZISA 1SQMA 1TNOA 4HOTA 3ZYKA 1U3CA 5CRUA 2XPYA 4BERA 2FULA 5E76A 4ILGA 4DX7D 5EIBE 3PZ2A 2WXRA 4XEIG 1A5EA 4UI9C 3I4RB 4UWLA 1HO8A 4CT0A 2H6HA 2MOWA 1QBQA 2LAIA 1MYOA 1HE8A 3PREA 2OOEA 4HORA 3Q9UC 1N11A 3PH0C 3BQOA 4NQ0A 4JB8P 5FQ6A 3DWLG 2LSVA 1QYMA 1INZA 4OVVA 4GAAA 1DC2A 3FTXA 4WNDA 2B6CA 3MYVA 4AP2A 3UM3A 4BFRA 4HB5A 3UPVA 3RRMB 4I6JA 3D3MA 4M3OA 5T4YA 3J5QB 1TNBA 4CDNA 2PQRA 4L7TA 1FCHA 2PQNA 5FQ7A 1DVPA 4TV3A 5CHEE 1Z3YA 4Q94A 3ZHEA 3FDHA 2L6BA 1JCSA 1HG2A 3PUJA 2VJ8A 2J08A 3U9WA 3D9NA 4JW1A 5KBAA 1EPUA 2LUHA 3PRZA 1E96B 4EECA 1HS6A 3FTYA 3ASGA 3RRUA 2YHEA 2UY1B 3IHVA 2VGEA 5AENA 4GTVA 2ZXWE 3Q7FA 3ZYLA 5CRVA 3MJWA 3TWWA 5ARFA 1P5QA 2AXVA 1HH8A 4BX8A 1N0QA 3IV0A 5AN8A 3CHPA 4JHKA 4MBGA 4KZ0A 3BG1B 2IQCA 5LCWJ 2J4BA 3KS2A 4EZJA 2IFUA 3TWTA 1IYGA 4RQIA 4XKBA 3LYAA 5D0OD 1G3NB 1K1AA 3DBSA 4F6RD 3KSLA 2QC9A 2FO7A 3RSEG 3G2UA 2XEHA 4Y6CA 2GRPB 4GZDA 3LCAA 3BU8A 3PZ4A 1KPSB 3CVYA 3QOUA 4FLHA 3U4TA 4DK5A 1N95A 2R05A 2EINE 2KATA 2AWIA 3MKQB 4YDWA 4UQXA 3I4GA 4HOQA 1BI7B 2WMOA 3LKUA 5G04J 5KJNA 3MKRA 3FUJA 4H7XA 1D9SA 3CHMA 3SNXA 4XI9A 3UM2A 2AVPA 5ENOD 4GA0A 4K5AB 3P2BA 3DRAA 4B94A 4DRXE 1TJCA 3NOCD 4WWOA 2WVIA 5BW8C 5CEAA 4BSXA 1QNFA 3ASFA 4I17A 2VSYA 3PZDA 3FHEA 5AIJA 2KZTA 2LSUA 4TUUA 2L9BA 2CHZA 5EN5D 3CHQA 5D2MC 3APFA 5CEDB 4YVQC 4DJAA 2V5QC 3VLDA 5AQ9A 3CVUA 2HYZA 4P29A 3FUFA 2DZNA 3FP3A 2F8YA 3FTZA 3KSQA 5G05J 1SW6A 3B7SA 4WWNA 4AV7A 4WNGA 3S2AA 2DVWA 2ETCA 3UT4A 2FF4A 1OWNA 4UWFA 4A55A 2WXNA 3QWPA 1JPLA 5ENRD 4HRNA 4GTOA 3O4ZA 4IYPA 4O1OA 2AJAA 3C98A 1AWCB 2BUGA 3TXMA 1JWGA 5A6CA 4AOFA 3NOGD 2WQ7A 3FTSA 4KYOB 4EBAA 3CSFA 1MHQA 2IY0C 3CGHA 5D66A 2WXIA 1A17A 1H2UA 3CVPA 3FFLA 4KBQA 2AXUA 4LCTA 5JJ6A 1YA0A 2XPIA 3SD5A 2X6HA 3V30A 4APFA 3QB2A 3ESKA 4TUMA 1NA3A 2P9SG 3C3QA 4FA6A 3AAAC 3UUXA 2Y0BG 4HNAD 4A1SA 4J8FA 3EHMA 4J8SA 4EZLA 3PVLA 3ZN3A 2YQ8A 4QQIA 4UI9J 4G8LA 2VTBA 1KZOA 1K8KG 4BETA 3GW4A 3JXJA 3QWVA 4GZCA 3ASOE 2P9UG 3C3RA 1UN9A 1SA5A 1WY6A 5HKPA 3LY8A 1WAO1 4XE0A 1OCCE 5CMWA 2F0YA 3G2VA 3LJNA 4BT9A 5AAOA 3TGOA 1Z3XA 5C1DA 1JWFA 4I2ZA 1KT0A 3UT8A 3PZ3A 1V55E 1Y6IA 5ANLA 2LAHA 2GGFA 3WXXA 3RK6A 3FH8A 4HI8A 2CHXA 2BKKB 4HS2A 2WXPA 4J6IA 4NACA 3RAUA 2KBXA 3UKUG 2XEEA 4ME2A 4HBDA 3APDA 2XGMA 5T8IA 3IXEA 4GCOA 3LY7A 2MRIA 3RU0A 4GTMA 4F1PA 2J49A 3UI2A
chains in the Genus database with same CATH topology
