2ZGGA

Asn-hydroxylation stabilises the ankyrin repeat domain fold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVAAKDKNGSTPLHLAARNGHLEVVKLLLEAGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asparagine beta-hydroxylation stabilizes the ankyrin repeat domain fold
pubmed doi rcsb
molecule keywords 3 repeat synthetic ankyrin
molecule tags De novo protein
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2zggA00
4CZ2D 5CEDB 1N0RA 4HLLA 4K5CA 3ZUVB 4HQDA 4N5QA 5CBOA 4ZFHA 2ZGGA 3AAAC 2AJAA 3V30A 4F6RD 4GPMA 5CERB 5AAOA 5FINA 5CBNA 1A5EA 2F8YA 3LJNA 5KNGA 4U95D 4DX5D 1SW6A 5EYPF 4YDYA 1QYMA 2BKKB 3J5PA 4BESA 2NYJA 3IXEA 5KBAA 2RFAA 4UUCA 3C5RA 4LG6A 3B95A 1NFIE 3KEAA 5HRYA 3TWVA 4HI8A 5D66A 3W9GA 2ETBA 5ENPD 4DX2A 4CYMD 3TWQA 1YMPA 3Q9NC 3DEOA 3TWWA 5ITZF 1BD8A 3UTMA 5KNHD 4DRXE 1IHBA 3ZU7B 2B0OE 2F37A 1BU9A 2XENA 3D9HA 3ZNGA 3SO8A 3B7BA 3TWUA 4RLYA 4HRMB 1N11A 3Q9UC 4LNUD 2FO1E 1D9SA 5EN5D 5BXUA 5JA4D 4J7WA 2A5EA 3TWRA 2XEEA 3UI2A 3TWXA 2XEHA 1K3ZD 2HE0A 2KBXA 4OAUC 1AP7A 2MYOA 1OY3D 5ENTD 3EHQA 4ATZD 4OAVB 4U96D 4Z68A 1BI7B 4QQIA 5ENSD 4F1PA 4J8YA 5HKPA 2V5QC 3T8KA 4BERA 4JB8P 1S70B 2DWZA 5EIBE 5EIDA 3TWSA 3HRAA 3V2OA 2J8SD 2KXPC 1YYHA 2QYJA 3NOCD 1DCQA 4GMRA 4DX1A 2F8XK 1AWCB 1UOHA 3NOGD 5AQAA 4DUIA 1TR4A 3V31A 2ZGDA 4HBDA 4HI9A 4O1OA 4DX7D 5BXOA 3AJIA 1IKND 1DC2A 1IXVA 1OT8A 2DZOA 3EHRA 4B93B 4O60A 1WDYA 4HB5A 1G3NB 4BSZB 5CEAA 1SVXA 4YDWA 5AQBA 1N0QA 5EILA 2ETAA 1YCSB 2DVWA 4LSZE 5AN8A 2Y1LE 4HRNA 4U8VD 2P2CP 2VGEA 2RFMA 3JXJA 5JMND 5HS0A 1K1AA 2V4HC 2L6BA 4O1PA 4BETA 4NIKA 3EU9A 5AQ9A 5ENQD 4TUMA 1MYOA 5KWDA 2XZTG 2QC9A 4C48B 4G8KA 2XZDG 3DEPA 5AQ7A 4A63B 5ENOD 1MJ0A 3NBNB 2PNNA 2Y0BG 4K5BA 1BLXB 3V2XA 3UXGA 4HRLA 1MX2A 2ETCA 4K5AB 3JXIA 3V79K 4G8LA 3F6QA 1WG0A 5EYLA 4ZHBA 2BKGA 4HNAD 5ENRD 1BI8B 3JUEA 5CECB 1K1BA 5AARA 3W9FA 3J5QB 1MX4A 2JABA 4BEPA 3ZKJA 1MX6A 2DZNA 4QFVA 3T9KA 5FIOA 4DX6D 3HG0D 3TWTA 4U8YD
chains in the Genus database with same CATH superfamily
1MHQA 3KD7A 3PEVB 2VSXE 4GTPA 3PNTB 3FH7A 2J9QA 3PE4A 3ZYQA 2P9IG 3ZGQA 2KCLA 3BUAA 4TXPA 2V0PA 3FFLA 2DIWA 3T8MA 4EZLA 3CGHA 5CCMA 3SI5A 4J7WA 3TWXA 3L6AA 3RJVA 1K3ZD 2WVIA 2LXLA 3U3WA 3DSVA 2J49A 1LF8A 4FLBA 5EIDA 1Z3YA 1TNYA 1N94A 4PS8A 4OVUA 4G2VA 2FEZA 4I6EA 4UWFA 3FUIA 4W9RA 4G24A 5CEAA 2EILE 2UY1A 2Y1LE 5HS0A 3VLFA 1N4PA 4GTVA 5ENOD 3NBNB 1FPPA 4HRLA 1JCQA 4A1GA 5EYLA 3D3MA 1HX8A 3JUEA 3SNXA 3UIPC 4AVXA 5KJMA 2I9CA 2J4DA 3LY7A 1B89A 4ILHB 3IKOB 2XPIA 1FCHA 4BTAA 4AM9A 3PS6A 2PM6A 3IXEA 2QYUA 4UUCA 5JHAA 4N3CA 3MKQB 4I2WA 5FZQA 4X8QA 3SF4A 2X38A 3G2VA 1IHBA 2XENA 2DCPA 3ZNGA 3FEXA 3PZ3A 2Y4UA 4JA7A 3Q49B 1ZB1A 2A5EA 1HFAA 4F53A 4Y6WA 4URKA 4FLHA 1BI7B 2V5QC 3T8KA 2M63A 5EIBE 1ELKA 3NOCD 1DCQA 1OWLA 3G2SA 3NOGD 4I2ZA 4DUIA 4PDXA 2E0IA 2WXHA 1IKND 4B93B 4JHRA 3ZXSA 2L0TB 4ME2A 2FO7A 5KJLA 2EIJE 1H2UA 4YDWA 1YCSB 4PS3A 2XEVA 4U8VD 3UKUG 4MRUA 3R7RA 3ENEA 1N52A 4AY5A 3FUEA 4CCAA 3O4ZA 4GYYA 4UI9C 4GA2A 2Y3AA 4G8LA 1X81A 4JPSA 2WMNA 1MX6A 1PY1A 2L6JA 5B1BE 3G2UA 4DLOA 1NA0A 3UIOC 4CRWA 2RFAA 4KT6B 4UWLA 3AU4A 2OV8A 3ESKA 3W9GA 3B7TA 2P9KG 3GW4A 1BD8A 5E76A 2CHWA 2P58C 4DI3A 1FT1A 2WXKA 3CK9A 3ULEG 3URZA 4A55A 5BT1A 5KJKA 3T5XA 3UM2A 4LCTA 3QNKA 2KBXA 4APFA 3GZ1A 2LSUA 4L7TA 2WXNA 4RVBA 4DX1A 1UN9A 2IO3C 3ONKA 1TR4A 3QDNA 4HI9A 1SZ9A 3AJIA 3QWPA 2P9UG 3ZYKA 1SVXA 2ETAA 3CIAA 3CHSA 3DSWA 1XNFA 4YVQC 2LUHA 2Q7FA 5ENQD 4EECA 3UM3A 4IRUA 3D9IA 2WXLA 3OTNA 5IY5E 1IQUA 3F6QA 4BT8A 2IO2C 4KZCA 4JEHA 5ANRA 5LCWC 4JD2G 1KZOA 3FULA 4OYSA 1TEZA 3RRNB 5JJ7A 4NQ0A 1N0RA 1TN6A 3QJZA 4HLEA 3ASHA 2V5FA 3L22A 3APCA 3LJNA 3HVEA 3CVNA 5B1AE 1QYMA 1OCCE 3KEAA 2JLBA 5A23A 3Q9NC 4RG9A 4CGWA 2VGYA 5ITZF 5DBKA 4HOSA 3ZN3A 4GZDA 4AV7A 3B7BA 3OXLA 3LEWA 4NACA 4KZ0A 4HS2A 4APOA 