2ZGKA

Crystal structure of wildtype aal
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
QGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
molecule tags Hydrolase
total genus 38
structure length 158
sequence length 158
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgkA00
5CB7A 3WCRA 1D2SA 4XMIA 1GZWB 1MACA 2PHTA 1V6OA 4ISRA 2ZHNA 4AGGA 5AVAA 4LBNA 1A3KA 1C57A 1PZ8A 4M3CF 4P9WA 5JVVA 1AZDA 2A6ZA 3OPZA 1ZA4A 3Q9OA 4ZXKA 1F31A 2NP0A 4LBJA 1GANA 1WD4A 1W6NB 3BTAA 3L2YA 3JU9A 5F5QA 1LTEA 4C1XA 4PQ9A 4H55A 1DQ6A 3OY8B 2B7YA 3T1LA 1UL9A 1S0CA 1F5FA 1CIWA 3BIWE 3UJOA 1FYUA 1RIRA 2R0HA 1Q8SA 2VY0A 4XE9A 1WLDA 1LESA 2PHFA 4FVVA 4RA0A 1G9AA 4D69A 3WLUA 5CBLA 3VKNA 2W52A 4XZPA 4XHBA 3AYCA 4P14A 3WZ1A 3AZXA 2Q5TA 1ZM1A 3NV2A 4XXAA 5DUWA 5GM0A 3WNXA 3AYAA 2GALA 3HMYA 2R16A 2ZMLA 1SCRA 3O12A 3GALA 2VW0A 4U2AA 2P34A 2HYKA 4K1YA 2DV9A 4YW1A 1ONAA 1UX6A 2C5DA 4SLIA 2A70A 1DFQA 2A5ZA 3PJQA 2D6LX 1N1SA 5DXDA 1H9PA 5CA6A 4XXPA 2ZHLA 2EAKA 2ARXA 3AP9A 4XJAA 5JLVA 2DUPA 2LALA 5CNAA 4M3CE 4BM8A 2ZGLA 1I3HA 3AZZA 3N7JA 5DG2A 3OBRA 4LBQD 1Q56A 3ZYPA 3I4IA 1V6KA 3IPVB 4BQ1A 5HCFA 1QDOA 1JOJA 4R9BA 4XBLA 1GICA 3ILRA 2V73A 1JXNA 2D7FA 1W0PA 2VH9A 3WDTA 1WBFA 1LULA 1CQ9A 1CR7A 1DQ0A 1MVEA 4TZDA 1QDCA 1N3QA 1V6MA 1ULCA 2GMPA 3POYA 4AVTA 2A6YA 1UZZA 1BYHA 1LU1A 1PZ9A 2JKBA 1BJQA 2R49A 3ZXJA 1J1TA 4YG3A 2AYHA 1QOTA 3I8TA 5KXDA 4CZSA 3AJYA 1S0JA 3APBA 3RMYA 1MS4A 2ARBA 3H0OA 3WUCA 1WLCA 2A7AA 4XJWA 2A3WA 1BQPA 1PZ7A 1C1FA 1CPMA 3PVNA 1QOOA 2PHWA 3D5OA 4Y22A 4Q8LA 3BOPA 1Z0HA 1W6PA 3M3EA 3PVOA 5H9RA 5IK4A 1N1TA 3C2UA 1N3PA 1VLNA 4FPKA 5DZEA 2GMEA 1R1ZA 3M2MA 1YRZA 1MS3A 1IKQA 2W08A 4FQZA 1MS9A 4AYUA 1JYIA 5GLZA 4U36A 1F9KA 3USUA 1U0AA 1LHNA 1WLWA 4YM1A 5GZEA 3AZWA 4C1WA 3B3QE 1LOBA 4LBOA 3V0AB 2P2KA 2ZGOA 1JN2P 2FHRA 1DHKB 2PELA 5EWSA 4FP2A 1VALA 3WG4A 4ATFA 3LCPA 4BOWA 3ZSJA 3WDVA 2R1DA 4YZ5A 3RG0A 4YFWA 4YM0A 1W6QB 2D6PA 1HQWA 1NLSA 2G4IA 1LHOA 1MR5A 2WSVA 3O0XA 4YGCA 3AYEA 3V0BA 1Q8PA 2R1BA 1AX0A 1D0HA 1ENQA 1G86A 1WD3A 4GWMA 1S0IA 2JJ6A 1IKPA 3AP7A 1S1AA 4Y20A 3PMEA 1WUVA 4Y1VA 4UW6A 3RS6A 3MPPG 4AVVA 2GDFA 2PHXA 2ZGMA 4K21A 1H30A 1SCSA 5DG1A 4JCKA 3DGTA 2CYFA 2DVAA 1KDKA 3OJBA 3IM0A 4FPHA 4L8QA 5L73A 5JMCA 2ZZJA 5CAZA 2D3PA 4YW4A 2ZGQA 3R4SA 2E7TA 5T5PA 1ENSA 2EXIA 4XHXA 5GLTA 1G9CA 1S0GA 2DVFA 2WJSA 1W6NA 1QNWA 1C1LA 1Q8VA 1V6JA 1DQ4A 1QU0A 1LHWA 1KITA 5GZFA 4XDQA 3POSA 3WG2A 1HQLA 4XJ9A 5IK5A 2ZGSA 3T1MA 3WG1A 3R05A 3WVJA 5E8AA 5T54A 5F9TA 3OBTA 4UW5A 4GKXA 2JDZA 1FAYA 1LODA 1W6OA 2DYCA 3SITA 3FLTA 1O4YA 2WT0A 1G9DA 5H9SA 2BQPA 1S0FA 1A78A 1N1YA 2A3YA 2AUYA 5GZDA 4FOWA 3AYDA 4YGEA 1B09A 1QOSA 4TYSA 2H0BA 2D6OX 3FLPA 4FPCA 4DQAA 2UWCA 3IMNA 2GNTA 2ERFA 3V64A 1YI7A 2GN7A 5GJ6A 2AREA 4Y26A 1W6MA 3IKWA 1SLAA 1GV9A 2ZGUA 1UN1A 1KJLA 3VKFC 1NXD1 4K20A 1YO8A 1KRIA 1FNYA 2ZBJA 1DGLA 3UJQA 4LBQB 2P37A 1X50A 2DTYA 1BXHA 3VKLA 1IOAA 4M3CB 1CVNA 1MS0A 3WV6A 1O4ZA 1OFSA 4FOVA 2E53A 3N7KA 2E51A 5BYNA 5E88A 3ILNA 4LBKA 4YW3A 1KDMA 1KQRA 2DVBA 1APNA 1JBCA 4HL0A 1V00A 2RHPA 2ZGTA 4Q1RA 2JECA 4WZFA 3WUDA 1YYNA 1JHNA 1RITA 4YGDA 1ULFA 1LU2A 3ZPYA 1SLLA 2OUHA 3FBYA 2WNEA 3HN1A 4CTEA 3WHTA 1LOAA 1GZCA 1DBNA 2WQZC 3RSJA 4AGRA 4Y1ZA 3VKOA 2VW1A 4YW5A 3N36A 4Q1PA 5GLUA 5HCAA 5JOWA 1YXWA 2CWMA 4Q8KA 1DQ2A 1QF3A 2ES3A 1CN1A 1GYKA 2AR6A 2DUQA 2V5YA 3R4UA 1G9BA 4GKYA 4FQ4A 2W39A 2PHUA 2CTVA 5DUUA 3SLIA 3WOGA 1I1EA 2A3XA 3WG3A 1AX2A 1C4RA 1FNZA 2DWRA 5EXOA 1DQ1A 4RL7A 1EPWA 4XJ8A 3TAYA 1LOEA 1A8DA 5JOXA 2EIGA 3B01A 2UWBA 4YZ2A 4FP3A 2ZGKA 1JW6A 4NO4A 3RMXA 1GZ9A 1WW5A 1Q8QA 3AK0A 3ASIA 3D6EA 3POWA 1FV2A 2SLIA 4BLJA 1UZYA 1ULGA 1DYKA 2ZGRA 3NWKA 3ZSMA 3M3CA 2TEPA 3GNEA 3BODA 2A6WA 4R9CA 1LHVA 4IQPA 1AF9A 4BMEA 5JOZA 3OYWA 2C9AA 3A0KA 3ILFA 3MEPA 4XBNA 3B00A 3KM5A 4NOTA 3SNMA 4XILA 3U4XA 1LEMA 2OUJA 4FPFA 4DS0A 2DU1A 2AH2A 3KQRA 2CWSA 4WVVA 4YLZA 1LOFC 1SFYA 4W65A 1AXZA 2NMNA 1SBDA 3A4UA 3ZSLA 4GA9A 2ZGPA 2E6VA 5DUXA 4BMBA 5IK7A 1SLTA 5IUQA 2D3RA 3WDYA 1SBFA 5KXEA 1CONA 2A71A 4WV8A 1LCLA 1LGNA 3RRDA 4ASMB 5T5OA 4FOQA 2CL2A 2D6MA 2EALA 4Q26A 2UWAA 1GZWA 2A75A 5IT6A 3M3OA 2EXKA 3AP4A 4Y1YA 3N7MA 5SV8A 2JD4A 1FX5A 3VV1A 1AXKA 2YY1A 1WW4A 5H9PA 1G9FA 5GALA 2WLQA 4R9DA 1HLCA 3SH4A 2Z42A 2EXJA 2LTNA 3OY8A 1Q8OA 4PBOA 1LENA 1W6PB 4PBPA 4KBBA 4XTMA 4P9YA 2NM1A 4JRAA 1GKBA 1MS1A 1ULDA 2WKKA 1S0DA 3T2TA 4ZKTB 1W0OA 3ZXKA 2ZMNA 3USUB 4PCRA 4AVSA 2VXRA 2CY6A 2R0FA 2D6NA 2ZHMA 1RINA 4FPYA 4DFSA 3D4KA 2WT1A 1V6LA 4XBQA 1V6IA 5GLVA 2NMOA 1VIWB 4M00A 2ZAAA 1HDKA 2GN3A 3FUOA 4UW4A 2GNMA 3INAA 3ZVXA 2AENA 2D3SA 1AX1A 3B9CA 1WW6A 3W59A 4Z8BA 1N47A 1AXYA 1N1VA 3QLQA 1OQ1A 3O5SA 5DUVA 5T52A 2UURA 5T55A 2YZ4A 1TEIA 1MZ6A 2ZKNA 4FPOB 2FMDA 4LBLA 2GNBA 1DLLA 2WSUA 2EXHA 3IPVA 2DURA 2DVGA 4XOGA 1KJRA 3LSEA 1CPNA 3A0NA 1BKZA 3AZVA 3FUQA 1MS8A 3IN9A 2JE7A 2P3JA 3PVEA 5JOYA 3WDUA 4PF5A 1LJ7A 1VAMA 5KXCA 1FATA 4XJZA 3DUIA 1DZQA 3AX4A 2ZACA 3NV4A 2GNDA 4YZ1A 1SACA 1H9WA 3O0WA 4YW2A 5IK8A 1MVQA 1ENRA 1UKGA 4AWDA 2NZ9A 3NV1A 5GZGA 1QNYA 4CRQA 4FPJA 3ZSKA 3CNAA 1OKQA 1DYPA 1W6OB 