1K1BA 4U96D 1MX6A 1IKND 1BI8B 4JB8P 3V30A 5HRYA 1TR4A 1QYMA 3J5PA 4YDYA 3JUEA 4TUMA 4RLYA 4G8KA 3TWUA 3UXGA 4HRMB 3HRAA 5EYLA 4N5QA 3AJIA 4GMRA 3AAAC 2ETBA 3W9FA 2Y1LE 4DX5D 1DC2A 4GPMA 3EHQA 1SVXA 2F37A 2Y0BG 3T8KA 4HNAD 1S70B 2KXPC 5ENQD 4LNUD 3TWTA 1BLXB 5CBNA 3T9KA 2J8SD 3V31A 1WG0A 4HB5A 5KNHD 4ATZD 3W9GA 4QFVA 3TWVA 4CYMD 4BESA 3C5RA 1YCSB 4BSZB 1NFIE 5EN5D 3D9HA 1G3NB 3B7BA 2XZTG 3HG0D 4QQIA 1K1AA 4ZHBA 4LG6A 5CEDB 3J5QB 4G8LA 4J7WA 2V5QC 5AQ9A 1MX2A 3UTMA 4BETA 1OT8A 4F6RD 2ETAA 3V2OA 2PNNA 3F6QA 2QYJA 3JXJA 4K5CA 3V79K 2DZNA 1OY3D 4U8VD 5FIOA 5JMND 2FO1E 2A5EA 2QC9A 1AP7A 5FINA 2F8YA 3DEOA 1YYHA 4A63B 5HKPA 4DX1A 4U8YD 2XEHA 4ZFHA 1SW6A 1YMPA 3DEPA 2JABA 4J8YA 5EIDA 2RFAA 2L6BA 1K3ZD 3ZU7B 1UOHA 3LJNA 5AAOA 4HRLA 5AQ7A 3ZUVB 5ITZF 2DVWA 5AQBA 4K5BA 2ETCA 5ENPD 2F8XK 3KEAA 3B95A 5EYPF 1IXVA 4Z68A 2XENA 4OAVB 2BKGA 5KNGA 5BXUA 4LSZE 5KBAA 5EILA 5ENRD 3SO8A 4HRNA 3ZNGA 4CZ2D 4YDWA 4HI8A 4BEPA 1MJ0A 4HLLA 4O1OA 3EHRA 2BKKB 2V4HC 2AJAA 1AWCB 1WDYA 1BI7B 2DZOA 5CECB 4HI9A 2KBXA 4BERA 5KWDA 5AQAA 4DX6D 2RFMA 4C48B 1DCQA 2VGEA 2P2CP 3NOGD 3TWXA 5ENTD 2XEEA 4DX7D 4B93B 5EIBE 1D9SA 2ZGGA 4HQDA 4NIKA 4HBDA 5ENSD 1A5EA 5CBOA 5HS0A 3TWSA 5D66A 2B0OE 2NYJA 3EU9A 3JXIA 5CERB 3TWWA 4O1PA 3NBNB 1BU9A 2HE0A 4DX2A 3IXEA 5ENOD 1MX4A 5JA4D 1N0RA 4OAUC 3TWRA 4U95D 4K5AB 3Q9NC 1BD8A 3V2XA 4F1PA 1MYOA 1N0QA 5CEAA 5AN8A 4UUCA 1IHBA 4DRXE 5AARA 4O60A 5BXOA 3NOCD 2ZGDA 3Q9UC 3UI2A 2XZDG 3TWQA 4DUIA 1N11A 2MYOA 2DWZA 3ZKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1B A;  4U96 D;  1MX6 A;  1IKN D;  1BI8 B;  4JB8 P;  3V30 A;  5HRY A;  1TR4 A;  1QYM A;  3J5P A;  4YDY A;  3JUE A;  4TUM A;  4RLY A;  4G8K A;  3TWU A;  3UXG A;  4HRM B;  3HRA A;  5EYL A;  4N5Q A;  3AJI A;  4GMR A;  3AAA C;  2ETB A;  3W9F A;  2Y1L E;  4DX5 D;  1DC2 A;  4GPM A;  3EHQ A;  1SVX A;  2F37 A;  2Y0B G;  3T8K A;  4HNA D;  1S70 B;  2KXP C;  5ENQ D;  4LNU D;  3TWT A;  1BLX B;  5CBN A;  3T9K A;  2J8S D;  3V31 A;  1WG0 A;  4HB5 A;  5KNH D;  4ATZ D;  3W9G A;  4QFV A;  3TWV A;  4CYM D;  4BES A;  3C5R A;  1YCS B;  4BSZ B;  1NFI E;  5EN5 D;  3D9H A;  1G3N B;  3B7B A;  2XZT G;  3HG0 D;  4QQI A;  1K1A A;  4ZHB A;  4LG6 A;  5CED B;  3J5Q B;  4G8L A;  4J7W A;  2V5Q C;  5AQ9 A;  1MX2 A;  3UTM A;  4BET A;  1OT8 A;  4F6R D;  2ETA A;  3V2O A;  2PNN A;  3F6Q A;  2QYJ A;  3JXJ A;  4K5C A;  3V79 K;  2DZN A;  1OY3 D;  4U8V D;  5FIO A;  5JMN D;  2FO1 E;  2A5E A;  2QC9 A;  1AP7 A;  5FIN A;  2F8Y A;  3DEO A;  1YYH A;  4A63 B;  5HKP A;  4DX1 A;  4U8Y D;  2XEH A;  4ZFH A;  1SW6 A;  1YMP A;  3DEP A;  2JAB A;  4J8Y A;  5EID A;  2RFA A;  2L6B A;  1K3Z D;  3ZU7 B;  1UOH A;  3LJN A;  5AAO A;  4HRL A;  5AQ7 A;  3ZUV B;  5ITZ F;  2DVW A;  5AQB A;  4K5B A;  2ETC A;  5ENP D;  2F8X K;  3KEA A;  3B95 A;  5EYP F;  1IXV A;  4Z68 A;  2XEN A;  4OAV B;  2BKG A;  5KNG A;  5BXU A;  4LSZ E;  5KBA A;  5EIL A;  5ENR D;  3SO8 A;  4HRN A;  3ZNG A;  4CZ2 D;  4YDW A;  4HI8 A;  4BEP A;  1MJ0 A;  4HLL A;  4O1O A;  3EHR A;  2BKK B;  2V4H C;  2AJA A;  1AWC B;  1WDY