2ZGKA

Crystal structure of wildtype aal
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
QGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
total genus 38
structure length 158
sequence length 158
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgkA00
5IK7A 1IS6A 1SLLA 2NMOA 3DGTA 4JCKA 4XDQA 2W52A 1LOEA 4DFSA 3V0AB 4FP2A 2WSUA 3USUB 3V65A 2AYHA 4JC1A 1UAIA 3AFKA 3FUOA 3JUUA 4XTPA 5CB7A 3QLQA 3IM0A 1DQ1A 1LEMA 1MS0A 2ZHNA 2JE9A 2EXHA 4R9CA 3POYA 3AP9A 2EALA 3NV2A 2A71A 2YV8A 5KXDA 1CJPA 3PVEA 3WOGA 4LBMA 3WUDA 3ATGA 3OJBA 4YGCA 1S0GA 3A4UA 4XJWA 2DVFA 2GALA 4XYXA 4GWMA 3RQ0A 3SH3A 2D3PA 4YM2A 5DUWA 1KDMA 1LHUA 1WD4A 2B7YA 2ARBA 2PHWA 2WLQA 1G8WA 5T5OA 3WG3A 3V0BA 4WVVA 5H9SA 2PELA 5E8AA 1LU2A 1OKQA 2A75A 5H9QA 2Z42A 2D44A 1N1YA 3WDUA 1SLBA 4FPKA 2ZGOA 3KQRA 1C1FA 4Q2FA 5H9RA 5HCBA 3ZXFA 1WLCA 2ZMNA 1HKDA 1SLCA 2ZGRA 3AZXA 3WDTA 4FOWA 3WHTA 2W08A 4IQPA 4TZDA 2FMDA 5JOXA 1HLCA 1F9KA 1Q8OA 1CN1A 3H0OA 3N7JA 5IK8A 4FVVA 2A70A 5BYNA 1Q8QA 1HDKA 4P14A 5GZEA 1W6NA 3MW3A 4FOVA 4XBQA 3QCWA 3SNMA 3FBYA 2YXSA 5SV8A 2FHRA 1ULCA 4H55A 2AUYA 5IK5A 2DURA 1AXKA 4R9BA 3V0BB 1Q8VA 1DHKB 4AGVA 2NM1A 4Y1XA 3M1HA 2ZGMA 4XBLA 4Y24A 1QNWA 2AENA 1UZYA 4YLZA 1BKZA 5F5QA 1DQ0A 2E51A 3W59A 3IPVB 1JYIA 5GJ6A 2VU9A 3ILRA 4FPEA 4UW3A 4F83A 1XQNA 4DQAA 1WW4A 2E7TA 1SCRA 3LSDA 1KRIA 1V6MA 2EF6A 1SACA 1KJRA 1JXNA 1A8DA 2PHUA 2DUPA 3AZYA 4YGDA 4BM8A 5T50A 2D6LX 4M3CE 4Y22B 3ILNA 1GLHA 1AVBA 1HQLA 1S0EA 2PHRA 2R1DA 3GNEA 2ZBJA 2ZMLA 4Y1VA 5DZEA 3SH5A 1G9DA 1SLAA 2NYYA 3VKOA 3BODA 4ISQA 1HQWA 2GNTA 4L8QA 3M3QA 5EYYA 5GZCA 1IS4A 4ATFA 4FPCA 2ZGPA 1ULEA 3UL2A 1URXA 3AZWA 3AJYA 3MW4A 3VKFC 1AXZA 1LOAA 3OYWB 4FOQA 5EYXA 1AXYA 3IKWA 5JDBA 2DYCA 1S0BA 1QOSA 3D5OA 3O0XA 2VY0A 2NMNA 4M3CB 4K1YA 1GBGA 4MYEA 1DQ5A 4FPJA 3WUCA 3ZXLA 1D0HA 1LCLA 1MS3A 3RRDA 3GALA 3OPZA 2KM2A 1KDKA 1MZ6A 1WW7A 4XJUA 2P3IA 4ZXKA 5H9PA 2WJSA 3B01A 3ZYPA 1FATA 4Q1PA 5GLTA 1S0DA 1LHNA 5CA6A 1VAMA 2P3KA 3TAYA 1A78A 3O12A 1MS4A 3WG2A 2E6VA 1B09A 2VUAA 4YG0A 1SBFA 1APNA 2UURA 3VUOA 1AF9A 3ZSLA 1KQRA 2R0HA 1FNZA 2DTWA 3RS6A 1DQ4A 1LHOA 1Q8PA 4FPHA 4AVSA 2LALA 1RITA 4YG3A 4D69A 5DZFA 2D3SA 5DUXA 3FFZA 1Z0HA 3ZPYA 1S0CA 4CRQA 4YZ3A 2UWBA 4PQ9A 4YM1A 4CTEA 5AVAA 2GNDA 1ENQA 4XJ8A 2BQPA 3BOPA 2WSVA 5GZDA 1UN1A 1YIFA 4XE9A 2ARXA 1CIWA 1LHVA 3LSEA 3SLIA 4M00A 1GZWA 3IN9A 3V64A 1FYUA 3WV6A 5DG1A 1WW6A 2V5YA 2ZGUA 3OY8B 1I3HA 4NOTA 5JOYA 2DVBA 3OY8A 4BMBA 2A3WA 3AP7A 3O5SA 4GA9A 3ZSJA 1R1ZA 3ILFA 5HCFA 3SISA 4XJZA 5EWSA 2D6MA 3R05A 3VKMA 3WG4A 2DWRA 1A3KA 3T1MA 2A6WA 4BPZA 1UX6A 2P37A 1D2SA 2GN7A 2HYKA 5GLUA 1MS9A 3RMXA 1KJLA 1FV2A 2I2SA 1SLIA 3I8TA 4M3CA 1SLTA 1PZ8A 1ZA4A 1Z78A 2A3XA 4W65A 3M3OA 5GLVA 1JUIA 4GXLA 3B3QE 2ZGNA 3OYWA 4FP3A 1QMJA 3N7MA 4XJAA 1G9FA 2A6YA 3OBRA 2OVUA 4AVVA 2D43A 2D3RA 5E89A 1S0JA 3UJOA 2JECA 2A6VA 2PHTA 5FREA 2A3YA 1LODA 4XOGA 1YI7A 1CR7A 1QOOA 1CPNA 4XHXA 1DQ2A 1IOAA 2CL2A 2ENRA 1G9BA 2GN3A 2GMPA 1JHNA 1WD3A 1V6OA 4LBQD 3AP4A 2CYFA 3WHUA 4XIKA 4FPGA 1AX2A 4WZFA 2JD4A 1LENA 4YM0A 1NXD1 2W39A 2LTNA 5T54A 3WNXA 1LEDA 2A6XA 4AGGA 4BLIA 2NN8A 3ZYRA 5JMCA 1ZM1A 1ULDA 2ZACA 1H30A 2ZGTA 4JRAA 1WW5A 4LBJA 1YO8A 1JOJA 1FV3A 1VLNA 3ZSKA 4AWDA 3AZZA 5L73A 1MVQA 2ZGLA 2YZ4A 2JDZA 1V00A 1O4YA 3JU9A 1AJOA 3RMYA 1CPMA 1UKGA 1MS5A 1YYNA 2WNEA 1QKQA 1J1TA 4DS0A 3AZVA 4Y26A 3R4SA 4YGEA 5DZGA 3FLRA 4XXAA 4YW3A 2JKBA 2ZHLA 5IUQA 3ASIA 3CNAA 5GM0A 1LGCA 1GANA 1DFQA 5GLWA 1QOTA 3MW2A 1N1VA 3T1LA 2GDFA 4UW4A 2PHFA 1WBFA 1GKBA 4P9XA 4M01A 1AJKA 1TEIA 4U36A 2GMEA 4HL0A 2AH2A 3POSA 2DTYA 1UL9A 1GICA 2JJ6A 1LGBA 4BLJA 2RHPA 2GMMA 3OGGA 1RIRA 1ULGA 2SLIA 4K21A 4ISRA 4UW5A 4LBLA 1N47A 5GZFA 4P9YA 1QDOA 5GLZA 1LOGA 3VKNA 3SH4A 3W58A 1WBLA 3M2MA 1W6MB 4M3CF 1KITA 4Q26A 3RG0A 3WDVA 4DRVA 1QGLA 2YROA 1W6OA 2WT1A 3ZXJA 2V73A 3WVJA 5T5PA 3WDXA 1S0FA 2E53A 2OUJA 2DU1A 2VXRA 2TEPA 2YY1A 2ZA9A 1WLDA 5GZGA 1ENRA 1FX5A 5T52A 4PBPA 1BYHA 2XB6C 2ZZJA 1G9AA 1LESA 1LTEA 1W6MA 4R9DA 1Y7BA 1CONA 5LK5A 4K1ZA 1MR5A 4YW1A 1OQ1A 3FUQA 4RA0A 1YXWA 4FOYA 2WKKA 3USUA 1VIWB 3N3HA 5T5JA 5JLVA 1I1EA 4DPNA 3WDYA 3V0AA 1QDCA 4FQZA 4YGBA 5HCAA 1N3PA 1IKQA 2VW0A 2VW1A 1QNYA 2ZKNA 1SBEA 4HANA 4Z8BA 1DBNA 4RL7A 4PF5A 1H9PA 4ASMB 3N7LA 4TYSA 1MS8A 1WUVA 2UWCA 2AR6A 1VALA 2D6NA 1IS5A 1W6PA 1V6KA 2ZHMA 3BTAA 3T2TA 1LOFC 2EXKA 3INAA 1V6IA 1S1AA 3HN1A 4FPLA 2DVAA 2CNAA 4PBOA 2E7QA 5GALA 3ZSMA 1W0OA 4I30A 3AXEA 3N36A 1S0IA 4AVTA 3PVNA 2EXJA 1V6LA 1W6NB 2A7AA 1IS3A 2ZABA 3HMYA 3MEPA 1F5FA 4Y1UA 4YW5A 1BXHA 2WT2A 4KBBA 2NP0A 1Q56A 4YZ1A 1LU1A 4CZSA 4XHBA 3D4KA 4YZ4A 1G7YA 3ZVXA 4GKYA 4XILA 5KXBA 3AYEA 2CTVA 3AYDA 4FQ4A 4XXPA 3WCRA 1JW6A 4Y20A 1AX1A 2ZGKA 2D6PA 2JE7A 5DXDA 3O0WA 4YW2A 1PZ7A 5DUVA 4Q1RA 4XBNA 4YFZA 1RINA 5KXEA 4GKXA 4OZXA 3APBA 3UJQA 3WDWA 2D6KA 1CVNA 1YRZA 2DVDA 1AZDA 1V6JA 2GNMA 4Y1YA 2WT0A 2SBAA 1CESA 1LJ7A 1GZCA 3FLTA 4FPOB 2C9AA 3NV3A 3VKLA 4DRRA 3PJQA 2EIGA 4LBKA 1MZ5A 4ITCA 4XJ9A 3FLPA 1F31A 2GNBA 4LBQB 4P9WA 1DGLA 2D7FA 3I4IA 4LBNA 4NO4A 4XZPA 1LULA 3B69A 1AX0A 1JYCA 1WLWA 3N7KA 1G86A 