2ZGGA

Asn-hydroxylation stabilises the ankyrin repeat domain fold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVAAKDKNGSTPLHLAARNGHLEVVKLLLEAGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3 repeat synthetic ankyrin
publication title Asparagine beta-hydroxylation stabilizes the ankyrin repeat domain fold
pubmed doi rcsb
molecule tags De novo protein
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2zggA00
1MYOA 5AAOA 5FIOA 4ZFHA 3TWTA 5EIDA 4HNAD 1IHBA 1MJ0A 4Z68A 4QFVA 3F6QA 4YDWA 3TWVA 2Y0BG 4DX2A 5CBNA 3NBNB 4HI8A 1K1AA 2HE0A 2NYJA 3EU9A 4B93B 3NOGD 4CZ2D 2DWZA 2PNNA 1MX4A 4GPMA 3T8KA 4BERA 5CECB 4O1PA 1BI8B 3T9KA 1K1BA 3TWSA 2AJAA 4HLLA 4U8VD 2DZOA 4DRXE 5ENSD 1YYHA 1BD8A 4BESA 2MYOA 5EYLA 4K5AB 4OAVB 3B95A 2BKKB 3C5RA 1MX2A 4TUMA 2KXPC 3EHRA 4HRNA 2Y1LE 1N11A 3UXGA 2V4HC 4UUCA 5CBOA 3V2OA 4F6RD 5EYPF 3DEPA 5KWDA 3KEAA 5HRYA 4G8KA 4G8LA 2ZGGA 2RFMA 3V2XA 2F8YA 1WDYA 3V30A 5CEAA 3IXEA 2L6BA 4O1OA 3V31A 5JMND 2VGEA 4F1PA 1QYMA 5HKPA 5D66A 5ENRD 1BU9A 3JXIA 3NOCD 2DVWA 3W9FA 2ETCA 3SO8A 3B7BA 3V79K 4NIKA 3TWXA 1YMPA 4C48B 4HB5A 2XEHA 3JUEA 1MX6A 2QYJA 2F37A 4HI9A 4U8YD 5KNHD 4ZHBA 1NFIE 5ENQD 5BXOA 4J7WA 3HRAA 1OY3D 2XEEA 1N0RA 2BKGA 5ITZF 2A5EA 2FO1E 1D9SA 1IKND 3TWQA 2RFAA 3ZUVB 3JXJA 3DEOA 5ENPD 2ETAA 2J8SD 1BLXB 3W9GA 5AARA 1IXVA 2ETBA 3AAAC 3LJNA 4LSZE 1SW6A 4LG6A 4U95D 4YDYA 5AQBA 4BETA 4DUIA 2V5QC 2XZTG 2QC9A 3EHQA 2ZGDA 4HRLA 5AQAA 3AJIA 3TWUA 3UI2A 5CERB 5HS0A 4JB8P 1OT8A 4K5CA 3TWWA 5EIBE 1K3ZD 5KBAA 5AQ9A 5EILA 4RLYA 1SVXA 2JABA 2XZDG 2F8XK 2B0OE 3Q9UC 3UTMA 1BI7B 4GMRA 4LNUD 5AN8A 4J8YA 4DX5D 1S70B 3D9HA 4K5BA 4ATZD 4DX1A 4A63B 4HQDA 4CYMD 5AQ7A 4BEPA 3ZU7B 1AP7A 2KBXA 1WG0A 4DX7D 1A5EA 4N5QA 5ENTD 2P2CP 5KNGA 5EN5D 3J5PA 1AWCB 1DCQA 3ZKJA 1TR4A 1DC2A 1N0QA 5JA4D 4U96D 2XENA 3Q9NC 1G3NB 5CEDB 4QQIA 5BXUA 5ENOD 4O60A 2DZNA 3TWRA 1YCSB 3J5QB 4DX6D 1UOHA 4OAUC 3HG0D 3ZNGA 4HRMB 5FINA 4HBDA 4BSZB
chains in the Genus database with same CATH superfamily
2HYZA 2YHCA 3PREA 2L0TB 3L22A 1TNUA 2WQHA 2P9NG 3T8KA 4GMJA 4HLLA 4L2LA 4DRXE 4UWLA 2XHEA 2MRIA 3VLEA 2WQ6A 3Q49B 2F0YA 4OYSA 1OUVA 2VTBB 4JC8A 2J08A 4RG6A 2C0LA 5KWDA 5B1AE 5AIJA 3HXCA 2XCCA 3DSUA 4URKA 4ATGA 3LS8A 2DVWA 4G24A 3B7BA 3ZYQA 4HFGA 5AYWD 4HB5A 3C3OA 1S64A 1OCZE 4OVUA 3URZA 1D9SA 1IKND 3RJVA 4GZCA 4N3AA 3LYAA 4EBAG 3IHVA 5AQAA 3AJIA 3D9IA 1K3ZD 2P9PG 2OVBA 4PDXA 4JVSA 4WWNA 2GRNB 1EF1C 4CYMD 2ZIRA 4DK5A 4UWKA 2XS8A 3Q7AA 3UIOC 2GRMA 1DCQA 2P58C 4W9RA 5FQ4A 3BG1B 4AY6A 2J4DA 4ANVA 3QOUA 5ENNA 1YCSB 4DX6D 3ZYKA 3QAQA 2P9IG 1SA5A 3LEWA 4P29A 5FIOA 3TWTA 4U0ZA 3B7UX 3LY9A 3R9MA 3D9JA 4KZCA 4TXQA 3GW4A 3ZIMA 3OAWA 4G11A 4IYPA 3WG7E 1LD8A 4AVXA 3ZXSA 3DRAA 4AY5A 2EIJE 2OCCE 2ZXWE 4L2YA 3B7TA 4HRNA 2Y4UA 1XGWA 5KJKA 1KT0A 2P9SG 3V2OA 3R9AB 1E8XA 3ASHA 5D66A 4UI9C 1TYQG 1BU9A 3ZN3A 4FJZA 3W9FA 2UWJG 4NIKA 2WXHA 4EECA 1E96B 3L08A 1QBQA 5FZRA 4XI0A 3HYMB 3QWPA 2ETBA 3SBTB 3DSSA 2OOEA 4CEMA 4K03A 4GTOA 4EHMA 1A17A 3MKRA 3UUXA 4BX9A 1Q2ZA 2LSVA 2VJ8A 5AQ7A 3ULYA 4U0SA 1N9AA 3UINC 4TRQA 2WXRA 2DZNA 4UI9K 1Y8MA 3TG5A 4GTVA 2R05A 3BU8A 4APFA 3PE4A 4GMLA 4CZ2D 1QQEA 4RG9A 4O1PA 3T9KA 1K1BA 5ENSD 2WXGA 3GZ2A 3FULA 2KZTA 4GZ6A 3AS8A 3OXLA 3P1UA 5LX8A 3V2XA 5KJMA 3HXBA 4LERA 4GA2A 2JLBA 1ELWA 1EDUA 3BQOA 1H6KA 1YMPA 2P9UG 3Q75A 3ABKE 3G2VA 3CVUA 4GB9A 4XX5A 3JXJA 2ETAA 2KC7A 3QKYA 3UX4A 4LSZE 4WNEA 3I3NA 4HOQA 2I1JA 4CGWA 5BUZA 2WQ7A 1SZAA 2CHXA 3G2SA 4KVOA 1TJCA 3G2TA 4B89A 2XZDG 4XEIG 2L9BA 2F8XK 3CK7A 3ULQA 2KCVA 2X6FA 4ANXA 5JJ6A 3ENEA 4JHRA 4I1AA 3ZKJA 4U96D 3S2AA 4LUNU 3APDA 2OVFA 1UN9A 1UW4B 4AP2A 4U8HA 5FINA 5D2MC 4FA6A 5AAOA 4BT8A 4ZFHA 5LCWC 3ASFA 3FP3A 3PRZA 2NC9A 3EU9A 2WMNA 5D0QD 4YNDA 3ZEFA 2AJAA 5AJLA 2PQNA 5B1BE 5ARFA 2PQRA 4NRHB 3L6AA 3D9MA 