A;  1BI7 B;  2DZO A;  5CEC B;  4HI9 A;  2KBX A;  4BER A;  5KWD A;  5AQA A;  4DX6 D;  2RFM A;  4C48 B;  1DCQ A;  2VGE A;  2P2C P;  3NOG D;  3TWX A;  5ENT D;  2XEE A;  4DX7 D;  4B93 B;  5EIB E;  1D9S A;  2ZGG A;  4HQD A;  4NIK A;  4HBD A;  5ENS D;  1A5E A;  5CBO A;  5HS0 A;  3TWS A;  5D66 A;  2B0O E;  2NYJ A;  3EU9 A;  3JXI A;  5CER B;  3TWW A;  4O1P A;  3NBN B;  1BU9 A;  2HE0 A;  4DX2 A;  3IXE A;  5ENO D;  1MX4 A;  5JA4 D;  1N0R A;  4OAU C;  3TWR A;  4U95 D;  4K5A B;  3Q9N C;  1BD8 A;  3V2X A;  4F1P A;  1MYO A;  1N0Q A;  5CEA A;  5AN8 A;  4UUC A;  1IHB A;  4DRX E;  5AAR A;  4O60 A;  5BXO A;  3NOC D;  2ZGD A;  3Q9U C;  3UI2 A;  2XZD G;  3TWQ A;  4DUI A;  1N11 A;  2MYO A;  2DWZ A;  3ZKJ A; 
#chains in the Genus database with same CATH topology
 3HHM A;  2QFC A;  1ELW A;  1W3B A;  4J0U A;  5EYL A;  3L13 A;  4GMR A;  1S0P A;  3W9F A;  4XKC A;  3SF4 A;  3RRN B;  4I6G A;  4QFV A;  3LS8 A;  2IOL A;  4GA2 A;  2LXM A;  4I2W A;  4LG6 A;  2L6J A;  1FVF A;  4K5C A;  1OY3 D;  4UWG A;  4I1M A;  2VSX E;  3OTN A;  4KVM A;  3LPZ A;  4CCA A;  3JCK C;  2FI7 A;  2YNQ A;  3HVE A;  4ILH B;  3UQ3 A;  2DYR E;  2XQ0 A;  4K03 A;  4AIF A;  3RJV A;  2A4Z A;  2HO1 A;  5HQ8 A;  2DZO A;  2I2O A;  4FP7 A;  3ZXP A;  3O48 A;  5AQA A;  3ENE A;  1DCQ A;  5FTP A;  2P2C P;  4OVU A;  3FWV A;  2IO2 C;  2WB2 A;  2Y3A A;  3I3N A;  1BU9 A;  1IQU A;  4KZC A;  4DI3 A;  1PY1 A;  5JA4 D;  2WXO A;  3T5V A;  2GRL A;  3CHS A;  2ZGD A;  3GZ2 A;  3UMV A;  4G8K A;  1D8E A;  3X2Q E;  4G1T A;  3MV2 B;  4N39 A;  2F37 A;  3UIN C;  4FHK A;  2KXP C;  1S64 A;  4LNU D;  4JVS A;  3QAR A;  1EDU A;  4ANV A;  2R59 A;  4ATZ D;  3ZYQ A;  2P9P G;  2H6F A;  3S7D A;  2GW1 A;  4I1O B;  3LJ3 A;  5AJL A;  4L23 A;  3Q15 A;  3NAW A;  3ASD A;  4UQY A;  4RG9 A;  1NA0 A;  4U8Y D;  4U8H A;  5CCL A;  1UJK A;  3ONL A;  3BUA A;  3AU5 A;  1L5J A;  3FTU A;  3QWW A;  3ZUV B;  4A3T A;  4OYS A;  3URZ A;  2XHE A;  3U3W A;  2R03 A;  4GZ5 A;  5CEC B;  1OWM A;  3DSW A;  4HI9 A;  2IU1 A;  2KCV A;  3TJP A;  2ZGG A;  4GYO A;  3FU6 A;  5J08 A;  3ZRH A;  2C2L A;  3NBN B;  3LXU X;  3R7R A;  5FZQ A;  4BWR A;  4N3B A;  3EHN A;  3SFY A;  4O6F A;  1N94 A;  4C9B B;  4IN3 B;  4E6H A;  4F53 A;  1FVH A;  2P9N G;  1K1B A;  4U96 D;  3PS6 A;  3FTW A;  1RZ4 A;  1S63 A;  2OEV A;  4HFG A;  3ZEF A;  2XCB A;  1O1S A;  4N3C A;  4TXR A;  2FBN A;  5BNW A;  2WXF A;  1N4Q A;  1TN8 A;  5BV1 A;  2WXG A;  4CYM D;  5BV0 A;  5FT9 A;  2ZIR A;  3ULE G;  4GCN A;  4BT8 A;  5LOZ A;  3D9O A;  3ZXS A;  4KT6 B;  3ML9 A;  3T8M A;  1KT1 A;  4LER A;  3EDT B;  2Y4U A;  1OXJ A;  4DX1 A;  4BX9 A;  1E7U A;  1KLX A;  2I1J A;  3C72 A;  3ZFW A;  3PDN A;  3QNK A;  4HRL A;  1H6K