1SFYA 1LOFA 1ONAA 5IT6A 3NV4A 3C2UA 4YZ2A 2AREA 3A0KA 3OBTA 4FPFA 4U2AA 3ZXKA 3M3CA 4YW4A 1SCSA 4Q8KA 2EXIA 5F9TA 5FRAA 5DG2A 5EXOA 4UW6A 1W0PA 1BJQA 1DLLA 4K20A 1DIWA 1MACA 2DUQA 3AYAA 4XTMA 5CAZA 3NV1A 1W6QA 1N3QA 4ATEA 3AP6A 1UPSA 2CWMA 3DUIA 4XIOA 4Y22A 1C4RA 3WCSA 1N1SA 3RSJA 1GZWB 2P34A 3ENRA 2A5ZA 1QU0A 1GNZA 2VH9A 4FPYA 2NZ9A 4C1WA 2ZAAA 3KM5A 5JOZA 2Q5TA 1N1TA 3VV1A 2ZMKA 2DUOA 4PCRA 4SLIA 4YFWA 2DU0A 5CBLA 4Q27A 1DZQA 4R9AA 1IKPA 3AP5A 3BIWE 1JBCA 4YM3A 2DVGA 3IPVA 2D6OX 1O4ZA 1BZWA 1GSLA 3B9CA 4WV8A 4XMIA 2ERFA 1LOCA 2AGSA 2R1BA 2A6ZA 2CWSA 2DV9A 2YMZA 1GNHA 3PVOA 2W68A 1BQPA 4WVWA 1GV9A 4BQ1A 1U0AA 1W6PB 3O0VA 1CQ9A 3AXDA 2WQZC 1FNYA 1H9WA 1V6NA 1FAYA 2ES3A 5JVVA 1EPWA 4BMEA 3U4XA 1VAVA 3AJZA 3WG1A 1UZZA 2ZGSA 1X50A 3TB0A 1N3OA 1Q8SA 2R0FA 3HR9A 5T5LA 1GYKA 4Y1ZA 1LECA 2R16A 1NLSA 2UU8A 1DYKA 2ZHKA 3IMNA 3NWKA 2P3JA 1SBDA 2R49A 2VW2A 3WZ1A 1C57A 3M3EA 1ULFA 4XMAA 3PMEA 4YZ5A 1ENSA 3AX4A 2P2KA 4BOWA 3MPPG 1LOBA 2CY6A 4Q8LA 1JN2P 2UWAA 3SITA 4GWNA 4C1XA 2H0BA 4LBQA 1UMZA 5E88A 5IK4A 1LGNA 1WCSA 3L2YA 1PZ9A 3D6EA 1GZ9A 2OUHA 1DQ6A 2EAKA 2PHXA 1QF3A 3R4UA 4ZKTB 1MVEA 2XG3A 1OFSA 4AGRA 3Q9OA 3AK0A 3UK9A 1W6QB 1W6OB 3N35A 4LBOA 3ZXEA 3A0NA 2G4IA 4YG6A 2ZGQA 1DYPA 4AYUA 3POWA 1MS1A 5KXCA 3WLUA 5CNAA 3B00A 4GALA 2C5DA 5T55A 1G9CA 1C1LA 3AYCA 5DUUA 4Y20B 5JOWA 2OW4A 3LCPA 1LHWA
chains in the Genus database with same CATH superfamily
4BZ4A 3HIFA 1RYYA 5FPXA 2AZ5A 4R52A 4LK7A 5FMOL 2Y64A 1UXZA 3DGTA 2RJKA 4JCKA 2W52A 1IQAA 3SCFA 3WSOA 5HV0A 4FP2A 3V0AB 2WSUA 4WM8C 1CZSA 4GZ9A 2AYHA 5JZGA 4K8RB 4IEUA 4NIIA 1POV1 5FOJB 3LDKA 1XXNA 3QLQA 3IM0A 4EZ4A 1LEMA 2ZHNA 1HB4A 3LKJA 2QVSB 5F6LB 4WM8B 3POYA 3CZJA 2A71A 1UYPA 3KQ4B 1BK0A 4EV0A 1CJPA 1S2KA 1ULPA 2ARAA 1JYVA 1S0GA 3A4UA 4YVWC 4LO4B 4AEDB 1DGRA 4MH0E 2RM21 4IGPA 4CCCA 4W6XA 5L9BA 1WD4A 4RQPB 5F39A 5T5OA 2B9VA 2G1MA 2Q1ZB 5H9SA 2C6SA 2BWCA 3WNMA 2YHJA 1R1A1 1TQ5A 5H9QA 4S2HA 1D2QA 1OA3A 4FPKA 4RYDA 4Q2FA 5H9RA 3H8XA 1BMV1 5C4WA 4ZXEA 5FZ8A 2ZGRA 4TZDA 4UF0B 1YUDA 1PGL2 2VCCA 1NE4A 4B4PA 2Y8KA 3ZFFA 5JOXA 3R4DB 1KS5A 3ZYBA 1Q8OA 1OQEA 3H0OA 4I0AA 4EWEA 3T2PA 4MGYE 1HDKA 1R1A2 4BE3A 4LTAA 4TTGA 3SNMA 5SV8A 4QXHA 4FXGB 3U14A 3VLBB 1J83A 2JG8B 1UPIA 2BNNA 4H7MA 1ULCA 5E1RA 3H8UA 5IK5A 1AXKA 3V0BB 2QJVA 1UY0A 1M4WA 4Q4Y3 3M1HA 2WFPA 2ZGMA 4Q4W3 4XBLA 4DNYA 3CJIC 3PLQA 5LRRA 3BKZA 1XNKA 2XHNA 5F5QA 5A33A 3MUY1 3ZLIA 4UW3A 3RJ2X 4FPEA 4F3JA 1XQNA 1ZRCA 1ZA7A 2Q8CA 4JHTA 3DEMA 3D3AA 2EF6A 4N90A 2CSGA 3PHMA 3IIAA 3DECA 1AYN2 1BEV2 1TNRA 2GH8A 3B9IA 5T50A 2HH9A 2HWE2 4BQ5A 1JYXA 1VBE1 2RE9A 5A7QA 4BDVB 1GLHA 2R1DA 3GBFA 3VHNA 4AK3A 2ZMLA 4IEXA 1IG0A 2RS32 5ABJA 1SLAA 4NRMA 1D4M3 4AXOA 4ISQA 1AYM3 2GNTA 2OXBA 1XB9A 3M3QA 1K5MB 5A33B 5FLIA 3NNGA 2XMLA 3OUHA 4FPCA 2Y0IA 1ULEA 4ONUA 3UL2A 3AZWA 4IE4A 3AJYA 3J7MA 5FZEA 5E16A 4E8CA 1AXZA 1LOAA 4RS5B 5J37A 4JQRA 4P5HA 5EYXA 2WC2A 3ZFFC 1AXYA 4UBGA 1OQDA 4CDQC 3VN4A 3PL0A 2JIGA 4W8JA 2R071 1GBGA 3NNFA 2RMU2 3H1MA 1L7RA 3DYMA 3GALA 3VDDA 1ZBA2 3BYWA 2KM2A 1WW7A 4XJUA 1HB2A 4Y4RA 1XNBA 1POV3 3CQOA 1RJ7A 4NHLA 3CBNA 3THTA 1FATA 5GLTA 3CU7A 3HBZA 1VMJA 3FE5A 3WP4A 1RMU2 5C9AB 3GM8A 2YU2A 2E6VA 3H7JA 1SBFA 2UURA 4XFHA 1AF9A 3ZSLA 1ZZ9A 3VBOB 2R0HA 2JICA 3FBMA 4NVPA 3PUIA 5D8AA 4Q0VA 2Y6GA 4EE2A 3VZMA 1XOYA 4YG3A 5A1AA 2JG9C 1WKYA 2D3SA 2PHDA 2TNFA 4KU7A 3FFZA 4NAOA 2G9ZA 4JZRA 1IHMA 4I01A 1S0CA 1TMF2 1SQ4A 3FJSA 2OA2A 2UWBA 3D82A 4IE6A 2GNDA 2YU1A 5FV3A 2B46X 1HN1A 4GAZA 5FR3A 4LUMA 1YIFA 1SEFA 2BPA2 3JB8A 2ARXA 1LHVA 3SLIA 3LAGA 1BK1A 1GZWA 5IYYA 1Q5OA 1FYUA 3AMHA 3WV6A 4CCLA 3T2QA 1YWKA 1COV2 2PN5A 3OOXA 3W9AA 1REFA 1A8MA 5ANNA 4GMP1 1JODA 5C9AA 1FMD2 1HX6A 3M4FA 2DVBA 4BMBA 1JZ6A 3AP7A 2P3YA 5M0TA 5C70A 2JDKA 2XVGA 4GA9A 1R1ZA 3ILFA 2XJQA 5F32A 3SISA 2CGNA 4QKBA 1AR91 4QU2A 5LA1A 3VBHC 4MGQA 4M4RA 4WM7B 3HJRA 5F2SA 4QPYA 5BNQA 4OHZA 2GN7A 2YFUA 3J8F3 4NPRA 1Y9MA 1MS9A 2Y6KA 2VMHA 4LHLA 1FV2A 3FFQA 4DY5A 4DY3A 1AR72 4QB1A 1W99A 4ET7A 2YC0A 5HXMA 1ZA4A 1Z78A 3M3OA 5HXVA 1OURA 1LNSA 3LA3A 4GXLA 3T0BA 1Q3EA 3VL8A 5D8AC 3U75A 3O1SA 1UY1A 4RS5A 4FBFA 1QMJA 3P6BA 2A6YA 3HNYM 3OBRA 5A32B 4ZU7A 5A6XA 4YW7A 4NIAA 4B4RA 1EY2A 1S0JA 2VJXA 3VBSC 4D7TA 5A1FA 1QOOA 2VMFA 1CPNA 2ENRA 1CZTA 1G9BA 2GN3A 4NPMA 3LOBA 4Q4X2 3IDCB 5ABJC 4LBQD 3AP4A 3JBG1 4DUXA 1Z7S3 2FCVA 2JD4A 1UYYA 2Q0AA 4YM0A 3U1XA 2W39A 3WNNA 4XW3A 4MG2A 5T54A 3UKVA 3TEXA 1S4CA 4CCEA 1HRI1 2VULA 3WW3A 4YWAA 1ULDA 3U10A 2ZACA 1H30A 4JRAA 3KB5A 5A7WA 5BXXA 1EP0A 1YO8A 4PIXA 3ZM8A 4BXSV 5BV6A 2V72A 4OUSA 5L73A 1W9SA 5FZOA 2R062 2JDZA 4LA3A 2IC1A 4QDQA 1PGW1 4BQWA 5L7OC 4RR3B 1UKGA 2WNEA 4C0BA 1ND3A 1CGPA 3EYPA 3R4SA 5C3PA 4Z1VA 3FLRA 2C26A 4YW3A 5IVJA 1RUNA 1VBD3 3CNAA 4JKMA 1BCXA 1O3TA 1F15A 2UY8A 4IEVA 5GKAC 2VBPA 5CVRA 2VMGA 3SKVA 4CP9A 1GANA 1O3QA 5GLWA 1OF3A 2F4PA 3RDIA 3K46A 3T1LA 1WBFA 1SFPA 4L97A 4P9XA 3TYJA 3URFA 1NXMA 4AFDA 2HWD2 3EXUA 1FI2A 2VBBA 2ZAHA 1ND3C 3IZOA 3V56A 4B29A 2QQWA 2JEMA 2DTYA 1UL9A 1GICA 2O0OA 3OSDA 4KMQA 2JIJA 3J4UH 3ZDVA 4ASLA 2B9UA 2GMMA 2WABA 3OGGA 