3FLRA 5DZGA 1URXA 4Y1UA 3SISA 1BZWA 4XTPA 1GNHA 1JYCA 2XG3A 3MW3A 3RQ0A 4R9AA 5T5JA 2A6VA 1WW7A 2ENRA 4FOYA 5EYXA 2ZGNA 5JDBA 4YGBA 1SLIA 1ULEA 5EYYA 3W58A 3FFZA 2YXSA 3MW2A 4OZXA 4Q27A 1GNZA 2YMZA 2WT2A 5GLWA 1IS5A 3N3HA 1GBGA 1W6MB 4YZ4A 5T5LA 4YM2A 3V0AA 1AJOA 1DIWA 3VKMA 1AJKA 2W68A 3ZYRA 1GLHA 2D6KA 4YG6A 1SLCA 3M1HA 4DRVA 3AJZA 1W6QA 2SBAA 1Y7BA 4UW3A 3WDWA 3AFKA 3N35A 4GWNA 1FV3A 5H9QA 3TB0A 2D43A 4FPEA 1QKQA 1LGBA 2VU9A 4XJUA 4XIKA 5HCBA 2DTWA 1LOCA 2DUOA 2GMMA 3ZXLA 4GALA 2A6XA 1MS5A 3AP5A 1WBLA 5FRAA 1LOGA 4XIOA 2ZABA 1QMJA 1YIFA 3MW4A 2YV8A 2E7QA 4YFZA 3SH5A 1JUIA 3VUOA 3AZYA 1DQ5A 1LECA 2UU8A 4LBMA 4YZ3A 4YM3A 2OW4A 2KM2A 1LHUA 4AGVA 1GSLA 1LGCA 5KXBA 1S0EA 3AP6A 3O0VA 2P3KA 1IS6A 3B69A 3AXEA 2NYYA 1S0BA 2DU0A 3UK9A 3WCSA 1G8WA 3N7LA 3M3QA 1V6NA 4P9XA 4ATEA 1LEDA 2DVDA 3ENRA 2PHRA 3ATGA 4ITCA 4DPNA 1SBEA 4FPLA 3V65A 1WCSA 1IS3A 1G7YA 2P3IA 1N3OA 4Y22B 1IS4A 2AGSA 3JUUA 3WDXA 3SH3A 4WVWA 2I2SA 3NV3A 2NN8A 2JE9A 4XYXA 4YG0A 1XQNA 3HR9A 4ISQA 1HKDA 3AXDA 3OYWB 3WHUA 2ZA9A 1QGLA 2YROA 4MYEA 1UMZA 4XMAA 4JC1A 2VUAA 4LBQA 2XB6C 4Y24A 1AVBA 1UPSA 5FREA 3LSDA 2CNAA 2ZMKA 4M3CA 3ZXFA 4I30A 4DRRA 1VAVA 4Q2FA 1CJPA 4F83A 2OVUA 2D44A 4Y1XA 1SLBA 1CESA 3OGGA 4HANA 4BLIA 4K1ZA 4M01A 3UL2A 2VW2A 2ZHKA 3V0BB 4FPGA 1Z78A 4BPZA 5E89A 3ZXEA 2EF6A 3QCWA 5T50A 1MZ5A 5GZCA 1UAIA 5DZFA 5LK5A 1LOFA 4Y20B 4GXLA
chains in the Genus database with same CATH superfamily
1HB4A 1NY71 1UU4A 4JDMA 1D2SA 1SQ4A 1MACA 1NCQA 2HWB2 1K5MA 2PHTA 5HV4A 5DMYA 4MXWB 3VD9A 2OQ6A 2QQUA 2VMEA 1XE8A 4UBHA 4LBNA 3AKQA 4M3CF 2Q30A 2ARCA 2QVSB 2E63A 4B8EA 2Y34A 4RSUA 2VMCA 2Z69A 4LEJA 4LBJA 4G3YC 4DEVA 2NP0A 2WZEA 3JU9A 4QPIA 1LTEA 4C1XA 2J1SA 5FO8B 1KD7A 1VBD1 2GH2A 1DQ6A 3OY8B 2IXCA 1UL9A 1F5FA 1RIRA 2K9ZA 1AR92 2QE3A 2R0HA 5ACA3 1WLDA 1LESA 1G9AA 5FK7A 3OUHA 4Z82A 4I0WB 4D94A 4TN7A 2XLAA 4G9SB 4UF0B 3U1XA 4MHUA 1ZM1A 1FOD3 5GM0A 5BNOB 4WBBA 3VDDA 1FPN3 2Y38A 4TWTA 2ZMLA 3J7NA 1DCSA 1H4HA 2VW0A 3LFIA 4Y5Z0 5C8WA 2HYKA 2CSGA 4BA6A 3WXPA 1ONAA 2A70A 1DFQA 2CDPA 4UFHA 2I74A 4Q4Y3 4NPRA 1VB4A 2ZZQA 3LZZA 5F6LB 3GGLA 5A7WA 4L2NA 3CKHA 3FFQA 4GAZA 5F7UA 1QJFA 1E5SA 3POFA 5JSOA 5C9AA 4M3CE 3C8XA 3OD4A 1X33A 3S7IA 2CDOA 1I3HA 1XNBA 2YB7A 5I0UA 1Q56A 4EYUA 1CWPA 1JOJA 4JRLA 3AL6A 4R9BA 4MGZE 1YI9A 1O3SA 1GICA 4XCAA 5IVFA 5FLIA 3VHRA 3ZXDA 5FZGA 5CFCA 3AKPA 1J1LA 3PUIA 1CR7A 1DQ0A 2X05A 3BB6A 3MF9A 3BIEA 2VE1A 4LOSA 1VBE2 1TG7A 4NMIA 2VM9A 3IWZA 4NHKA 2LW8A 2R042 2Y60A 3CJIC 4I02A 1Z7S3 2R49A 3ZXJA 4B7EA 2AYHA 3BCWA 3VD7A 2EIEA 3ZN6A 3AJYA 3QBQA 3H8XA 2VULA 3H0OA 4NRQA 1PHMA 4XJWA 1BQPA 1Y43B 1PZ7A 2W46A 4G4FA 1CPMA 3PVNA 4DMIA 1VRBA 3ZR6A 2X29A 5DN2A 1JTZX 5D2AA 5JIUA 1R092 3M3EA 4KQ7A 3ROUA 3T08A 4A7ZA 3C2UA 4A42A 1PVC3 4B29A 4GZ9A 3RFRA 1CAWB 4BXSV 4S2DA 5CKMA 5APAA 2OZ6A 3NNFA 2FMYA 5DDJ2 2EAAA 3CMGA 3OEAA 4YM1A 1UQXA 1UD1A 4LBOA 3ZFEB 1SFPA 3KT7A 3PTYA 4RHV1 4PIYA 5C3RA 2FHRA 5JPNB 1DHKB 3WG4A 1HN0A 1NUKA 5LY2A 4C0BA 4WM8C 3LCPA 4BOWA 3WDVA 2WABA 4IDZA 2QQWA 3ITQA 4YM0A 4YZ5A 1W6QB 1BBT1 1HQWA 5FYHA 3A23A 3O0XA 4TTGA 1Q8PA 2R1BA 1ENQA 2QZ2A 4KGQA 1S0IA 2JJ6A 1NG0A 1S1AA 1MEC2 1WCUA 2MHFA 1QJU2 3M70A 4MGTA 4QQOA 4L99A 2ORZA 2ZGMA 4QX7A 4K21A 4NIAA 3ZYGA 3ZPOA 2V4VA 3DPRC 1NE4A 3OJBA 1OOPA 3KWVA 4L8QA 1POV0 5L73A 4AFBA 3WF4A 1M06G 1CIYA 5A80A 2E7TA 2HWD3 3MFCA 5FZCA 5G05L 1U5IA 4IE4A 3O1RA 2WJSA 4B3NA 2VOWA 1W6NA 4E4DX 1K5JA 3W5NA 1RUE2 2Q0AA 1TE1B 4RS5B 4LO5B 4IEQA 1FMD3 4XFCA 2BBAA 3I59A 5IK5A 2ZGSA 4DNYA 2Q1FA 3T1MA 3WVJA 1CZTA 2RM21 4PDWA 5F9TA 1H2KA 4KMQA 4C8DA 1RB8G 1AL21 2WWJA 3OEBA 4NR1A 1RUF1 4UW5A 2HWF2 2JDZA 1FAYA 1LODA 1HRV1 2DYCA 1O6UA 5JXIA 2WT0A 1X9PA 2OZJA 5H9SA 3ZLIA 5CISA 5DAWA 1A78A 4YW7A 2AUYA 5GZDA 4BH9A 4I2OA 3GHMA 1B09A 4X6RB 4CDUC 1REEA 4LPLA 1O5UA 5FOBB 1RUG2 4CEYC 4EWAA 1HIXA 4C90A 4LORA 3VZNA 2UWCA 3IMNA 2ERFA 3V64A 5AFBA 3THCA 3E6BA 4CCNA 5GJ6A 4Y26A 4YYOA 1VMFA 1RUI1 2Q8EA 1UN1A 3LDKA 5FZOB 1DGLA 3WW1A 1RMU1 4LBQB 1VBA2 3VBOA 3VKLA 2RS11 1FI2A 3HN3A 1IOAA 1RUJ2 4WM7A 1CVNA 3O14A 1MS0A 2HWB3 3NAPA 3WV6A 1OFSA 4OI0A 1RHI2 1NCRA 2GP5A 4S2HA 2ETEA 3R0RA 4NRPA 5DAVA 3VBSC 1KQRA 3AMPA 1DLCA 2W47A 3WT3A 5L7OC 4K8FA 4WZFA 4AVBA 2PQSA 2W1QA 1WMDA 1RITA 5CADA 2Z2SB 3K4AA 3ZPYA 3ORJA 3FBYA 4X6QB 3WHTA 1NCQB 4AGRA 5I93A 1K5MB 2BWCA 1AR93 5GLUA 2OKXA 5HCAA 5JOWA 4RR3A 1W3VA 4ASLA 2RG4A 1CN1A 2BGPA 1ASJ2 4Q0QA 2MEV2 1CX4A 3S6PA 5A3OA 5IFTA 4GKYA 4H7MA 4FQ4A 5FZHA 2CTVA 1W9SA 4HSLA 2QZ3A 3UKTA 2VTFA 1A8MA 1PMJX 5LBEA 1C4RA 1WA6X 2FDFA 1EPWA 4BQXA 5JOXA 4E8CA 1OQEA 5FYIA 4UFIA 4YZ2A 4W6XA 4JV4A 3RMXA 5BNNC 3H7YA 3JB4C 1POV1 3EBRA 2WINB 4O9EA 3WQ7A 4CUAA 1Q8QA 3ASIA 1WKYA 4I3GA 2EVXA 3POWA 2SLIA 1WGPA 4IGOA 5FMOS 2JIGA 3H1YA 5A3PA 4DEQA 2VBDA 4UXAA 3SMHA 3KCCA 3VDDB 2Y6GA 3ZIXA 3PTRB 2YG0A 5FZKA 4AHYA 3M3CA 1JUHA 2C1FA 2OA2A 3KS7A 1AF9A 4D6QA 5JOZA 3OYWA 4UFKA 4AFDA 1EV12 4OUMA 3KVAA 3UGGA 1PK6C 5A7WB 3A0KA 3I2HA 1J84A 4BDVB 5JZGB 4GJZA 1GMMA 3KM5A 4NOTA 3UGFA 4XILA 2CGPA 1F4AA 2OUJA 1ZZ8A 1VBE3 2BZDA 3FL7A 5IFPA 1C28A 4WVVA 4YLZA 1LKNA 