1TJFA 4Y6WA 2V4LA 4GTPA 3CV0A 5CBOA 4I17A 4GTRA 1HF8A 3TJPA 1TNOA 3RKVA 4O1OA 2VGEA 1OWNA 4LNBA 5ENRD 3CLJA 3ULEG 1HXIA 2OEWA 2CHWA 3OXFA 4U8YD 5FZSA 3LJ3A 3Q4AB 4GZDA 4BETA 2V5QC 3LDZA 4DLOA 4HRLA 2LXMA 1K8KG 2WXJA 3UIPC 3U66A 3AU5A 3NB2A 4AEZC 4FULA 2B0OE 2AXUA 3Q9UC 3SF4A 2WXLA 3DXKG 2IFUA 2WXKA 4I43A 3CK9A 5DBKA 2P9LG 4EBAA 1TR4A 5BV1A 4CT0A 3VTXA 1S0PA 1UOHA 4OAUC 4GZ3A 4MS6A 4BSZB 5CCMA 3FY4A 1MJ0A 4FC8A 4DI4A 3QK0A 1E90A 3ASNE 5JHBA 3EUVA 3RO3A 2QFCA 3FU5A 3UM1A 1N4RA 3EHNA 3UQ3A 3AG3E 3RAUA 1H6PA 3B95A 4DPRA 4A55A 5CMYA 1MX2A 2J49A 2AWIA 2X38A 4UUCA 4G26A 5HKPA 3L54A 3JXIA 4UWGA 3L13A 3Q78A 1O1RA 3MV3B 4XZ4A 1IHGA 1HFAA 1NFIE 5BXOA 4HOUA 2XEEA 3HXEA 4CT4A 4C9BB 3ML8A 4YDEA 5KJNA 4JB8P 3KEZA 2GRLA 3T5XA 2X6IA 2CG2A 4BX8A 5EILA 4RLYA 5CRVA 3E30A 1TEZA 3D9HA 2XGSA 4K5BA 2BTDA 2XRYA 1HZ4A 3MEKA 3GZSA 2P2CP 2H6IA 5EX3A 3HVEA 3E4BA 2OEVA 2XENA 4L7TA 1G3NB 2C0MA 2IOSA 4FLBA 4HBDA 1LD7A 3QNKA 4Z68A 3FWVA 4JZYA 4DX2A 4K0RA 4I9CA 1WM5A 4KMOA 1U3DA 3ZHEA 4L23A 3DSWA 1KLXA 4GPKA 3FEYA 3U3WA 1N4QA 3CQGB 4OAVB 4X8QA 1Z6TA 5BNWA 4UI9J 4RSYA 2B6CA 4F6RD 5EYPF 3SFZA 2R17C 1N52A 1QNFA 4KVMA 3ESLA 2WXPA 3CHRA 2GRRB 4KXKB 3CSTA 4F7AA 2YNQA 2F37A 3GZ1A 3Q7FA 3BEEA 1MZCA 2WM9A 3W9GA 3PH0C 3TAXA 3Q15A 2WB2A 1UN8A 4J8EA 2XEVA 2R2LA 2R02A 2X6KA 4TUUA 4WNFA 3PZDA 2XCBA 4JEUA 1H19A 3U9WA 4UWFA 1E8ZA 1HX8A 3Q5MA 1BI7B 4LNUD 3SQVA 2IQCA 1UG3A 4AXHA 3D9KA 2KBXA 4CDMA 3LY8A 3PVLA 3X2QE 1IQRA 3E37A 1ELRA 4ABNA 3D9NA 4J8DA 1OCOE 2Y69E 4HRMB 4M3OA 3DSVA 3ASOE 3PE3A 3UMVA 2VSOE 4RVBA 4JA9A 3SD5A 5ANRA 2KZTB 5B3SE 3EIJA 4HI8A 2NYJA 3VLDA 3CGHA 1LF8A 4V3IA 2VGYA 5JJTA 2QYUA 3FTYA 1BD8A 3CQCB 3ZXPA 3PEUB 3TXMA 2ZISA 3IEGA 4TUMA 4KT6B 2LAIA 3QB2A 1JWFA 1HH8A 3L9TA 1N95A 4WNDA 2V5FA 2YINA 3ZYMA 3CVWA 3K9IA 2L6BA 5M72A 2I1KA 1O5MA 1H2UA 4D10C 1N94A 3V79K 3TG4A 3TWXA 5G2NA 4HI9A 4JPSA 3KS2A 3UKUG 3TWQA 3FUHA 1MQSA 4U95D 5AQBA 1H6OA 5JHAA 3LVQE 3UI2A 5KJLA 3ISMC 1TN8A 1OWPA 4XI9A 3MCXA 2NXPA 3CVVA 2IU1A 1FVFA 3MA5A 3CEQA 4L9PA 2MHKA 2XPZA 4WWPA 1BPOA 5LCWJ 3DPDA 3DSXA 3CSFA 4U63A 3RU0A 3JCKC 3JQ0A 3HG0D 2LO6A 3EU5A 4HOTA 3B13A 4NURA 2V8SE 4FHKA 4GTQA 4HVBA 3CVYA 2PNNA 3CIAA 2J09A 4F53A 1ZB1A 3MYVA 5G05C 3KD7A 2H6HA 1YYHA 3UM3A 1UJKA 4I1MA 4BTAA 4JHJA 2GRQB 4B0ZA 4N2QA 3GYZA 1N11A 5KCMA 2FF4A 2AXVA 5HRYA 4MRUA 1JCSA 1WDYA 5CRUA 2IJGX 3WXXA 1FPPA 1B89A 2PM7A 3NQPA 3R7RA 3NOCD 2Y3AA 4XIFA 2XEHA 4ZHBA 4ILIA 3PS6A 3MKQA 1E7UA 2EILE 3HHMA 3ML9A 2WPVA 2RFAA 5D0OD 1Z5SC 4J8SA 3RSEG 3LJNA 2R5SA 3U4TA 4J8FA 2XGMA 3D3MA 4GA0A 3T5VA 2QZAA 4C0EA 5EIBE 2AW6A 3LY7A 4ATZD 2LNIA 5FTPA 4GYWA 3ZU7B 4FJYA 3CVNA 4DJAA 1DVPA 5DIZA 4UQYA 1KZPA 1Z3XA 2M63A 2VYIA 1SA4A 1ZBPA 5LOZA 4BWRA 2KCKA 2DYRE 3FUJA 1E8WA 2L0IA 1DNPA 4E85A 1O1TA 5G04C 3ZVVA 5BV0A 2HE0A 4GCNA 4BERA 3KSQA 3SFXA 2I6HA 4ACKA 2YHEA 4KBQA 3EHRA 3FUNA 2Y1LE 2X3MA 4WNGA 4G8KA 3SHFA 3IKOB 2ONDA 4UQZA 3FEXA 2OV8A 3CHPA 3QDNA 4I2ZA 2IF4A 1RW2A 1IQUA 3E33A 3PEVB 3ZFWA 3FFLA 5ENQD 4BY6A 5ITZF 4N5CA 4Y6CA 1W3BA 4GTTA 4J6IA 1JWGA 3QC1A 4YDYA 2XZTG 2QC9A 3AG1E 2ZGDA 3EHQA 5CERB 2WXQA 5EKQD 1XNFA 3HVEB 3TWWA 4B94A 4GYYA 1FT2A 3JYSA 4GU5A 3UTMA 1FT1A 4AJWA 4HQDA 1EPUA 3OTNA 2XPYA 4BTBA 2LAHA 5JJ7A 1D8DA 3FH5A 3FTSA 1JUQA 3S7FA 3MGBA 4N2SA 3ZHEB 3ZNGA 4TXRA 2CFZA 3E34A 4HNAD 1YA0A 1TN7A 4QFVA 4BFRA 3S7BA 1L5JA 1HG2A 2LSUA 2VGXA 1IYGA 4WUYA 2DWZA 4GPMA 4GZ5A 3TWSA 4U8VD 2WXMA 4DLQA 2LUHA 5T3RA 3G2WA 4AV7A 4K5AB 2GGFA 3CHOA 5FZQA 2XPIA 3UXGA 1WY6A 3Q79A 5E76A 2NSZA 4TV3A 1TNBA 4G8LA 3RRMB 2F8YA 5CEAA 5JMND 1HU3A 2KCLA 4UQXA 5ANLA 4A1GA 3ZYLA 3FU0A 4GYOA 3TGOA 1X5BA 2WXNA 1OY3D 3FUKA 3CVLA 2A5EA 2JEKA 2V0PA 4I1OB 5BPPA 3APCA 3DEOA 2J8SD 5FQ8A 4N3CA 5CCLA 4PUCA 4MBGA 1SW6A 4ANWA 3L16A 4EPZA 4ILHB 4HXIA 1OCRE 3FTVA 3VLFA 4PS7A 5IY5E 4JXTA 