5FJKA 3PUHA 4V2WA 2WNOA 4ISRA 4UW5A 5FZ4A 2VQTA 1N47A 3RZMA 3W58A 1RUD1 1RUF2 4Q26A 4RD7A 4ZU4A 3I2HA 5AC91 1W6OA 2WT1A 1DZRA 1NKGA 2ZX1A 4MO3M 4B1MA 1AYM1 5J96B 5AC92 3ZYFA 2GC0A 2VXRA 2TEPA 2WQ8A 2YY1A 3MLLA 5GZGA 1FX5A 1PO21 5T52A 3NO8A 1BYHA 2X8KA 2XB6C 3LA2A 4PBPA 1LTEA 2WNVC 3ST7A 1Y7BA 4XF1A 1CONA 2KD7A 4K1ZA 4QX2A 4YW1A 3NSTA 3PU8A 1FPN1 1YXWA 2R7EB 2WKKA 3E6BA 3N3HA 2VXJA 4HT1T 4W6YA 3SMHA 1WGPA 2J1AA 2ZEZA 4RHV1 1GQPA 1OH3A 4AG4A 2PFWA 5HCAA 3POJA 3NJVA 1GMMA 5B4NA 5TSWA 2HWD1 5CFCC 2VW1A 4N43B 3I2GA 4OYUA 1C5IA 3ELNA 5IFTA 2PAEA 2FZ2A 4FCAA 3KS7A 1H9PA 4R8HA 5FBZA 4AFMA 5IATA 3MIDA 4DUWA 4WVMA 3LE0A 3BIEA 4TYSA 1MS8A 1NAEA 1NQDA 1RUG3 1VALA 3ZFEC 2Y6FA 2VNOA 4AHYA 1W6PA 5JSOA 1RUG1 3MICA 3INAA 1RXGA 3HN1A 3K4AA 2XXZA 4UXAA 2DVAA 4LIUA 1C28A 1PIV3 2BEOA 5LWBA 1V6LA 4CDXA 1XSQA 4YW5A 4Y1UA 1MZEA 2JXAA 3RJRA 2FD8A 1RL3A 3OGVA 1Q56A 1ULOA 2OS2A 4SBVA 5C8WA 1LU1A 3NAPB 1PMIA 3JBG3 1JMUB 2O1QA 4YZ4A 3ZVXA 4XILA 5BNPC 5FQ0A 4FTEA 3NW4A 4FQ4A 4HOOA 3SCGA 4E2SA 3MIHA 3JBG2 2HWC2 3WW4A 3U4SA 2WZR1 3O1TA 1PZ7A 4YFZA 1PGSA 4GKXA 3IWZA 5F3IA 3UJQA 3ZO0B 1CVNA 1V70A 3WDUA 5KWRA 1PVC2 3IAQA 4NHYA 2C9AA 3BALA 3VKLA 4A42A 2JKXA 2P6CA 3ZIWA 2EIGA 4GMP3 3O1VA 1E57A 3NJZA 4PQQA 5FYUA 5A7NA 3FLPA 4E4DX 2WWJA 1OOPB 2BNOA 2YGMA 1UOGA 2GNBA 1JI6A 3L2HA 4RGGA 4KWKA 3VDDB 3BPZA 3AMQA 2GC1A 4LBNA 4XZPA 1LULA 4RGKA 1AX0A 4XQDA 5FYTA 1G86A 3AKTA 1AUYA 2XJSA 3I3DA 1LOFA 1ONAA 4FO9A 2ET1A 5FK8A 4M0HA 4QX1A 2JDHA 3RYRA 2UY9A 3K75B 1AR61 2E31A 2QUOA 2W9XA 3C2UA 1A34A 3ZXKA 4RR3C 4FPFA 2JG9A 2YBKA 4OVEA 4TLGA 2EXIA 2A1XA 2MEV1 5DDJ2 5FRAA 3CO2A 4PLOA 2VC9A 1DIWA 1GP4A 2PMWB 3NV1A 4EWDA 4ATEA 5BNPA 1GFF2 1COV1 4KG8A 4PIYA 4OLLA 4XIOA 1HXS3 3PURA 4TXWA 2CGPA 3L9JT 1HRV1 3GZTB 4NRPA 4QKDA 2D98A 4L99A 4ARYA 3ENRA 3EBRA 4D3WA 1QU0A 2QQNA 1PHMA 4FPYA 2ZAAA 1UKRA 2Q5TA 2B42B 3VV1A 1TZOA 1K42A 4QXBA 4TN7A 1W2NA 1TMF1 2HBTA 4OI4A 2B39A 5C33A 5K8SA 4SLIA 4YFWA 5KHJA 4JGZC 5EQUA 4Q27A 1IKPA 1GQGA 1ZYBA 2WZR3 3GHNA 5IHRA 3VBSB 4G9SB 5FP9A 2D6OX 4QQLA 1O4ZA 4R4XA 3B9CA 4B7KA 5JUVA 2ERFA 1PM4A 1XYPA 3ES1A 1LOCA 3QOPA 1WMEA 5HV4A 1GNHA 2ORXA 3KT4A 1W8HA 3PVOA 4AI3A 4CCOA 4XFIA 3MZHA 2Q8OA 2DCYA 1U0AA 3NQHA 1NX9A 2RS11 1CQ9A 1X8EA 1CAWA 3AXDA 3UT0A 5FKCA 5JR2A 1V6NA 5IFPA 1UF2C 3WF4A 1EPWA 3I97A 5CU1A 4P08A 5C3RA 2ZGSA 1X50A 3I54A 3RZHA 3W5NA 1BBT1 4C90A 4BCUA 3HR9A 3WP6A 4Y1ZA 1LECA 2Y6HA 3CDZB 4Q0QA 1NLSA 2WO2A 3LEMA 1VBB1 2ZHKA 1SBDA 3IDBB 2B45X 4KH9A 3POFA 4XMAA 1MQTA 3AX4A 1R093 4JX0A 2CY6A 1NG0A 4KWLA 2XKOA 4FAHA 3GDBA 4GWNA 3Q8FA 2QTWB 4C1XA 5F5CA 4DXTA 5IK4A 1BLZA 5LY2A 2RDQA 1PK6A 4CPBD 3I2JA 3T0AA 2OUHA 3HBKA 4QPGB 1QF3A 2IXKA 2Y34A 2YPJA 5CYYA 3KHCA 1JZ5A 4P00B 5FZKA 3AK0A 3UK9A 3VD7A 4ZY9A 3ZXEA 3THCA 3N9NA 3OF1A 3VBUA 3KV5A 4JVAA 5JMOA 2XHKA 4CDUC 2RS31 3AMPA 1ZZBA 4E2GA 1X36A 4HSJA 5CNAA 3B00A 3RWKX 4O65A 3WLUA 2JG9B 5A6QA 1VBE2 1RUC2 5CADA 2W1WA 4GH4B 3MUZ1 5DUUA 4Q4V1 2OW4A 5FZ1A 5JOWA 3LCPA 1LHWA 1UQXA 5IK7A 1IS6A 3MIFA 3VBOC 2NMOA 2RS53 4QHBA 4DFSA 2R043 4QX0A 1Q43A 3VBUC 3ZYIB 4IEYA 4AQ6A 1GWKA 4Y33A 4G3YC 1TG7A 3V65A 4BHPA 1H6YA 4XTPA 2ID4A 4JV4A 2ZKLA 5FZ9A 2JE9A 4PHZA 5FXXA 5FPLA 3VBUB 5FY5A 3EB7A 1LAJA 5FY1A 2QQMA 3WF3A 2NPIA 2PLV2 3ATGA 1C8NA 3KZ4C 4YGCA 3AKPA 3ROUA 2JWPA 1ZREA 3ZR6A 2YC2A 2XKPA 5FWJA 1YNAA 3RQ0A 1PK6B 2OZJA 1FMD3 3WXPA 5C8CB 2WLQA 4IE5A 1G8WA 4EZHA 4LHKA 4WVVA 2DDUA 4CDUB 1LU2A 1OKQA 5JXIA 5A7SA 3ZYHA 1SLBA 1NT0A 1XBFA 2ZGOA 1F2NA 2MNGA 4KWJA 2HWF3 1WLCA 3HPNA 1HKDA 3WHTA 4CEWB 1PGL1 4XQWA 3I2IA 3UGGA 3BTYA 2QQLA 4EN6B 1BMV2 4HFSA 1TMF3 1OLMA 4MGSA 2A70A 5BYNA 4P14A 4B8EA 3BB6A 4FOVA 3QCWA 1CAWB 2WWUA 3J7HA 3ZN4A 2FHRA 1SDWA 2ILMA 2QQOA 2YBPA 3FMGA 4Q5OA 1ZRFA 2HYXA 4LIVA 4R9BA 1UNBA 1WCQA 1VBD1 1ZBE1 3AFGA 4PT6A 4AGVA 5CFDB 2ATFA 1UY3A 1RVF2 4MGZE 4LO8A 5FY4A 5F3GA 4LO6B 5J48A 4HKWA 5FZCA 1XNAA 1EUUA 2VL4A 2QQPA 1O6UA 2JB8A 1UXXX 1U12A 3UETA 1NA1B 1NE6A 4DXRA 1JYIA 2HWB1 3LSDA 4GQ7A 5EJ3A 5F5AA 3NL1A 1XNCA 1SDDB 3PIJA 2RS52 3HOBA 4K3UA 1SACA 3VD9A 1KJRA 3MF9A 3CJIB 2DCTA 3OGSA 1A8DA 1J3PA 4OI1A 4COWA 5A3MA 3CHXA 4YGDA 1QY4A 4AL9A 2D6LX 4CCJA 1RUC1 4FTSA 3ILNA 2PHRA 1AVBA 1HQLA 3GNEA 4PDWB 3SITA 4EWAA 3U0ZA 4YW6A 2NYYA 5FXWA 1HQWA 2ARCA 4A6SA 4L8QA 5GZCA 4XF4A 2FCUA 1GWMA 3T4HB 5C3QA 3DF0A 2QFEA 3A21A 3MW4A 2FBEA 3VZJA 1ZZ6A 3VKFC 1YQ5A 5FZ0A 3CZUA 1PX3A 4AI0A 3IKWA 2RS33 1O3RA 4BYYA 2VTXA 3NNJA 2XQRA 4KL1A 2XJRA 3EMRA 3I59B 4RQPC 4HXCA 1DQ5A 4L2NA 4ZONA 3WUCA 3ZXLA 4LO7A 1LCLA 2ZZQA 1XC6A 3ZYJB 1ZX5A 4AEDC 1MS3A 4EN8B 4HPKB 1MZ6A 3OBZA 1BBT2 4BQYA 1XU2A 1HIXA 5H9PA 2WJSA 2JDUA 3ZYPA 3CIHA 1S0DA 4MXWA 2P3KA 3B5LB 2QDRA 3VUOA 4Q4W2 3PVBB 5G05L 4ARXA 3VDDC 2ADDA 2IFRA 1LKNA 3RNSA 1Q8PA 4LNVA 2VG9A 4FPHA 4UOJA 2D5HA 1JS9A 2RJ2A 4D69A 3HQUA 3KWVA 5CIRA 3OD4A 3ETQA 1R1A3 4E9KA 1UCXA 5BNNB 4DEQA 4C8DA 2V09A 4LO5B 3S5QA 3I59A 2EA7A 4IEWA 1DG6A 4R4ZA 4CTEA 4YPJA 4KGQA 1CAVA 4AE2A 4D8MA 4LOSA 1WMXA 3A22A 5EPAA 1UN1A 3C7HA 4H7LA 2G9GA 2GP3A 4XE9A 3BVCA 4URAA 1HRV2 2D93A 3KD4A 5FFOC 1WWYA 3S30A 4E27A 3O14A 