1H6PA 4HFGA 1SA4A 1U3DA 4Z68A 4GTMA 1QBQA 4J8FA 2P9PG 4U63A 2DWZA 1Y6IA 2AW6A 3B13A 4JW1A 2J8SD 1YYHA 2OVBA 4FJZA 1AWCB 2YQ8A 3DXMG 3AU5A 5BXOA 3CQCB 3ULYA 1FVHA 3TAXA 2UY1B 3HXFA 5LP0A 2C0LA 3N71A 3D9LA 4PH4B 5A7DB 2XGSA 1ELWA 2CFZA 3CSFA 5EDSA 3CK7A 3MV2B 1RZ4A 1E90A 2QC9A 5AIJA 2NXPA 3AG3E 2VJ8A 2VSNA 3JQ1A 4B0ZA 4ZHBA 4ANXA 3J5QB 2DZNA 2GRNB 4QFVA 4R7LA 1MQSA 2MOWA 2MRIA 4K5CA 5HQ8A 2J4BA 2ZIRA 2E2EA 3IHVA 3SBTB 1HG5A 3CHQA 1SW6A 2AXUA 2JEKA 2YNQA 1UN8A 1NP7A 4XKBA 3D9PA 4GZ3A 3RIBA 4DX2A 3QARA 4I1MA 3C3QA 3PZ2A 5T4YA 3ULQA 4AIFA 3PUKA 1P5QA 3SO8A 4AY6A 2H6HA 3G2WA 4RG6A 3FTSA 3IBEA 4KVOA 3HHMA 3ABLE 1D9SA 4DK5A 2LAHA 2XEEA 3FUKA 3EHMA 5CRUA 2MYOA 2R05A 2IFUA 5FT9A 3PH0C 4PS7A 3I4RB 4JB8P 4V3IA 1E8XA 1JPLA 4ACLA 4NURA 4U0ZA 1LD7A 4HOTA 4BT9A 4K0RA 2V4LA 4O1OA 3LDZA 4UQZA 3DXKG 4BSZB 3Q5MA 4KVMA 4CT4A 4UI9K 3DRAA 4TUUA 3ML8A 5AQ9A 3S7JA 3DPDA 3U64A 3FU5A 2YHEA 4C48B 4G8KA 4Q94A 4WAFA 5M72A 3JUIA 1Z5SC 2ZU6B 4K5BA 1TN8A 3V2XA 1N4SA 3KAEA 1MX2A 3MA5A 3V79K 1A17A 3VTXA 2ZXWE 3W9FA 4BEPA 4N2SA 4DI4A 3IHYA 3FHEA 3I3NA 2RKKA 4PUCA 3ASOE 3NAWA 3RU0A 4KBQA 4WNEA 1Q2ZA 4J8EA 3CR3A 2RG8A 4BFRA 4CT0A 4XKCA 3G2TA 4WUYA 3R9AB 1D8EA 2B0OE 4C0MA 3UT7A 3KSLA 3QK0A 2PQRA 5KJNA 5FQ4A 4LERA 2IJGX 5EN5D 4UQYA 3I5PA 2GRPB 4EBAG 4XI9A 5BW8C 4J0UA 4U96D 3C98A 4QQIA 4F1PA 2GROB 2ZISA 4ANVA 3SQVA 3S2AA 2F8XK 3ZW3A 4UWHA 4EQFA 2I6HA 5ENNA 2R59A 4ILIA 2DVWA 5AN8A 3GYZA 3LJ3A 1HS6A 1NI1A 4FHKA 2VGEA 1TNUA 1PAQA 2ONDA 4NIKA 3E34A 3FTXA 5AQ7A 5T8IA 4LNGA 3ASFA 1TNZA 4WWNA 5AJDA 4DX6D 3CVYA 5FIOA 2KC7A 3FDHA 4U8YD 3HXBA 3HVEB 1OWOA 5AAOA 3L17A 1VDYA 2L0IA 4I1OB 5KNGA 3AS5A 3CVWA 1E8ZA 3EU5A 2QZAA 5ARGA 4BY6A 5LOZA 3QWVA 2ETBA 5ENPD 5AJLA 4KYOB 3ASDA 3S7FA 3DEOA 3TWWA 5D0OD 2F37A 3MKRA 2BF0X 3TWUA 3FU6A 4LNUD 2VTBA 4OAUC 5D2MC 5J08A 5BNWA 3EHQA 1S70B 3ZVVA 5FZRA 3TL5A 2QY7A 1FVFA 2CHZA 3B7SA 2I1JA 1OT8A 1IHGA 4DJAA 5CMWA 1TN7A 3HDXA 5C2YA 1W3BA 1H2VC 3LPZA 2ILRA 4KMOA 4K03A 3FU3A 1MJ0A 2XGMA 3FTVA 3T5VA 4FA6A 1V55E 1EYHA 2XPZA 3E4BA 4I9CA 2X6FA 1MX4A 2HYZA 4L1BA 3TG4A 3L16A 5CEDB 4JEUA 2GW1A 2X6JA 4LRZA 2WXMA 5G2NA 2WXJA 3CKBA 2AXZA 4G11A 5FINA 4GTOA 2FULA 3KEZA 1O5MA 4D10C 4U95D 3IEGA 3UMVA 2BKKB 1HF8A 2UWJG 4HXIA 3Q15A 4GMLA 1N4QA 3MX3A 2VSOE 2IU1A 2P9NG 3U66A 4GYOA 2BUGA 4TXRA 1QQEA 3B7UX 3Q7FA 2WQHA 4BERA 1S63A 2LAIA 4XE0A 2GRMA 1MZCA 4ANUA 4GTTA 3VTYA 3ABKE 3JCKC 1Z3XA 4GB9A 4AEZC 1KLXA 3B7RL 3Q73A 1G3NB 2R03A 3GZ2A 4MBGA 4GCNA 4HRNA 1HH8A 4MKTA 5EX0A 3OXFA 2FF4A 3SBSA 1E96B 1Y8MA 2PNNA 5JJTA 1BLXB 3FUMA 3Q47B 3CHMA 1EDUA 5B3SE 3D9NA 4GAAA 4GU5A 2PQNA 4YDEA 2XRZA 3DBSA 4N5QA 4ZFHA 4A3TA 4UI9J 2YINA 1HXIA 3AS8A 3PZ1A 5LFAA 5EYPF 4YDYA 1OWMA 2X3MA 3J5PA 5G05C 2NYJA 3SFYA 3CKCA 3ZYLA 4DLQA 5KBAA 4GCOA 4JHJA 3UTMA 1E7VA 3BQOA 3DSXA 3BEEA 3IV0A 5BXUA 1U2VG 4GA0A 4GTSA 1AP7A 4Q69A 5ENTD 4I17A 2IOLA 4J8YA 5G04C 5AYWD 5A6CA 3LKUA 1OWPA 4I1AA 3MJWA 3PUJA 4HBDA 1N95A 3DSTA 3EHRA 2WXQA 3HIZA 3UT4A 1O1TA 4ILGA 1QNFA 4U0UA 4B8CB 2MHKA 4M7CA 3PREA 3UT8A 4WNDA 3QB2A 1MYOA 5KWDA 1EPUA 1JWGA 2PZIA 1ZU2A 3CK8A 3ZHEA 5G55A 1E8WA 4BWRA 1JWFA 1H6OA 5ANLA 4IYPA 4JC8A 3TJPA 3ZIMA 3CEQA 2JABA 1UW4B 4EZKA 3CVQA 2KM4A 2CFUA 1KPSB 4HLLA 5FWQA 3ESLA 4HQDA 2ZGGA 4F6RD 3DWLG 1Z6TA 3OXGA 2XRYA 5LCWJ 4U8HA 1NL4A 3TG5A 3C5RA 2EINE 5LX8A 1NFIE 1TYQG 1HO8A 4HI8A 3KSQA 4CYMD 4A1SA 2IOSA 2OOEA 4HORA 3ZXPA 4DRXE 3PNLB 3D9HA 3LVRE 1V54E 2VTBB 3C3RA 3Q9UC 2IEJA 1U3CA 2IF4A 2VGXA 3PEUB 4J8SA 2I1KA 3SD5A 5JA4D 3UI2A 3E32A 2H6IA 2HE0A 3FH5A 4BX9A 4I6GA 3D9KA 4N5CA 4H7XA 5HKPA 5FQ6A 3NZUA 2HR2A 2XHEA 3EIJA 3V2OA 4UWKA 2HM8A 5KCMA 3AG2E 3LCAA 1DVPA 2PM7A 1SQMA 5C1DA 1X5BA 3FUDA 2PL2A 2H6FA 3ASNE 1UJKA 3PRZA 4GYWA 4F7AA 2XZTG 2AVPA 2VYIA 2WM9A 1LTXA 5FQ7A 4Q96A 5ENRD 2AWIA 1BI8B 3HG0D 1N9AA 2X6KA 