2Z5WA 3NL1A 2R043 5KWRA 1XE0A 4W65A 5K9YA 5FWEA 1AR72 2JG9C 1AXZA 3GXUA 4PT6A 3ZMNA 3ZSLA 4GA9A 4QD2A 5FZ1A 5CFDA 3DN7A 2IZWA 4CCLA 2Q1MA 3GCXA 3WD5A 2PHDA 2YU1A 1YQCA 4ASMB 3Q8EA 4AXOA 4D0QA 3TEXA 4OQ8A 5CFCB 1REDA 1VE0A 3BYWA 2WO7A 5JR7B 4O7XA 3NNJA 5EJ3A 4Q26A 3ZYBA 2UWAA 2GSYA 1GZWA 1UYPA 1R093 3ZN5A 3P6BA 5SV8A 4Q4W1 4EQVA 4UFJA 2YY1A 4JQRA 2PTMA 5DDJ3 3LOIA 4ASKA 2WZR3 5GALA 5FXXA 4R9DA 4IV1B 3CJIA 1NOVA 5FMDA 2G19A 2IUWA 2EXJA 5IHRA 2AACA 2VOKA 2F17A 3PURA 1H6YA 3DKQA 1PM4A 4P9YA 2NM1A 1RUC3 3BPZA 4QPYA 5FBZA 1ULDA 5LZ6A 1S0DA 4QM8A 3ZXKA 4MADA 2R0FA 1MEC3 4FPYA 4GQ7A 3RWKX 4XF0A 1QJU3 1W2TA 1D0GA 3NKTA 4DIQA 3CEWA 4M00A 1W8HA 2HWC2 2GN3A 2J22A 1NLRA 4IE5A 3INAA 3ZVXA 2PLV1 1AX1A 1YQ6A 3HPNA 4FT8A 4OHXA 5FY4A 1AXYA 4NHYA 4AAXA 2VBBA 4NAMA 5F3GA 5FJHA 5FPBA 3LGRA 4P08A 1V9U1 2J7MA 1MZ6A 3U0ZA 3PUAA 1RUE3 5EHDA 4QT6A 3POBA 4D7SA 2HYXA 3I3DA 3IPVA 2DVGA 1OOPB 2RR12 1RXGA 2XHKA 1Y9GA 1YNAA 3A0NA 3H1WA 1X7NA 2WFF2 5F32A 3KV6A 2HWF3 1K42A 3PVEA 5LRRA 2C9KA 5JOYA 3WDUA 2NLRA 3ECQA 1CAUA 1WWYA 4KG0A 4MSVA 5A7QA 2W0XA 3RVHA 3DPRA 3DUIA 3AX4A 1SACA 2JG8C 5IK8A 4RFRB 4RGKA 1AR61 3I59B 1QQP2 4AOCA 3GCWA 2NZ9A 3NV1A 5LBBA 1QNYA 2HEWF 4HLTA 4Y4YA 2ZEZA 2WNVC 3H3ZA 3WP4A 1W39A 3QOPA 4FPJA 3ZFGC 3ZSKA 1TMF2 4EROA 1NYWA 1TZOA 2I07B 5A70A 1OA2A 2Q1ZB 5DZGA 2Y26A 4Y1UA 1BZWA 1LB2A 4CYDA 4XPVA 1UNBA 2H6CA 2XG3A 4MH0E 3MW3A 5FWJA 1PGL2 4R9AA 1DG6A 5FIXA 5F37A 4FOYA 2IXLA 3UESA 4HN0A 2TNFA 3VBRA 1JYTA 1VBA3 2ZGNA 4HK9A 1RUJ3 1RUD1 1ND3C 2CV6A 1SLIA 1ULEA 1UW8A 2OT7A 3ZR5A 1MQTC 2IXIA 1JZ7A 2FZ2A 1JOBA 3CU7A 4OZXA 4DUXA 1GNZA 1RHI3 2PFWA 1W2NA 2YMZA 2WT2A 5GLWA 3N3HA 4CDUA 1R1A1 1B35C 1PVXA 4LIVA 3MYXA 4YZ4A 2JDYA 1XU1A 4CEYA 3V0AA 3HT1A 1RTVA 1GLHA 2D6KA 1XU2A 1UO9A 3S30A 3VLBB 3VBOB 1SLCA 1UY1A 3I3BA 2RS31 3M1HA 1CZSA 3AJZA 4WM7B 5E6HA 3NAPB 2YBPA 3DF0A 3FHQA 5LRSA 1NCRB 4LQRA 5F3EA 1AR81 4N7IA 1ASJ3 2MEV3 3AMNA 5FKBA 4R4XA 5FUPA 1WMXA 3KF3A 1LGBA 2VU9A 3ZO0B 3HD8B 5HCBA 2HWE1 4F7ZA 3GZAA 5IWFA 3G6JB 1F5JA 1MS5A 3OGSA 3VBSA 3KT1A 4LK6A 1WA4A 1XBFA 1HXS1 3LA7A 4Q4X1 5L7OA 2BW8A 4TXWA 4PLMA 3UYJA 4YFZA 4OMDA 4OHVA 2BDRA 3F2ZA 3NJZA 4I3PA 2P4EA 2YBKA 3KGLA 1WMFA 3FN9A 3ZN4A 5KHIA 2GU9A 3EO6A 4AGVA 2O8QA 3THPA 1LGCA 2VXJA 5KXBA 1KGYA 1S0EA 3O0VA 1QJY2 2W1UA 4ZS3A 1IS6A 1H4GA 1COV1 3AXEA 1R081 1XOYA 2HKXA 4QPIC 3UK9A 1IQDC 1EV13 1G8WA 4IEXA 1V6NA 2O0OA 1LEDA 3IB3A 2PHRA 3POGA 4LLOA 3VD5A 3I3QA 1WCSA 3CJXA 2RDQA 2RS51 1N3OA 4Y22B 1RVF1 2IVJA 5BNNA 4IEYA 1CAVA 4RFT0 4NROA 1NA1C 2G9ZA 3GBWA 3PUSA 2WC2A 2QDRA 4XYXA 3FHIB 4L0PA 1OC1A 5F5AA 1AR73 1C8M1 3OYWB 5EFUA 5J3UA 2ID4A 2VZ1A 2VNGA 3WNLA 3OF1A 2V72A 2XJSA 4CA9A 1O91A 1SMVA 5A6QA 2VUAA 2XB6C 1AVBA 1UPSA 1JH5A 2VZOA 3ES4A 4M3CA 4I30A 4D6SA 2XL9A 5CEHA 4K6BA 1BK1A 1PK6A 2YPDA 3JBG1 4Y1XA 5JSPA 1CESA 5C9AC 3OGGA 4BLIA 4M01A 1XB9A 5FXZA 2ZHKA 3BTZA 3Q8CA 4JKMA 1Z78A 5AC92 3B7MA 4OULA 2EF6A 3H8RA 1MZ5A 4QB1A 3S5QA 3RYKA 1MPXA 4GXLA 2R072 4Y20B 5FKCA 2JG9A 1FT9A 4XMIA 3HQRA 1GZWB 3ABZA 1V6OA 2JDUA 4QM9A 2VGDA 3R4DB 5FYBA 2XVLA 4B4QA 1A3KA 4EN8B 5LASA 2Q8CA 5KR7A 4P9WA 3NKGA 1AZDA 4GH4A 2J1AA 4QQLA 4YNIA 2R061 4CVUA 2D93A 2G9FA 2VQUA 3S5AA 3CJIB 3BTAA 4PQ9A 4CUCA 1ODMA 3T1LA 2HWC3 1S0CA 1O8PA 1W05A 1CIWA 4HONA 4Q0SA 4IW3A 3ZIWA 3VD4A 3CDZB 1Q8SA 4XE9A 1RJ7A 4FVVA 4RA0A 4D69A 3WLUA 3PDQA 5CBLA 2PHLA 3D0JA 3MBWA 4QGLA 1D4VB 3AMHA 5A6XA 3AYCA 4P14A 2ADDA 2BOJA 2WS92 3HBKA 2Q5TA 1HJFA 2XWJB 5DUWA 1YJKA 3WNXA 1NQDA 3TEWA 1UY4A 4CEWC 3HMYA 3MO4A 2R16A 3U07A 2Y6FA 3F95A 1SCRA 5FZMA 3O12A 1ZRIA 2UYBA 2P34A 4GD4A 2ILMA 2RR13 1S2EA 2DV9A 4Y3OA 3P5BA 4AQ2A 1UX6A 4SLIA 5FUIA 4FBFA 4XEZA 2WFF3 3PJQA 1N1SA 2F4PA 5DXDA 4AQSA 1F4HA 3ELNA 4NHXA 1I5PA 2ZHLA 4WM8B 2ARXA 5JLVA 1FPN1 2DUPA 2JDPA 3LFMA 4Q0VA 4BM8A 2ZGLA 3E5UA 3WX5A 3CHXA 4PLOA 1QQP3 4NIDA 3I4IA 1V6KA 3IPVB 5BNQA 4BQ1A 5HCFA 2DCTA 1QDOA 3WF1A 3IAQA 2XJRA 1TMF3 4XAAA 2W9XA 1UOGA 4BE3A 4BQ2A 1NLQA 1VBC2 3H42B 4XBLA 5JIAA 1CAUB 3ILRA 3QD6A 1JXNA 2B42B 1W0PA 2QQMA 4AQTA 3DPRB 4HETA 5KHGA 4CU8A 2VQ0A 1V6MA 4QXKA 5BUVA 1O8SA 4AVTA 1O3QA 1UZZA 1BYHA 1LU1A 1JI6A 3AMQA 2JKBA 1BJQA 3AVSA 3DCQA 4B1LA 4YG3A 5J09A 1QOTA 1LRHA 3LA3A 4QAWA 1XSQA 1S0JA 3L9JT 3J26N 4MOAA 2VAUA 5FLHA 2A3WA 5KHHA 3H8UA 3D5OA 2C26A 4PDWC 4XUPA 3ZFGA 4FFIA 5B4NA 1W28A 1IPSA 1Z0HA 3VBRB 5LWBA 1YIPA 1W6PA 3Q8BA 1ND2A 5I0SA 1N1TA 1EP0A 5FBJA 1R1ZA 3I2DA 2CHHA 2B39A 2ZX4A 2W08A 3EXUA 1IKQA 1PO22 3MLJA 4FQZA 5L9RA 3M3IA 3MZHA 4U36A 4MVTA 2BVVA 2HLEA 1BVVA 4CDUB 3I49A 3BTXA 4C1WA 1OA4A 2FCTA 1UY2A 5FYUA 4CEYB 1LOBA 1ND3A 2ZKLA 3V0AB 4OI4A 2OYZA 4QMAA 2PELA 4FP2A 1XRUA 3T4HB 1VB2A 4M4RA 4W50A 3WNMA 3ZSJA 2R1DA 4FXKB 3RG0A 1BMV2 1B35A 4IETA 4QB6A 3B9IA 1LHOA 2WSVA 3V0BA 1YFXA 3RJRA 1VR3A 2HJIA 2Y8KA 4GWMA 3O1UA 2PN5A 4D6RA 4DUWA 1IKPA 3AP7A 4Y1VA 3RS6A 3PMEA 3T3YA 5DABA 4UW6A 5FP8A 2GDFA 2PHXA 5LEKA 1RUH1 1AYM2 1NY72 2VZQA 1YQ8A 5DG1A 3VBHA 3H3LA 5C8CC 2W92A 1OLME 1KDKA 2WLPA 4FPHA 5JMCA 3VBSB 5CAZA 2D3PA 4YW4A 1QJY3 5L7OB 1YQ5A 1ENSA 2VOTA 3H50A 3KZ4C 1S0GA 3KGZA 5I8TA 1GUIA 1PIV1 