5BNPB 1HJFA 1OC1A 2BV4A 1MPXA 1RUI1 2ZEYA 3ACFA 2BYVE 2WAOA 2V5YA 1YFYA 5LB6A 5LBBA 3RPQA 4E4ZA 3ALQA 3OY8B 3NAPC 1QJU1 1OPMA 1I3HA 1QWRA 3PIGA 4NOTA 1PO23 1UOJA 1JYWA 1UYXA 1B35C 2VZQA 4XZUG 3HT2A 2K9ZA 3ZSJA 3WG4A 5EWSA 3H1YA 4DIQA 2QNKA 1VE0A 5EP9A 1ND2A 4WZCA 1W3VA 2FDGA 1XYOA 1UW8A 2VZOA 3HN3A 1UX6A 2P37A 3CF6E 4JKKA 4A4AA 3I3MA 1NCQC 5AFBA 2RV9A 4COZA 3WNKA 3PTRB 2I2SA 1SLIA 3F2ZA 3MBWA 3ZFEB 2PA7A 4CP1A 5BNOA 2A3XA 2ETEA 5DN2A 2X5IC 4RFT0 5FJHA 4FSJA 3OEAA 4N43C 3OYWA 4N8MA 4H2AA 1ZRIA 3AB0A 3VBRA 1MEC2 2R6QA 2E9QA 2E32A 3Q8BA 4NIDA 1LODA 1GOHA 1SMVA 4N53A 4XOGA 2VZUA 1T2XA 3KF5A 1HRV3 2CL2A 2WNVB 4IV3C 3FL7A 2QQKA 5IWFA 4HVOA 1RUF3 2HWC1 1H2NA 1AX2A 3VBFB 4YVSB 1IPJA 2BZDA 3IDAA 1NXD1 1U5XA 3EHKA 2X05A 3LFIA 1GZTA 2WFF2 2K0GA 1QXRA 3U37A 4CEWA 4AGGA 4BLIA 4IV3A 1WW5A 4LBJA 4YSFA 2GC3A 1OA2A 4KG0A 1YC61 5K0UB 5G04L 2VOWA 1RC6A 2VECA 4NWVA 4Z92B 1O4YA 3JU9A 4EN9B 5A70A 2JX9A 1KGYA 1MS5A 1ND3B 3AZVA 1RUG2 2CGOA 3KVBA 4Y26A 2Z79A 4HETA 4CUBA 2NLRA 2JKBA 4XAEA 1HW5A 5GM0A 2DBNA 3ACIA 1S55A 2WO3A 1QXJA 4PJYA 5JPMB 1N1VA 2GDFA 3BI3A 2O8OA 1ASJ2 2PHFA 1DYOA 3CKHA 4EJRA 1DCSA 1H2KA 1R091 4HLTA 1RXFA 2WS91 3A7QA 1YQ6A 2WRAA 4CP0A 1OFNA 2IUWA 1DGRN 4A44A 2WYFA 2VVFA 5C4WB 4QX7A 3UGFA 3KT1A 4JRLA 4K21A 1CX1A 3VZKA 2WUHA 3GZUC 4XF9A 2XBO1 5FZ3A 2QZ2A 4LBLA 4Z82A 5GZFA 3ABZA 2VD7A 3K2OA 1Z7S2 2AEYA 3B94A 2RDRA 3FHIB 1KITA 3I2DA 5JXHA 4XFFA 4LULA 4DRVA 2YROA 4HSLA 5LA9A 3I2OA 1E5RA 2NQYA 5HI0A 5I0DA 1CAXA 3W20A 2V73A 3WVJA 3RI8A 3D8CA 4XFBA 2ZCWA 2ZXQA 3E97A 1S0FA 2E53A 2OUJA 2PTMA 4S2DA 4CU6A 1AR81 5I8YA 4NIHA 1WLDA 1Z7S1 2VBDA 5ABJB 2VAUA 2BRTA 5L9RA 3WD5A 2ZZJA 1HB3A 3PMSA 3NKGA 5FLHA 3LOIA 1X33A 5LK5A 3OEBA 1OQ1A 4HN1A 5JZGB 4BU2A 4LUKA 1VIWB 5T5JA 2RR11 3ACHA 3WDYA 1MQTB 3V0AA 5I8SA 1POV0 1UZ0A 4XFAA 4IW3A 2WS92 3QH7A 4COVA 4AI9A 1HV0A 1R092 2W94A 3B02A 1QNYA 1OLME 2Q30A 2F4LA 1SBEA 1ASJ1 2ZKNA 4HANA 4LKFA 4MX3A 1GQHA 4Z8BA 4RL7A 4QGMA 4ASMB 1ASJ3 2N7GA 1U5IA 3K3NA 1NA1A 2XVKA 4KGGA 3T0DA 1UWWA 2AACA 3EJKA 4Y3OA 3PUSA 5FP7A 3Q8CA 2AR6A 2Q4SA 2X29A 3QD6A 2QQVA 5FO9B 2D6NA 1FOD1 2ZHMA 1W9TA 4PI2A 4QHZA 3WY6A 1Y9GA 1LOFC 5FYVA 2EXKA 1XE8A 2HKXA 5FY0A 1V6IA 1S1AA 5SV5A 1IQDC 5CFCA 3ZSMA 2E7QA 2JDAA 1W0OA 5FPZA 4AVTA 1S0IA 5L36A 1V9U3 2K46A 1UYZA 2WT2A 4KBBA 2IVJA 5I8TA 2NP0A 1IGOA 3ACGA 1F4HA 2BGPA 2WS93 3MDPA 4K8FA 4CZSA 1H8VA 4X8NA 2V4AA 2HWF2 4UWDA 3JCIA 2W0XA 5KXBA 4GKYA 4UF0A 5KHIA 2EIBA 3VBFA 2CTVA 3HNMA 3N9OA 4XAAA 4XXPA 5J1XA 3D0SA 3WCRA 4LKEA 2WFF3 1BVP1 2WWSA 4Y20A 4D6QA 1J59A 3WR0A 2WNVA 2GAUA 2VOXA 4OZXA 3WP3A 5FLJA 4QPWA 3ZSEA 5C5TA 2D6KA 5F3CA 3C3VA 2GNMA 5FUPA 4FPOB 2XLAA 4GULA 2FZ1A 1REEA 2FCTA 4RSUA 1YIPA 3PJQA 3M70A 1RMU3 2Z5WA 4LBKA 5F6KA 1MEC1 3WF1A 4PF1A 3AMMA 1MEC3 1SPPA 5FDBA 5JAXA 2V5DA 4LBQB 2VZVA 1UIKA 4P9WA 3VBRB 1DGLA 4QHOA 3H8RA 1JYCA 1WLWA 3GJAA 3N7KA 4HKLA 4XABA 1H1AA 3WQBA 1X82A 4OHXA 5FZHA 4B3NA 5BNOB 5IT6A 4KNCA 4X6RB 3HQRA 4WM7A 1ND2B 4KBZA 4QWNA 3ZFEA 4J6GA 4JDOA 4E4HA 4YZ2A 3A0KA 4U2AA 3NVCA 1SCSA 2YGLA 5LA0A 4AAXA 3HD8B 1O5LA 1W2TA 1W0PA 1BJQA 4ES9A 1N3QA 3OBAA 3HNBM 4NHKA 1BHGA 1KEXA 4J1WA 3DUIA 4Y22A 3WCSA 3UESA 1N1SA 3TEZA 2J1SA 3N9PA 1GZWB 2P34A 1OSGA 2V4VA 1WCKA 4ZZ5A 5JOZA 5JLVA 5I0TA 5FYBA 4LHNA 5BNNA 2ZMKA 4XEZA 5J36A 2J1TA 2C1FA 1CAVB 4IV3B 2OIIA 2DU0A 1GNYA 1F5JA 3AKQA 4RHV3 2P4EA 5JR7B 1RJ8A 1PMHX 2BNMA 3AP5A 1JBCA 4YM3A 1EV12 2Z4FA 1VRBA 2VVDA 4I09A 4EROA 5JSRA 2BBVA 2YDEA 2YMZA 2Z2SB 1OD3A 4C0HA 3U11A 1BQPA 3H9AA 1WLTA 4Q4W1 4WVWA 1GV9A 3VBOA 4IE7A 3O0VA 2X5IB 5I0UA 2JG8A 5J7MA 1JU4A 2HEYF 1WA6X 3GXUA 2WQZC 4CU7A 4Y5Z0 5T3NA 4OULA 5JVVA 4OQ9A 3U4XA 3LWCA 2VTXJ 2B5HA 3PDQA 3WG1A 4BA6A 4CXYA 1US3A 3TB0A 5ISLA 1F35A 3DPRB 1E5HA 3C7EA 1SZBA 2W3JA 5FUIA 1PIV1 1ZBA1 3KGLA 5FYSA 4BH9A 2XOMA 5KC6A 2P3JA 3C7OA 4HPKA 2RMU1 2R49A 2VW2A 4N7UA 1C57A 2C4XA 2JG8C 1JZ3A 4IV1C 4LORA 5APAA 4LLOA 3ZDSA 2WZPP 4BXFA 2PQSA 3PUAA 2ZX4A 2J42A 1NY71 2TUNA 2P5BA 2H0BA 3LDRA 1UU6A 1UMZA 3R0RA 1BVVA 1NZCA 5E88A 1ZRDA 4TWTA 4AZZA 4LJHA 2XJPA 1DQ6A 4AEDA 3RVHA 1K5MA 3WEZA 1OFSA 1YQ8A 4B7EA 3E6CC 4BIFA 1NCQA 2XONA 2F17A 4P9IA 4WM8A 2VTFA 2ZGQA 4GJYA 1DYPA 2XLFA 3POWA 1MS1A 5ERLA 5A7OA 3QBQA 5T55A 2BVBA 3AYCA 4Y20B 4P5YA 4IERA 2O8QA 2HJIA 3E5XA 3H3ZA 3I3EA 4XQ4A 3M3IA 1JTZX 2VGDA 2D97A 1LOEA 2GC2A 3ZOIA 3FN9A 3USUB 4G4FA 5ACA2 1W28A 2IZWA 1YI9A 2C24A 3AFKA 3FUOA 3JUUA 4K40A 3ZFGC 3KVAA 1DQ1A 1JUHA 3SEEA 3POIA 1OOPA 2EXHA 2W46A 2RDSA 2W1SA 2KXLA 3PVEA 2XWJB 3QACA 3WUDA 1RVF1 3OJBA 1ZBE2 1VBD2 1YQ2A 4GWMA 1RVF3 2D3PA 4YM2A 4D94A 1BBT3 1LHUA 2B7YA 2PHWA 1EV13 2VNRA 3MO4A 3V0BA 4MV2A 5CG9A 1WZXA 3USSA 2PELA 1VMHA 2A75A 4S2GA 2IXHA 2Q8DA 5HCBA 1GP6A 1C1FA 2H0VA 1AL21 1O5UA 1NOVA 3ZXFA 4AEJA 2ZMNA 1SLCA 3AZXA 3DXTA 3WDTA 2W08A 3J7NA 4IQPA 2FMDA 3KV9A 4AI1A 2W5FA 1HLCA 4LK6A 4FFHA 1CN1A 3N7JA 4YVSA 1US2A 1O8PA 2TBVA 4FVVA 4XFGA 5CZKA 3KGZA 2CU5A 4FAGA 1HV1A 5LEKA 2YXSA 3AMNA 4JDNA 4PDWC 2Q8EA 4H55A 4CEYB 2DURA 4I0WB 3TWIA 1Q8VA 4N53B 1CAXB 2NM1A 4OUEA 5J09A 2ZEWA 2FDKA 2WN2A 3DPRC 4YLZA 3P3PA 2R30A 