1YA0A 1KT0A 4GPMA 2X6HA 2EIME 3HXDA 4UWGA 1JUQA 3Q75A 3BG1B 4KXKB 3S7BA 3E30A 3SGHA 4N3BA 4U0SA 2DYRE 3ZYMA 2R02A 4LNBA 4G1TA 2A5UA 3ASGA 4LEUA 2J09A 1N54A 1PC2A 4FJYA 5D0QD 4RLYA 2FO1E 4TRQA 3NZSA 2XEHA 4HOUA 3Q4AB 4L23A 4FADA 2KZTA 2EQXA 4YVOA 4WWOA 2FBNA 4GMJA 3APDA 5BV1A 2DZOA 4RSYA 2LO6A 2LXMA 3GZSA 3LY9A 3RAUA 3LYAA 4TUMA 3FUHA 2XZDG 4I6JA 4N2QA 3UXGA 5CRVA 5JJ6A 2CG2A 3SFZA 3FH8A 3FTUA 2F0YA 3CVUA 2VQ2A 3TXMA 5AARA 4DPRA 3UM0A 2CG3A 3APFA 3AG1E 2AJAA 3JQ0A 3WXXA 1IYGA 2P9SG 3L54A 3LS8A 1FT2A 4BESA 4CDNA 3B95A 1INZA 2WXOA 4J6IA 2X6IA 3FY4A 1QZ2A 2XPYA 4JL0A 4ANWA 3EJNA 3CV0A 1SZAA 1H0AA 2XGOA 2BEDA 4ATZD 3DSSA 2KXPC 4GMRA 3CVVA 3V31A 2B6CA 3S7DA 3SHFA 3BG0B 1WDYA 2EIKE 4WWPA 4FP7A 2V8SE 3D9OA 4EBAA 3SY2A 4O1PA 2XS1A 4LUNU 3VLDA 4IN3B 3SZ7A 3ZHEB 3DEPA 3FTZA 2Y0BG 4OVVA 4GTRA 5FTPA 3VLEA 4HVBA 3R9MA 2NC9A 4UQXA 4N3AA 2WPVA 3I4GA 4HOQA 3MV3B 5CERB 4ATGA 4FHJA 4DX5D 5CMYA 3TGOA 3UUXA 3QC1A 1UJJA 3BU8A 3HYMB 4LG6A 4WNFA 1OXJA 5HRYA 5D66A 2KCKA 4NRHB 2AXVA 4GZ6A 3TWQA 1GW6A 2VGXB 2WXRA 2LNIA 4HRMB 3CSTA 3CVPA 2VSYA 3FU0A 2WB2A 1TNOA 4GZ5A 5AENA 1NZNA 1IQRA 3PZ4A 4B89A 2WMOA 2IONA 4CEMA 2GRRB 4JXTA 3HRAA 3K9IA 4EPZA 4Y6CA 3RK6A 2QYJA 4XIFA 2ZGDA 3FUNA 1DC2A 4GA1A 3E37A 1OCOE 4HB5A 5EILA 4B8AA 4J8DA 4A3VA 2R5SA 3NF1A 5JMND 1K1AA 2V4HC 3ZEFA 2IY0C 4E85A 4C0EA 4TV3A 3DSUA 5BV0A 1OCRE 1TJFA 4AXHA 3PZDA 4I9EA 4JA9A 3L08A 3D9JA 4K5AB 3C72A 3JXIA 2R2LA 3MEKA 4HNAD 1OUVA 3LXUX 4AJWA 3OAWA 3AG4E 1HZ4A 3HXEA 3RSEG 2DYSE 4CGVA 4GPKA 2C0MA 3ZUVB 1O1RA 4AOFA 3PE3A 2WXPA 3L13A 3CVLA 4AP2A 2YHCA 3FUJA 4JVSA 3ISMC 3P1UA 2H6GA 3UQ3A 4EHMA 2GRLA 2Y69E 4GZCA 1JCRA 4FC8A 5KNHD 4BTBA 3ZU7B 5H7PA 5J90A 1BU9A 2Y4TA 5EKQD 3R7QA 2DBAA 4L2YA 1HU3A 1WAO1 3C3OA 3ZRHA 3U9WA 2KZTB 4G26A 3P2BA 1OY3D 5HI7A 5BUZA 1EF1C 4O6FA 3PDNA 1S64A 4BSXA 2KATA 4MS6A 1DCEA 1UOHA 5AQAA 3FEYA 1IXVA 3MYVA 3QKYA 2XCBA 4O60A 2NSZA 1KT1A 3CQGB 5AQBA 3QWWA 3CHOA 4LSZE 2RFMA 2L6BA 2OEWA 3UPVA 3Q7AA 3UM1A 4A63B 3NB2A 1RW2A 3O48A 2ETCA 2GRQB 3FTYA 3TXNA 1WG0A 2BKGA 4XX5A 2LSVA 5E75A 2A4ZA 5FQ8A 2BTDA 1H19A 2R17C 5DIZA 5CBNA 1A5EA 4U04A 3QAQA 4BX8A 2CHXA 1H6KA 1WY6A 2WXIA 4TXQA 3RKVA 4F3VA 1D8DA 3ZPJA 3TWVA 1LD8A 3FTWA 2WQ6A 3ZFWA 4I43A 1OWNA 3MKQA 2J08A 2XS8A 1H2TC 4C9BB 5G05J 4ABNA 1E8YA 4FU3A 4EZJA 1N11A 3TWRA 2I2OA 1ELRA 4F1SA 3UKRG 4L9PA 5FZSA 1DNPA 2XQ0A 2IQCA 2WXGA 4XZ4A 1L5JA 3Q79A 2QFCA 4DX7D 3U4TA 1SA5A 3LY8A 3FUFA 3PVLA 5G04J 3EDTB 3L82A 3FP3A 2XCCA 4IULA 1S0PA 2P2CP 4E6HA 3JXJA 3KS2A 3X2QE 4BETA 4P29A 3EU9A 5FJYA 3EHNA 4XI0A 3NQPA 2L9BA 4FULA 4CDMA 5T3RA 1JCSA 1O1SA 4YDOA 3RRMB 3UX4A 1K1BA 4M3OA 2P9LG 3ZKJA 3SFXA 3TWTA 5CECB 4CZ2D 1WM5A 3CHRA 3D9MA 5CBOA 3AAAC 3V30A 1NA3A 5ARFA 2C2LA 5CCLA 2F8YA 1HE8A 4WNGA 3ML9A 3E33A 4L2LA 1UG3A 3LVQE 4CDRA 4U7EB 2KCVA 4H7YA 2WXFA 3Q78A 3JYSA 4MLPA 3WG7E 1HG2A 1YMPA 4GTQA 3CVXA 2OCCE 2HO1A 3CLJA 3EUVA 1ZBPA 3ONLA 3QOUA 3HXCA 4YNDA 4OAVB 5ENSD 3RO3A 1KZPA 4G25A 3TWSA 1N4RA 1OCZE 4G23A 3MGBA 4ACKA 4JZYA 3FWVA 2RD0A 4N39A 4JHKA 2J07A 2OVFA 1TJCA 2FI7A 1N0QA 4XEIG 3DPYA 3AS4A 3RO2A 4U07A 3UINC 2GGFA 3MZLB 5EX3A 3MCXA 3CHPA 4RQIA 4B94A 5BPPA 5CHEE 1XGWA 3L9TA 3ABME 3RRUA 5JHBA 3EIQC 1BPOA 1E7UA 1TNBA 1K8KG 3T9KA 2WQ7A 2OEVA
chains in the Genus database with same CATH topology