4IEVA 4URTA 5DAXA 1LHWA 3OTFA 1AYN3 5GZFA 1VBD2 2OXBA 4RR3C 4XJ9A 5FY9A 3J8F2 2QTWB 2W5FA 5T54A 4KL1A 4JZRA 4DO0A 1E5RA 4JGZC 1W6OA 3SITA 4GMP0 1YLLA 1UPIA 3SCFA 1O4YA 2IXJA 1SDDB 3JB8A 2D97A 1XPWA 4QDRA 3WQBA 4CDXA 1N1YA 2WO1A 3C3VA 1JZ4A 2CAUA 1C3HA 3ALQA 1QOSA 5FZEA 3E97A 2H0BA 4BISA 5BNNB 2D6OX 3GYDA 4MGKE 1CAVB 4HMZA 3FLPA 4FPCA 5BXXA 5FZ0A 4DQAA 5FYVA 2GNTA 2IWGB 3FX3A 5JR2A 1YI7A 1C5IA 4QPGC 4H14A 3K77A 2AREA 5A3TA 3OPTA 1SLAA 5AC93 5DAQA 1KJLA 4ONUA 5K0UA 3VZLA 1NA1A 2YUEA 2ZBJA 3UJQA 2QQJA 5E16A 2R073 4M3CB 3U4SA 1RXFA 4PI0A 1H8TC 4NHMA 4YSFA 1PK6B 5I0TA 1O4ZA 5KHJA 3T0AA 2XR4A 4IEOA 3I2IA 2E53A 1VBB2 5LBCA 3ILNA 4YW3A 1KDMA 4YVSA 3D8CA 3KV5A 1ALYA 1APNA 1JBCA 3AM2A 3JQXA 1JZ3A 2JWPA 4MUVA 4Q1RA 1YYNA 1BEV2 4CUBA 4Y4RA 3SCHA 3OBZA 1ULFA 5EQUA 2YFUA 2JG9B 2FDKA 3HN1A 4DOUA 5ISLA 5CFDC 1AL0G 1LOAA 1DBNA 1OMIA 2FCUA 3K4ZA 4LO4B 4Y1ZA 4Q1PA 4CDQC 4D7TA 3ACIA 2QQOA 5FZDA 1PGSA 2ET1A 1QF3A 3RI9A 1GYKA 1NZIA 2R7EB 2DUQA 2V5YA 4GWJA 4B7KA 2BFUS 3NW4A 5M0TA 1G9BA 5A32A 5CKNA 1VJ2A 2PHUA 2W39A 3WP3A 4CCKA 2WS93 4N8MA 3JCIA 5DUUA 4TSVA 3SLIA 1I1EA 2A3XA 5ANQA 1PO11 3WG3A 1AX2A 3WINE 3IT8A 5FPZA 1DQ1A 4RL7A 1QJX1 4XJ8A 3TAYA 1DGWA 5FZ4A 1CJDA 1HJGA 3BUCA 4NO4A 2P17A 2QNKA 3VD3A 3AC0A 2Y0OA 2WNOA 4AF9A 4Z2AA 4RHV2 5A3MA 1OT5A 3WNPA 4JQTA 1JZ8A 4M0NA 2ZGRA 3NWKA 2FDHA 1PGW2 2VVDA 4TLGA 2TEPA 3AKTA 1BBT2 1T6GC 4XQWA 4IQPA 1HRI1 5C70A 4BMEA 2WRAA 1W99A 3DEMA 4A7YA 3MUZ1 3T4VA 1F15A 1VBC3 4CEWA 3SQOA 3B93A 1ZX5A 3ILFA 2J1TA 4KG8A 4XBNA 4GMP1 2H6BA 3UETA 1OPOA 1UIKA 4XQDA 4QX1A 1W9WA 4Q4V2 2DU1A 3KQRA 2EIDA 4DS0A 4EZHA 3CF6E 2K46A 3J7HA 4XUNA 1HB1A 4A2UA 2XJUA 1LOFC 1SFYA 2XBO3 4AEKA 2XUEA 4AE2A 2QQNA 1H2MA 4X8NA 5IK7A 4QX2A 4WV8A 1VBE1 2AEYA 5T5OA 4E9KA 4AEDC 2KA3A 4JHTA 1ZBA2 2X09A 3CO2A 2A75A 5IT6A 2RM22 2EXKA 4NE9A 4ZS2A 5FQ0A 4MG2A 3N7MA 5A6ZA 2JD4A 1FX5A 1NKGA 1AL22 4RD7A 1W03A 1RUF2 2CGOA 4BQ3A 3IDAA 4Y5SA 5LA1A 1HRV2 3JZVA 1PO23 2JG8B 5H9PA 3RZLA 4CXYA 5JI9A 3W5MA 1GFF2 2WLQA 5LBFA 3HAGA 4QU2A 1HLCA 3RNSA 5J1XA 3ZFGB 2WNVB 1R091 4QDQA 3OUIA 3O7OA 5FPXA 1Q8OA 1W6PB 4AVCA 2JDAA 5DDJ1 4Q0PA 2WKKA 2WZR1 3T2TA 2DCZA 1W0OA 1OF4A 2VQTA 1JHJA 4XF3A 4DB5A 1GQPA 3VBRC 1RUI2 2ZPXA 2ZHMA 1RINA 4DFSA 1ND3B 2WT1A 1V6IA 1AYM3 1MQTB 1RMU2 1VIWB 4F3JA 2RS12 2ZAAA 1RUC1 4UW4A 4AFAA 4WVZA 2YGMA 2AENA 2Y6JA 2D3SA 3B9CA 2VMHA 1B35B 4KH9A 4CPBD 4RQPC 4HKOA 4CE8A 3VN4A 1OQ1A 1RYYA 4AQ6A 2WWSA 2VOXA 3OPWA 5FY7A 3W9AA 1OH3A 2UURA 3IDBB 4UFLA 4CP0A 4EWDA 1G6NA 1GQHA 5DAPA 1Y4WA 4CP9B 3RDIA 2BVBA 4N53C 2XONA 2FMDA 2WL1A 4LBLA 4QQ2A 1ZYBA 1AHSA 1NT0A 1VBD3 3MV11 3J8F3 2WSUA 2EXHA 3RPQA 3CLPA 2Z79A 1QEXA 3SKVA 3S57A 1CPNA 1BKZA 3AZVA 3ZKYA 1MS8A 1BK0A 2WNUC 5IAXA 4NIHA 1K3IA 2XVGA 1AUYA 4XFHA 4PF5A 1Y9QA 1VAMA 5A7PA 5KXCA 1FATA 4QB2A 5C3OA 5C8CA 2DBIA 1DZQA 2ZACA 4BCUA 1GQGA 2B4KA 2GNDA 1H9WA 4NWVA 2BP6A 2DCKA 3BPSA 5JSRA 3T2OA 5JXGA 1EYBA 4AWDA 1DGWX 1HV1A 2XQRA 2HWF1 4CXXA 4PIXA 2YFZA 3K3OA 3IBMA 1W6OB 2BV4A 1URXA 2GC1A 3SISA 4A44A 1IPJA 3LE0A 3MFAA 5F39A 4XTPA 5FAXA 3SCGA 3E6CC 2HH9A 4R8HA 3RQ0A 2B9UA 3HJRA 1PNGA 4JGZA 4K3UA 1Y3TA 2JD9A 3OSDA 1H0BA 1ZVFA 4QPIB 1OH4A 1D2QA 4KGGA 4ORFA 2RV9A 3KSCA 4TLFA 3W58A 3FFZA 1UY0A 3KD4A 2YC0A 1VBB3 3KCYA 1GBGA 4MZUA 1D7PM 3NNLA 5T5LA 1UMHA 1DIWA 1AJKA 1K12A 1NA1B 1XC6A 3I7DA 4COUA 1BEV3 1P8JA 1UMIA 4QPGA 4URAA 4DRVA 4LNVA 3TN91 3U11A 2WYSA 4MO3M 2XLGA 4N9HA 4UW3A 4ZU5A 2Q8DA 2E32A 1IHMA 3S7EA 5H9QA 5ERLA 3DXTA 3TB0A 1GOHA 4FPEA 1TVGA 1H8TA 2MPFA 5F6KA 3B5LB 5CIRA 4QU1A 4XIKA 2QKDA 1SFNA 2DUOA 2R30A 2ZXQA 3LD8A 3TYJA 5I0DA 3QACA 5C9AB 2E33A 1UU6A 2A6XA 1RGSA 4BJ0A 4Q4W2 3VBUC 5B2GB 5FRAA 3VZMA 4XIOA 4E4ZA 4UT5A 1ASJ1 2ZABA 1QMJA 2MEV1 1YIFA 3LPGA 4LOTA 4DZGA 2E7QA 3SH5A 3LDBA 3PIGA 1DQ5A 5EP9A 5A32B 1O7FA 3WW2A 1LNSA 2OW4A 4RHV3 4CDQA 2WIIB 2KM2A 5IVJA 2QBXA 1GSLA 4ES9A 2VECA 4GH4C 2WZ8A 2OIIA 4C91A 1BBT3 4CU6A 2C0ZA 2IVIB 4QHBA 3RZGA 1UIJA 5FYMA 3CZJA 4ATEA 4P9XA 3ZN6B 3U78A 3T0BA 1NE6A 1UWWA 2F4LA 4COYA 5J37A 3NJXA 4FPLA 2YHJA 3V65A 1IS3A 4HPKA 2K2SA 3N9PA 1UKRA 1EAH1 2AGSA 4Q4V3 3SH3A 4J6GA 4IGPA 4LT5A 5BV6A 3LIHA 4NHLA 4NAOA 3OBAA 4YG0A 3UKVA 1J3QA 4N90A 1XQNA 1HQNA 4ISQA 5J48A 3D0SA 5C5TA 4L11A 4QXCA 1V9U2 4CEWB 3CBNA 1QJEA 4MYEA 5F8PA 2P3YA 2A73B 4XMAA 4NN0A 2LROA 5IYYA 1ZREA 4AK3A 1SEFA 5C4WA 2ZMKA 3N9OA 3ZXFA 1ZBA3 1EPZA 4HKWA 4CDWA 1AR71 2RM23 3R6SA 1VAVA 4META 3RZHA 1CJPA 2C6SA 1RUF3 1S2KA 1OA3A 1SLBA 3CL1A 3GDBA 4HANA 5JMOA 1HRV3 4K1ZA 2R32A 2OPKA 2FDGA 2VW2A 2BBVA 1TME1 1STMA 4FPGA 2CU5A 5E89A 2WZPP 5T50A 3MV01 5LY1A 5GZCA 1UAIA 4V2VA 5D21A 1LOFA 3GHNA 5DZFA 4MGQA 1OUXA 5CYYA 3MF6A 1VMHA 4BWOA 3ZYIB 3I2JA 4BXFA 1US3A 1QXJA 4C0HA 3ACFA 2ZHNA 4AGGA 3K75B 5AVAA 1UYZA 4LO6B 1PZ8A 4Y33A 2XOMA 4AEDA 5JVVA 2QQPA 2A6ZA 3OPZA 3VDCA 5I0RA 1ZA4A 3GZUC 3Q9OA 5A3NA 1LAJA 4PF1A 1RUI3 5F2SA 3L2HA 3RWNA 3UNPA 1GANA 3L2YA 1W6NB 1XXNA 2WBKA 1IGOA 1YWKA 5EZWA 5F5QA 5C6CA 2VTXJ 4H55A 1RMU3 4XETA 4LHKA 2B7YA 4Z92B 1ACCA 2AEZA 2RS13 1XNTA 2I45A 3BIWE 1FYUA 3FZ3A 3I2KA 4IE0A 4OZOA 2ZEYA 4RGAA 1RUG3 3IDEA 