3O7OA 4CSWA 2VU9A 4F83A 4DOUA 1WW4A 5IVEA 3VL9A 1V6MA 2P1BA 2IXCA 1NA1C 5FOBB 3LPFA 3LQCA 3NJXA 1CJDA 3VHOA 1NUKA 1JXNA 2WBKA 1OLQA 4Y5SA 3KMHA 3CJIA 3HQXA 2DUPA 5FXVA 3ZPOA 3AZYA 4BM8A 4E4SA 4UT5A 1AR73 4F8AA 4AVBA 1OF4A 4Y1VA 4XCAA 5DZEA 5JIUA 2FQPA 2ZBJA 3BCWA 1G9DA 1XPWA 5AVPA 4IEZA 4HZFA 4OQ8A 2HBUA 2JDMA 4MGKE 4QT6A 1SG3A 4XUNA 4QQHA 4ATFA 1QJY3 2YYOA 1WCDJ 1LRHA 5F8PA 4CEYA 2X09A 3GYDA 3ZMOA 5F1RA 2J1RA 3JD73 3POBA 3OUJA 3LFMA 4FOQA 1NZIA 1NY72 4A3ZA 4MHUA 4KU8A 2DYCA 1CWPA 2HWD3 3ZN6B 2VY0A 1W2UA 2NMNA 4Q4V3 5C8CC 4MYEA 5L7OA 4JTOA 1NYWA 4FPJA 3P3NA 1V9U2 5LEJA 2XJTA 5KHHA 3RRDA 5LY1A 2VZSA 3OPZA 3V64A 5A3LA 1ND2C 1WA4A 4CXXA 1OHFA 1L7QA 1W8FA 5A7PA 1VBA2 1V0AA 4IL7A 4O9EA 5FZFA 4AHXA 1LHNA 5CA6A 3TAYA 1RHI2 2WAAA 3JZVA 3K51A 2DCZA 1MS4A 2Y38A 3VBRC 4YG0A 3ZXGA 1KQRA 2ADEA 4TSVA 4P9LA 4OHWA 3VBSA 4HN0A 2DTWA 4LT5A 4Q0PA 1DQ4A 1LHOA 1EV11 3E1F1 4GH4C 1D7PM 1PX4A 1RITA 5IVVA 5DZFA 2G9FA 5AFEA 4M0NA 2R042 2WZEA 2XL9A 1OA4A 1Z0HA 4YYOA 4LR4A 4J1XA 4FFFA 2WINB 4YM1A 5AVAA 2BGOA 5F37A 1RUC3 1QH7A 4OI0A 1ENQA 1LB2A 4XJ8A 2BQPA 3FWEA 4FT8A 4Q4X3 3U78A 2WSVA 4W50A 2XUEA 4NUBA 4QPGC 1CIWA 1UX7A 4M00A 3VDBA 2OPKA 5LA2A 2J7MA 2JDYA 1WW6A 3UV9A 1VRH3 2Y33A 1H4GA 1RUOA 3MFAA 5JOYA 3OY8A 1W9FA 1H0BA 3PU3A 3O5SA 2W1UA 3D0JA 3RZKA 1UMIA 3VKMA 2R32A 2WO1A 4XJZA 1A6CA 2MEV2 3R05A 2DWRA 2E63A 1A3KA 3NMBA 4PDWA 4BK5A 3KHBA 5DDJ3 2VM9A 2LS6A 2W47A 3OB8A 1L7LA 1D2SA 4MZUA 1AR62 4YVWA 5EFUA 2HYKA 3OGRA 5GLUA 3RMXA 1K5JA 4COUA 1DGWA 4AR2A 4M3CA 1PZ8A 3MGUA 4W65A 4W6WA 2BBAA 5FYYA 5C3OA 3K77A 3ZXAC 2OQ6A 2XL7A 4AQSA 3UGHA 3B3QE 2ZGNA 2QCSB 2WNUA 1ZNPA 5LBFA 3UKNA 3S0MA 4FP3A 4AVCA 2ZPXA 4XJAA 1YFUA 2B4KA 2OVUA 4AVVA 4CCMA 3H7YA 4CCDA 1JZ2A 5E89A 1CIYA 3UJOA 2JECA 4D0QA 2A6VA 2PHTA 2WO7A 1W0NA 2VUCA 4E2QA 4JGZB 1CZVA 4XHXA 3VZNA 1DQ2A 1IOAA 4Q4Y2 5FIXA 2OPWA 3IBMA 3E5UA 1D0GA 2GP5A 2GMPA 1C3HA 1V6OA 4LE3A 2WZR2 4UFMA 3THDA 2VCBA 4WZFA 1DLCA 3MV01 3S5AA 1TVGA 2G19A 5FQ0B 5FY9A 3M7AA 1LENA 2LTNA 4HONA 3JQWA 4IEOA 4BISA 2Q1MA 3WNXA 3NAPA 1LEDA 1Y4WA 3DYOA 1YJKA 5JXJA 2NN8A 2RR13 2VUDA 1ZM1A 4QDSA 2ZGTA 3LEKA 3IT8A 4AAPA 3ES4A 1JOJA 3MFCA 3ZSKA 1HXS2 4AWDA 4BQ2A 3AZZA 1W39A 3BU7A 1MVQA 3W21A 1T6GC 2YZ4A 5A80A 1V00A 4DZGA 1AJOA 1NCRC 1J1LA 5IVYA 1J1TA 4X8PA 5A6YA 4YGEA 5IUQA 4XXAA 4I2OA 2WIIB 2ZHLA 1JH5A 4GB32 1S2EA 2BOJA 5F3EA 4OFGA 3SC7X 2RMU3 3BTZA 4WVMB 4O61A 2YFZA 4CCKA 4QQPA 1AJKA 1VB2A 5FMBA 3RFRA 1TEIA 4LQRA 4HL0A 1XJAA 5ANQA 1W8UA 3POSA 3BOWA 4IUGA 4XPVA 3ETPA 3S7EA 1VB4A 1FPN2 4BLJA 4HBNA 1RGSA 1RIRA 1ULGA 1W9YA 4NRQA 1X9PA 2DF7A 2FDFA 4CDQA 4P9YA 5GLZA 3VKNA 1PO22 2IWGB 1DF0A 4MSVA 2D5FA 4QPIB 3SH4A 4LHSA 1GR3A 1QHDA 4M3CF 3M8LA 3RG0A 1D4VB 1PVC3 4LKSA 1OVPA 4NWWA 1ALYA 3AL6A 1XYNA 3OCPA 1AYM2 4BIOA 3ZXJA 2O14A 5C7GA 3FHAA 3NKTA 2CDPA 5T5PA 1FXZA 4XF3A 4AVAA 5IAVA 1UD1A 2VMEA 1RUD2 4Z2WA 1ENRA 1JZ8A 2E33A 1OI6A 5FZDA 1KFXL 1W6MA 2YBSA 2XBO2 1MR5A 3J9SA 2QQUA 1RUE2 2XGXA 4FFIA 4RA0A 4FOYA 4FI9A 2EAAA 3S6PA 4DPNA 4BWOA 3N4MA 1H1MA 1QDCA 4FQZA 4YGBA 4HK9A 2BFUS 3J8F1 1IKQA 2ZX3A 1ENXA 3VB9A 3O1MA 4JAAA 1DBNA 5C3SA 1SFNA 4PF5A 2FDJA 5J3UA 4CDUA 3N7LA 5J98B 1WUVA 2UWCA 5FTTC 1PNFA 4GB31 4LITA 4QGNA 5IJRA 5HCHA 2LW8A 1JOBA 1V6KA 1NCQB 2BU9A 2QKDA 5CFCB 1RTVA 5KHGA 2QQIA 3JQXA 2QBXA 4FPLA 4PBOA 4XETA 1K45A 4MVTA 3AXEA 3N36A 4MGIE 4QU1A 3WQ1A 2EXJA 1IS3A 2A7AA 3SCHA 2AEZA 4PLNA 4JGYC 1F5FA 4OHYA 3TRSB 3ZMNA 4A3XA 4QD2A 3KCYA 4YZ1A 1JZ7A 1OPOA 2JENA 3VD4A 1QJZA 3D4KA 5CISA 3AYEA 2WFF1 1CX4A 1DU3D 3AYDA 5IVBA 1VAKA 1HN0A 4JKLA 2WQ4A 4AI2A 1VPHA 4DXSA 1AX1A 2ZGKA 3WP5A 1IZ3A 1GU3A 3T3YA 4XDPA 1ZZCA 2IXJA 3B7MA 2BVVA 3O0WA 3THPA 3WNPA 4PIZA 3DKQA 5DUVA 4Q1RA 4XBNA 1MZFA 3APBA 4Q4Y1 4UI9L 1AZDA 4FXKB 3W59A 2WT0A 2SBAA 2XR4A 2X5IA 3GZAA 2VE1A 2OKXA 2AC1A 2XJVA 3NV3A 3H42B 4DRRA 4BJ0A 1H4HA 1NQJA 1XE7A 5EJZB 2CV6A 3ECQA 5A3TA 3C7GA 1MZ5A 3RZGA 2RS13 4ITCA 2ZEXA 2KA3A 3H3LA 2IVIB 1F31A 1I6XA 2Y6LA 1UZWA 1AR93 5DAXA 3I4IA 2D7FA 4UAPA 5LBEA 3B69A 3SKJE 2YB7A 3FZ3A 3IIIA 1VBB3 2VOKA 4FTBA 1DP0A 1W2AX 4D6RA 1F4AA 4X6QB 3WQ7A 5EZWA 5JI9A 2GU9A 5CG8A 2GZWA 3LIGA 3BN6A 4XUPA 1NCRB 3DPRA 3JXSA 3KLSA 3OBTA 5BPXA 4IV1A 4Q8KA 5F9TA 5FBJA 4BQ3A 5DG2A 5EXOA 3FHQA 4CP9B 1DLLA 4XTMA 5CAZA 2BDRA 5D1IA 1W6QA 2YC4A 1QJU2 3TOJA 2B8MA 2CAVA 1W8WA 2XQXA 4HK8A 3AP6A 1UPSA 2CWMA 5FZLA 1YCIA 1COV3 4I3PA 1O59A 4RR3A 5FMCA 1QEXA 3RWNA 4L9BA 3BPSA 3RSJA 5FZMA 2A5ZA 2VH9A 3MLJA 1W8NA 1N1TA 5FCCA 4NJ4A 2DUOA 4EQVA 2Y26A 3SHRA 2VZPA 3IAPA 5K7PA 1RB8G 4XFCA 5CBLA 3VDCA 2WN3A 1DZQA 4I02A 4R9AA 4XVHA 3BIWE 3RZJA 5K9YA 5I0SA 3IPVA 3O1RA 1UMHA 1YFXA 2J1UA 4XMIA 3ZYGA 1W8OA 4CVUA 4I0BA 4A6OA 2R1BA 2A6ZA 2CWSA 2DV9A 2WLPA 4QGLA 3KCXA 1CAUB 5D8AB 1GOGA 2W68A 4AF9A 2PLV3 5IW0A 3QH6A 1QJX2 1W6PB 2W87A 3EO6A 4YARA 5FYMA 4V1PA 3LEIA 1FAYA 1VBA1 1VAVA 3AJZA 5FYCA 1EAH1 3SQOA 1UZZA 4A41A 3MV11 1L3JA 4QQ2A 1EYBA 1Q8SA 5FZGA 5T5LA 3WX5A 3WF2A 4ZS3A 2R16A 5CFDC 3KT7A 4WM7C 3HVDA 1HB1A 2UU8A 3X29B 1OUXA 1V9U1 4O7XA 3VBHB 4COYA 1UY4A 4OUMA 3WZ1A 2R072 3M3EA 4L11A 1ULFA 4XUQA 4YZ5A 