4CZ2D 5CEDB 1N0RA 4HLLA 4K5CA 3ZUVB 4HQDA 4N5QA 5CBOA 4ZFHA 2ZGGA 3AAAC 2AJAA 3V30A 4F6RD 4GPMA 5CERB 5AAOA 5FINA 5CBNA 1A5EA 2F8YA 3LJNA 5KNGA 4U95D 4DX5D 1SW6A 5EYPF 4YDYA 1QYMA 2BKKB 3J5PA 4BESA 2NYJA 3IXEA 5KBAA 2RFAA 4UUCA 3C5RA 4LG6A 3B95A 1NFIE 3KEAA 5HRYA 3TWVA 4HI8A 5D66A 3W9GA 2ETBA 5ENPD 4DX2A 4CYMD 3TWQA 1YMPA 3Q9NC 3DEOA 3TWWA 5ITZF 1BD8A 3UTMA 5KNHD 4DRXE 1IHBA 3ZU7B 2B0OE 2F37A 1BU9A 2XENA 3D9HA 3ZNGA 3SO8A 3B7BA 3TWUA 4RLYA 4HRMB 1N11A 3Q9UC 4LNUD 2FO1E 1D9SA 5EN5D 5BXUA 5JA4D 4J7WA 2A5EA 3TWRA 2XEEA 3UI2A 3TWXA 2XEHA 1K3ZD 2HE0A 2KBXA 4OAUC 1AP7A 2MYOA 1OY3D 5ENTD 3EHQA 4ATZD 4OAVB 4U96D 4Z68A 1BI7B 4QQIA 5ENSD 4F1PA 4J8YA 5HKPA 2V5QC 3T8KA 4BERA 4JB8P 1S70B 2DWZA 5EIBE 5EIDA 3TWSA 3HRAA 3V2OA 2J8SD 2KXPC 1YYHA 2QYJA 3NOCD 1DCQA 4GMRA 4DX1A 2F8XK 1AWCB 1UOHA 3NOGD 5AQAA 4DUIA 1TR4A 3V31A 2ZGDA 4HBDA 4HI9A 4O1OA 4DX7D 5BXOA 3AJIA 1IKND 1DC2A 1IXVA 1OT8A 2DZOA 3EHRA 4B93B 4O60A 1WDYA 4HB5A 1G3NB 4BSZB 5CEAA 1SVXA 4YDWA 5AQBA 1N0QA 5EILA 2ETAA 1YCSB 2DVWA 4LSZE 5AN8A 2Y1LE 4HRNA 4U8VD 2P2CP 2VGEA 2RFMA 3JXJA 5JMND 5HS0A 1K1AA 2V4HC 2L6BA 4O1PA 4BETA 4NIKA 3EU9A 5AQ9A 5ENQD 4TUMA 1MYOA 5KWDA 2XZTG 2QC9A 4C48B 4G8KA 2XZDG 3DEPA 5AQ7A 4A63B 5ENOD 1MJ0A 3NBNB 2PNNA 2Y0BG 4K5BA 1BLXB 3V2XA 3UXGA 4HRLA 1MX2A 2ETCA 4K5AB 3JXIA 3V79K 4G8LA 3F6QA 1WG0A 5EYLA 4ZHBA 2BKGA 4HNAD 5ENRD 1BI8B 3JUEA 5CECB 1K1BA 5AARA 3W9FA 3J5QB 1MX4A 2JABA 4BEPA 3ZKJA 1MX6A 2DZNA 4QFVA 3T9KA 5FIOA 4DX6D 3HG0D 3TWTA 4U8YD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZ2 D;  5CED B;  1N0R A;  4HLL A;  4K5C A;  3ZUV B;  4HQD A;  4N5Q A;  5CBO A;  4ZFH A;  2ZGG A;  3AAA C;  2AJA A;  3V30 A;  4F6R D;  4GPM A;  5CER B;  5AAO A;  5FIN A;  5CBN A;  1A5E A;  2F8Y A;  3LJN A;  5KNG A;  4U95 D;  4DX5 D;  1SW6 A;  5EYP F;  4YDY A;  1QYM A;  2BKK B;  3J5P A;  4BES A;  2NYJ A;  3IXE A;  5KBA A;  2RFA A;  4UUC A;  3C5R A;  4LG6 A;  3B95 A;  1NFI E;  3KEA A;  5HRY A;  3TWV A;  4HI8 A;  5D66 A;  3W9G A;  2ETB A;  5ENP D;  4DX2 A;  4CYM D;  3TWQ A;  1YMP A;  3Q9N C;  3DEO A;  3TWW A;  5ITZ F;  1BD8 A;  3UTM A;  5KNH D;  4DRX E;  1IHB A;  3ZU7 B;  2B0O E;  2F37 A;  1BU9 A;  2XEN A;  3D9H A;  3ZNG A;  3SO8 A;  3B7B A;  3TWU A;  4RLY A;  4HRM B;  1N11 A;  3Q9U C;  4LNU D;  2FO1 E;  1D9S A;  5EN5 D;  5BXU A;  5JA4 D;  4J7W A;  2A5E A;  3TWR A;  2XEE A;  3UI2 A;  3TWX A;  2XEH A;  1K3Z D;  2HE0 A;  2KBX A;  4OAU C;  1AP7 A;  2MYO A;  1OY3 D;  5ENT D;  3EHQ A;  4ATZ D;  4OAV B;  4U96 D;  4Z68 A;  1BI7 B;  4QQI A;  5ENS D;  4F1P A;  4J8Y A;  5HKP A;  2V5Q C;  3T8K A;  4BER A;  4JB8 P;  1S70 B;  2DWZ A;  5EIB E;  5EID A;  3TWS A;  3HRA A;  3V2O A;  2J8S D;  2KXP C;  1YYH A;  2QYJ A;  3NOC D;  1DCQ A;  4GMR A;  4DX1 A;  2F8X K;  1AWC B;  1UOH A;  3NOG D;  5AQA A;  4DUI A;  1TR4 A;  3V31 A;  2ZGD A;  4HBD A;  4HI9 A;  4O1O A;  4DX7 D;  5BXO A;  3AJI A;  1IKN D;  1DC2 A;  1IXV A;  1OT8 A;  2DZO A;  3EHR A;  4B93 B;  4O60 A;  1WDY A;  4HB5 A;  1G3N B;  4BSZ B;  5CEA A;  1SVX A;  4YDW A;  5AQB A;  1N0Q A;  5EIL A;  2ETA A;  1YCS B;  2DVW A;  4LSZ E;  5AN8 A;  2Y1L E;  4HRN A;  4U8V D;  2P2C P;  2VGE A;  2RFM A;  3JXJ A;  5JMN D;  5HS0 A;  1K1A A;  2V4H C;  2L6B A;  4O1P A;  4BET A;  4NIK A;  3EU9 A;  5AQ9 A;  5ENQ D;  4TUM A;  1MYO A;  5KWD A;  2XZT G;  2QC9 A;  4C48 B;  4G8K A;  2XZD G;  3DEP A;  5AQ7 A;  4A63 B;  5ENO D;  1MJ0 A;  3NBN B;  2PNN A;  2Y0B G;  4K5B A;  1BLX B;  3V2X A;  3UXG A;  4HRL A;  1MX2 A;  2ETC A;  4K5A B;  3JXI A;  3V79 K;  4G8L A;  3F6Q A;  1WG0 A;  5EYL A;  4ZHB A;  2BKG A;  4HNA D;  5ENR D;  1BI8 B;  3JUE A;  5CEC B;  1K1B A;  5AAR A;  3W9F A;  3J5Q B;  1MX4 A;  2JAB A;  4BEP A;  3ZKJ A;  1MX6 A;  2DZN A;  4QFV A;  3T9K A;  5FIO A;  4DX6 D;  3HG0 D;  3TWT A;  4U8Y D; 
#chains in the Genus database with same CATH topology