1ZZ7A 4ZZ8A 2GAUA 4PDWB 5HPOA 1GP6A 2JICA 1R1A2 2WR9A 4XZPA 3VBFC 2DBNA 4XHBA 2YU2A 5F5CA 2VZ3A 3WZ1A 1ND2C 2D98A 3E6DA 4QHZA 2O14A 4XXAA 4DINB 4WVMA 4BHPA 3AYAA 3LB9A 4E4SA 3CQOA 1QHDA 2VMIA 2RS32 4U2AA 5FY8A 4YW1A 2C5DA 1ZRFA 2XWBB 3I97A 3KCXA 5L36A 2D6LX 5EJ1B 1AR82 1H9PA 1T2XA 4QWNA 3T2PA 1OFNA 2FQPA 4XXPA 4XFAA 4QX0A 2TUNA 2PA7A 2RMU2 5CKQA 2LALA 5CNAA 3BKZA 4RQPA 5FZ8A 1X9TA 2HWE2 2WA4A 3IAPA 2D5FA 2BEOA 3KB5A 2IXHA 1W8UA 3OBRA 5DG2A 5FMOL 2KD7A 3ZYPA 2AZ5A 1OLMA 2JX9A 1HXS2 4Q4X2 5A1AA 2XMLA 4N53A 2VCAA 5FZAA 3DKWA 2BGOA 3RI8A 4KBZA 1REFA 2K0GA 4LIUA 1J3RA 1POV3 3C7HA 2VH9A 1OLQA 4PQQA 5FZFA 3VBHC 1GOFA 3WDTA 5C8CB 5IVBA 2FD8A 1LULA 4ZXEA 4ZU4A 1CQ9A 4AHXA 1MVEA 1QDCA 1ULCA 2WNUA 1BCXA 3KV4A 4FAHA 4EN0A 1H8VA 1OHFA 2EICA 1TMF1 2A6YA 2WWUA 3HNYM 2WDBA 4Q29A 4QQPA 5FY1A 3I8TA 3K48A 1R082 2BOIA 4A3XA 3RMYA 3E5QA 3WUCA 1MS4A 4CCOA 4E2GA 3AKSA 4RR3B 2A7AA 3M4FA 3M8LA 1QOOA 2PHWA 1O4TA 2ZS6B 4Q8LA 3W21A 3GJAA 1W9TA 2RS52 4JGZB 2QUOA 3HT2A 5H9RA 1N3PA 1VLNA 4FPKA 4UYBA 5DZEA 4LHNA 3ZX7A 1J83A 4CDXC 3M2MA 4LKFA 4OHWA 1YRZA 1MS3A 1C8M2 3GBFA 1MS9A 2E9QA 3ACLA 5GLZA 3LA2A 1F9KA 3ZFFA 1LHNA 1WLWA 1H1IA 5GZEA 1UYYA 3B3QE 2P2KA 2ZGOA 4O9GA 4HBNA 1HN1A 4E2SA 4R52A 4UOJA 3C7FA 1KXGA 1DYOA 4GB32 4QKNA 4QPGB 2XKOA 1PMIA 4YFWA 2VMDA 2D6PA 4Q4W3 2PMWB 4JKKA 3JBG2 4YGCA 5K0UC 3EJKA 5FXVA 2XJVA 1QWRA 2ZJCA 3JD71 4EE2A 4XC9A 1WLTA 4L92A 5EPAA 1WUVA 1OXCA 2ZAHA 3E1F1 1H8TB 3MPPG 2E7AA 4NUBA 1GWKA 1K45A 2AC1A 3BN6A 3GJBA 2VZPA 4MXWA 1BHGA 3D3AA 2DCYA 3HVDA 2B9VA 3DGTA 2CYFA 2JDMA 3FBMA 3T30A 3WNNA 4FTSA 3OD0A 4YVSC 1W90A 3IMMA 5A3WA 1JZ2A 3C7EA 4XABA 5GLTA 4XHXA 1G9CA 4CSWA 2DVFA 5CZKA 2VOVA 2PQQA 1QNWA 5FP4A 5LA0A 2R062 3VL9A 5CFDB 4YW6A 1YEWA 3VBUA 1KITA 2ZX3A 3POSA 3MICA 1Q3EA 1ZBE1 3KHBA 4CDQB 1DF0A 5FR3A 2D40A 1VRH1 2XJTA 5FOJB 1YJLA 5FV3A 5E8AA 3OBTA 3TNPB 1GZTA 3POIA 4F8AA 5FZLA 4XAEA 1U5ZA 3FLTA 4UF0A 1AYN1 2ADEA 2YC2A 2BQPA 1V9U3 1S0FA 4HXCA 1SZBA 2A3YA 3RZZA 5IAVA 1ZNPA 3IIIA 4PHZA 4HPKB 4I0BA 2JDKA 5FPLA 2V5DA 1S55A 5HV0A 3GM8A 2VJXA 2RJKA 2GN7A 3BU0A 1S2BA 1JODA 1PMHX 1UXZA 1W6MA 2FCVA 3JQWA 2Y6HA 4XVHA 4AZZA 4IE6A 4B1MA 4QKBA 1FPN2 5SV5A 1O3TA 1WMEA 5A1LA 1KRIA 2VVFA 1H1AA 2DF7A 4YWAA 1X50A 1W8TA 1OBNA 2ZX0A 3PLQA 3H3UA 1UOFA 4IEPA 3WNOA 5ACA1 3VHPA 4DXZA 5E1RA 2UY9A 5FYCA 2J1VA 2JB4A 1NXMA 4XCBA 3DV8A 2DVBA 1V00A 2RHPA 2R071 1HB3A 2JECA 3WUDA 4E2QA 1JHNA 1FOD1 1U12A 1XE7A 4LULA 1JYVA 2WO2A 3WR0A 1LU2A 2JB8A 1SLLA 2WNEA 2GC0A 4P5HA 1GZCA 3VKOA 1D4M2 4UAPA 3W20A 5CG9A 4Q4Y1 3PJYA 3O1SA 4ZPIA 3VHNA 5KHKA 4AEDB 2ES3A 1R1A3 2UYAA 3B94A 2VZVA 1DGRA 2QDNA 3MHZA 4YPJA 3WOGA 1UXXX 3FWEA 1GWLA 4ZU7A 3QH6A 4HN1A 1FNZA 2DWRA 3SHRA 5EXOA 1YHFA 2BRTA 1CGPA 2RS33 1LOEA 3B01A 2UWBA 4PJYA 5FO9B 1I5ZA 1JW6A 4BK5A 4EN7B 2OX0A 1GZ9A 3ZFEA 4D7YA 1AR83 1RL3A 1W9YA 3ZDVA 4FTEA 1DDLA 4FSJA 4OVEA 4OQ9A 1MZEA 2LS6A 4BLJA 2RMU3 4P9JA 5FZ6A 5LEJA 1ULGA 4WVMB 3UGHA 2HWE3 4XF9A 4XFIA 4CPBA 3ZSMA 3VBFA 1Z7S1 4R9CA 3BODA 2A6WA 3H7JA 1O59A 4Q4X3 3BGAA 1HXS3 4XDOA 1TNRA 5FZBA 3TEYA 3MIFA 3WQ1A 4AI1A 3H9AA 4DXTA 1RUH2 1V70A 1IPKA 2XGXA 3J7MA 4IERA 4RQPB 5D1IA 4CP1A 4FO9A 4S2GA 4FPFA 3MI8A 4IESA 4AI9A 1OD5A 1PVC1 2P1BA 1L3JA 3ZSEA 3UKNA 4AR2A 4N53B 4IEZA 2NMNA 3TNQA 3A4UA 1R083 4UBGA 5IUQA 5KXEA 1HV0A 1SBFA 2P6HA 1PIV2 2A71A 1FXZA 2BGCA 1LGNA 1XNDA 2VO5A 2W87A 4M0HA 4MV2A 2XLFA 3ME2A 5KBFA 2EALA 2RS53 2WNUB 4HSJA 2VL4A 1X82A 2XBO1 3M3OA 2XH6A 2ZTNA 4Y1YA 3VV1A 3VHOA 1GNYA 1R64A 4QQHA 4ZONA 4MGIE 3SEEA 1PM7A 3NRUA 1O5LA 3PUQA 3QH7A 5FZ3A 1G9FA 3HOBA 5JXJA 2ARAA 2JDHA 3SH4A 2Z42A 4AI8A 1E57A 2LTNA 4EWEA 4JDOA 1W2OA 4PBOA 1UZWA 4GB33 2B45X 4ES8A 4KBBA 5FTTC 2B46X 4UI9L 5A33A 1GKBA 1MS1A 1XNCA 2HWD1 3JBG3 1ULOA 2NQYA 2VZUA 4PCRA 2HEYF 4HOOA 4XF1A 1YC61 5FZOA 3RYPA 4AVSA 5GKAC 3HQXA 3D4KA 5BNPC 4XBQA 1QY4A 1FMD1 3TOJA 1UZ0A 2VNOA 1DZTA 4W4ZA 5FCCA 2KXLA 1OUSA 4OI1A 3CIHA 1WW6A 2VD7A 3POEA 4AEJA 5C33A 2B8MA 3QLQA 1VPHA 4L9BA 4CP2A 3A21A 5DUVA 5T52A 1NQJA 5T55A 2YZ4A 2R063 4GULA 1EUUA 1OVPA 3THDA 4HG6B 2YBSA 3N9QA 4B4RA 4BU2A 2DURA 1TNFA 1ZZ6A 3H1MA 1OQDA 3IN9A 2QCSB 2X5IC 5LW9A 1IZ3A 2XL7A 4LTAA 1QXPA 1ZRRA 4KWKA 4LKEA 2Y33A 3OGVA 3NV4A 3J8F1 4KU7A 3VBUB 3O0WA 5LA9A 1MVQA 5A7SA 1ENRA 1PO12 1XSRA 1VP6A 2C24A 4N7UA 2V4AA 1GWMA 4XUOA 5D8AC 1QJX2 2HWB1 3ZYFA 4CRQA 5C5UA 3SC7X 3CNAA 5KC5A 1OKQA 4OLLA 1DYPA 3FLRA 3ZDSA 5EIYB 3AL5A 4IEWA 5LB6A 1DU3D 3N9MA 1GNHA 1JYCA 4ARYA 5T5JA 4GH4B 1CD3G 4IV3C 1NZCA 1H1MA 2PXJA 4YARA 5EYXA 2VC9A 3SXWA 4YGBA 1W0NA 1AR91 4LE3A 4P9IA 4XDPA 1HRI2 5F3CA 2YXSA 2LM3A 4Q27A 1XYPA 5JZGA 1IS5A 5FYZA 1YFYA 1W6MB 2BNMA 4YM2A 1AJOA 4CCMA 5HBAA 3VKMA 2ZX2A 4BYYA 3ZYRA 1QH7A 2YC4A 4RGGA 4YG6A 3D82A 4MXVA 4DY3A 1UYXA 3VZJA 4KWLA 1VBB1 2SBAA 1Y7BA 1GP5A 1J3PA 3WDWA 4FTBA 1D4M3 3NMBA 3N35A 2QJVA 3LKJA 4FXGB 4LHLA 2EA7A 3EQEA 3NJVA 3VZKA 4LUKA 1BEV1 2D43A 3NNMA 3VB9A 5C4WC 4CDWC 2VCMA 3NJYA 2XDVA 3LIGA 2WAAA 1QXRA 1ZZCA 1MZFA 2GMMA 3I3EA 4GALA 4HFSA 2XVKA 3LEGA 1UOJA 1Q43A 5J98B 3MUY1 1LOGA 2GC2A 5FLJA 2BTVC 2V09A 3MW4A 4IV1A 1L7RA 4XURA 