4IEQA 1ENSA 3VZOA 1VBE3 4WBBA 2LM3A 2ZX0A 3WW1A 5JSPA 3DXUA 3RI9A 1VMFA 5FK7A 4LBQA 5DAQA 1J58A 1RUI3 1SPPB 5EIYB 2JD9A 1LGNA 2EVXA 5FZAA 4ES8A 1PZ9A 1GZ9A 1W06A 1SHWB 4CEWC 3R4UA 3MI8A 4QB2A 1MVEA 4AQ2A 4AGRA 3RYPA 3Q9OA 1W6OB 1VBC3 2VO5A 4Z07A 4JDMA 5DMYA 2D40A 4A7ZA 1VBC1 2BFUL 4J25A 4EN0A 4K7JA 3WNOA 1G9CA 1U5YA 1PK6C 4QKNA 3I3BA 2HWE1 5C5UA 1C8M3 1H8TA 4D7YA 4HVQA 2HWB3 1AYN1 1BEV1 3H8OA 2ORZA 1F8VA 1SLLA 5LATA 1Y3TA 4XDQA 5FYIA 1WCUA 1O8SA 4I3GA 1AYN3 1BEV3 2WA4A 4Y5TA 2RS51 2CAUA 3E6DA 2QDNA 4JC1A 4CDXC 1UAIA 5CB7A 2HWB2 5A3WA 4CDXB 1MS0A 4R9CA 3GF6A 1AR63 3AP9A 2EALA 3NV2A 4HMZA 4CA9A 2YV8A 3K4DA 3ITQA 5DAVA 3WOGA 5KXDA 4LBMA 1D4M1 4XJWA 5F5IA 1X8MA 1GWLA 2DVFA 2GALA 3AL5A 4XYXA 5HBAA 4LMFA 3ZN5A 3SH3A 1YEWA 2Z69A 5DUWA 3MIBA 1KDMA 5FPVA 3WG3A 2ARBA 1UZVA 1X7NA 4MXWB 2XLGA 1ZBA3 5E8AA 1W8TA 1W03A 1VR3A 4CDQB 4META 4RN5A 4ZHNA 1AL23 3DL3A 2WDBA 1W2OA 2JB4A 2D44A 1N1YA 2Z42A 3DCQA 3T30A 3T4VA 3ZFFB 4N43A 3KQRA 2VVEA 3TNQA 3O1UA 3B93A 3G6JB 4FOWA 4JQTA 4UFKA 2BOIA 1C5HA 5LRSA 3AKRA 3ZIXA 1AL22 1F9KA 4DMIA 4OHVA 2C0ZA 5CKMA 5IK8A 1XRUA 3T09A 1Q8QA 3GJBA 3I7DA 4OZOA 1W6NA 5GZEA 3MW3A 4XBQA 3FBYA 3P5BA 1PM7A 4BB3A 3OGJA 1TNFA 4XURA 4BK4A 2AUYA 2A73B 2RM22 2VMCA 1DHKB 3GBWA 3S57A 4OMCA 1D4M2 4Y1XA 2PLV1 3POGA 4Y24A 1QNWA 2VZ1A 2AENA 1UZYA 5D2AA 1BKZA 1DQ0A 2E51A 1OMIA 5KBFA 3IPVB 4URTA 3WF0A 4TLFA 5GJ6A 5FPUA 5IVFA 3ILRA 4DQAA 2E7TA 5B4XA 1VBA3 2W95A 4ORFA 1SCRA 1KRIA 5FP3A 5ACA1 1K12A 1OH4A 1OXCA 4QM8A 1W3XA 2MPFA 3TEYA 1Y43B 2X10A 1Y9QA 3NNLA 2PHUA 1W8ZA 3LDBA 3ZXDA 4N53C 4Q4V2 5JI7A 4IGOA 4MUVA 4ASKA 4M3CE 4Y22B 4CEYC 4GJZA 2BW8A 3SH5A 1S0EA 4PLMA 1RUH1 3PNAA 3VKOA 1VBC2 3BTXA 2OZ6A 1RUJ2 3BODA 5LZ6A 5EYYA 1FT9A 4CUGA 1IS4A 2L9LA 3VHRA 2VUJA 4GD4A 4DO0A 3I3QA 2ZGPA 1UOBA 4DINB 1URXA 3O1OA 5CFDA 4Q0SA 2HWC3 5FY7A 3WT3A 1NCRA 1QJY1 3ON7A 5FZOB 1QJEA 3OYWB 1IPSA 5HPOA 4QXCA 4CP2A 2EIDA 5A7WB 1REDA 2GH2A 2XWBB 3N9LA 4N9HA 5JDBA 1S0BA 4LKDA 1QOSA 3D5OA 3KV6A 3C8XA 2JE8A 3O0XA 4NAMA 2MHFA 4M3CB 5FZIA 4K1YA 2FDHA 4QQOA 4GWIA 2Q1FA 1NLRA 3OTFA 1B35A 1D0HA 1VBB2 2P6HA 4YVWB 1PIV2 2J1VA 4A7KA 1KDKA 3VBHA 1I9RA 1XNDA 1OBNA 4PI0A 3DV8A 2P3IA 1EAH2 2OX0A 4NR1A 4ZXKA 3B01A 1STMA 1QJX3 1ST8A 4Q1PA 3ZFGB 5FWEA 4AFCA 2VCAA 4B4QA 1VAMA 3GCXA 4M4PA 2RS12 5C8CA 4IETA 1A78A 1QJX1 4UFLA 2DCKA 3O12A 5FZ6A 3WG2A 1PO12 3PJYA 1B09A 2VUAA 3PTYA 4QXKA 1APNA 3PUQA 4XCBA 1OVSA 1YFWA 3W5MA 1OOPC 1EUTA 5DPNA 2DFBA 3DYPA 1FNZA 3RS6A 1H1IA 4D6SA 2EICA 4AVSA 4AI8A 2LALA 2PAKA 2YPDA 4IESA 3TN92 5DUXA 4LXLA 3ACLA 1JYNA 2VZTA 4MOAA 3ZPYA 4CRQA 4UBHA 3AM2A 4YZ3A 1H6XA 4KI5M 4PQ9A 2X53S 3POEA 2BP6A 2VOVA 4NHMA 1E5SA 3NRUA 3BOPA 5GZDA 1XSRA 4OI2A 3SEPA 4AOCA 2VZRA 4H14A 3LSEA 3OG2A 2PHLA 4CCNA 4GH4A 5AC93 2BJSA 3CLPA 3IN9A 4JTNA 3G7DA 4CYDA 2LUWA 4QX8A 3VZLA 5DG1A 5FYZA 1CD3G 5I91A 2ZGUA 1KXGA 1JU3A 5FZBA 4UYBA 1QQP2 4IEPA 2A3WA 4HKOA 3GZEA 4BQXA 4IV1B 4JGYB 2RG4A 4AHZA 2XDVA 3JD71 5HCFA 5DDJ1 2D6MA 3VGIA 2VOTA 3TNPB 2LRPA 3C7FA 3HWJA 4OCTA 3T1MA 2A6WA 4BPZA 1XU1A 5I0RA 3I2FA 4A2UA 4AFBA 1E5IA 1J3RA 1S2BA 4INDA 2W91A 1KJLA 2BTVC 3I8TA 5FPBA 2RJLA 5ACA3 1SLTA 4AQTA 2XUMA 3ZN6A 1HQNA 1I5ZA 5KC5A 5GLVA 1JUIA 3S7IA 4MGTA 4CU8A 4CDWC 1H2MA 1RUE3 2VZ3A 3MIEA 3N7MA 3HAGA 1G9FA 2DFCA 2D43A 3MHZA 2D3RA 4JGYA 5FYHA 3T08A 3LZZA 4XDOA 3EQEA 3N9QA 3DKWA 1PVC1 2H6BA 2A3YA 5FREA 3RZLA 1YI7A 1CR7A 2R063 4QPIA 1OD5A 1H2LA 2OQ7A 1UO9A 1XE0A 4NMIA 2J22A 5L9VA 3RYKA 3AVRA 4P9JA 1JHNA 1OT5A 1WD3A 4DB5A 1UY2A 2ZTNA 1OKOA 2CYFA 2IXIA 4XIKA 5DQ0A 3WHUA 5A3OA 2HEWF 4FPGA 1G6NA 3WNLA 5C71A 2YUEA 4NN0A 4AEMA 1ODMA 3MLKA 4Q29A 3HT1A 1JOPA 3TN93 3ZX7A 1FPN3 1POQA 1ACCA 2A6XA 2BWAA 5JIAA 1GUIA 2HWF1 3GCWA 3CEWA 4QPIC 3ZYRA 5JMCA 2VR4A 5FUNA 2I74A 3VD3A 1UU5A 1W9WA 1FV3A 1VLNA 4LE4A 3I49A 4A45A 1YQCA 5BUVA 1PVXA 2ZGLA 3LEGA 5A3PA 1PO13 1VRH1 1DGWX 4UFIA 3KSCA 2OYZA 4MXVA 4RQPA 1GOFA 2I45A 4WVZA 5DAWA 1CPMA 5LBCA 3RMYA 3WQ0A 4ZZ8A 1YYNA 2IFWA 1I5PA 1QKQA 3LF7A 4DS0A 3HEIA 4XC9A 5BY5A 4GB33 1FOD2 1R082 1EAH3 5DZGA 1W04A 2PXJA 5BNOC 5FY8A 4RGAA 3ZFGA 5CKNA 4IDZA 5F7UA 3ASIA 5E6HA 5K0UA 3UKTA 1LGCA 3T2OA 1DFQA 4KQ7A 3BU0A 1EPZA 1QOTA 2CDOA 3MW2A 4C91A 5EV7A 1PNGA 3UNPA 4UW4A 4AHWA 4NPLA 1GKBA 1YHFA 5JPNB 4M01A 1AHSA 2GMEA 3J8F2 4U36A 4HG6B 2AH2A 5L7OB 4CE8A 1TME2 2JJ6A 3H1WA 4RHV2 2RR12 1LGBA 4XACA 2ZJCA 1H8TB 4OMDA 1RUE1 2RHPA 2ZS6B 2J1EA 1O4TA 2JDNA 2UYAA 2SLIA 3FC0A 3IB3A 3N9MA 4GWJA 4IE0A 1M06G 4Z2AA 1RUD3 1C8M2 1QDOA 1X9TA 1LOGA 3A23A 3KF3A 1WBLA 3M2MA 1WMFA 4JGZA 1W6MB 1AR82 3J7LA 2RDNA 4K6BA 3WDVA 5FO8B 1DZTA 1NLQA 1QGLA 1JYTA 5FAXA 4JHZA 4ZU5A 1P8JA 1RUJ3 4FFGA 4Q0UA 4W4ZA 4O9GA 4DUVA 2WL1A 2QE3A 2XH6A 3CJXA 3I2KA 3WDXA 4AEKA 2Y60A 2HLEA 2DU1A 1RUF1 2ZA9A 2PQQA 4Y4YA 2WNUB 2FMYA 5D21A 4S2FA 4CUCA 3CL1A 1G9AA 1C8M1 2PAMA 1AR83 2Y0OA 1LESA 4R9DA 2CHHA 4XUOA 5A3UA 3GGLA 3FUQA 2WA3A 1HRI3 2BUKA 3USUA 2ZOEB 2H6CA 1TE1B 4H3WA 1I1EA 1TME1 2VNGA 4K9SA 1UIJA 1N3PA 1XNTA 2JDPA 2VW0A 3IMMA 3MPBA 1HJGA 3GBGA 1OLRA 1W05A 1WMDA 3NNMA 5DAPA 1JZ4A 4GMP0 4P9GA 4CUAA 1QJFA 1KFUL 