 1MHQ A;  3KD7 A;  3PEV B;  2VSX E;  4GTP A;  3PNT B;  3FH7 A;  2J9Q A;  3PE4 A;  3ZYQ A;  2P9I G;  3ZGQ A;  2KCL A;  3BUA A;  4TXP A;  2V0P A;  3FFL A;  2DIW A;  3T8M A;  4EZL A;  3CGH A;  5CCM A;  3SI5 A;  4J7W A;  3TWX A;  3L6A A;  3RJV A;  1K3Z D;  2WVI A;  2LXL A;  3U3W A;  3DSV A;  2J49 A;  1LF8 A;  4FLB A;  5EID A;  1Z3Y A;  1TNY A;  1N94 A;  4PS8 A;  4OVU A;  4G2V A;  2FEZ A;  4I6E A;  4UWF A;  3FUI A;  4W9R A;  4G24 A;  5CEA A;  2EIL E;  2UY1 A;  2Y1L E;  5HS0 A;  3VLF A;  1N4P A;  4GTV A;  5ENO D;  3NBN B;  1FPP A;  4HRL A;  1JCQ A;  4A1G A;  5EYL A;  3D3M A;  1HX8 A;  3JUE A;  3SNX A;  3UIP C;  4AVX A;  5KJM A;  2I9C A;  2J4D A;  3LY7 A;  1B89 A;  4ILH B;  3IKO B;  2XPI A;  1FCH A;  4BTA A;  4AM9 A;  3PS6 A;  2PM6 A;  3IXE A;  2QYU A;  4UUC A;  5JHA A;  4N3C A;  3MKQ B;  4I2W A;  5FZQ A;  4X8Q A;  3SF4 A;  2X38 A;  3G2V A;  1IHB A;  2XEN A;  2DCP A;  3ZNG A;  3FEX A;  3PZ3 A;  2Y4U A;  4JA7 A;  3Q49 B;  1ZB1 A;  2A5E A;  1HFA A;  4F53 A;  4Y6W A;  4URK A;  4FLH A;  1BI7 B;  2V5Q C;  3T8K A;  2M63 A;  5EIB E;  1ELK A;  3NOC D;  1DCQ A;  1OWL A;  3G2S A;  3NOG D;  4I2Z A;  4DUI A;  4PDX A;  2E0I A;  2WXH A;  1IKN D;  4B93 B;  4JHR A;  3ZXS A;  2L0T B;  4ME2 A;  2FO7 A;  5KJL A;  2EIJ E;  1H2U A;  4YDW A;  1YCS B;  4PS3 A;  2XEV A;  4U8V D;  3UKU G;  4MRU A;  3R7R A;  3ENE A;  1N52 A;  4AY5 A;  3FUE A;  4CCA A;  3O4Z A;  4GYY A;  4UI9 C;  4GA2 A;  2Y3A A;  4G8L A;  1X81 A;  4JPS A;  2WMN A;  1MX6 A;  1PY1 A;  2L6J A;  5B1B E;  3G2U A;  4DLO A;  1NA0 A;  3UIO C;  4CRW A;  2RFA A;  4KT6 B;  4UWL A;  3AU4 A;  2OV8 A;  3ESK A;  3W9G A;  3B7T A;  2P9K G;  3GW4 A;  1BD8 A;  5E76 A;  2CHW A;  2P58 C;  4DI3 A;  1FT1 A;  2WXK A;  3CK9 A;  3ULE G;  3URZ A;  4A55 A;  5BT1 A;  5KJK A;  3T5X A;  3UM2 A;  4LCT A;  3QNK A;  2KBX A;  4APF A;  3GZ1 A;  2LSU A;  4L7T A;  2WXN A;  4RVB A;  4DX1 A;  1UN9 A;  2IO3 C;  3ONK A;  1TR4 A;  3QDN A;  4HI9 A;  1SZ9 A;  3AJI A;  3QWP A;  2P9U G;  3ZYK A;  1SVX A;  2ETA A;  3CIA A;  3CHS A;  3DSW A;  1XNF A;  4YVQ C;  2LUH A;  2Q7F A;  5ENQ D;  4EEC A;  3UM3 A;  4IRU A;  3D9I A;  2WXL A;  3OTN A;  5IY5 E;  1IQU A;  3F6Q A;  4BT8 A;  2IO2 C;  4KZC A;  4JEH A;  5ANR A;  5LCW C;  4JD2 G;  1KZO A;  3FUL A;  4OYS A;  1TEZ A;  3RRN B;  5JJ7 A;  4NQ0 A;  1N0R A;  1TN6 A;  3QJZ A;  4HLE A;  3ASH A;  2V5F A;  3L22 A;  3APC A;  3LJN A;  3HVE A;  3CVN A;  5B1A E;  1QYM A;  1OCC E;  3KEA A;  2JLB A;  5A23 A;  3Q9N C;  4RG9 A;  4CGW A;  2VGY A;  5ITZ F;  5DBK A;  4HOS A;  3ZN3 A;  4GZD A;  4AV7 A;  3B7B A;  3OXL A;  3LEW A;  4NAC A;  4KZ0 A;  4HS2 A;  4APO A;  1H6P A;  4HFG A;  1SA4 A;  1U3D A;  4Z68 A;  4GTM A;  1QBQ A;  4J8F A;  2P9P G;  4U63 A;  2DWZ A;  1Y6I A;  2AW6 A;  3B13 A;  4JW1 A;  2J8S D;  1YYH A;  2OVB A;  4FJZ A;  1AWC B;  2YQ8 A;  3DXM G;  3AU5 A;  5BXO A;  3CQC B;  3ULY A;  1FVH A;  3TAX A;  2UY1 B;  3HXF A;  5LP0 A;  2C0L A;  3N71 A;  3D9L A;  4PH4 B;  5A7D B;  2XGS A;  1ELW A;  2CFZ A;  3CSF A;  5EDS A;  3CK7 A;  3MV2 B;  1RZ4 A;  1E90 A;  2QC9 A;  5AIJ A;  2NXP A;  3AG3 E;  2VJ8 A;  2VSN A;  3JQ1 A;  4B0Z A;  4ZHB A;  4ANX A;  3J5Q B;  2DZN A;  2GRN B;  4QFV A;  4R7L A;  1MQS A;  2MOW A;  2MRI A;  4K5C A;  5HQ8 A;  2J4B A;  2ZIR A;  2E2E A;  3IHV A;  3SBT B;  1HG5 A;  3CHQ A;  1SW6 A;  2AXU A;  2JEK A;  2YNQ A;  1UN8 A;  1NP7 A;  4XKB A;  3D9P A;  4GZ3 A;  3RIB A;  4DX2 A;  3QAR A;  4I1M A;  3C3Q A;  3PZ2 A;  5T4Y A;  3ULQ A;  4AIF A;  3PUK A;  1P5Q A;  3SO8 A;  4AY6 A;  2H6H A;  3G2W A;  4RG6 A;  3FTS A;  3IBE A;  4KVO A;  3HHM A;  3ABL E;  1D9S A;  4DK5 A;  2LAH A;  2XEE A;  3FUK A;  3EHM A;  5CRU A;  2MYO A;  2R05 A;  2IFU A;  5FT9 A;  3PH0 C;  4PS7 A;  3I4R B;  4JB8 P;  4V3I A;  1E8X A;  1JPL A;  4ACL A;  4NUR A;  4U0Z A;  1LD7 A;  4HOT A;  4BT9 A;  4K0R A;  2V4L A;  4O1O A;  3LDZ A;  4UQZ A;  3DXK G;  4BSZ B;  3Q5M A;  4KVM A;  4CT4 A;  4UI9 K;  3DRA A;  4TUU A;  3ML8 A;  5AQ9 A;  3S7J A;  3DPD A;  3U64 A;  3FU5 A;  2YHE A;  4C48 B;  4G8K A;  4Q94 A;  4WAF A;  5M72 A;  3JUI A;  1Z5S C;  2ZU6 B;  4K5B A;  1TN8 A;  3V2X A;  1N4S A;  3KAE A;  1MX2 A;  3MA5 A;  3V79 K;  1A17 