4A7KA 5JCTA 1W8FA 4NIIA 2KR2A 5KC6A 3VUOA 4KWJA 4LBMA 1LECA 2UU8A 4YM3A 1YFWA 4QHOA 3J7LA 4LITA 1LHUA 3JXSA 3DYOA 3N9NA 4FI9A 4P02B 3N4MA 2BPA2 1UOBA 2R041 5F2WA 4Y5TA 2VUDA 2OS2A 3B69A 2WZR2 4CCCA 3P3NA 2QQIA 1S0BA 2JENA 1ZRCA 2BU9A 5L19A 4J1WA 3RZJA 3N7LA 3M3QA 2X53S 3BALA 3ENRA 2DVDA 2QQKA 1ST8A 1XJAA 4HZFA 2OPWA 4ITCA 1OD3A 1SBEA 4DPNA 5K7PA 1RUH3 1G7YA 1JZ6A 1JU3A 1PGW1 5DPNA 1W8NA 3VL8A 1RUC2 4NJ4A 1IS4A 2WQ4A 1EY2A 4DXSA 3VBFB 4UFMA 4XFBA 2I2SA 3WP5A 4AVAA 4NRMA 3NV3A 2NN8A 1ND2B 3AMMA 1RC6A 3ACGA 1SG3A 1HKDA 3AXDA 3PMSA 3VDAA 1QGLA 4XUTA 2PAEA 1PIV3 5BPXA 4Q4V1 4GJYA 4V2WA 5FREA 4AG4A 2CNAA 2GP3A 2WFPA 1ZZ9A 4DRRA 3UV9A 1OI6A 3MIEA 1JU4A 4F83A 3ETPA 2OVUA 4BQ5A 3ZM8A 4PI2A 4ZZ5A 1W2UA 3UL2A 1U5YA 5L9BA 3BTYA 3V0BB 4BPZA 3AVRA 1MEC1 5F3IA 4AL9A 3QCWA 4AEMA 1QJU1 1GU3A 5C71A 1ZBA1 1VAKA 3FHAA 5LK5A 1S4CA 2FZ1A 2BWAA 1A34A 5CB7A 1J58A 2WYFA 3T2QA 3WCRA 2VUCA 1XNKA 4ISRA 4CU9A 3VBHB 4JGYC 5CU1A 1C57A 2CGNA 4P5YA 3S0MA 4AHWA 5C3SA 5B4XA 3OCPA 2WAOA 4W8JA 4ZXKA 3LOBA 1F31A 5FZIA 1RUE1 1WD4A 5FY5A 4EN6B 2J1EA 3UJOA 3BI3A 2VY0A 3I3MA 4LO8A 4GWIA 3B02A 4O61A 1I9RA 2PAMA 2PHFA 3TRSB 5A33B 4OHYA 1W04A 3VKNA 2W52A 3RGBA 4COVA 4RN5A 3PL0A 4JDNA 4LJHA 3H8OA 4CU7A 3LEIA 3AZXA 4CDXB 4FAGA 2BFUL 3C7OA 2DFCA 3EB7A 3NV2A 4W6WA 2GALA 4E8DA 3ZFFC 1RUG1 1SPPA 3GALA 3TN92 3K46A 1UY3A 4K1YA 4OMCA 3FJSA 4AI3A 5BNPA 5ABJA 5T3NA 2A5ZA 3V56A 5A1FA 4V1PA 4YVWC 5CA6A 4IL7A 4N43C 4QXHA 2EAKA 3AP9A 4XJAA 2DDUA 2N7GA 4XQ4A 4Z2WA 4L97A 3KV9A 5L9VA 1VBA1 2RE9A 3AZZA 3N7JA 1PO13 3Q8AA 1RUJ1 5K0UB 4LBQD 3VZOA 2XPJA 1QJX3 3T0DA 2PYTA 4AHZA 1RUOA 1RHI1 2EIBA 1RJ8A 2JXAA 3PIJA 3ZXGA 4CXWA 1JYNA 1POQA 3LAGA 2LUWA 4ZHNA 2JDNA 1ZZBA 2V73A 2L9LA 2D7FA 1WBFA 2E26A 3KT4A 4A41A 4YVSB 4H7LA 2IFWA 3EHKA 1N3QA 2BNNA 4HK8A 3PUHA 2GMPA 2X5IA 3U10A 1J59A 5IJRA 3POYA 2YGLA 4H3WA 5ANNA 3ST7A 1PZ9A 3WSOA 1J1TA 4A6OA 1BVP1 2UY8A 5KXDA 3PVBB 1HRI3 4CZSA 1PX3A 3APBA 2D5HA 2ARBA 4QX8A 1WLCA 1DGRN 5D8AA 1C1FA 2VZTA 4Y22A 4JX0A 4GMP3 2J1RA 1Y9MA 1EAH2 3BOPA 3PVOA 2VG9A 3LEKA 4COZA 4XW3A 5IK4A 2FDIA 3LF7A 5BNOC 2GMEA 2ZCWA 4DXRA 5FDBA 5JXHA 2DCJA 4FCAA 4AYUA 1JYIA 1PNFA 4IV3A 4LA3A 3USUA 1U0AA 2H0VA 1PX4A 2HEVF 2RVAA 1W8ZA 2Y6KA 2ORXA 3AZWA 5FK8A 3OG2A 1IG0A 2VNRA 4QXBA 5AVPA 1JN2P 4Q5OA 3K3NA 2FDJA 5EWSA 3LDRA 1VALA 3THTA 3WNKA 4ATFA 5A3LA 1US2A 2OQ7A 1NLSA 2G4IA 2PLV2 1MR5A 3KQ4B 2W2IA 3AYEA 1BLZA 1AX0A 1D0HA 1G86A 1WD3A 1EV11 4UWDA 1U5XA 5FFOC 1TME2 3ZYJB 3WEZA 4Y20A 2BERA 1O3RA 4AVVA 2W95A 1E5HA 4B4PA 1H30A 4QDSA 3ZKUA 1SCSA 4JCKA 2DVAA 3IM0A 3IIAA 5C3QA 1UU5A 2ZZJA 2ZGQA 2JKXA 2NPIA 4LO7A 1CAXA 3R4SA 4IE7A 4XZUG 5T5PA 2EXIA 4MGYE 3DYPA 1AL23 1GP4A 5HXMA 1C1LA 1Q8VA 1YFUA 2VR4A 4HVRA 5IVVA 1V6JA 1DQ4A 4OUSA 1QU0A 5FMBA 4CCJA 2B5HA 2Z4FA 4XDQA 3WG2A 4K40A 1HQLA 2GZWA 1KS4A 2J42A 1GR3A 2WO3A 3WG1A 2HBTA 3MIGA 3R05A 2WN2A 3BOWA 1AR62 1WCQA 2W1WA 3OGRA 4GKXA 2ZX1A 5FQ0B 5FYYA 1YQ2A 1G9DA 5FZ7A 4RYDA 2Y6LA 4K9SA 5J7MA 3FMGA 4SBVA 2VCBA 3AYDA 2WQ8A 4FOWA 4YGEA 5JPMB 4H2AA 5FPVA 4OUEA 4I09A 4TYSA 3ZFEC 1E5IA 5FY0A 4W6YA 1RUD2 4A3ZA 2GC3A 1KFUL 3ETQA 1ZA7A 1A6CA 4BIOA 4WM8A 2WN3A 3IZOA 4IGQA 3O1OA 2PAKA 5FMCA 1HW5A 3IKWA 4LHSA 1GV9A 2ZGUA 5K8SA 3POJA 3VKFC 1NXD1 4J25A 1YO8A 2JEMA 1FNYA 3HWJA 4K20A 3NSTA 4LKDA 3IDCB 3J9SA 4CCEA 2P37A 1X36A 2DTYA 1BXHA 2HWC1 3N9LA 1NAEA 3NNGA 3PNAA 2Q8OA 3T09A 4AI2A 3O1MA 5CG8A 2IXKA 2ATFA 3AB0A 2QFEA 1IQAA 4FOVA 3TBDA 3K2OA 2XQXA 3TEZA 2LRPA 3N7KA 3GZEA 2E51A 5BYNA 4KNCA 3RZMA 5E88A 4LBKA 4ARXA 4NWWA 4HL0A 4E4HA 4E27A 3K51A 3WQ0A 2ZGTA 3KF5A 4OHZA 1HB2A 3RJ2X 3KMHA 4YGDA 1YCIA 2OUHA 2VBPA 4CTEA 4CUGA 4QX5A 3X29B 1OURA 4AFMA 3RSJA 2WQZC 2RR11 4JAAA 4RS5C 4BQWA 2VW1A 4YW5A 3N36A 3MLKA 4TZDA 3EYPA 4LR4A 3ZYHA 1OF3A 1YXWA 2WFF1 2CWMA 4Q8KA 3UT0A 4BIFA 5J96B 1LR5A 1DQ2A 1SDWA 2AR6A 2W3JA 4IEUA 2XUMA 5IATA 3R4UA 2VZSA 3ZXAC 3MLLA 3MGUA 3C7GA 2ET7A 3U75A 4JGYA 4BB3A 1ODNA 2RJLA 2VNVA 3NVCA 1QQP1 1UF2C 2BJSA 2X8KA 2YPJA 1A8DA 5FYTA 3TN93 2EIGA 2W1SA 3USSA 4KWUA 4FP3A 4NPLA 2ZGKA 5F5IA 5BY5A 5JAXA 3P1IA 5G04L 3MIBA 1COV2 3MIHA 1WW5A 2X10A 3AK0A 3WP6A 2RDNA 2XJQA 3D6EA 1RUNA 1FV2A 1PGL1 2C4XA 1UZYA 3OGJA 1DYKA 4JHZA 4OYUA 5A6YA 1TQ5A 1QJZA 3KVBA 1SPPB 2W94A 1RVF2 3GNEA 1LHVA 2YYOA 4BQ4A 5BNPB 3JD72 5ABJB 4EV0A 5LK7B 3M7AA 3WF2A 5I8YA 2C9AA 2RMU1 4A4AA 3O1TA 4FFFA 2QQVA 3MEPA 3B00A 4X8PA 3I54A 1KFXL 5FUNA 1H2NA 5FJKA 1LEMA 3SNMA 5AFEA 3U4XA 2RDRA 4J1XA 1T6BX 2AH2A 2CWSA 3LQCA 4XACA 4LXLA 5K4LA 4COWA 1WCDJ 4LMFA 4YVWA 4S2FA 4N43A 4QKDA 5LA2A 4XUQA 1SBDA 2ZGPA 2E6VA 5DUXA 4BMBA 1NCQC 4LA2A 1I6XA 1K5MC 1SLTA 2D3RA 3WDYA 5JWPA 1OLRA 5HCHA 1Q5OA 1CONA 1V0AA 1LCLA 3RRDA 4BQYA 4FOQA 1ZBE2 1DP0A 4LE4A 4R4ZA 5EV7A 2CL2A 2D6MA 1VRH2 4A6SA 2X5IB 1EAH3 3WW3A 1NX9A 2XKPA 4D3WA 3AP4A 2VVEA 4LK7A 3KLSA 1C5HA 1AXKA 1CX1A 1KEXA 4N9IA 1W8OA 3I2GA 4OCTA 1WW4A 2WUHA 3DXUA 2ZEWA 1W8WA 3FC0A 4XF4A 5FZ9A 1AYN2 5LCWL 3NO8A 5D8AB 1C8NA 5HI0A 5LATA 3ACHA 3OY8A 1H6XA 2XJPA 4FFHA 2BYVE 1LENA 5FPAA 4PBPA 4XTMA 4PLNA 1F2NA 3P3PA 4JRAA 1QJY1 5F1RA 1OPMA 1UZVA 4BZ4A 1H2LA 