2OT7A 1KS4A 1QH6A 1ZZ7A 3DN7A 4QX3A 3RGBA 3LB9A 4IXLA 2RM23 2DCJA 2MEV3 1R081 2GSYA 2KR2A 1W90A 1IS5A 3BTAA 4N9IA 2I07B 3T2TA 3MIGA 4QB6A 1R083 3CMGA 2CNAA 5GALA 4QPGA 1MQTC 1PGW2 4I30A 4MLOA 1VRH2 2R061 3PVNA 5JWPA 2ZABA 4AW7A 1O7FA 1W6NB 4BQ1A 3MEPA 3HMYA 5JZGC 5FPAA 5FZ7A 1BXHA 1HXS1 1PMJX 1VP6A 2VMDA 1UOFA 4L0PA 4KWUA 5LW9A 2WNUC 4XHBA 1R64A 2XPJA 1G7YA 1HRI2 2C9KA 2Y6JA 2K2SA 4LA2A 5IVCA 3ZKYA 2W92A 5FO7B 1ODNA 3GHMA 4QX5A 5FP8A 4XUTA 1JW6A 4QM9A 4AFAA 4UFHA 4B1LA 1J3QA 5LCWL 4MHRA 2D6PA 2JE7A 5DXDA 4YW2A 4V2VA 3KCCA 4Q4X1 4UFJA 1RINA 4BQ4A 5KXEA 1ZVFA 3VDAA 3H3UA 3ORJA 4QMAA 4D7SA 3WDWA 2DVDA 1YRZA 2F6BA 4Y1YA 1V6JA 5K4LA 1KD7A 4A7YA 5C6CA 1CESA 1LJ7A 1GZCA 3FLTA 1H8TC 5DABA 5C4WC 5L19A 2RVAA 5EJ1B 5FMOS 1QJU3 5FP4A 1RHI3 4XJ9A 3Q8EA 2HWE3 4L92A 3O1PA 2XVLA 3J26N 1K3IA 5I93A 3BGAA 4P02B 3LGRA 3RZZA 1LR5A 1J84A 5LK7B 2EIEA 3MF6A 1TME3 4IGQA 4NO4A 1QXPA 5C9AC 3K3OA 3LD8A 4LOTA 2VMIA 2QQJA 1SFYA 5CEHA 1AR71 2W2IA 3R6SA 5EHDA 5JCTA 2IXLA 4E8DA 3NV4A 2VCMA 3MYXA 3TEWA 1OUSA 2AREA 3M3CA 4YW4A 5IAXA 2VPVA 3NJYA 1AR92 1VJ2A 3JD72 1FOD3 4ZS2A 4UW6A 4HVRA 4K20A 5K0UC 2DUQA 1MACA 3AYAA 1QQP1 1FMD1 3JB4C 2WZ8A 3K48A 1O91A 4QDRA 5KHKA 2WYSA 4DXZA 4CDWA 3K4ZA 1RUI2 4LLFA 4RS5C 4CPBA 1C4RA 4XF0A 3OD0A 4YVSC 5FXZA 3VBFC 3WW2A 1U5ZA 1GNZA 4C1WA 2NZ9A 2R073 2LROA 3KM5A 4DEVA 1K5MC 3IDEA 2VQ0A 3OPWA 2VQUA 3E5QA 4PCRA 1ZRRA 5FKBA 4RFRB 1YJLA 2DBIA 2UYBA 2R041 2VNVA 2YG0A 3TN91 4CU9A 3VD5A 2DVGA 3LPGA 4NHXA 1BZWA 1GSLA 4WV8A 3AKSA 5CKQA 5A1LA 2AGSA 4MADA 3KV4A 5FMDA 1O3SA 3LIHA 3ZR5A 4CDWB 4EN7B 3SXWA 1PO11 2VQAA 3BUCA 1DDLA 1RMU1 2ET7A 2XJUA 3UYJA 1RHI1 1UU4A 1FNYA 1H9WA 4BMEA 1ZZ8A 2ES3A 1CAUA 2W1QA 4LEJA 3P1IA 3ZKUA 3OUIA 4EYUA 2BERA 3FX3A 1N3OA 4GIQA 4NROA 5A32A 2R0FA 5LASA 1GYKA 5JXGA 4YNIA 2HEVF 1IPKA 4QKFA 1DYKA 3U07A 3IMNA 3NWKA 3TBDA 3VHPA 2E26A 3H50A 5A6ZA 1IG3A 3PMEA 1B35B 2P2KA 5F2WA 4BOWA 3MPPG 1LOBA 2BGCA 2E7AA 4Q8LA 1JN2P 2UWAA 1RUH3 2P17A 1GP5A 3ME2A 5B2GB 4ZPIA 1WCSA 3L2YA 1QJY2 3D6EA 5A3NA 2XBO3 1QQP3 2EAKA 2PHXA 4YRDA 4LPLA 4CXWA 1T6BX 4ZKTB 2PYTA 2XG3A 2QZ3A 3OPTA 2WR9A 5KR7A 1W6QB 3N35A 4LBOA 4N7IA 3A0NA 2G4IA 4YG6A 1YLLA 1RUJ1 1ZBE3 3LA7A 2ZX2A 3WINE 4AYUA 2FDIA 3AVSA 4QAWA 1RUH2 5BNNC 4NE9A 4F7ZA 5KXCA 1QIQA 4GALA 2C5DA 3AC0A 1JHJA 3F95A 1C1LA 1AL0G 3Q8AA 4NIGA
chains in the Genus database with same CATH topology
4BZ4A 3HIFA 5FPXA 2AZ5A 4R52A 5FMOL 3DGTA 2RJKA 4JCKA 2W52A 1IQAA 3SCFA 3V0AB 4FP2A 2WSUA 4WM8C 2AYHA 5JZGA 4IEUA 1POV1 5FOJB 1XXNA 3QLQA 3IM0A 1LEMA 2ZHNA 3LKJA 2QVSB 5F6LB 4WM8B 3POYA 2A71A 4EV0A 1CJPA 1S2KA 1S0GA 3A4UA 4YVWC 4LO4B 4AEDB 1DGRA 4MH0E 2RM21 4W6XA 1WD4A 4RQPB 5T5OA 2Q1ZB 5H9SA 2BWCA 2YHJA 1R1A1 1TQ5A 5H9QA 4S2HA 1D2QA 1OA3A 4FPKA 4Q2FA 5H9RA 1BMV1 5C4WA 2ZGRA 4TZDA 1YUDA 1PGL2 1NE4A 4B4PA 3ZFFA 5JOXA 3R4DB 1KS5A 1Q8OA 1OQEA 3H0OA 4I0AA 4EWEA 4MGYE 1HDKA 1R1A2 4BE3A 4LTAA 3SNMA 5SV8A 3VLBB 4FXGB 2JG8B 1UPIA 2BNNA 4H7MA 1ULCA 5E1RA 3H8UA 5IK5A 1AXKA 3V0BB 2QJVA 1M4WA 4Q4Y3 3M1HA 2WFPA 2ZGMA 4Q4W3 4XBLA 4DNYA 3CJIC 3PLQA 5LRRA 1XNKA 5F5QA 5A33A 4UW3A 3RJ2X 4FPEA 4F3JA 1XQNA 1ZRCA 2EF6A 4N90A 3PHMA 3IIAA 1AYN2 1BEV2 1TNRA 2GH8A 3B9IA 5T50A 2HWE2 1VBE1 2RE9A 1GLHA 2R1DA 3GBFA 3VHNA 4AK3A 2ZMLA 4IEXA 2RS32 5ABJA 1SLAA 1D4M3 4AXOA 4ISQA 1AYM3 2GNTA 3M3QA 1K5MB 5A33B 5FLIA 4FPCA 2Y0IA 1ULEA 4ONUA 3UL2A 3AZWA 3AJYA 5E16A 1AXZA 1LOAA 4RS5B 5J37A 4JQRA 4P5HA 5EYXA 2WC2A 3ZFFC 1AXYA 4UBGA 1OQDA 4CDQC 3VN4A 2R071 1GBGA 2RMU2 3H1MA 3GALA 3VDDA 1ZBA2 2KM2A 1WW7A 4XJUA 1XNBA 1POV3 1RJ7A 4NHLA 3THTA 1FATA 5GLTA 3CU7A 3HBZA 3FE5A 3WP4A 1RMU2 5C9AB 2E6VA 3H7JA 1SBFA 2UURA 4XFHA 1AF9A 3ZSLA 1ZZ9A 3VBOB 2R0HA 2JICA 3FBMA 4NVPA 5D8AA 4Q0VA 3VZMA 4YG3A 2JG9C 2D3SA 2PHDA 2TNFA 4QM8A 4KU7A 3FFZA 1IHMA 4I01A 1S0CA 1TMF2 1SQ4A 3FJSA 2OA2A 2UWBA 3D82A 2GNDA 2B46X 4LUMA 1YIFA 1SEFA 2BPA2 3JB8A 2ARXA 1LHVA 3SLIA 3LAGA 1BK1A 1GZWA 1Q5OA 1FYUA 3AMHA 3WV6A 1YWKA 1COV2 2PN5A 3W9AA 1A8MA 1REFA 4GMP1 5C9AA 1FMD2 1HX6A 3M4FA 2DVBA 4BMBA 3AP7A 2XVGA 4GA9A 1R1ZA 3ILFA 2XJQA 3SISA 2CGNA 1AR91 4QU2A 3VBHC 4WM7B 4QPYA 5BNQA 4OHZA 2GN7A 3J8F3 4NPRA 4LHLA 1MS9A 2VMHA 1FV2A 3FFQA 4DY5A 4DY3A 1AR72 2YC0A 1ZA4A 1Z78A 3M3OA 5HXVA 3LA3A 4GXLA 1Q3EA 3VL8A 5D8AC 4RS5A 4FBFA 1QMJA 2A6YA 3OBRA 5A32B 4ZU7A 4B4RA 1EY2A 1S0JA 3VBSC 4D7TA 1QOOA 1CPNA 2ENRA 1G9BA 2GN3A 3LOBA 4Q4X2 3IDCB 5ABJC 4LBQD 3AP4A 3JBG1 1Z7S3 2JD4A 2Q0AA 4YM0A 2W39A 4XW3A 5T54A 3UKVA 1HRI1 2VULA 3WW3A 1ULDA 3U10A 2ZACA 1H30A 4JRAA 3KB5A 5BXXA 1EP0A 1YO8A 4PIXA 5BV6A 4OUSA 5L73A 2R062 2JDZA 4LA3A 2IC1A 1PGW1 5L7OC 4RR3B 1UKGA 2WNEA 4C0BA 1ND3A 1CGPA 3R4SA 4Z1VA 3FLRA 4YW3A 1RUNA 1VBD3 3CNAA 1BCXA 1O3TA 2UY8A 4IEVA 5GKAC 5CVRA 2VMGA 1O3QA 1GANA 5GLWA 2F4PA 3RDIA 3T1LA 1WBFA 4L97A 3URFA 4P9XA 3TYJA 4AFDA 1NXMA 2HWD2 3EXUA 1FI2A 2ZAHA 1ND3C 3V56A 4B29A 2JEMA 2DTYA 1UL9A 1GICA 2O0OA 3J4UH 4ASLA 2B9UA 2GMMA 3OGGA 4ISRA 4UW5A 1N47A 3W58A 1RUD1 1RUF2 4Q26A 4RD7A 4ZU4A 5AC91 1W6OA 2WT1A 1DZRA 2ZX1A 1AYM1 5J96B 5AC92 2GC0A 2VXRA 2TEPA 2YY1A 3MLLA 5GZGA 1FX5A 1PO21 