4A63B 1TN6A 4HS2A 3B7RL 5ENTD 1H2TC 1N0QA 3C3QA 4QQIA 3BG0B 4TXPA 4I6JA 5EIDA 5HI7A 4GCOA 1FVHA 1N4SA 4ANUA 4YDWA 4GA1A 4JD2G 4F3VA 3NBNB 4B93B 2CFUA 2J4BA 2I2OA 3SI5A 2DZOA 1PAQA 2IONA 1EYHA 4NACA 4WAFA 3VTYA 5EX0A 2R03A 4FP7A 2V4HC 1RZ4A 2ZGGA 4XE0A 3I5PA 4DI3A 4Q94A 2P9KG 1H0AA 1X81A 1S63A 1P5QA 4FU3A 3JUEA 5KNHD 3I4GA 3LKUA 3HRAA 1N0RA 2BKGA 4LRZA 2GRPB 3PZ4A 4NQ0A 3ZUVB 4BSXA 2CHZA 3N71A 4IN3B 3ZGQA 5AARA 3FU3A 4CRWA 3DSTA 5H7PA 1DCEA 4YVQC 3FTZA 3Q73A 5LFAA 3DPYA 3O48A 2JABA 3AS5A 4CCAA 4IRUA 4PS3A 3CHSA 3FUMA 3ASDA 3PZ1A 4I2WA 5J08A 2Y4TA 1Y6IA 4O6FA 3T8MA 2FULA 5JA4D 2RKKA 5AJDA 3NAWA 3QJZA 3CR3A 4PS8A 3ABLE 3FUEA 3SZ7A 5G05J 3D9LA 1IHBA 3F6QA 2L6JA 3UPVA 3I4RB 3FH8A 4JW1A 5FQ6A 3BUAA 4F1SA 3FTWA 2LXLA 1OWMA 3NZSA 5EYLA 3C3RA 3SY2A 2RD0A 3C5RA 3AG4E 2WXIA 1TNZA 2XGOA 1OWLA 3FUIA 3MX3A 3IV0A 3MKQB 3UM2A 5A7DB 1NP7A 3DBSA 3AU4A 3FTUA 1O1SA 2RG8A 3CK8A 1N54A 1OCCE 5G55A 1HE8A 2FO1E 3ABME 4HLEA 5ENPD 1V55E 1MHQA 4U7EB 4LG6A 4ACLA 2PM6A 2WXOA 3MV2B 4A3TA 3TL5A 3HIZA 4AIFA 5HS0A 1OT8A 1H2VC 5BW8C 4G23A 3EIQC 5AN8A 4J8YA 2HR2A 1A5EA 3MJWA 3J5PA 2R59A 4JL0A 1DC2A 2DYSE 4CGVA 5G04J 5E75A 3J5QB 1KZOA 2H6FA 3RK6A 5BT1A 1TNYA 2Y0BG 1K1AA 2BEDA 2FO7A 2IO2C 2UY1A 4BT9A 2C2LA 4APOA 3AS4A 4YVOA 1HS6A 3L17A 3UT4A 3QARA 3FHEA 3DEPA 2CG3A 3IBEA 4FHJA 3V30A 3IXEA 3NZUA 4C48B 2H6GA 1MX6A 2VTBA 4J7WA 4GAAA 2EIKE 4KZ0A 2DIWA 3FU6A 3L82A 4L1BA 4GTSA 4PH4B 3UKRG 4YDOA 4FADA 3EHMA 3UT8A 3RO2A 2MOWA 2X6JA 4DX5D 4BEPA 1AP7A 3FDHA 4EZKA 4I6GA 1PY1A 4XKBA 4FLHA 2VGXB 3B7SA 4XKCA 3HDXA 1LTXA 4M7CA 1MYOA 1U3CA 2FI7A 3U64A 5CMWA 1NZNA 4KYOB 4MKTA 3JUIA 2PZIA 3NOGD 5FQ7A 1QZ2A 1HG5A 4N3BA 5CECB 4I9EA 4JEHA 2HM8A 2PL2A 2VSNA 3PNLB 3CHQA 1NA0A 2VQ2A 4C0MA 2BUGA 3JQ1A 3KSLA 4IULA 4U07A 1NL4A 3OXGA 2KXPC 5J90A 3S7JA 1SZ9A 1INZA 4GTMA 3KEAA 4ILGA 1D8EA 3HXDA 1KT1A 2RFMA 5A6CA 5FWQA 4R7LA 3ZW3A 3QWWA 1ELKA 3SO8A 5HQ8A 1OWOA 2QYJA 2X6HA 2ZU6B 4AM9A 5FJYA 3SBSA 1OXJA 2WMOA 4G1TA 3NF1A 5C1DA 3AAAC 4EQFA 3ZRHA 3G2UA 1V54E 3E32A 4GMRA 2IOLA 2GW1A 4MLPA 3CVPA 5FT9A 4DX7D 2WXFA 3ASGA 1UJJA 3Q9NC 2GROB 5BXUA 3SNXA 3LVRE 3C72A 3C98A 2BF0X 2VSXE 3TWVA 1Z3YA 5CBNA 3FUDA 5A23A 4H7YA 1MX4A 2A5UA 4LEUA 4BESA 3DWLG 1PC2A 3MZLB 4AOFA 5LP0A 3ESKA 1E8YA 2AVPA 1NA3A 3PUKA 4U0UA 3UT7A 3V31A 3CHMA 3O4ZA 3RIBA 1JPLA 1WAO1 3HXFA 2ETCA 2IO3C 3TXNA 3CKCA 5CHEE 3PNTB 4G25A 2E0IA 1SQMA 4EZJA 2KATA 3LXUX 1E7VA 1BLXB 2WVIA 2IEJA 3FUFA 3IHYA 4LCTA 1IXVA 4I6EA 2EIME 3TWUA 3PZ2A 3P2BA 4E6HA 3RRUA 1JCQA 4B8CB 4Q96A 5KBAA 4JA7A 5AQ9A 2FBNA 1SVXA 2Q7FA 4JHKA 4B8AA 2A4ZA 3PDNA 2XQ0A 1WG0A 2AXZA 3ONLA 5EDSA 5KNGA 5EN5D 4N39A 2DBAA 2KM4A 3CVQA 3S7DA 5CEDB 4CDNA 4OVVA 5ENOD 4O60A 3TWRA 4UWHA 3FH7A 2YQ8A 3CKBA 1KPSB 3APFA 3ZPJA 4LNGA 2EQXA 4HOSA 4G2VA 1BI8B 4HORA 1GW6A 2FEZA 3PZ3A 4J0UA 5T8IA 2MYOA 4U04A 2BKKB 3EDTB 3D9PA 3LPZA 2HO1A 2DCPA 2XRZA 4F1PA 2EINE 1QYMA 5ARGA 2J07A 3Q47B 1U2VG 3QWVA 3EJNA 2VSYA 4A3VA 4ME2A 1VDYA 3SGHA 3FTXA 4EZLA 1ZU2A 2I9CA 5T4YA 4Q69A 4DUIA 1NI1A 1N4PA 5AENA 2XS1A 4K5CA 4A1SA 3SFYA 1FCHA 3RRNB 5C2YA 4CDRA 3LCAA 1S70B 3R7QA 1JCRA 4DX1A 2QY7A 2J9QA 3PUJA 4WWOA 3D9OA 4N5QA 3UM0A 2IY0C 1AWCB 3KAEA 3ONKA 2ILRA 4H7XA 2UY1B 3CVXA 1HO8A 3DXMG 4RQIA 2E2EA 3AG2E
chains in the Genus database with same CATH topology