A;  3VTX A;  2ZXW E;  3W9F A;  4BEP A;  4N2S A;  4DI4 A;  3IHY A;  3FHE A;  3I3N A;  2RKK A;  4PUC A;  3ASO E;  3NAW A;  3RU0 A;  4KBQ A;  4WNE A;  1Q2Z A;  4J8E A;  3CR3 A;  2RG8 A;  4BFR A;  4CT0 A;  4XKC A;  3G2T A;  4WUY A;  3R9A B;  1D8E A;  2B0O E;  4C0M A;  3UT7 A;  3KSL A;  3QK0 A;  2PQR A;  5KJN A;  5FQ4 A;  4LER A;  2IJG X;  5EN5 D;  4UQY A;  3I5P A;  2GRP B;  4EBA G;  4XI9 A;  5BW8 C;  4J0U A;  4U96 D;  3C98 A;  4QQI A;  4F1P A;  2GRO B;  2ZIS A;  4ANV A;  3SQV A;  3S2A A;  2F8X K;  3ZW3 A;  4UWH A;  4EQF A;  2I6H A;  5ENN A;  2R59 A;  4ILI A;  2DVW A;  5AN8 A;  3GYZ A;  3LJ3 A;  1HS6 A;  1NI1 A;  4FHK A;  2VGE A;  1TNU A;  1PAQ A;  2OND A;  4NIK A;  3E34 A;  3FTX A;  5AQ7 A;  5T8I A;  4LNG A;  3ASF A;  1TNZ A;  4WWN A;  5AJD A;  4DX6 D;  3CVY A;  5FIO A;  2KC7 A;  3FDH A;  4U8Y D;  3HXB A;  3HVE B;  1OWO A;  5AAO A;  3L17 A;  1VDY A;  2L0I A;  4I1O B;  5KNG A;  3AS5 A;  3CVW A;  1E8Z A;  3EU5 A;  2QZA A;  5ARG A;  4BY6 A;  5LOZ A;  3QWV A;  2ETB A;  5ENP D;  5AJL A;  4KYO B;  3ASD A;  3S7F A;  3DEO A;  3TWW A;  5D0O D;  2F37 A;  3MKR A;  2BF0 X;  3TWU A;  3FU6 A;  4LNU D;  2VTB A;  4OAU C;  5D2M C;  5J08 A;  5BNW A;  3EHQ A;  1S70 B;  3ZVV A;  5FZR A;  3TL5 A;  2QY7 A;  1FVF A;  2CHZ A;  3B7S A;  2I1J A;  1OT8 A;  1IHG A;  4DJA A;  5CMW A;  1TN7 A;  3HDX A;  5C2Y A;  1W3B A;  1H2V C;  3LPZ A;  2ILR A;  4KMO A;  4K03 A;  3FU3 A;  1MJ0 A;  2XGM A;  3FTV A;  3T5V A;  4FA6 A;  1V55 E;  1EYH A;  2XPZ A;  3E4B A;  4I9C A;  2X6F A;  1MX4 A;  2HYZ A;  4L1B A;  3TG4 A;  3L16 A;  5CED B;  4JEU A;  2GW1 A;  2X6J A;  4LRZ A;  2WXM A;  5G2N A;  2WXJ A;  3CKB A;  2AXZ A;  4G11 A;  5FIN A;  4GTO A;  2FUL A;  3KEZ A;  1O5M A;  4D10 C;  4U95 D;  3IEG A;  3UMV A;  2BKK B;  1HF8 A;  2UWJ G;  4HXI A;  3Q15 A;  4GML A;  1N4Q A;  3MX3 A;  2VSO E;  2IU1 A;  2P9N G;  3U66 A;  4GYO A;  2BUG A;  4TXR A;  1QQE A;  3B7U X;  3Q7F A;  2WQH A;  4BER A;  1S63 A;  2LAI A;  4XE0 A;  2GRM A;  1MZC A;  4ANU A;  4GTT A;  3VTY A;  3ABK E;  3JCK C;  1Z3X A;  4GB9 A;  4AEZ C;  1KLX A;  3B7R L;  3Q73 A;  1G3N B;  2R03 A;  3GZ2 A;  4MBG A;  4GCN A;  4HRN A;  1HH8 A;  4MKT A;  5EX0 A;  3OXF A;  2FF4 A;  3SBS A;  1E96 B;  1Y8M A;  2PNN A;  5JJT A;  1BLX B;  3FUM A;  3Q47 B;  3CHM A;  1EDU A;  5B3S E;  3D9N A;  4GAA A;  4GU5 A;  2PQN A;  4YDE A;  2XRZ A;  3DBS A;  4N5Q A;  4ZFH A;  4A3T A;  4UI9 J;  2YIN A;  1HXI A;  3AS8 A;  3PZ1 A;  5LFA A;  5EYP F;  4YDY A;  1OWM A;  2X3M A;  3J5P A;  5G05 C;  2NYJ A;  3SFY A;  3CKC A;  3ZYL A;  4DLQ A;  5KBA A;  4GCO A;  4JHJ A;  3UTM A;  1E7V A;  3BQO A;  3DSX A;  3BEE A;  3IV0 A;  5BXU A;  1U2V G;  4GA0 A;  4GTS A;  1AP7 A;  4Q69 A;  5ENT D;  4I17 A;  2IOL A;  4J8Y A;  5G04 C;  5AYW D;  5A6C A;  3LKU A;  1OWP A;  4I1A A;  3MJW A;  3PUJ A;  4HBD A;  1N95 A;  3DST A;  3EHR A;  2WXQ A;  3HIZ A;  3UT4 A;  1O1T A;  4ILG A;  1QNF A;  4U0U A;  4B8C B;  2MHK A;  4M7C A;  3PRE A;  3UT8 A;  4WND A;  3QB2 A;  1MYO A;  5KWD A;  1EPU A;  1JWG A;  2PZI A;  1ZU2 A;  3CK8 A;  3ZHE A;  5G55 A;  1E8W A;  4BWR A;  1JWF A;  1H6O A;  5ANL A;  4IYP A;  4JC8 A;  3TJP A;  3ZIM A;  3CEQ A;  2JAB A;  1UW4 B;  4EZK A;  3CVQ A;  2KM4 A;  2CFU A;  1KPS B;  4HLL A;  5FWQ A;  3ESL A;  4HQD A;  2ZGG A;  4F6R D;  3DWL G;  1Z6T A;  3OXG A;  2XRY A;  5LCW J;  4U8H A;  1NL4 A;  3TG5 A;  3C5R A;  2EIN E;  5LX8 A;  1NFI E;  1TYQ G;  1HO8 A;  4HI8 A;  3KSQ A;  4CYM D;  4A1S A;  2IOS A;  2OOE A;  4HOR A;  3ZXP A;  4DRX E;  3PNL B;  3D9H A;  3LVR E;  1V54 E;  2VTB B;  3C3R A;  3Q9U C;  2IEJ A;  1U3C A;  2IF4 A;  2VGX A;  3PEU B;  4J8S A;  2I1K A;  3SD5 A;  5JA4 D;  3UI2 A;  3E32 A;  2H6I A;  2HE0 A;  3FH5 A;  4BX9 A;  4I6G A;  3D9K A;  4N5C A;  4H7X A;  5HKP