3VDDC 2PLV3 3URFA 4ZKTB 2ZMNA 4IV3B 3USUB 2VXRA 1WCKA 2CY6A 5FP7A 4QGNA 1TME3 2D6NA 4P9LA 5JUVA 1V6LA 5BNOA 4GB31 5GLVA 2NMOA 1HDKA 3FUOA 4Q0UA 2GNMA 5JZGC 2MNGA 5ACA2 3W59A 4Z8BA 4NIGA 3EMRA 1N47A 1N1VA 3O5SA 5FP3A 1JYXA 3WF3A 5C3PA 4MX3A 2GH8A 4NVPA 1TEIA 3VDBA 1FOD2 1JS9A 2ZKNA 3OOXA 4JTNA 4FPOB 4INDA 1DZRA 4O65A 2XXZA 3WF0A 2GNBA 1DLLA 3NQHA 1GOGA 4I01A 5CFCC 4XOGA 3WY6A 4QGMA 1KJRA 5C4WB 1AR63 5FO7B 3LSEA 3PU3A 3ZOIA 2E31A 3FUQA 4IXLA 1CAXB 4LKSA 4Q4Y2 2JE7A 2P3JA 4CDWB 4HVOA 3MPBA 1LJ7A 4KI5M 3RZKA 3A22A 2IC1A 4P9GA 4XJZA 5AC91 4K7JA 4NPMA 4YZ1A 4EJRA 4YW2A 1F8VA 2Y0IA 1UKGA 4M4PA 4D8MA 2VUJA 4IV1C 5GZGA 4OFGA 1KS5A 3E5XA 2G9GA 1W9FA 1RUD3 5DQ0A 3AFGA 1YUDA 4ZY9A 1QH6A 1UCXA 2BUKA 4ET7A 5I8SA 2JE8A 2ZEXA 2VTXA 1UX7A 1W3XA 1IG3A 2A6VA 3BU7A 1WW7A 2ENRA 4MHRA 3VGIA 4DUVA 3HNMA 5JDBA 2ZOEB 1JYWA 1Z7S2 1CAWA 4LUMA 2O1QA 5EYYA 4EZ4A 4A45A 3OUJA 3ES1A 3MW2A 2CAVA 4EN9B 5I91A 1OKOA 3ON7A 4QKFA 2WA3A 2RJ2A 4K8RB 2VQAA 1ULPA 3HBZA 5C7GA 4AAPA 4CCDA 2A1XA 2WS91 2W68A 2O8OA 3LPFA 4HT1T 4I0AA 4XFGA 3ZMOA 1F35A 5A3UA 2TBVA 4YRDA 1W2AX 1PVC2 2QQLA 2P5BA 4HKLA 5FYSA 1JOPA 1W6QA 3I2FA 3OB8A 2HBUA 2Q4SA 4AW7A 4GIQA 3AFKA 3RYRA 1QIQA 3DL3A 4GWNA 1FV3A 3SKJE 3Q8FA 1OOPC 4JVAA 1ENXA 1QKQA 4P00B 4XFFA 4LLFA 5EJZB 4XJUA 2DFBA 2DTWA 1LOCA 4DY5A 2XBO2 3ZXLA 1L7LA 1D4M1 3AP5A 2JG8A 3MIDA 1WBLA 3HEIA 2BNOA 3U37A 1X8MA 2YV8A 4KU8A 3AKRA 5TSWA 1VBC1 2VMFA 3HNBM 1JUIA 2F6BA 1COV3 1CZVA 1XNAA 2WNVA 3BVCA 1JMUB 1XYOA 3AZYA 3FE5A 4YZ3A 4JKLA 4RS5A 2YDEA 4JGYB 1L7QA 4PIZA 4AFCA 3O1VA 5FXWA 4Z07A 1JZ5A 4HVQA 1VMJA 2P6CA 3I2OA 3AP6A 3HQUA 4QX3A 4BK4A 2P3KA 1RVF3 3A7QA 2HWD2 4IUGA 5IVEA 4QPWA 5HXVA 2NYYA 3JD73 2DU0A 2RDSA 1OVSA 3DYMA 1HX6A 2G1MA 3PU8A 3WCSA 1MQTA 1C8M3 3ATGA 1SHWB 5A7NA 1FMD2 5IW0A 3SEPA 3J4UH 2P3IA 2XHNA 3HIFA 3JUUA 3WDXA 2IFRA 1XYNA 4WVWA 3LEMA 1ZRDA 1EUTA 2VCCA 3CZUA 4MGSA 5IVYA 1OSGA 2JE9A 3VBOC 4AI0A 2VMGA 3HR9A 1PO21 1W06A 4WM7C 4CP9A 2VPVA 3WW4A 3WHUA 2ZA9A 3NAPC 1X8EA 3LWCA 2JIJA 5FPUA 5J36A 3ZFFB 2YROA 3DECA 3GBGA 1UMZA 2R6QA 1NCRC 3G7DA 3GZTB 3K4DA 4JC1A 4LBQA 4WZCA 4Y24A 5CVRA 5A7OA 4OI2A 1ZBE3 3LSDA 5ABJC 4Z1VA 1VRH3 1BMV1 5IVCA 4YVWB 2J1UA 3KHCA 4N43B 4Q2FA 5JI7A 2D44A 4FFGA 5FP9A 2W91A 3U14A 3MDPA 1WZXA 2Y64A 3TWIA 3O1PA 4JTOA 4MLOA 3ZXEA 2VZRA 3GF6A 1M4WA 1AYM1 3PHMA 2FBEA
chains in the Genus database with same CATH topology
1NY71 1UU4A 4JDMA 1D2SA 1SQ4A 1MACA 1NCQA 2HWB2 1K5MA 2PHTA 4MXWB 1XE8A 4UBHA 4LBNA 3AKQA 4M3CF 2Q30A 2QVSB 2E63A 4B8EA 4RSUA 2Z69A 4LEJA 4LBJA 4G3YC 2NP0A 3JU9A 4QPIA 1LTEA 4C1XA 5FO8B 1KD7A 1VBD1 2GH2A 1DQ6A 3OY8B 2IXCA 1UL9A 1F5FA 1RIRA 2K9ZA 1AR92 2QE3A 2R0HA 5ACA3 1WLDA 1LESA 1G9AA 4Z82A 4I0WB 4D94A 2XLAA 4G9SB 1ZM1A 1FOD3 5GM0A 5BNOB 4WBBA 3VDDA 1FPN3 2Y38A 4TWTA 2ZMLA 1H4HA 2VW0A 4Y5Z0 5C8WA 2HYKA 4BA6A 3WXPA 1ONAA 2A70A 1DFQA 2I74A 4Q4Y3 4NPRA 1VB4A 2ZZQA 3LZZA 5F6LB 4L2NA 3FFQA 5JSOA 5C9AA 4M3CE 3OD4A 1X33A 3S7IA 1I3HA 1XNBA 5I0UA 1Q56A 1JOJA 4JRLA 4R9BA 4MGZE 1YI9A 1O3SA 1GICA 5FLIA 3VHRA 3ZXDA 5CFCA 3AKPA 1J1LA 1CR7A 1DQ0A 3BB6A 3MF9A 1VBE2 3IWZA 4NHKA 3CJIC 2R042 4I02A 1Z7S3 2R49A 3ZXJA 4B7EA 2AYHA 3BCWA 3ZN6A 3AJYA 3QBQA 2VULA 3H0OA 1PHMA 4XJWA 1BQPA 1Y43B 1PZ7A 4G4FA 4DMIA 1CPMA 3PVNA 2X29A 1JTZX 5JIUA 1R092 3M3EA 4KQ7A 3ROUA 4A7ZA 4B29A 3C2UA 1PVC3 1CAWB 4S2DA 2OZ6A 2FMYA 5DDJ2 2EAAA 4YM1A 1UD1A 4LBOA 3ZFEB 3KT7A 3PTYA 4RHV1 4PIYA 2FHRA 5JPNB 1DHKB 3WG4A 4C0BA 4WM8C 3LCPA 4BOWA 3WDVA 4YZ5A 4YM0A 1W6QB 1BBT1 1HQWA 3O0XA 1Q8PA 2R1BA 1ENQA 2QZ2A 4KGQA 1S0IA 2JJ6A 1NG0A 1S1AA 1MEC2 2MHFA 1QJU2 3M70A 4QQOA 4L99A 5FDBA 2ZGMA 3ZYGA 4K21A 3DPRC 1NE4A 3OJBA 1OOPA 5L73A 4L8QA 1POV0 4AFBA 1M06G 2E7TA 2HWD3 3MFCA 1U5IA 2WJSA 4B3NA 2VOWA 1W6NA 4E4DX 1RUE2 2Q0AA 1TE1B 4RS5B 4LO5B 4IEQA 1FMD3 4XFCA 3I59A 5IK5A 2ZGSA 4DNYA 3T1MA 3WVJA 2RM21 4PDWA 5F9TA 1H2KA 1RB8G 1AL21 4NR1A 4UW5A 1RUF1 2HWF2 2JDZA 1FAYA 1LODA 1HRV1 2DYCA 2WT0A 2OZJA 5H9SA 1A78A 2AUYA 5GZDA 4BH9A 4I2OA 3GHMA 1B09A 4X6RB 4CDUC 1REEA 1O5UA 5FOBB 1RUG2 4CEYC 4EWAA 1HIXA 4C90A 3VZNA 2UWCA 3IMNA 2ERFA 3V64A 5AFBA 3E6BA 5GJ6A 4Y26A 4YYOA 1RUI1 1UN1A 1DGLA 3WW1A 1RMU1 4LBQB 1VBA2 3VBOA 3VKLA 2RS11 1FI2A 1IOAA 1RUJ2 4WM7A 1CVNA 3O14A 1MS0A 2HWB3 3NAPA 3WV6A 1OFSA 4OI0A 1RHI2 1NCRA 4S2HA 2ETEA 3R0RA 3VBSC 1KQRA 3AMPA 3WT3A 5L7OC 4K8FA 4WZFA 4AVBA 1WMDA 1RITA 5CADA 2Z2SB 3ZPYA 3FBYA 4X6QB 3WHTA 1NCQB 4AGRA 5I93A 1K5MB 2BWCA 1AR93 5GLUA 5HCAA 5JOWA 4RR3A 4ASLA 1CN1A 1ASJ2 4Q0QA 2MEV2 1CX4A 3S6PA 4GKYA 4H7MA 4FQ4A 2CTVA 4HSLA 2QZ3A 3UKTA 1A8MA 1C4RA 1EPWA 5JOXA 1OQEA 4YZ2A 4W6XA 4JV4A 3RMXA 5BNNC 3H7YA 3JB4C 1POV1 3EBRA 2WINB 4O9EA 3WQ7A 1Q8QA 3ASIA 4I3GA 2EVXA 3POWA 2SLIA 1WGPA 5FMOS 3H1YA 4UXAA 3SMHA 3KCCA 3VDDB 3ZIXA 4AHYA 3M3CA 1JUHA 2C1FA 2OA2A 3KS7A 1AF9A 5JOZA 3OYWA 4AFDA 1EV12 4OUMA 1PK6C 3A0KA 5JZGB 3KM5A 4NOTA 4XILA 2CGPA 2OUJA 1ZZ8A 1VBE3 1C28A 4WVVA 4YLZA 1LKNA 2Z5WA 3NL1A 2R043 5KWRA 4W65A 5K9YA 3ZMNA 1AR72 2JG9C 1AXZA 3ZSLA 4GA9A 4QD2A 5CFDA 3DN7A 2IZWA 2Q1MA 3WD5A 2PHDA 4ASMB 4AXOA 5CFCB 1REDA 5JR7B 5EJ3A 4Q26A 2UWAA 