1MYOA 5AAOA 5FIOA 4ZFHA 3TWTA 5EIDA 4HNAD 1IHBA 1MJ0A 4Z68A 4QFVA 3F6QA 4YDWA 3TWVA 2Y0BG 4DX2A 5CBNA 3NBNB 4HI8A 1K1AA 2HE0A 2NYJA 3EU9A 4B93B 3NOGD 4CZ2D 2DWZA 2PNNA 1MX4A 4GPMA 3T8KA 4BERA 5CECB 4O1PA 1BI8B 3T9KA 1K1BA 3TWSA 2AJAA 4HLLA 4U8VD 2DZOA 4DRXE 5ENSD 1YYHA 1BD8A 4BESA 2MYOA 5EYLA 4K5AB 4OAVB 3B95A 2BKKB 3C5RA 1MX2A 4TUMA 2KXPC 3EHRA 4HRNA 2Y1LE 1N11A 3UXGA 2V4HC 4UUCA 5CBOA 3V2OA 4F6RD 5EYPF 3DEPA 5KWDA 3KEAA 5HRYA 4G8KA 4G8LA 2ZGGA 2RFMA 3V2XA 2F8YA 1WDYA 3V30A 5CEAA 3IXEA 2L6BA 4O1OA 3V31A 5JMND 2VGEA 4F1PA 1QYMA 5HKPA 5D66A 5ENRD 1BU9A 3JXIA 3NOCD 2DVWA 3W9FA 2ETCA 3SO8A 3B7BA 3V79K 4NIKA 3TWXA 1YMPA 4C48B 4HB5A 2XEHA 3JUEA 1MX6A 2QYJA 2F37A 4HI9A 4U8YD 5KNHD 4ZHBA 1NFIE 5ENQD 5BXOA 4J7WA 3HRAA 1OY3D 2XEEA 1N0RA 2BKGA 5ITZF 2A5EA 2FO1E 1D9SA 1IKND 3TWQA 2RFAA 3ZUVB 3JXJA 3DEOA 5ENPD 2ETAA 2J8SD 1BLXB 3W9GA 5AARA 1IXVA 2ETBA 3AAAC 3LJNA 4LSZE 1SW6A 4LG6A 4U95D 4YDYA 5AQBA 4BETA 4DUIA 2V5QC 2XZTG 2QC9A 3EHQA 2ZGDA 4HRLA 5AQAA 3AJIA 3TWUA 3UI2A 5CERB 5HS0A 4JB8P 1OT8A 4K5CA 3TWWA 5EIBE 1K3ZD 5KBAA 5AQ9A 5EILA 4RLYA 1SVXA 2JABA 2XZDG 2F8XK 2B0OE 3Q9UC 3UTMA 1BI7B 4GMRA 4LNUD 5AN8A 4J8YA 4DX5D 1S70B 3D9HA 4K5BA 4ATZD 4DX1A 4A63B 4HQDA 4CYMD 5AQ7A 4BEPA 3ZU7B 1AP7A 2KBXA 1WG0A 4DX7D 1A5EA 4N5QA 5ENTD 2P2CP 5KNGA 5EN5D 3J5PA 1AWCB 1DCQA 3ZKJA 1TR4A 1DC2A 1N0QA 5JA4D 4U96D 2XENA 3Q9NC 1G3NB 5CEDB 4QQIA 5BXUA 5ENOD 4O60A 2DZNA 3TWRA 1YCSB 3J5QB 4DX6D 1UOHA 4OAUC 3HG0D 3ZNGA 4HRMB 5FINA 4HBDA 4BSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYO A;  5AAO A;  5FIO A;  4ZFH A;  3TWT A;  5EID A;  4HNA D;  1IHB A;  1MJ0 A;  4Z68 A;  4QFV A;  3F6Q A;  4YDW A;  3TWV A;  2Y0B G;  4DX2 A;  5CBN A;  3NBN B;  4HI8 A;  1K1A A;  2HE0 A;  2NYJ A;  3EU9 A;  4B93 B;  3NOG D;  4CZ2 D;  2DWZ A;  2PNN A;  1MX4 A;  4GPM A;  3T8K A;  4BER A;  5CEC B;  4O1P A;  1BI8 B;  3T9K A;  1K1B A;  3TWS A;  2AJA A;  4HLL A;  4U8V D;  2DZO A;  4DRX E;  5ENS D;  1YYH A;  1BD8 A;  4BES A;  2MYO A;  5EYL A;  4K5A B;  4OAV B;  3B95 A;  2BKK B;  3C5R A;  1MX2 A;  4TUM A;  2KXP C;  3EHR A;  4HRN A;  2Y1L E;  1N11 A;  3UXG A;  2V4H C;  4UUC A;  5CBO A;  3V2O A;  4F6R D;  5EYP F;  3DEP A;  5KWD A;  3KEA A;  5HRY A;  4G8K A;  4G8L A;  2ZGG A;  2RFM A;  3V2X A;  2F8Y A;  1WDY A;  3V30 A;  5CEA A;  3IXE A;  2L6B A;  4O1O A;  3V31 A;  5JMN D;  2VGE A;  4F1P A;  1QYM A;  5HKP A;  5D66 A;  5ENR D;  1BU9 A;  3JXI A;  3NOC D;  2DVW A;  3W9F A;  2ETC A;  3SO8 A;  3B7B A;  3V79 K;  4NIK A;  3TWX A;  1YMP A;  4C48 B;  4HB5 A;  2XEH A;  3JUE A;  1MX6 A;  2QYJ A;  2F37 A;  4HI9 A;  4U8Y D;  5KNH D;  4ZHB A;  1NFI E;  5ENQ D;  5BXO A;  4J7W A;  3HRA A;  1OY3 D;  2XEE A;  1N0R A;  2BKG A;  5ITZ F;  2A5E A;  2FO1 E;  1D9S A;  1IKN D;  3TWQ A;  2RFA A;  3ZUV B;  3JXJ A;  3DEO A;  5ENP D;  2ETA A;  2J8S D;  1BLX B;  3W9G A;  5AAR A;  1IXV A;  2ETB A;  3AAA C;  3LJN A;  4LSZ E;  1SW6 A;  4LG6 A;  4U95 D;  4YDY A;  5AQB A;  4BET A;  4DUI A;  2V5Q C;  2XZT G;  2QC9 A;  3EHQ A;  2ZGD A;  4HRL A;  5AQA A;  3AJI A;  3TWU A;  3UI2 A;  5CER B;  5HS0 A;  4JB8 P;  1OT8 A;  4K5C A;  3TWW A;  5EIB E;  1K3Z D;  5KBA A;  5AQ9 A;  5EIL A;  4RLY A;  1SVX A;  2JAB A;  2XZD G;  2F8X K;  2B0O E;  3Q9U C;  3UTM A;  1BI7 B;  4GMR A;  4LNU D;  5AN8 A;  4J8Y A;  4DX5 D;  1S70 B;  3D9H A;  4K5B A;  4ATZ D;  4DX1 A;  4A63 B;  4HQD A;  4CYM D;  5AQ7 A;  4BEP A;  3ZU7 B;  1AP7 A;  2KBX A;  1WG0 A;  4DX7 D;  1A5E A;  4N5Q A;  5ENT D;  2P2C P;  5KNG A;  5EN5 D;  3J5P A;  1AWC B;  1DCQ A;  3ZKJ A;  1TR4 A;  1DC2 A;  1N0Q A;  5JA4 D;  4U96 D;  2XEN A;  3Q9N C;  1G3N B;  5CED B;  4QQI A;  5BXU A;  5ENO D;  4O60 A;  2DZN A;  3TWR A;  1YCS B;  3J5Q B;  4DX6 D;  1UOH A;  4OAU C;  3HG0 D;  3ZNG A;  4HRM B;  5FIN A;  4HBD A;  4BSZ B; 
#chains in the Genus database with same CATH topology