A;  5FQ6 A;  3NZU A;  2HR2 A;  2XHE A;  3EIJ A;  3V2O A;  4UWK A;  2HM8 A;  5KCM A;  3AG2 E;  3LCA A;  1DVP A;  2PM7 A;  1SQM A;  5C1D A;  1X5B A;  3FUD A;  2PL2 A;  2H6F A;  3ASN E;  1UJK A;  3PRZ A;  4GYW A;  4F7A A;  2XZT G;  2AVP A;  2VYI A;  2WM9 A;  1LTX A;  5FQ7 A;  4Q96 A;  5ENR D;  2AWI A;  1BI8 B;  3HG0 D;  1N9A A;  2X6K A;  1YA0 A;  1KT0 A;  4GPM A;  2X6H A;  2EIM E;  3HXD A;  4UWG A;  1JUQ A;  3Q75 A;  3BG1 B;  4KXK B;  3S7B A;  3E30 A;  3SGH A;  4N3B A;  4U0S A;  2DYR E;  3ZYM A;  2R02 A;  4LNB A;  4G1T A;  2A5U A;  3ASG A;  4LEU A;  2J09 A;  1N54 A;  1PC2 A;  4FJY A;  5D0Q D;  4RLY A;  2FO1 E;  4TRQ A;  3NZS A;  2XEH A;  4HOU A;  3Q4A B;  4L23 A;  4FAD A;  2KZT A;  2EQX A;  4YVO A;  4WWO A;  2FBN A;  4GMJ A;  3APD A;  5BV1 A;  2DZO A;  4RSY A;  2LO6 A;  2LXM A;  3GZS A;  3LY9 A;  3RAU A;  3LYA A;  4TUM A;  3FUH A;  2XZD G;  4I6J A;  4N2Q A;  3UXG A;  5CRV A;  5JJ6 A;  2CG2 A;  3SFZ A;  3FH8 A;  3FTU A;  2F0Y A;  3CVU A;  2VQ2 A;  3TXM A;  5AAR A;  4DPR A;  3UM0 A;  2CG3 A;  3APF A;  3AG1 E;  2AJA A;  3JQ0 A;  3WXX A;  1IYG A;  2P9S G;  3L54 A;  3LS8 A;  1FT2 A;  4BES A;  4CDN A;  3B95 A;  1INZ A;  2WXO A;  4J6I A;  2X6I A;  3FY4 A;  1QZ2 A;  2XPY A;  4JL0 A;  4ANW A;  3EJN A;  3CV0 A;  1SZA A;  1H0A A;  2XGO A;  2BED A;  4ATZ D;  3DSS A;  2KXP C;  4GMR A;  3CVV A;  3V31 A;  2B6C A;  3S7D A;  3SHF A;  3BG0 B;  1WDY A;  2EIK E;  4WWP A;  4FP7 A;  2V8S E;  3D9O A;  4EBA A;  3SY2 A;  4O1P A;  2XS1 A;  4LUN U;  3VLD A;  4IN3 B;  3SZ7 A;  3ZHE B;  3DEP A;  3FTZ A;  2Y0B G;  4OVV A;  4GTR A;  5FTP A;  3VLE A;  4HVB A;  3R9M A;  2NC9 A;  4UQX A;  4N3A A;  2WPV A;  3I4G A;  4HOQ A;  3MV3 B;  5CER B;  4ATG A;  4FHJ A;  4DX5 D;  5CMY A;  3TGO A;  3UUX A;  3QC1 A;  1UJJ A;  3BU8 A;  3HYM B;  4LG6 A;  4WNF A;  1OXJ A;  5HRY A;  5D66 A;  2KCK A;  4NRH B;  2AXV A;  4GZ6 A;  3TWQ A;  1GW6 A;  2VGX B;  2WXR A;  2LNI A;  4HRM B;  3CST A;  3CVP A;  2VSY A;  3FU0 A;  2WB2 A;  1TNO A;  4GZ5 A;  5AEN A;  1NZN A;  1IQR A;  3PZ4 A;  4B89 A;  2WMO A;  2ION A;  4CEM A;  2GRR B;  4JXT A;  3HRA A;  3K9I A;  4EPZ A;  4Y6C A;  3RK6 A;  2QYJ A;  4XIF A;  2ZGD A;  3FUN A;  1DC2 A;  4GA1 A;  3E37 A;  1OCO E;  4HB5 A;  5EIL A;  4B8A A;  4J8D A;  4A3V A;  2R5S A;  3NF1 A;  5JMN D;  1K1A A;  2V4H C;  3ZEF A;  2IY0 C;  4E85 A;  4C0E A;  4TV3 A;  3DSU A;  5BV0 A;  1OCR E;  1TJF A;  4AXH A;  3PZD A;  4I9E A;  4JA9 A;  3L08 A;  3D9J A;  4K5A B;  3C72 A;  3JXI A;  2R2L A;  3MEK A;  4HNA D;  1OUV A;  3LXU X;  4AJW A;  3OAW A;  3AG4 E;  1HZ4 A;  3HXE A;  3RSE G;  2DYS E;  4CGV A;  4GPK A;  2C0M A;  3ZUV B;  1O1R A;  4AOF A;  3PE3 A;  2WXP A;  3L13 A;  3CVL A;  4AP2 A;  2YHC A;  3FUJ A;  4JVS A;  3ISM C;  3P1U A;  2H6G A;  3UQ3 A;  4EHM A;  2GRL A;  2Y69 E;  4GZC A;  1JCR A;  4FC8 A;  5KNH D;  4BTB A;  3ZU7 B;  5H7P A;  5J90 A;  1BU9 A;  2Y4T A;  5EKQ D;  3R7Q A;  2DBA A;  4L2Y A;  1HU3 A;  1WAO 1;  3C3O A;  3ZRH A;  3U9W A;  2KZT B;  4G26 A;  3P2B A;  1OY3 D;  5HI7 A;  5BUZ A;  1EF1 C;  4O6F A;  3PDN A;  1S64 A;  4BSX A;  2KAT A;  4MS6 A;  1DCE A;  1UOH A;  5AQA A;  3FEY A;  1IXV A;  3MYV A;  3QKY A;  2XCB A;  4O60 A;  2NSZ A;  1KT1 A;  3CQG B;  5AQB A;  3QWW A;  3CHO A;  4LSZ E;  2RFM A;  2L6B A;  2OEW A;  3UPV A;  3Q7A A;  3UM1 A;  4A63 B;  3NB2 A;  1RW2 A;  3O48 A;  2ETC A;  2GRQ B;  3FTY A;  3TXN A;  1WG0 A;  2BKG A;  4XX5 A;  2LSV A;  5E75 A;  2A4Z A;  5FQ8 A;  2BTD A;  1H19 A;  2R17 C;  5DIZ A;  5CBN A;  1A5E A;  4U04 A;  3QAQ A;  4BX8 A;  2CHX A;  1H6K A;  1WY6 A;  2WXI A;  4TXQ A;  3RKV A;  4F3V A;  1D8D A;  3ZPJ A;  3TWV A;  1LD8 A;  3FTW A;  2WQ6 A;  3ZFW A;  4I43 A;  1OWN A;  3MKQ A;  2J08 A;  2XS8 A;  1H2T C;  4C9B B;  5G05 J;  4ABN A;  1E8Y A;  