A;  4WAF A;  1TNY A;  1UW4 B;  2IF4 A;  3ASN E;  3CHR A;  4YDO A;  5ENP D;  2WQH A;  1IXV A;  1X5B A;  4CZ2 D;  3SY2 A;  3UT7 A;  4BEP A;  1MJ0 A;  3CK8 A;  5B1A E;  1N4S A;  4L1B A;  2EQX A;  3NZU A;  3FTV A;  3TWX A;  3ZPJ A;  4JHR A;  2MHK A;  2P58 C;  3Q79 A;  1VDY A;  4HQD A;  3ISM C;  2P9I G;  5CBO A;  2P9L G;  2LO6 A;  4EHM A;  3EU9 A;  3JXI A;  4O1P A;  4ACK A;  4DX2 A;  4URK A;  2WXK A;  3Q4A B;  2X6K A;  3G2T A;  2DWZ A;  2A5U A;  4G26 A;  1D8D A;  5HRY A;  4RLY A;  3TWU A;  4N5Q A;  2YIN A;  2BED A;  5ARG A;  1HFA A;  1E90 A;  1SVX A;  5ENQ D;  1BLX B;  5AJD A;  1RW2 A;  1OCZ E;  3TWV A;  3SZ7 A;  2HM8 A;  2CHW A;  3PE3 A;  3CEQ A;  5LX8 A;  3MV3 B;  4W9R A;  4GML A;  4J7W A;  5FZR A;  3V2O A;  2PNN A;  4JEU A;  5LFA A;  4G25 A;  3CIA A;  5H7P A;  5BT1 A;  3DEO A;  5HI7 A;  1MQS A;  1TNZ A;  3N71 A;  1FT2 A;  5DIZ A;  5EID A;  3PNL B;  1HXI A;  3BEE A;  3ZU7 B;  2VSN A;  4B0Z A;  5B3S E;  1OWP A;  2XRY A;  2UY1 A;  2X6I A;  4I9C A;  4Z68 A;  1E8X A;  3D9I A;  3HXC A;  4AM9 A;  3KEZ A;  1TJF A;  3CVV A;  3ZNG A;  4LNB A;  2FEZ A;  4U04 A;  5A7D B;  5M72 A;  2QY7 A;  3SFZ A;  2VGX B;  2Y69 E;  3ABM E;  4RSY A;  5EX0 A;  1OCR E;  3Q9N C;  3CK7 A;  3T5X A;  1IHB A;  3TWQ A;  3AS5 A;  4JXT A;  3U64 A;  2CG3 A;  5JHB A;  4E85 A;  1TNU A;  4GTQ A;  1ZB1 A;  2X3M A;  2JEK A;  1NL4 A;  3AJI A;  2ETB A;  3DSS A;  2Y1L E;  3FUD A;  2X38 A;  3DSX A;  1S70 B;  2Y4T A;  5G55 A;  3QAQ A;  3RKV A;  1WG0 A;  1EF1 C;  4DLQ A;  4JPS A;  1QZ2 A;  3ESL A;  2XZT G;  4AXH A;  4ZHB A;  4I43 A;  3R7Q A;  5D0Q D;  3AG4 E;  2LXL A;  3QC1 A;  3S7J A;  2NC9 A;  4B8A A;  3FEY A;  3S7F A;  2VSO E;  2XPZ A;  3E32 A;  4ZFH A;  3CKB A;  4TXP A;  4N2Q A;  3MKQ A;  5FZS A;  3DSU A;  3QDN A;  4AVX A;  3Q7A A;  2WXQ A;  3IEG A;  3KEA A;  3SFX A;  1HU3 A;  5EIL A;  4N2S A;  1E7V A;  4WUY A;  3Q78 A;  1ELK A;  2PM7 A;  1IQR A;  3CVL A;  4Y6W A;  3I5P A;  3OAW A;  5LP0 A;  2L0T B;  5IY5 E;  2HE0 A;  3MZL B;  5BPP A;  4GTP A;  1N0R A;  1OUV A;  1OWL A;  3DPD A;  3FUI A;  1BD8 A;  4FLB A;  1N54 A;  3HXB A;  3LVQ E;  4L2Y A;  3FUL A;  3CV0 A;  1HZ4 A;  3EIJ A;  1IKN D;  1BI8 B;  2XRZ A;  1IHG A;  1LD8 A;  1O1T A;  4ANW A;  4J8E A;  3UXG A;  3HRA A;  2EIJ E;  2ION A;  2ZU6 B;  1JCR A;  2AXZ A;  1Q2Z A;  4LNG A;  4BSZ B;  4YVO A;  3B7B A;  3CVN A;  3CVW A;  3ASH A;  4JC8 A;  4F7A A;  4FAD A;  4GZ6 A;  2XCC A;  3B7U X;  1LF8 A;  3F6Q A;  3NF1 A;  5BUZ A;  2R02 A;  2XGS A;  3SI5 A;  3RO3 A;  4G11 A;  5E75 A;  4YND A;  4C0E A;  5FWQ A;  1YMP A;  2JAB A;  4N5C A;  2RFA A;  3SQV A;  2VGY A;  3LEW A;  1UOH A;  3D9K A;  3ULQ A;  4B89 A;  4X8Q A;  1HX8 A;  2EIK E;  3TG4 A;  3FUM A;  