5T52A 3NO8A 1BYHA 2XB6C 2X8KA 3LA2A 4PBPA 1LTEA 2WNVC 3ST7A 1Y7BA 4XF1A 1CONA 4K1ZA 4YW1A 3NSTA 1FPN1 1YXWA 3SMHA 2WKKA 3E6BA 3N3HA 4HT1T 4W6YA 5JLVA 1WGPA 4RHV1 4AG4A 2PFWA 5HCAA 5TSWA 2HWD1 5CFCC 2VW1A 4N43B 1C5IA 3ELNA 2FZ2A 2PAEA 4FCAA 3KS7A 1H9PA 4R8HA 5FBZA 4AFMA 3MIDA 4WVMA 4TYSA 1MS8A 1NQDA 1RUG3 1VALA 3ZFEC 2VNOA 4AHYA 1W6PA 5JSOA 1RUG1 3MICA 3INAA 4UXAA 3HN1A 2DVAA 1C28A 1PIV3 2BEOA 1V6LA 4CDXA 4YW5A 4Y1UA 1MZEA 2JXAA 3RJRA 1RL3A 1Q56A 4SBVA 5C8WA 1LU1A 3NAPB 1PMIA 3JBG3 2O1QA 4YZ4A 3ZVXA 4XILA 5BNPC 5FQ0A 4FTEA 3NW4A 4FQ4A 3SCGA 4E2SA 3MIHA 3JBG2 2HWC2 3WW4A 2WZR1 1PZ7A 4YFZA 1PGSA 4GKXA 3IWZA 3UJQA 3ZO0B 1CVNA 1V70A 3WDUA 5KWRA 1PVC2 2C9AA 3BALA 3VKLA 3ZIWA 2EIGA 4GMP3 1E57A 3NJZA 3FLPA 4E4DX 1OOPB 2BNOA 2YGMA 2GNBA 3L2HA 4RGGA 3VDDB 4KWKA 3BPZA 3AMQA 2GC1A 4LBNA 4XZPA 1LULA 1AX0A 4XQDA 1G86A 3AKTA 1AUYA 2XJSA 1LOFA 1ONAA 4FO9A 2ET1A 4M0HA 3RYRA 2UY9A 1AR61 2QUOA 3C2UA 3ZXKA 4RR3C 4FPFA 2JG9A 4OVEA 2EXIA 2MEV1 5FRAA 5DDJ2 3CO2A 4PLOA 1DIWA 3NV1A 4EWDA 4ATEA 5BNPA 1GFF2 1COV1 4KG8A 4PIYA 4OLLA 4XIOA 1HXS3 2CGPA 3L9JT 1HRV1 3GZTB 2D98A 4L99A 3ENRA 3EBRA 4D3WA 1QU0A 4FPYA 1PHMA 2ZAAA 1UKRA 2Q5TA 2B42B 3VV1A 1TMF1 4OI4A 5C33A 2B39A 5K8SA 5KHJA 4SLIA 4YFWA 4JGZC 4Q27A 1IKPA 1GQGA 1ZYBA 2WZR3 3GHNA 3VBSB 4G9SB 2D6OX 4QQLA 1O4ZA 4R4XA 3B9CA 4B7KA 2ERFA 1XYPA 3ES1A 1LOCA 3QOPA 1WMEA 1GNHA 3KT4A 3PVOA 4AI3A 4XFIA 3MZHA 2Q8OA 2DCYA 1U0AA 2RS11 1CQ9A 1X8EA 1CAWA 3AXDA 1V6NA 1UF2C 1EPWA 5CU1A 2ZGSA 1X50A 3I54A 1BBT1 4C90A 4BCUA 3HR9A 3WP6A 4Y1ZA 1LECA 4Q0QA 1NLSA 1VBB1 2ZHKA 1SBDA 3IDBB 2B45X 4KH9A 4XMAA 1MQTA 3AX4A 1R093 4KWLA 2CY6A 1NG0A 2XKOA 4FAHA 4GWNA 4C1XA 5IK4A 1PK6A 2OUHA 4QPGB 1QF3A 2IXKA 2YPJA 3AK0A 3UK9A 3ZXEA 3OF1A 3VBUA 4JVAA 2XHKA 4CDUC 2RS31 3AMPA 1ZZBA 4E2GA 1X36A 4HSJA 5CNAA 3B00A 3WLUA 2JG9B 1VBE2 1RUC2 5CADA 4GH4B 5DUUA 4Q4V1 2OW4A 5JOWA 3LCPA 1LHWA 5IK7A 1IS6A 3MIFA 3VBOC 2NMOA 2RS53 4QHBA 4DFSA 2R043 1Q43A 3VBUC 3ZYIB 4IEYA 4AQ6A 4G3YC 3V65A 4BHPA 4XTPA 4JV4A 2ZKLA 2JE9A 3VBUB 2NPIA 2PLV2 3ATGA 1C8NA 3KZ4C 4YGCA 3AKPA 3ROUA 1ZREA 2XKPA 1YNAA 3RQ0A 1PK6B 2OZJA 1FMD3 3WXPA 5C8CB 2WLQA 1G8WA 4LHKA 4WVVA 4CDUB 1LU2A 1OKQA 1SLBA 2ZGOA 1F2NA 2MNGA 4KWJA 2HWF3 1WLCA 1HKDA 3WHTA 4CEWB 1PGL1 4XQWA 4EN6B 1BMV2 4HFSA 1TMF3 2A70A 5BYNA 4P14A 4B8EA 3BB6A 4FOVA 3QCWA 1CAWB 3ZN4A 2FHRA 1SDWA 2ILMA 3FMGA 1ZRFA 4R9BA 1VBD1 1ZBE1 3AFGA 4AGVA 5CFDB 2ATFA 1RVF2 4MGZE 4LO8A 5J48A 4LO6B 4HKWA 2QQPA 1JYIA 1U12A 1NA1B 1NE6A 2HWB1 3LSDA 4GQ7A 5EJ3A 3NL1A 1XNCA 2RS52 4K3UA 1SACA 1KJRA 3MF9A 3CJIB 2DCTA 4COWA 1A8DA 1J3PA 4OI1A 5A3MA 4YGDA 1QY4A 2D6LX 4FTSA 1RUC1 3ILNA 2PHRA 1AVBA 1HQLA 3GNEA 4PDWB 3SITA 4EWAA 3U0ZA 2NYYA 1HQWA 4L8QA 5GZCA 4XF4A 3DF0A 2QFEA 3MW4A 2FBEA 3VZJA 1ZZ6A 3VKFC 4AI0A 3IKWA 2RS33 1O3RA 4BYYA 4KL1A 2XJRA 3I59B 4RQPC 1DQ5A 4L2NA 3WUCA 3ZXLA 4LO7A 1LCLA 2ZZQA 4AEDC 3ZYJB 1ZX5A 4EN8B 1MS3A 4HPKB 1MZ6A 1BBT2 1XU2A 1HIXA 5H9PA 2WJSA 3ZYPA 1S0DA 4MXWA 2P3KA 3B5LB 2QDRA 3VUOA 4Q4W2 3PVBB 3VDDC 2IFRA 1LKNA 3RNSA 1Q8PA 4LNVA 2VG9A 4FPHA 2D5HA 4D69A 5CIRA 3OD4A 3ETQA 1R1A3 4E9KA 1UCXA 5BNNB 2V09A 4LO5B 3I59A 2EA7A 4IEWA 1DG6A 4R4ZA 4CTEA 4KGQA 1CAVA 4AE2A 1UN1A 4H7LA 2G9GA 4XE9A 1HRV2 2D93A 3KD4A 5FFOC 3S30A 4E27A 3O14A 5BNPB 3AMMA 4XQ4A 3V64A 1RUI1 3RPQA 2BYVE 2V5YA 1YFYA 4E4ZA 3ALQA 3OY8B 3NAPC 1QJU1 1OPMA 1I3HA 1QWRA 4NOTA 1PO23 1B35C 3ZSJA 3HT2A 2K9ZA 3WG4A 5EWSA 3H1YA 2QNKA 1ND2A 4WZCA 1XYOA 1UW8A 1UX6A 2P37A 3CF6E 1NCQC 5AFBA 4COZA 3ZFEB 2I2SA 1SLIA 2PA7A 4CP1A 5BNOA 2A3XA 2ETEA 2X5IC 4RFT0 4FSJA 4N43C 3OYWA 3AB0A 3VBRA 1MEC2 2R6QA 2E9QA 1LODA 4XOGA 1SMVA 4N53A 4IV3C 1HRV3 2CL2A 2WNVB 4HVOA 1RUF3 2HWC1 1H2NA 1AX2A 3VBFB 4YVSB 1IPJA 1NXD1 1U5XA 3EHKA 2WFF2 2K0GA 1QXRA 4CEWA 4AGGA 4BLIA 4IV3A 1WW5A 4LBJA 4YSFA 2GC3A 1OA2A 4KG0A 5K0UB 2VOWA 1RC6A 2VECA 4NWVA 4Z92B 1O4YA 3JU9A 4EN9B 2JX9A 1MS5A 1ND3B 3AZVA 1RUG2 2CGOA 4Y26A 2Z79A 4HETA 2NLRA 2JKBA 1HW5A 5GM0A 1S55A 4PJYA 1QXJA 5JPMB 1N1VA 2GDFA 2O8OA 1ASJ2 2PHFA 4EJRA 1H2KA 1R091 4HLTA 2WS91 4CP0A 1OFNA 1DGRN 2VVFA 5C4WB 3KT1A 4JRLA 4K21A 3VZKA 3GZUC 4XF9A 2XBO1 2QZ2A 4LBLA 4Z82A 5GZFA 1Z7S2 3B94A 3FHIB 1KITA 3I2DA 4XFFA 4LULA 4DRVA 2YROA 4HSLA 2NQYA 5HI0A 1CAXA 2V73A 3WVJA 3RI8A 3D8CA 4XFBA 2ZCWA 3E97A 5I8YA 1S0FA 2PTMA 2E53A 2OUJA 4S2DA 1AR81 1WLDA 1Z7S1 5ABJB 3WD5A 2ZZJA 3PMSA 3NKGA 5FLHA 3LOIA 1X33A 5LK5A 1OQ1A 4HN1A 5JZGB 4LUKA 1VIWB 5T5JA 2RR11 3WDYA 1MQTB 3V0AA 5I8SA 1POV0 4XFAA 2WS92 3QH7A 4COVA 1HV0A 1R092 3B02A 4AEMA 1QNYA 2Q30A 4MX3A 2ZKNA 1SBEA 1ASJ1 4HANA 4Z8BA 1GQHA 4RL7A 4QGMA 4ASMB 1ASJ3 2N7GA 1U5IA 1NA1A 2XVKA 4KGGA 3EJKA 2AR6A 2Q4SA 2X29A 3QD6A 5FO9B 1FOD1 2D6NA 2ZHMA 3WY6A 1LOFC 5SV5A 2EXKA 1XE8A 2HKXA 1V6IA 1S1AA 5CFCA 3ZSMA 2E7QA 1W0OA 5FPZA 4AVTA 1S0IA 5L36A 1V9U3 2WT2A 4KBBA 5I8TA 2NP0A 1IGOA 3MDPA 2WS93 4K8FA 4CZSA 1H8VA 4X8NA 2HWF2 3JCIA 2W0XA 5KXBA 4GKYA 5KHIA 3VBFA 2CTVA 4XXPA 3D0SA 3WCRA 2WFF3 1BVP1 2WWSA 4Y20A 1J59A 3WR0A 2WNVA 2GAUA 2VOXA 4OZXA 3WP3A 5FLJA 3ZSEA 2D6KA 3C3VA 2GNMA 4FPOB 2XLAA 4GULA 2FZ1A 1REEA 4RSUA