4FU3 A;  4EZJ A;  1N11 A;  3TWR A;  2I2O A;  1ELR A;  4F1S A;  3UKR G;  4L9P A;  5FZS A;  1DNP A;  2XQ0 A;  2IQC A;  2WXG A;  4XZ4 A;  1L5J A;  3Q79 A;  2QFC A;  4DX7 D;  3U4T A;  1SA5 A;  3LY8 A;  3FUF A;  3PVL A;  5G04 J;  3EDT B;  3L82 A;  3FP3 A;  2XCC A;  4IUL A;  1S0P A;  2P2C P;  4E6H A;  3JXJ A;  3KS2 A;  3X2Q E;  4BET A;  4P29 A;  3EU9 A;  5FJY A;  3EHN A;  4XI0 A;  3NQP A;  2L9B A;  4FUL A;  4CDM A;  5T3R A;  1JCS A;  1O1S A;  4YDO A;  3RRM B;  3UX4 A;  1K1B A;  4M3O A;  2P9L G;  3ZKJ A;  3SFX A;  3TWT A;  5CEC B;  4CZ2 D;  1WM5 A;  3CHR A;  3D9M A;  5CBO A;  3AAA C;  3V30 A;  1NA3 A;  5ARF A;  2C2L A;  5CCL A;  2F8Y A;  1HE8 A;  4WNG A;  3ML9 A;  3E33 A;  4L2L A;  1UG3 A;  3LVQ E;  4CDR A;  4U7E B;  2KCV A;  4H7Y A;  2WXF A;  3Q78 A;  3JYS A;  4MLP A;  3WG7 E;  1HG2 A;  1YMP A;  4GTQ A;  3CVX A;  2OCC E;  2HO1 A;  3CLJ A;  3EUV A;  1ZBP A;  3ONL A;  3QOU A;  3HXC A;  4YND A;  4OAV B;  5ENS D;  3RO3 A;  1KZP A;  4G25 A;  3TWS A;  1N4R A;  1OCZ E;  4G23 A;  3MGB A;  4ACK A;  4JZY A;  3FWV A;  2RD0 A;  4N39 A;  4JHK A;  2J07 A;  2OVF A;  1TJC A;  2FI7 A;  1N0Q A;  4XEI G;  3DPY A;  3AS4 A;  3RO2 A;  4U07 A;  3UIN C;  2GGF A;  3MZL B;  5EX3 A;  3MCX A;  3CHP A;  4RQI A;  4B94 A;  5BPP A;  5CHE E;  1XGW A;  3L9T A;  3ABM E;  3RRU A;  5JHB A;  3EIQ C;  1BPO A;  1E7U A;  1TNB A;  1K8K G;  3T9K A;  2WQ7 A;  2OEV A; 
#chains in the Genus database with same CATH homology
 4CZ2 D;  5CED B;  1N0R A;  4HLL A;  4K5C A;  3ZUV B;  4HQD A;  4N5Q A;  5CBO A;  4ZFH A;  2ZGG A;  3AAA C;  2AJA A;  3V30 A;  4F6R D;  4GPM A;  5CER B;  5AAO A;  5FIN A;  5CBN A;  1A5E A;  2F8Y A;  3LJN A;  5KNG A;  4U95 D;  4DX5 D;  1SW6 A;  5EYP F;  4YDY A;  1QYM A;  2BKK B;  3J5P A;  4BES A;  2NYJ A;  3IXE A;  5KBA A;  2RFA A;  4UUC A;  3C5R A;  4LG6 A;  3B95 A;  1NFI E;  3KEA A;  5HRY A;  3TWV A;  4HI8 A;  5D66 A;  3W9G A;  2ETB A;  5ENP D;  4DX2 A;  4CYM D;  3TWQ A;  1YMP A;  3Q9N C;  3DEO A;  3TWW A;  5ITZ F;  1BD8 A;  3UTM A;  5KNH D;  4DRX E;  1IHB A;  3ZU7 B;  2B0O E;  2F37 A;  1BU9 A;  2XEN A;  3D9H A;  3ZNG A;  3SO8 A;  3B7B A;  3TWU A;  4RLY A;  4HRM B;  1N11 A;  3Q9U C;  4LNU D;  2FO1 E;  1D9S A;  5EN5 D;  5BXU A;  5JA4 D;  4J7W A;  2A5E A;  3TWR A;  2XEE A;  3UI2 A;  3TWX A;  2XEH A;  1K3Z D;  2HE0 A;  2KBX A;  4OAU C;  1AP7 A;  2MYO A;  1OY3 D;  5ENT D;  3EHQ A;  4ATZ D;  4OAV B;  4U96 D;  4Z68 A;  1BI7 B;  4QQI A;  5ENS D;  4F1P A;  4J8Y A;  5HKP A;  2V5Q C;  3T8K A;  4BER A;  4JB8 P;  1S70 B;  2DWZ A;  5EIB E;  5EID A;  3TWS A;  3HRA A;  3V2O A;  2J8S D;  2KXP C;  1YYH A;  2QYJ A;  3NOC D;  1DCQ A;  4GMR A;  4DX1 A;  2F8X K;  1AWC B;  1UOH A;  3NOG D;  5AQA A;  4DUI A;  1TR4 A;  3V31 A;  2ZGD A;  4HBD A;  4HI9 A;  4O1O A;  4DX7 D;  5BXO A;  3AJI A;  1IKN D;  1DC2 A;  1IXV A;  1OT8 A;  2DZO A;  3EHR A;  4B93 B;  4O60 A;  1WDY A;  4HB5 A;  1G3N B;  4BSZ B;  5CEA A;  1SVX A;  4YDW A;  5AQB A;  1N0Q A;  5EIL A;  2ETA A;  1YCS B;  2DVW A;  4LSZ E;  5AN8 A;  2Y1L E;  4HRN A;  4U8V D;  2P2C P;  2VGE A;  2RFM A;  3JXJ A;  5JMN D;  5HS0 A;  1K1A A;  2V4H C;  2L6B A;  4O1P A;  4BET A;  4NIK A;  3EU9 A;  5AQ9 A;  5ENQ D;  4TUM A;  1MYO A;  5KWD A;  2XZT G;  2QC9 A;  4C48 B;  4G8K A;  2XZD G;  3DEP A;  5AQ7 A;  4A63 B;  5ENO D;  1MJ0 A;  3NBN B;  2PNN A;  2Y0B G;  4K5B A;  1BLX B;  3V2X A;  3UXG A;  4HRL A;  1MX2 A;  2ETC A;  4K5A B;  3JXI A;  3V79 K;  4G8L A;  3F6Q A;  1WG0 A;  5EYL A;  4ZHB A;  2BKG A;  4HNA D;  5ENR D;  1BI8 B;  3JUE A;  5CEC B;  1K1B A;  5AAR A;  3W9F A;  3J5Q B;  1MX4 A;  2JAB A;  4BEP A;  3ZKJ A;  1MX6 A;  2DZN A;  4QFV A;  3T9K A;  5FIO A;  4DX6 D;  3HG0 D;  3TWT A;  4U8Y D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...