5KNG A;  3ZHE B;  3Q5M A;  3PNT B;  2V4H C;  4AY5 A;  3CST A;  3CQG B;  4LEU A;  4PS7 A;  4GB9 A;  4ACL A;  4B93 B;  3AG1 E;  1TEZ A;  4I1A A;  4FU3 A;  1H0A A;  3TWS A;  3L6A A;  2RD0 A;  5EX3 A;  1MX4 A;  3CLJ A;  2PM6 A;  4OAU C;  4RG6 A;  3TWR A;  5ENN A;  2WM9 A;  5BXO A;  2XZD G;  4I6E A;  2OCC E;  3AG3 E;  3CVX A;  3J5P A;  2Q7F A;  4BTB A;  5CMY A;  3EHQ A;  4TXQ A;  3HXE A;  3OXL A;  2V0P A;  3FEX A;  4R7L A;  4LUN U;  1UG3 A;  4U7E B;  3C5R A;  1DNP A;  3TG5 A;  2M63 A;  3EUV A;  2XS1 A;  1KZP A;  1H6O A;  1MX2 A;  2RKK A;  2J9Q A;  1N52 A;  2ETA A;  3WG7 E;  3E4B A;  2FO1 E;  2WXJ A;  5DBK A;  1LTX A;  3FUK A;  3AS8 A;  4XIF A;  3AS4 A;  5FJY A;  3DEP A;  1PC2 A;  1NI1 A;  5T3R A;  3Q75 A;  4U0S A;  4CDR A;  4KXK B;  3U66 A;  4DPR A;  2KC7 A;  5G2N A;  1DCE A;  3S7B A;  4AEZ C;  4BY6 A;  4U63 A;  2C0L A;  4MKT A;  1JUQ A;  3ABL E;  3KAE A;  4FHJ A;  2X6F A;  4MRU A;  5HS0 A;  4HOS A;  2ILR A;  3LVR E;  2DCP A;  2XS8 A;  3VTY A;  2OV8 A;  4JA7 A;  3QK0 A;  2MYO A;  4ANU A;  3ZGQ A;  3PEU B;  4JHJ A;  1N9A A;  2CFZ A;  1TR4 A;  4NUR A;  2L0I A;  3L82 A;  3VLE A;  2GRR B;  1H19 A;  4PH4 B;  4A3V A;  5FQ4 A;  4C0M A;  3C3O A;  2J07 A;  3V31 A;  1O1R A;  3FUN A;  4GA1 A;  3L9T A;  2V8S E;  3D9H A;  4EBA G;  4AY6 A;  3UIO C;  4EQF A;  3SBS A;  2E0I A;  3CHO A;  3LDZ A;  2KZT B;  2QZA A;  2X6J A;  1AP7 A;  5FIN A;  1UJJ A;  3GZS A;  3DPY A;  2WXM A;  1YYH A;  3E37 A;  4EPZ A;  1BPO A;  4V3I A;  4NRH B;  4GTT A;  2WMN A;  1K3Z D;  2VYI A;  2WPV A;  2EIL E;  5AQ7 A;  3MCX A;  2J4D A;  2CG2 A;  5EYP F;  4OAV B;  3L54 A;  4HOU A;  3UKR G;  4L9P A;  1TN6 A;  3K9I A;  3D9J A;  3E30 A;  3APC A;  3EHR A;  2KCK A;  3PZ1 A;  3IBE A;  5KWD A;  5EDS A;  4H7Y A;  2RG8 A;  4C48 B;  2I1K A;  3B7R L;  3EU5 A;  5ENS D;  4N3A A;  4XZ4 A;  3ML8 A;  4AJW A;  2VQ2 A;  4APO A;  4UWH A;  2YHC A;  4PUC A;  4KVO A;  5A23 A;  4UUC A;  3ZIM A;  3ZW3 A;  2EIM E;  5J90 A;  1ZBP A;  1MX6 A;  4G2V A;  3UX4 A;  3JUE A;  2QYU A;  3ZVV A;  3AG2 E;  4UQZ A;  1H6P A;  3T8K A;  2GRM A;  4DLO A;  3QJZ A;  2J8S D;  4WNF A;  3PEV B;  1B89 A;  3L08 A;  1ZU2 A;  4GYW A;  2IOS A;  3HIZ A;  4HXI A;  2R17 C;  4GPK A;  4U8V D;  5FIO A;  3Q73 A;  4RVB A;  3E34 A;  1OWO A;  4JEH A;  4U0Z A;  1XGW A;  3OXF A;  4M7C A;  2VTB B;  4F3V A;  5JJ7 A;  5KJK A;  2BF0 X;  3JQ1 A;  2C0M A;  1UN8 A;  4FUL A;  3L22 A;  2F8X K;  1HG5 A;  4U0U A;  4ATG A;  2H6I A;  3PE4 A;  3DXK G;  3UM1 A;  1HF8 A;  4HLL A;  3D9M A;  1NZN A;  4XI0 A;  4JL0 A;  2RFM A;  1GW6 A;  1XNF A;  3FUH A;  2WXL A;  4CEM A;  2NXP A;  4NIK A;  2OEW A;  3GZ1 A;  3FH5 A;  4FC8 A;  5CER B;  5KCM A;  2H6G A;  2BTD A;  4EZK A;  