 2HYZ A;  2YHC A;  3PRE A;  2L0T B;  3L22 A;  1TNU A;  2WQH A;  2P9N G;  3T8K A;  4GMJ A;  4HLL A;  4L2L A;  4DRX E;  4UWL A;  2XHE A;  2MRI A;  3VLE A;  2WQ6 A;  3Q49 B;  2F0Y A;  4OYS A;  1OUV A;  2VTB B;  4JC8 A;  2J08 A;  4RG6 A;  2C0L A;  5KWD A;  5B1A E;  5AIJ A;  3HXC A;  2XCC A;  3DSU A;  4URK A;  4ATG A;  3LS8 A;  2DVW A;  4G24 A;  3B7B A;  3ZYQ A;  4HFG A;  5AYW D;  4HB5 A;  3C3O A;  1S64 A;  1OCZ E;  4OVU A;  3URZ A;  1D9S A;  1IKN D;  3RJV A;  4GZC A;  4N3A A;  3LYA A;  4EBA G;  3IHV A;  5AQA A;  3AJI A;  3D9I A;  1K3Z D;  2P9P G;  2OVB A;  4PDX A;  4JVS A;  4WWN A;  2GRN B;  1EF1 C;  4CYM D;  2ZIR A;  4DK5 A;  4UWK A;  2XS8 A;  3Q7A A;  3UIO C;  2GRM A;  1DCQ A;  2P58 C;  4W9R A;  5FQ4 A;  3BG1 B;  4AY6 A;  2J4D A;  4ANV A;  3QOU A;  5ENN A;  1YCS B;  4DX6 D;  3ZYK A;  3QAQ A;  2P9I G;  1SA5 A;  3LEW A;  4P29 A;  5FIO A;  3TWT A;  4U0Z A;  3B7U X;  3LY9 A;  3R9M A;  3D9J A;  4KZC A;  4TXQ A;  3GW4 A;  3ZIM A;  3OAW A;  4G11 A;  4IYP A;  3WG7 E;  1LD8 A;  4AVX A;  3ZXS A;  3DRA A;  4AY5 A;  2EIJ E;  2OCC E;  2ZXW E;  4L2Y A;  3B7T A;  4HRN A;  2Y4U A;  1XGW A;  5KJK A;  1KT0 A;  2P9S G;  3V2O A;  3R9A B;  1E8X A;  3ASH A;  5D66 A;  4UI9 C;  1TYQ G;  1BU9 A;  3ZN3 A;  4FJZ A;  3W9F A;  2UWJ G;  4NIK A;  2WXH A;  4EEC A;  1E96 B;  3L08 A;  1QBQ A;  5FZR A;  4XI0 A;  3HYM B;  3QWP A;  2ETB A;  3SBT B;  3DSS A;  2OOE A;  4CEM A;  4K03 A;  4GTO A;  4EHM A;  1A17 A;  3MKR A;  3UUX A;  4BX9 A;  1Q2Z A;  2LSV A;  2VJ8 A;  5AQ7 A;  3ULY A;  4U0S A;  1N9A A;  3UIN C;  4TRQ A;  2WXR A;  2DZN A;  4UI9 K;  1Y8M A;  3TG5 A;  4GTV A;  2R05 A;  3BU8 A;  4APF A;  3PE4 A;  4GML A;  4CZ2 D;  1QQE A;  4RG9 A;  4O1P A;  3T9K A;  1K1B A;  5ENS D;  2WXG A;  3GZ2 A;  3FUL A;  2KZT A;  4GZ6 A;  3AS8 A;  3OXL A;  3P1U A;  5LX8 A;  3V2X A;  5KJM A;  3HXB A;  4LER A;  4GA2 A;  2JLB A;  1ELW A;  1EDU A;  3BQO A;  1H6K A;  1YMP A;  2P9U G;  3Q75 A;  3ABK E;  3G2V A;  3CVU A;  4GB9 A;  4XX5 A;  3JXJ A;  2ETA A;  2KC7 A;  3QKY A;  3UX4 A;  4LSZ E;  4WNE A;  3I3N A;  4HOQ A;  2I1J A;  4CGW A;  5BUZ A;  2WQ7 A;  1SZA A;  2CHX A;  3G2S A;  4KVO A;  1TJC A;  3G2T A;  4B89 A;  2XZD G;  4XEI G;  2L9B A;  2F8X K;  3CK7 A;  3ULQ A;  2KCV A;  2X6F A;  4ANX A;  5JJ6 A;  3ENE A;  4JHR A;  4I1A A;  3ZKJ A;  4U96 D;  3S2A A;  4LUN U;  3APD A;  2OVF A;  1UN9 A;  1UW4 B;  4AP2 A;  4U8H A;  5FIN A;  5D2M C;  4FA6 A;  5AAO A;  4BT8 A;  4ZFH A;  5LCW C;  3ASF A;  3FP3 A;  3PRZ A;  2NC9 A;  3EU9 A;  2WMN A;  5D0Q D;  4YND A;  3ZEF A;  2AJA A;  5AJL A;  2PQN A;  5B1B E;  5ARF A;  2PQR A;  4NRH B;  3L6A A;  3D9M A;  1TJF A;  4Y6W A;  2V4L A;  4GTP A;  3CV0 A;  5CBO A;  4I17 A;  4GTR A;  1HF8 A;  3TJP A;  1TNO A;  3RKV A;  4O1O A;  2VGE A;  1OWN A;  4LNB A;  5ENR D;  3CLJ A;  3ULE G;  1HXI A;  2OEW A;  2CHW A;  3OXF A;  4U8Y D;  5FZS A;  3LJ3 A;  3Q4A B;  4GZD A;  4BET A;  2V5Q C;  3LDZ A;  4DLO A;  4HRL A;  2LXM A;  1K8K G;  2WXJ A;  3UIP C;  3U66 A;  3AU5 A;  3NB2 A;  4AEZ C;  4FUL A;  2B0O E;  2AXU A;  3Q9U C;  3SF4 A;  2WXL A;  3DXK G;  2IFU A;  2WXK A;  4I43 A;  3CK9 A;  5DBK A;  2P9L G;  4EBA A;  1TR4 A;  5BV1 A;  4CT0 A;  3VTX A;  1S0P A;  1UOH A;  4OAU C;  4GZ3 A;  4MS6 A;  4BSZ B;  5CCM A;  3FY4 A;  1MJ0 A;  4FC8 A;  4DI4 A;  3QK0 A;  1E90 A;  3ASN E;  5JHB A;  3EUV A;  3RO3 A;  2QFC A;  3FU5 A;  3UM1 A;  1N4R A;  3EHN A;  3UQ3 A;  3AG3 E;  3RAU A;  1H6P A;  3B95 A;  4DPR A;  4A55 A;  5CMY A;  1MX2 A;  2J49 A;  2AWI A;  2X38 A;  4UUC A;  4G26 A;  5HKP A;  3L54 A;  3JXI A;  4UWG A;  3L13 A;  3Q78 A;  1O1R A;  3MV3 B;  4XZ4 A;  1IHG A;  1HFA A;  1NFI E;  5BXO A;  4HOU A;  2XEE A;  3HXE A;  4CT4 A;  4C9B B;  3ML8 A;  4YDE A;  5KJN A;  4JB8 P;  3KEZ A;  2GRL A;  3T5X A;  2X6I A;  2CG2 A;  4BX8 A;  5EIL A;  4RLY A;  5CRV A;  3E30 A;  1TEZ A;  3D9H A;  2XGS A;  4K5B A;  2BTD A;  2XRY A;  1HZ4 A;  3MEK A;  3GZS A;  2P2C P;  2H6I A;  5EX3 A;  3HVE A;  3E4B A;  2OEV A;  2XEN A;  4L7T A;  1G3N B;  2C0M A;  2IOS A;  4FLB A;  4HBD A;  1LD7 A;  3QNK A;  4Z68 A;  3FWV A;  4JZY A;  4DX2 A;  4K0R A;  4I9C A;  1WM5 A;  4KMO A;  1U3D A;  3ZHE A;  4L23 A;  3DSW