2GSYA 1GZWA 1R093 3ZN5A 5SV8A 4Q4W1 2YY1A 4JQRA 2PTMA 5DDJ3 3LOIA 2WZR3 5GALA 4R9DA 4IV1B 3CJIA 1NOVA 2EXJA 2VOKA 4P9YA 2NM1A 1RUC3 3BPZA 4QPYA 5FBZA 1ULDA 1S0DA 4QM8A 3ZXKA 2R0FA 1MEC3 4FPYA 4GQ7A 4XF0A 1QJU3 1D0GA 3NKTA 3CEWA 4M00A 2HWC2 2GN3A 1NLRA 3INAA 3ZVXA 2PLV1 1AX1A 4FT8A 4OHXA 1AXYA 3LGRA 1V9U1 1MZ6A 3U0ZA 1RUE3 4QT6A 4D7SA 3IPVA 2DVGA 1OOPB 2RR12 2XHKA 1YNAA 3A0NA 3H1WA 1X7NA 2WFF2 2HWF3 3PVEA 5LRRA 5JOYA 3WDUA 2NLRA 3ECQA 1CAUA 4MSVA 4KG0A 2W0XA 3DPRA 3DUIA 3AX4A 1SACA 2JG8C 5IK8A 1AR61 3I59B 1QQP2 2NZ9A 3NV1A 3WP4A 1QNYA 2HEWF 4HLTA 4Y4YA 3ZFGC 2WNVC 3H3ZA 1W39A 3QOPA 4FPJA 3ZSKA 4EROA 1TMF2 1NYWA 2I07B 1OA2A 2Q1ZB 5DZGA 2Y26A 4Y1UA 1BZWA 1LB2A 4CYDA 4XPVA 2H6CA 2XG3A 4MH0E 3MW3A 1PGL2 4R9AA 1DG6A 4FOYA 2IXLA 4HN0A 2TNFA 3VBRA 1VBA3 2ZGNA 4HK9A 1RUJ3 1RUD1 1ND3C 1SLIA 1UW8A 1ULEA 2CV6A 1MQTC 2IXIA 2FZ2A 3CU7A 4OZXA 1GNZA 1RHI3 2PFWA 2YMZA 2WT2A 5GLWA 3N3HA 4CDUA 1R1A1 1B35C 1PVXA 3MYXA 4YZ4A 1XU1A 4CEYA 3V0AA 3HT1A 1RTVA 1GLHA 2D6KA 1XU2A 3S30A 3VLBB 3VBOB 1SLCA 3M1HA 4WM7B 2RS31 3AJZA 3NAPB 3DF0A 5LRSA 1NCRB 1AR81 4N7IA 1ASJ3 2MEV3 3AMNA 4R4XA 1LGBA 2VU9A 3ZO0B 3HD8B 5HCBA 2HWE1 4F7ZA 3GZAA 3G6JB 1F5JA 1MS5A 3VBSA 3KT1A 1WA4A 4Q4X1 1HXS1 3LA7A 5L7OA 2BW8A 4PLMA 4YFZA 4OHVA 4I3PA 3NJZA 3KGLA 1WMFA 3ZN4A 5KHIA 2GU9A 3EO6A 4AGVA 2O8QA 3THPA 1LGCA 5KXBA 1S0EA 3O0VA 1QJY2 1IS6A 1H4GA 1COV1 3AXEA 1R081 2HKXA 4QPIC 3UK9A 1EV13 1G8WA 4IEXA 1V6NA 2O0OA 1LEDA 2PHRA 4LLOA 1WCSA 3CJXA 2RS51 1N3OA 4Y22B 1RVF1 5BNNA 4IEYA 1CAVA 4RFT0 1NA1C 3GBWA 2WC2A 2QDRA 4XYXA 3FHIB 1AR73 1C8M1 3OYWB 5EFUA 5J3UA 2VNGA 3OF1A 2XJSA 1O91A 1SMVA 2VUAA 2XB6C 1AVBA 1UPSA 1JH5A 3ES4A 4M3CA 4I30A 2XL9A 4K6BA 1BK1A 1PK6A 3JBG1 4Y1XA 5JSPA 1CESA 5C9AC 3OGGA 4BLIA 4M01A 2ZHKA 5AC92 1Z78A 3B7MA 4OULA 2EF6A 1MZ5A 3RYKA 4Y20B 4GXLA 2R072 2JG9A 1FT9A 4XMIA 1GZWB 1V6OA 4QM9A 2VGDA 3R4DB 2XVLA 4B4QA 1A3KA 4EN8B 4P9WA 3NKGA 1AZDA 4GH4A 4QQLA 4YNIA 2R061 2D93A 2G9FA 3CJIB 3BTAA 4PQ9A 3T1LA 2HWC3 1S0CA 4Q0SA 1CIWA 3ZIWA 1Q8SA 4XE9A 1RJ7A 4FVVA 4RA0A 4D69A 3WLUA 5CBLA 2PHLA 3D0JA 4QGLA 1D4VB 3AMHA 3AYCA 4P14A 2WS92 2Q5TA 2XWJB 5DUWA 1YJKA 3WNXA 1NQDA 4CEWC 3HMYA 2R16A 3U07A 1SCRA 3O12A 2UYBA 2P34A 2ILMA 2RR13 2DV9A 4AQ2A 4FBFA 1UX6A 4SLIA 4XEZA 2WFF3 3PJQA 1N1SA 2F4PA 5DXDA 4AQSA 3ELNA 4WM8B 2ZHLA 5JLVA 2ARXA 1FPN1 2DUPA 4Q0VA 4BM8A 2ZGLA 3E5UA 3WX5A 4PLOA 1QQP3 3I4IA 1V6KA 3IPVB 5BNQA 4BQ1A 5HCFA 2DCTA 1QDOA 2XJRA 1TMF3 4BE3A 1VBC2 4XBLA 5JIAA 1CAUB 3ILRA 3QD6A 1JXNA 2B42B 1W0PA 4AQTA 3DPRB 4HETA 5KHGA 2VQ0A 1V6MA 4QXKA 5BUVA 4AVTA 1O3QA 1UZZA 1BYHA 1LU1A 3AMQA 2JKBA 1BJQA 5J09A 4YG3A 1QOTA 1LRHA 3LA3A 1S0JA 3L9JT 3J26N 5FLHA 2A3WA 5KHHA 3H8UA 3D5OA 4PDWC 3ZFGA 1Z0HA 3VBRB 1YIPA 1W6PA 1ND2A 5I0SA 1N1TA 1EP0A 1R1ZA 3I2DA 2B39A 2ZX4A 2W08A 3EXUA 1IKQA 1PO22 3MLJA 4FQZA 3MZHA 3M3IA 4U36A 4MVTA 2BVVA 1BVVA 4CDUB 4C1WA 1OA4A 4CEYB 1LOBA 1ND3A 2ZKLA 3V0AB 4OI4A 2OYZA 4QMAA 2PELA 4FP2A 1XRUA 1VB2A 3ZSJA 1BMV2 2R1DA 4FXKB 3RG0A 1B35A 4IETA 3B9IA 1LHOA 2WSVA 3V0BA 1YFXA 3RJRA 1VR3A 2HJIA 4GWMA 2PN5A 1IKPA 3AP7A 4Y1VA 3RS6A 3PMEA 4UW6A 2GDFA 2PHXA 5LEKA 1RUH1 1AYM2 1NY72 5DG1A 3VBHA 5C8CC 4FPHA 1KDKA 2WLPA 5JMCA 3VBSB 5CAZA 2D3PA 4YW4A 1QJY3 5L7OB 1ENSA 3H50A 3KZ4C 1S0GA 3KGZA 5I8TA 1PIV1 4IEVA 4URTA 1LHWA 3OTFA 1AYN3 5GZFA 1VBD2 4RR3C 4XJ9A 3J8F2 5T54A 4KL1A 4JGZC 1W6OA 3SITA 4GMP0 1YLLA 1UPIA 3SCFA 1O4YA 2IXJA 3JB8A 2D97A 4CDXA 1N1YA 3C3VA 2CAUA 1C3HA 3ALQA 1QOSA 3E97A 2H0BA 5BNNB 2D6OX 3GYDA 4MGKE 1CAVB 4HMZA 3FLPA 4FPCA 5BXXA 4DQAA 2GNTA 2IWGB 3FX3A 1YI7A 1C5IA 4QPGC 4H14A 2AREA 1SLAA 5AC93 1KJLA 4ONUA 5K0UA 3VZLA 1NA1A 2YUEA 2ZBJA 3UJQA 5E16A 2R073 4M3CB 1H8TC 4NHMA 4YSFA 1PK6B 5I0TA 1O4ZA 5KHJA 4IEOA 2E53A 1VBB2 3ILNA 4YW3A 1KDMA 4YVSA 3D8CA 1ALYA 1APNA 1JBCA 3AM2A 3JQXA 4MUVA 4Q1RA 1YYNA 1BEV2 3SCHA 1ULFA 2JG9B 3HN1A 4DOUA 5CFDC 1AL0G 1LOAA 1DBNA 1OMIA 4LO4B 4Y1ZA 4Q1PA 4CDQC 4D7TA 1PGSA 2ET1A 1QF3A 3RI9A 1GYKA 4B7KA 2DUQA 2V5YA 2BFUS 3NW4A 1G9BA 5A32A 1VJ2A 2PHUA 2W39A 3WP3A 2WS93 3JCIA 5DUUA 4TSVA 3SLIA 1I1EA 2A3XA 1PO11 3WG3A 1AX2A 3WINE 3IT8A 5FPZA 1DQ1A 4RL7A 1QJX1 4XJ8A 3TAYA 1DGWA 1CJDA 4NO4A 2P17A 2QNKA 2Y0OA 4AF9A 4RHV2 5A3MA 4M0NA 2ZGRA 3NWKA 1PGW2 2VVDA 2TEPA 3AKTA 1BBT2 1T6GC 4XQWA 4IQPA 1HRI1 4BMEA 4A7YA 1VBC3 4CEWA 3B93A 1ZX5A 3ILFA 4KG8A 4XBNA 4GMP1 2H6BA 1OPOA 1UIKA 4XQDA 4Q4V2 2DU1A 3KQRA 4DS0A 3CF6E 4A2UA 2XJUA 1LOFC 1SFYA 2XBO3 4AEKA 4AE2A 1H2MA 4X8NA 5IK7A 4WV8A 1VBE1 5T5OA 4E9KA 4AEDC 2KA3A 1ZBA2 3CO2A 2A75A 5IT6A 2RM22 2EXKA 5FQ0A 3N7MA 2JD4A 1FX5A 1AL22 4RD7A 2CGOA 1RUF2 1HRV2 3JZVA 1PO23 2JG8B 5H9PA 5JI9A 1GFF2 2WLQA 3HAGA 4QU2A 1HLCA 3RNSA 3ZFGB 2WNVB 1R091 3O7OA 5FPXA 1Q8OA 1W6PB 4AVCA 5DDJ1 4Q0PA 2WKKA 2WZR1 3T2TA 2DCZA 1W0OA 4XF3A 4DB5A 3VBRC 1RUI2 2ZPXA 2ZHMA 1RINA 4DFSA 1ND3B 2WT1A 1V6IA 1AYM3 1MQTB 1RMU2 1VIWB 4F3JA 2RS12 2ZAAA 1RUC1 4UW4A 4AFAA 4WVZA 2YGMA 2AENA 2D3SA 3B9CA 2VMHA 1B35B 4KH9A 4RQPC 4HKOA 3VN4A 1OQ1A 4AQ6A 2WWSA 2VOXA 3W9AA 4EWDA 2UURA 3IDBB 1G6NA 1GQHA 3RDIA 2BVBA 4N53C 2FMDA 2WL1A 4LBLA 4QQ2A