3TL5 A;  4U95 D;  1OCO E;  3NB2 A;  3IKO B;  3ZKJ A;  1FPP A;  4HVB A;  4A1G A;  2CFU A;  4DX5 D;  2DYS E;  4GPM A;  4JZY A;  3CVQ A;  3TAX A;  1YCS B;  4DI4 A;  2XEV A;  4GZ3 A;  4HLE A;  3B7T A;  3MEK A;  3UTM A;  1OT8 A;  3Q49 B;  2PZI A;  3DXM G;  5CCM A;  2IJG X;  4WNE A;  3MGB A;  3EJN A;  4CDM A;  4CGW A;  2GRN B;  4Q69 A;  3HYM B;  2OVF A;  4ILI A;  1SA4 A;  1O5M A;  4I9E A;  3JUI A;  1E8Y A;  4PDX A;  5ITZ F;  4MS6 A;  3SHF A;  3FU0 A;  4FJZ A;  2R2L A;  3ULY A;  2BKG A;  5LCW C;  4LSZ E;  2R5S A;  2I6H A;  3SO8 A;  3R9A B;  1H2V C;  3P1U A;  2GRQ B;  3HVE B;  1EYH A;  2I9C A;  4GYY A;  4DX6 D;  4K0R A;  3HXF A;  2OVB A;  2IEJ A;  4CT4 A;  1E8Z A;  2B0O E;  2NYJ A;  1E8W A;  4O60 A;  5JJT A;  3KD7 A;  2JLB A;  1V54 E;  4ANX A;  4YDE A;  3AU4 A;  3IHY A;  2IO3 C;  4UI9 K;  2OND A;  2HR2 A;  4WWP A;  4HRM B;  1ELR A;  3G2S A;  5ANR A;  5KJL A;  5CBN A;  4IRU A;  3T9K A;  3D9L A;  3GYZ A;  3W9G A;  2XGO A;  1H2T C;  3L16 A;  1NFI E;  3CKC A;  3LY9 A;  3BG0 B;  3Q47 B;  5G04 C;  4UWK A;  3HXD A;  5KJM A;  4KMO A;  3ZYM A;  3JQ0 A;  1QQE A;  3CK9 A;  1TN7 A;  5JMN D;  2A5E A;  1SZ9 A;  4GTR A;  2V5F A;  1JCQ A;  2UWJ G;  3G2W A;  4J8Y A;  3DST A;  5C2Y A;  2E2E A;  3TXN A;  3FY4 A;  4CGV A;  3FH7 A;  5AQB A;  4K5B A;  3UIP C;  2VGX A;  4FJY A;  3B95 A;  4JA9 A;  3VLF A;  1LD7 A;  4CRW A;  2XEN A;  1U2V G;  5EKQ D;  5B1B E;  3PUK A;  5BXU A;  4Q96 A;  2LNI A;  1MZC A;  3HDX A;  1X81 A;  1U3D A;  4G24 A;  2J09 A;  1WDY A;  3L17 A;  3FU3 A;  3RO2 A;  4GTS A;  2WXH A;  3E33 A;  5ENT D;  2DBA A;  3D9P A;  3FU5 A;  4XX5 A;  4JD2 G;  1Z5S C;  3R9M A;  3QKY A;  4G23 A;  3V2X A;  4ABN A;  2P9K G;  3RIB A;  1FT1 A;  5AAR A;  5JHA A;  3NQP A;  4TRQ A;  5G05 C;  4DUI A;  4F1S A;  1WM5 A;  2GRO B;  3EIQ C;  4GU5 A;  4BTA A;  3VTX A;  4YDY A;  1SZA A;  4GMJ A;  1Y8M A;  3ABK E;  4IUL A;  4LRZ A;  3SGH A;  3FUE A;  2PL2 A;  5KNH D;  4BES A;  4L2L A;  1NP7 A;  3MX3 A;  3CR3 A;  4D10 C;  3CQC B;  3HG0 D;  3SBT B;  2WQ6 A;  2KCL A;  2V4L A;  5FQ8 A;  4B8C B;  1TYQ G;  3B13 A;  3OXG A;  2NSZ A;  2QYJ A;  3V79 K;  2AW6 A;  4MLP A;  3MA5 A;  4U07 A;  2DIW A;  4A63 B;  3UM0 A;  1PAQ A;  1N4P A;  2KM4 A;  3ONK A;  3NZS A;  4J8D A;  5AYW D;  1N4R A;  1Z6T A;  3DSV A;  4PS8 A;  3JYS A;  4PS3 A;  2ZIS A;  1SQM A;  1TNO A;  4HOT A;  3ZYK A;  1U3C A;  5CRU A;  2XPY A;  4BER A;  2FUL A;  5E76 A;  4ILG A;  4DX7 D;  5EIB E;  3PZ2 A;  2WXR A;  4XEI G;  1A5E A;  4UI9 C;  3I4R B;  4UWL A;  1HO8 A;  4CT0 A;  2H6H A;  2MOW A;  1QBQ A;  2LAI A;  1MYO A;  1HE8 A;  3PRE A;  2OOE A;  4HOR A;  3Q9U C;  1N11 A;  3PH0 C;  3BQO A;  4NQ0 A;  4JB8 P;  5FQ6 A;  3DWL G;  2LSV A;  