A;  1KLX A;  4GPK A;  3FEY A;  3U3W A;  1N4Q A;  3CQG B;  4OAV B;  4X8Q A;  1Z6T A;  5BNW A;  4UI9 J;  4RSY A;  2B6C A;  4F6R D;  5EYP F;  3SFZ A;  2R17 C;  1N52 A;  1QNF A;  4KVM A;  3ESL A;  2WXP A;  3CHR A;  2GRR B;  4KXK B;  3CST A;  4F7A A;  2YNQ A;  2F37 A;  3GZ1 A;  3Q7F A;  3BEE A;  1MZC A;  2WM9 A;  3W9G A;  3PH0 C;  3TAX A;  3Q15 A;  2WB2 A;  1UN8 A;  4J8E A;  2XEV A;  2R2L A;  2R02 A;  2X6K A;  4TUU A;  4WNF A;  3PZD A;  2XCB A;  4JEU A;  1H19 A;  3U9W A;  4UWF A;  1E8Z A;  1HX8 A;  3Q5M A;  1BI7 B;  4LNU D;  3SQV A;  2IQC A;  1UG3 A;  4AXH A;  3D9K A;  2KBX A;  4CDM A;  3LY8 A;  3PVL A;  3X2Q E;  1IQR A;  3E37 A;  1ELR A;  4ABN A;  3D9N A;  4J8D A;  1OCO E;  2Y69 E;  4HRM B;  4M3O A;  3DSV A;  3ASO E;  3PE3 A;  3UMV A;  2VSO E;  4RVB A;  4JA9 A;  3SD5 A;  5ANR A;  2KZT B;  5B3S E;  3EIJ A;  4HI8 A;  2NYJ A;  3VLD A;  3CGH A;  1LF8 A;  4V3I A;  2VGY A;  5JJT A;  2QYU A;  3FTY A;  1BD8 A;  3CQC B;  3ZXP A;  3PEU B;  3TXM A;  2ZIS A;  3IEG A;  4TUM A;  4KT6 B;  2LAI A;  3QB2 A;  1JWF A;  1HH8 A;  3L9T A;  1N95 A;  4WND A;  2V5F A;  2YIN A;  3ZYM A;  3CVW A;  3K9I A;  2L6B A;  5M72 A;  2I1K A;  1O5M A;  1H2U A;  4D10 C;  1N94 A;  3V79 K;  3TG4 A;  3TWX A;  5G2N A;  4HI9 A;  4JPS A;  3KS2 A;  3UKU G;  3TWQ A;  3FUH A;  1MQS A;  4U95 D;  5AQB A;  1H6O A;  5JHA A;  3LVQ E;  3UI2 A;  5KJL A;  3ISM C;  1TN8 A;  1OWP A;  4XI9 A;  3MCX A;  2NXP A;  3CVV A;  2IU1 A;  1FVF A;  3MA5 A;  3CEQ A;  4L9P A;  2MHK A;  2XPZ A;  4WWP A;  1BPO A;  5LCW J;  3DPD A;  3DSX A;  3CSF A;  4U63 A;  3RU0 A;  3JCK C;  3JQ0 A;  3HG0 D;  2LO6 A;  3EU5 A;  4HOT A;  3B13 A;  4NUR A;  2V8S E;  4FHK A;  4GTQ A;  4HVB A;  3CVY A;  2PNN A;  3CIA A;  2J09 A;  4F53 A;  1ZB1 A;  3MYV A;  5G05 C;  3KD7 A;  2H6H A;  1YYH A;  3UM3 A;  1UJK A;  4I1M A;  4BTA A;  4JHJ A;  2GRQ B;  4B0Z A;  4N2Q A;  3GYZ A;  1N11 A;  5KCM A;  2FF4 A;  2AXV A;  5HRY A;  4MRU A;  1JCS A;  1WDY A;  5CRU A;  2IJG X;  3WXX A;  1FPP A;  1B89 A;  2PM7 A;  3NQP A;  3R7R A;  3NOC D;  2Y3A A;  4XIF A;  2XEH A;  4ZHB A;  4ILI A;  3PS6 A;  3MKQ A;  1E7U A;  2EIL E;  3HHM A;  3ML9 A;  2WPV A;  2RFA A;  5D0O D;  1Z5S C;  4J8S A;  3RSE G;  3LJN A;  2R5S A;  3U4T A;  4J8F A;  2XGM A;  3D3M A;  4GA0 A;  3T5V A;  2QZA A;  4C0E A;  5EIB E;  2AW6 A;  3LY7 A;  4ATZ D;  2LNI A;  5FTP A;  4GYW A;  3ZU7 B;  4FJY A;  3CVN A;  4DJA A;  1DVP A;  5DIZ A;  4UQY A;  1KZP A;  1Z3X A;  2M63 A;  2VYI A;  1SA4 A;  1ZBP A;  5LOZ A;  4BWR A;  2KCK A;  2DYR E;  3FUJ A;  1E8W A;  2L0I A;  1DNP A;  4E85 A;  1O1T A;  5G04 C;  3ZVV A;  5BV0 A;  2HE0 A;  4GCN A;  4BER A;  3KSQ A;  3SFX A;  2I6H A;  4ACK A;  2YHE A;  4KBQ A;  3EHR A;  3FUN A;  2Y1L E;  2X3M A;  4WNG A;  4G8K A;  3SHF A;  3IKO B;  2OND A;  4UQZ A;  3FEX A;  2OV8 A;  3CHP A;  3QDN A;  4I2Z A;  2IF4 A;  1RW2 A;  1IQU A;  3E33 A;  3PEV B;  3ZFW A;  3FFL A;  5ENQ D;  4BY6 A;  5ITZ F;  4N5C A;  4Y6C A;  1W3B A;  4GTT A;  4J6I A;  1JWG A;  3QC1 A;  4YDY A;  2XZT G;  2QC9 A;  3AG1 E;  2ZGD A;  3EHQ A;  5CER B;  2WXQ A;  5EKQ D;  1XNF A;  3HVE B;  3TWW A;  4B94 A;  4GYY A;  1FT2 A;  3JYS A;  4GU5 A;  3UTM A;  1FT1 A;  4AJW A;  4HQD A;  1EPU A;  3OTN A;  2XPY A;  4BTB A;  2LAH A;  5JJ7 A;  1D8D A;  3FH5 A;  3FTS A;  1JUQ A;  3S7F A;  3MGB A;  4N2S A;  3ZHE B;  3ZNG A;  4TXR A;  2CFZ A;  3E34 A;  4HNA D;  1YA0 A;  1TN7 A;  4QFV A;  4BFR A;  3S7B A;  1L5J A;  1HG2 A;  2LSU A;  2VGX A;  1IYG A;  4WUY A;  2DWZ A;  4GPM A;  4GZ5 A;  3TWS A;  4U8V D;  2WXM A;  4DLQ A;  2LUH A;  5T3R A;  3G2W A;  4AV7 A;  4K5A B;  2GGF A;  3CHO A;  5FZQ A;  2XPI A;  3UXG A;  1WY6 A;  3Q79 A;  5E76 A;  2NSZ A;  4TV3 A;  1TNB A;  4G8L A;  3RRM B;  2F8Y A;  5CEA A;  5JMN D;  1HU3 A;  2KCL A;  4UQX A;  5ANL A;  4A1G A;  3ZYL A;  3FU0 A;  4GYO A;  3TGO A;  1X5B A;  2WXN A;  1OY3 D;  3FUK A;  3CVL A;  2A5E A;  2JEK A;  2V0P A;  4I1O B;  5BPP A;  3APC A;  3DEO A;  2J8S D;  5FQ8 A;  4N3C A;  5CCL A;  4PUC A;  4MBG A;  1SW6 A;  4ANW A;  3L16 A;  4EPZ A;  4ILH B;  4HXI A;  1OCR E;  3FTV A;  3VLF A;  4PS7 A;  5IY5 E;  4JXT A;  4A63 B;  1TN6 A;  4HS2 A;  3B7R L;  5ENT D;  1H2T C;  1N0Q A;  3C3Q A;  4QQI A;  3BG0 B;  4TXP A;  4I6J A;  5EID A;  5HI7 A;  4GCO A;  1FVH A;  1N4S A;  4ANU A;  4YDW A;  4GA1 A;  4JD2 G;  4F3V A;  3NBN B;  4B93 B;  2CFU A;  2J4B A;  2I2O A;  3SI5 A;  2DZO A;  1PAQ A;  2ION A;  1EYH A;  4NAC A;  4WAF A;  3VTY A;  5EX0 A;  2R03 A;  4FP7 A;  2V4H C;  1RZ4 A;  2ZGG A;  4XE0 A;  3I5P A;  4DI3 A;  4Q94 A;  2P9K G;  1H0A A;  1X81 A;  1S63 A;  1P5Q A;  4FU3 A;  3JUE A;  5KNH D;  3I4G A;  3LKU A;  3HRA A;  1N0R A;  2BKG A;  4LRZ A;  2GRP B;  3PZ4 A;  4NQ0 A;  3ZUV B;  4BSX A;  2CHZ A;  3N71 A;  4IN3 B;  3ZGQ A;  5AAR A;  3FU3 A;  4CRW A;  3DST A;  5H7P A;  1DCE A;  4YVQ C;  3FTZ A;  3Q73 A;  5LFA A;  3DPY A;  3O48 A;  2JAB A;  3AS5 A;  4CCA A;  4IRU A;  4PS3 A;  3CHS A;  3FUM A;  3ASD A;  3PZ1 A;  4I2W A;  5J08 A;  2Y4T A;  1Y6I A;  4O6F A;  3T8M A;  2FUL A;  5JA4 D;  2RKK A;  5AJD A;  3NAW A;  3QJZ A;  3CR3 A;  4PS8 A;  3ABL E;  3FUE A;  3SZ7 A;  5G05 J;  3D9L A;  1IHB A;  3F6Q A;  2L6J A;  3UPV A;  3I4R B;  3FH8 A;  4JW1 A;  5FQ6 A;  3BUA A;  4F1S A;  3FTW A;  2LXL A;  1OWM A;  3NZS A;  5EYL A;  3C3R A;  3SY2 A;  2RD0 A;  3C5R A;  3AG4 E;  2WXI A;  1TNZ A;  2XGO A;  1OWL A;  3FUI A;  3MX3 A;  3IV0 A;  3MKQ B;  3UM2 A;  5A7D B;  1NP7 A;  3DBS A;  3AU4 A;  3FTU A;  1O1S A;  2RG8 A;  3CK8 A;  1N54 A;  1OCC E;  5G55 A;  1HE8 A;  2FO1 E;  3ABM E;  4HLE A;  5ENP D;  1V55 E;  1MHQ A;  4U7E B;  4LG6 A;  4ACL A;  2PM6 A;  2WXO A;  3MV2 B;  4A3T A;  3TL5 A;  3HIZ A;  4AIF A;  5HS0 A;  1OT8 A;  1H2V C;  5BW8 C;  4G23 A;  3EIQ C;  5AN8 A;  4J8Y A;  2HR2 A;  1A5E A;  3MJW A;  3J5P A;  2R59 A;  4JL0 A;  1DC2 A;  2DYS E;  4CGV A;  5G04 J;  5E75 A;  3J5Q B;  1KZO A;  2H6F A;  3RK6 A;  5BT1 A;  1TNY A;  2Y0B G;  1K1A A;  2BED A;  2FO7 A;  2IO2 C;  2UY1 A;  4BT9 A;  2C2L A;  4APO A;  3AS4 A;  4YVO A;  1HS6 A;  3L17 A;  3UT4 A;  3QAR A;  3FHE A;  3DEP A;  2CG3 A;  3IBE A;  4FHJ A;  3V30 A;  3IXE A;  3NZU A;  4C48 B;  2H6G A;  1MX6 A;  2VTB A;  4J7W A;  4GAA A;  2EIK E;  4KZ0 A;  2DIW A;  3FU6 A;  3L82 A;  4L1B A;  4GTS A;  4PH4 B;  3UKR G;  4YDO A;  4FAD A;  3EHM A;  3UT8 A;  3RO2 A;  2MOW A;  2X6J A;  4DX5 D;  4BEP A;  1AP7 A;  3FDH A;  4EZK A;  4I6G A;  1PY1 A;  4XKB A;  4FLH A;  2VGX B;  3B7S A;  4XKC A;  3HDX A;  1LTX A;  4M7C A;  1MYO A;  1U3C A;  2FI7 A;  3U64 A;  5CMW A;  1NZN A;  4KYO B;  4MKT A;  3JUI A;  2PZI A;  3NOG D;  5FQ7 A;  1QZ2 A;  1HG5 A;  4N3B A;  5CEC B;  4I9E A;  4JEH A;  2HM8 A;  2PL2 A;  2VSN A;  3PNL B;  3CHQ A;  1NA0 A;  2VQ2 A;  4C0M A;  2BUG A;  3JQ1 A;  3KSL A;  4IUL A;  4U07 A;  1NL4 A;  3OXG A;  2KXP C;  5J90 A;  3S7J A;  1SZ9 A;  1INZ A;  4GTM A;  3KEA A;  4ILG A;  1D8E A;  3HXD A;  1KT1 A;  2RFM A;  5A6C A;  5FWQ A;  4R7L A;  3ZW3 A;  3QWW A;  1ELK A;  3SO8 A;  5HQ8 A;  1OWO A;  2QYJ A;  2X6H A;  2ZU6 B;  4AM9 A;  5FJY A;  3SBS A;  1OXJ A;  2WMO A;  4G1T A;  3NF1 A;  5C1D A;  3AAA C;  4EQF A;  3ZRH A;  3G2U A;  1V54 E;  3E32 A;  4GMR A;  2IOL A;  2GW1 A;  4MLP A;  3CVP A;  5FT9 A;  4DX7 D;  2WXF A;  3ASG A;  1UJJ A;  3Q9N C;  2GRO B;  5BXU A;  3SNX A;  3LVR E;  3C72 A;  3C98 A;  2BF0 X;  2VSX E;  3TWV A;  1Z3Y A;  5CBN A;  3FUD A;  5A23 A;  4H7Y A;  1MX4 A;  2A5U A;  4LEU A;  4BES A;  3DWL G;  1PC2 A;  3MZL B;  4AOF A;  5LP0 A;  3ESK A;  1E8Y A;  2AVP A;  1NA3 A;  3PUK A;  4U0U A;  3UT7 