1QYM A;  1INZ A;  4OVV A;  4GAA A;  1DC2 A;  3FTX A;  4WND A;  2B6C A;  3MYV A;  4AP2 A;  3UM3 A;  4BFR A;  4HB5 A;  3UPV A;  3RRM B;  4I6J A;  3D3M A;  4M3O A;  5T4Y A;  3J5Q B;  1TNB A;  4CDN A;  2PQR A;  4L7T A;  1FCH A;  2PQN A;  5FQ7 A;  1DVP A;  4TV3 A;  5CHE E;  1Z3Y A;  4Q94 A;  3ZHE A;  3FDH A;  2L6B A;  1JCS A;  1HG2 A;  3PUJ A;  2VJ8 A;  2J08 A;  3U9W A;  3D9N A;  4JW1 A;  5KBA A;  1EPU A;  2LUH A;  3PRZ A;  1E96 B;  4EEC A;  1HS6 A;  3FTY A;  3ASG A;  3RRU A;  2YHE A;  2UY1 B;  3IHV A;  2VGE A;  5AEN A;  4GTV A;  2ZXW E;  3Q7F A;  3ZYL A;  5CRV A;  3MJW A;  3TWW A;  5ARF A;  1P5Q A;  2AXV A;  1HH8 A;  4BX8 A;  1N0Q A;  3IV0 A;  5AN8 A;  3CHP A;  4JHK A;  4MBG A;  4KZ0 A;  3BG1 B;  2IQC A;  5LCW J;  2J4B A;  3KS2 A;  4EZJ A;  2IFU A;  3TWT A;  1IYG A;  4RQI A;  4XKB A;  3LYA A;  5D0O D;  1G3N B;  1K1A A;  3DBS A;  4F6R D;  3KSL A;  2QC9 A;  2FO7 A;  3RSE G;  3G2U A;  2XEH A;  4Y6C A;  2GRP B;  4GZD A;  3LCA A;  3BU8 A;  3PZ4 A;  1KPS B;  3CVY A;  3QOU A;  4FLH A;  3U4T A;  4DK5 A;  1N95 A;  2R05 A;  2EIN E;  2KAT A;  2AWI A;  3MKQ B;  4YDW A;  4UQX A;  3I4G A;  4HOQ A;  1BI7 B;  2WMO A;  3LKU A;  5G04 J;  5KJN A;  3MKR A;  3FUJ A;  4H7X A;  1D9S A;  3CHM A;  3SNX A;  4XI9 A;  3UM2 A;  2AVP A;  5ENO D;  4GA0 A;  4K5A B;  3P2B A;  3DRA A;  4B94 A;  4DRX E;  1TJC A;  3NOC D;  4WWO A;  2WVI A;  5BW8 C;  5CEA A;  4BSX A;  1QNF A;  3ASF A;  4I17 A;  2VSY A;  3PZD A;  3FHE A;  5AIJ A;  2KZT A;  2LSU A;  4TUU A;  2L9B A;  2CHZ A;  5EN5 D;  3CHQ A;  5D2M C;  3APF A;  5CED B;  4YVQ C;  4DJA A;  2V5Q C;  3VLD A;  5AQ9 A;  3CVU A;  2HYZ A;  4P29 A;  3FUF A;  2DZN A;  3FP3 A;  2F8Y A;  3FTZ A;  3KSQ A;  5G05 J;  1SW6 A;  3B7S A;  4WWN A;  4AV7 A;  4WNG A;  3S2A A;  2DVW A;  2ETC A;  3UT4 A;  2FF4 A;  1OWN A;  4UWF A;  4A55 A;  2WXN A;  3QWP A;  1JPL A;  5ENR D;  4HRN A;  4GTO A;  3O4Z A;  4IYP A;  4O1O A;  2AJA A;  3C98 A;  1AWC B;  2BUG A;  3TXM A;  1JWG A;  5A6C A;  4AOF A;  3NOG D;  2WQ7 A;  3FTS A;  4KYO B;  4EBA A;  3CSF A;  1MHQ A;  2IY0 C;  3CGH A;  5D66 A;  2WXI A;  1A17 A;  1H2U A;  3CVP A;  3FFL A;  4KBQ A;  2AXU A;  4LCT A;  5JJ6 A;  1YA0 A;  2XPI A;  3SD5 A;  2X6H A;  3V30 A;  4APF A;  3QB2 A;  3ESK A;  4TUM A;  1NA3 A;  2P9S G;  3C3Q A;  4FA6 A;  3AAA C;  3UUX A;  2Y0B G;  4HNA D;  4A1S A;  4J8F A;  3EHM A;  4J8S A;  4EZL A;  3PVL A;  3ZN3 A;  2YQ8 A;  4QQI A;  4UI9 J;  4G8L A;  2VTB A;  1KZO A;  1K8K G;  4BET A;  3GW4 A;  3JXJ A;  3QWV A;  4GZC A;  3ASO E;  2P9U G;  3C3R A;  1UN9 A;  1SA5 A;  1WY6 A;  5HKP A;  3LY8 A;  1WAO 1;  4XE0 A;  1OCC E;  5CMW A;  2F0Y A;  3G2V A;  3LJN A;  4BT9 A;  5AAO A;  3TGO A;  1Z3X A;  5C1D A;  1JWF A;  4I2Z A;  1KT0 A;  3UT8 A;  3PZ3 A;  1V55 E;  1Y6I A;  5ANL A;  2LAH A;  2GGF A;  3WXX A;  3RK6 A;  3FH8 A;  4HI8 A;  2CHX A;  2BKK B;  4HS2 A;  2WXP A;  4J6I A;  4NAC A;  3RAU A;  2KBX A;  3UKU G;  2XEE A;  4ME2 A;  4HBD A;  3APD A;  2XGM A;  5T8I A;  3IXE A;  4GCO A;  3LY7 A;  2MRI A;  3RU0 A;  4GTM A;  4F1P A;  2J49 A;  3UI2 A; 