A;  3V31 A;  3CHM A;  3O4Z A;  3RIB A;  1JPL A;  1WAO 1;  3HXF A;  2ETC A;  2IO3 C;  3TXN A;  3CKC A;  5CHE E;  3PNT B;  4G25 A;  2E0I A;  1SQM A;  4EZJ A;  2KAT A;  3LXU X;  1E7V A;  1BLX B;  2WVI A;  2IEJ A;  3FUF A;  3IHY A;  4LCT A;  1IXV A;  4I6E A;  2EIM E;  3TWU A;  3PZ2 A;  3P2B A;  4E6H A;  3RRU A;  1JCQ A;  4B8C B;  4Q96 A;  5KBA A;  4JA7 A;  5AQ9 A;  2FBN A;  1SVX A;  2Q7F A;  4JHK A;  4B8A A;  2A4Z A;  3PDN A;  2XQ0 A;  1WG0 A;  2AXZ A;  3ONL A;  5EDS A;  5KNG A;  5EN5 D;  4N39 A;  2DBA A;  2KM4 A;  3CVQ A;  3S7D A;  5CED B;  4CDN A;  4OVV A;  5ENO D;  4O60 A;  3TWR A;  4UWH A;  3FH7 A;  2YQ8 A;  3CKB A;  1KPS B;  3APF A;  3ZPJ A;  4LNG A;  2EQX A;  4HOS A;  4G2V A;  1BI8 B;  4HOR A;  1GW6 A;  2FEZ A;  3PZ3 A;  4J0U A;  5T8I A;  2MYO A;  4U04 A;  2BKK B;  3EDT B;  3D9P A;  3LPZ A;  2HO1 A;  2DCP A;  2XRZ A;  4F1P A;  2EIN E;  1QYM A;  5ARG A;  2J07 A;  3Q47 B;  1U2V G;  3QWV A;  3EJN A;  2VSY A;  4A3V A;  4ME2 A;  1VDY A;  3SGH A;  3FTX A;  4EZL A;  1ZU2 A;  2I9C A;  5T4Y A;  4Q69 A;  4DUI A;  1NI1 A;  1N4P A;  5AEN A;  2XS1 A;  4K5C A;  4A1S A;  3SFY A;  1FCH A;  3RRN B;  5C2Y A;  4CDR A;  3LCA A;  1S70 B;  3R7Q A;  1JCR A;  4DX1 A;  2QY7 A;  2J9Q A;  3PUJ A;  4WWO A;  3D9O A;  4N5Q A;  3UM0 A;  2IY0 C;  1AWC B;  3KAE A;  3ONK A;  2ILR A;  4H7X A;  2UY1 B;  3CVX A;  1HO8 A;  3DXM G;  4RQI A;  2E2E A;  3AG2 E; 
#chains in the Genus database with same CATH homology
 1MYO A;  5AAO A;  5FIO A;  4ZFH A;  3TWT A;  5EID A;  4HNA D;  1IHB A;  1MJ0 A;  4Z68 A;  4QFV A;  3F6Q A;  4YDW A;  3TWV A;  2Y0B G;  4DX2 A;  5CBN A;  3NBN B;  4HI8 A;  1K1A A;  2HE0 A;  2NYJ A;  3EU9 A;  4B93 B;  3NOG D;  4CZ2 D;  2DWZ A;  2PNN A;  1MX4 A;  4GPM A;  3T8K A;  4BER A;  5CEC B;  4O1P A;  1BI8 B;  3T9K A;  1K1B A;  3TWS A;  2AJA A;  4HLL A;  4U8V D;  2DZO A;  4DRX E;  5ENS D;  1YYH A;  1BD8 A;  4BES A;  2MYO A;  5EYL A;  4K5A B;  4OAV B;  3B95 A;  2BKK B;  3C5R A;  1MX2 A;  4TUM A;  2KXP C;  3EHR A;  4HRN A;  2Y1L E;  1N11 A;  3UXG A;  2V4H C;  4UUC A;  5CBO A;  3V2O A;  4F6R D;  5EYP F;  3DEP A;  5KWD A;  3KEA A;  5HRY A;  4G8K A;  4G8L A;  2ZGG A;  2RFM A;  3V2X A;  2F8Y A;  1WDY A;  3V30 A;  5CEA A;  3IXE A;  2L6B A;  4O1O A;  3V31 A;  5JMN D;  2VGE A;  4F1P A;  1QYM A;  5HKP A;  5D66 A;  5ENR D;  1BU9 A;  3JXI A;  3NOC D;  2DVW A;  3W9F A;  2ETC A;  3SO8 A;  3B7B A;  3V79 K;  4NIK A;  3TWX A;  1YMP A;  4C48 B;  4HB5 A;  2XEH A;  3JUE A;  1MX6 A;  2QYJ A;  2F37 A;  4HI9 A;  4U8Y D;  5KNH D;  4ZHB A;  1NFI E;  5ENQ D;  5BXO A;  4J7W A;  3HRA A;  1OY3 D;  2XEE A;  1N0R A;  2BKG A;  5ITZ F;  2A5E A;  2FO1 E;  1D9S A;  1IKN D;  3TWQ A;  2RFA A;  3ZUV B;  3JXJ A;  3DEO A;  5ENP D;  2ETA A;  2J8S D;  1BLX B;  3W9G A;  5AAR A;  1IXV A;  2ETB A;  3AAA C;  3LJN A;  4LSZ E;  1SW6 A;  4LG6 A;  4U95 D;  4YDY A;  5AQB A;  4BET A;  4DUI A;  2V5Q C;  2XZT G;  2QC9 A;  3EHQ A;  2ZGD A;  4HRL A;  5AQA A;  3AJI A;  3TWU A;  3UI2 A;  5CER B;  5HS0 A;  4JB8 P;  1OT8 A;  4K5C A;  3TWW A;  5EIB E;  1K3Z D;  5KBA A;  5AQ9 A;  5EIL A;  4RLY A;  1SVX A;  2JAB A;  2XZD G;  2F8X K;  2B0O E;  3Q9U C;  3UTM A;  1BI7 B;  4GMR A;  4LNU D;  5AN8 A;  4J8Y A;  4DX5 D;  1S70 B;  3D9H A;  4K5B A;  4ATZ D;  4DX1 A;  4A63 B;  4HQD A;  4CYM D;  5AQ7 A;  4BEP A;  3ZU7 B;  1AP7 A;  2KBX A;  1WG0 A;  4DX7 D;  1A5E A;  4N5Q A;  5ENT D;  2P2C P;  5KNG A;  5EN5 D;  3J5P A;  1AWC B;  1DCQ A;  3ZKJ A;  1TR4 A;  1DC2 A;  1N0Q A;  5JA4 D;  4U96 D;  2XEN A;  3Q9N C;  1G3N B;  5CED B;  4QQI A;  5BXU A;  5ENO D;  4O60 A;  2DZN A;  3TWR A;  1YCS B;  3J5Q B;  4DX6 D;  1UOH A;  4OAU C;  3HG0 D;  3ZNG A;  4HRM B;  5FIN A;  4HBD A;  4BSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...