#chains in the Genus database with same CATH homology
 1K1B A;  4U96 D;  1MX6 A;  1IKN D;  1BI8 B;  4JB8 P;  3V30 A;  5HRY A;  1TR4 A;  1QYM A;  3J5P A;  4YDY A;  3JUE A;  4TUM A;  4RLY A;  4G8K A;  3TWU A;  3UXG A;  4HRM B;  3HRA A;  5EYL A;  4N5Q A;  3AJI A;  4GMR A;  3AAA C;  2ETB A;  3W9F A;  2Y1L E;  4DX5 D;  1DC2 A;  4GPM A;  3EHQ A;  1SVX A;  2F37 A;  2Y0B G;  3T8K A;  4HNA D;  1S70 B;  2KXP C;  5ENQ D;  4LNU D;  3TWT A;  1BLX B;  5CBN A;  3T9K A;  2J8S D;  3V31 A;  1WG0 A;  4HB5 A;  5KNH D;  4ATZ D;  3W9G A;  4QFV A;  3TWV A;  4CYM D;  4BES A;  3C5R A;  1YCS B;  4BSZ B;  1NFI E;  5EN5 D;  3D9H A;  1G3N B;  3B7B A;  2XZT G;  3HG0 D;  4QQI A;  1K1A A;  4ZHB A;  4LG6 A;  5CED B;  3J5Q B;  4G8L A;  4J7W A;  2V5Q C;  5AQ9 A;  1MX2 A;  3UTM A;  4BET A;  1OT8 A;  4F6R D;  2ETA A;  3V2O A;  2PNN A;  3F6Q A;  2QYJ A;  3JXJ A;  4K5C A;  3V79 K;  2DZN A;  1OY3 D;  4U8V D;  5FIO A;  5JMN D;  2FO1 E;  2A5E A;  2QC9 A;  1AP7 A;  5FIN A;  2F8Y A;  3DEO A;  1YYH A;  4A63 B;  5HKP A;  4DX1 A;  4U8Y D;  2XEH A;  4ZFH A;  1SW6 A;  1YMP A;  3DEP A;  2JAB A;  4J8Y A;  5EID A;  2RFA A;  2L6B A;  1K3Z D;  3ZU7 B;  1UOH A;  3LJN A;  5AAO A;  4HRL A;  5AQ7 A;  3ZUV B;  5ITZ F;  2DVW A;  5AQB A;  4K5B A;  2ETC A;  5ENP D;  2F8X K;  3KEA A;  3B95 A;  5EYP F;  1IXV A;  4Z68 A;  2XEN A;  4OAV B;  2BKG A;  5KNG A;  5BXU A;  4LSZ E;  5KBA A;  5EIL A;  5ENR D;  3SO8 A;  4HRN A;  3ZNG A;  4CZ2 D;  4YDW A;  4HI8 A;  4BEP A;  1MJ0 A;  4HLL A;  4O1O A;  3EHR A;  2BKK B;  2V4H C;  2AJA A;  1AWC B;  1WDY A;  1BI7 B;  2DZO A;  5CEC B;  4HI9 A;  2KBX A;  4BER A;  5KWD A;  5AQA A;  4DX6 D;  2RFM A;  4C48 B;  1DCQ A;  2VGE A;  2P2C P;  3NOG D;  3TWX A;  5ENT D;  2XEE A;  4DX7 D;  4B93 B;  5EIB E;  1D9S A;  2ZGG A;  4HQD A;  4NIK A;  4HBD A;  5ENS D;  1A5E A;  5CBO A;  5HS0 A;  3TWS A;  5D66 A;  2B0O E;  2NYJ A;  3EU9 A;  3JXI A;  5CER B;  3TWW A;  4O1P A;  3NBN B;  1BU9 A;  2HE0 A;  4DX2 A;  3IXE A;  5ENO D;  1MX4 A;  5JA4 D;  1N0R A;  4OAU C;  3TWR A;  4U95 D;  4K5A B;  3Q9N C;  1BD8 A;  3V2X A;  4F1P A;  1MYO A;  1N0Q A;  5CEA A;  5AN8 A;  4UUC A;  1IHB A;  4DRX E;  5AAR A;  4O60 A;  5BXO A;  3NOC D;  2ZGD A;  3Q9U C;  3UI2 A;  2XZD G;  3TWQ A;  4DUI A;  1N11 A;  2MYO A;  2DWZ A;  3ZKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...