2ZGMA

Crystal structure of recombinant agrocybe aegerita lectin,raal, complex with lactose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
total genus 39
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgmA00
1DYPA 4XTPA 1LEMA 1FX5A 3VKMA 2A70A 3ZXEA 2JD4A 3ZVXA 2YY1A 1S0DA 4PQ9A 4K21A 1V6KA 4XOGA 4YGDA 4YW1A 2E51A 1A3KA 1IKPA 1G9DA 2DVDA 3AYAA 3OYWB 3UK9A 1LHWA 1BYHA 2D6MA 2CY6A 4AWDA 4BOWA 3LSDA 2LALA 1MVQA 1KRIA 4YFWA 4GXLA 4XIKA 1W6PA 1ULEA 2NMOA 3M3EA 4WVVA 2ARXA 3OBTA 3AXEA 1B09A 1IS5A 1S0BA 2BQPA 1C57A 5T5PA 1AZDA 4BMBA 1IS4A 2XG3A 4YG0A 5EYYA 5IK7A 2A75A 1WUVA 2GMMA 5IK8A 1N1YA 3RG0A 3A4UA 5GJ6A 1MS4A 3T2TA 3ZYRA 5GZDA 3B01A 3UJQA 4IQPA 5T50A 1AVBA 4ZXKA 2ZA9A 3OJBA 1HLCA 5IK4A 1YIFA 1DQ4A 1WD3A 5GLVA 3AJYA 3FLTA 4FPCA 1JBCA 1FV3A 1SLBA 2P3IA 5JOXA 4XHBA 4TZDA 4K20A 3NV1A 1MS8A 5GLWA 3ZSJA 1A78A 2DU0A 3WUCA 5JOYA 4AVSA 2EALA 1JHNA 2P2KA 2XB6C 4XHXA 4AGGA 2ZMLA 4YM3A 3PMEA 1N1TA 3AP6A 2D6LX 4FQ4A 4ITCA 1AXKA 4FQZA 3ZYPA 3AZVA 1V6IA 1Q8OA 5T5OA 2CTVA 3VV1A 1W6OA 1Z78A 4Q8KA 3N7KA 1UZZA 4FPKA 1MS0A 1JYIA 1WW5A 1AXZA 4XBNA 3WDUA 1GKBA 3W59A 1DQ5A 4RL7A 4CTEA 3M1HA 4Y20B 3VKLA 4R9AA 2A3WA 1V6OA 1LENA 3V0AB 2E7QA 4RA0A 2LTNA 5DG1A 4R9DA 1SLAA 1H30A 1WLWA 5AVAA 1S0EA 1Q8SA 4YZ2A 1DBNA 1LOFC 2A3YA 2WNEA 3I8TA 4YW2A 3USUB 2JE7A 3O12A 4AVVA 1URXA 5KXDA 3A0NA 3IPVA 1LOBA 2DYCA 1LTEA 4FPOB 4HANA 1UPSA 4Y1VA 1D0HA 3AP7A 2WT1A 2JKBA 3WDVA 3APBA 3AFKA 1IOAA 1VAVA 1ENSA 1LESA 1O4YA 1WLCA 4WZFA 2A71A 4DS0A 3BIWE 2EF6A 1LU2A 2V5YA 5T54A 3V64A 4YFZA 3U4XA 3N36A 2P37A 1AJOA 1FV2A 3VKNA 5IT6A 2D3RA 1ULGA 3AK0A 2CYFA 1MS9A 1CJPA 1MS1A 1GZWA 2EXIA 2KM2A 2OUJA 3UJOA 4DQAA 3IPVB 1RIRA 2A6XA 1WBFA 4YW4A 5GLTA 5GZGA 1LGCA 3TAYA 3WCRA 1BJQA 3RS6A 3HN1A 4Y22B 3ZPYA 1GZ9A 2OVUA 4YM1A 1BZWA 2P3KA 2SBAA 1UAIA 2GN7A 3IM0A 3ILRA 4H55A 3NV3A 2WKKA 4FPGA 4Q26A 3WLUA 1KJRA 2GALA 4Q1PA 1MR5A 4UW6A 4YM0A 1DHKB 3BTAA 3ZSLA 3ZSMA 5GALA 2HYKA 3MW3A 4XMIA 1MVEA 2G4IA 1CESA 2GMPA 1TEIA 1W6QA 4ZKTB 1G9FA 2DVAA 2UURA 3N7LA 1G9BA 4P9XA 3IN9A 4FVVA 2WQZC 4FOQA 2UWAA 3B3QE 1LU1A 1NLSA 1W6MA 5T5JA 1LOEA 5GZEA 1ULCA 4PCRA 4F83A 3D5OA 2A6ZA 3JU9A 1FNZA 1GNZA 3R4UA 4FPFA 1UKGA 2ARBA 2C5DA 4Y1UA 2CL2A 2ZHMA 1JN2P 1S0IA 1SFYA 4FP2A 4DRVA 2ZGRA 1R1ZA 1GLHA 4YZ4A 2D43A 2D6KA 1BQPA 4M3CA 1APNA 3HR9A 1SLLA 1S0GA 1QDOA 1RITA 5KXBA 2VY0A 3ZSKA 4BMEA 3AP4A 1QOOA 1JXNA 3POYA 2NN8A 4PBOA 5H9PA 2DWRA 3N7JA 3AP5A 3DUIA 2E53A 4FOWA 2VW1A 2H0BA 4YW5A 1G9CA 4FP3A 4YM2A 1GSLA 3N3HA 4XBLA 2WSUA 1Q8VA 2E7TA 2ERFA 1X50A 3OBRA 2YMZA 5F9TA 2AYHA 4ASMB 1IS3A 1W0OA 2WSVA 1SBFA 3AXDA 1G86A 3PVOA 3AP9A 3WG3A 4BLIA 1KJLA 1S1AA 2NYYA 1LODA 1AJKA 1LHOA 4FPJA 3N35A 4M3CF 1W6MB 4FOVA 4WVWA 3IKWA 3WUDA 4XIOA 1CPNA 3V65A 5EXOA 2VW2A 1Y7BA 1GANA 5GZFA 1H9PA 2W52A 4Y1ZA 1Q8PA 1QGLA 1HKDA 1ZA4A 2UWCA 5E88A 1LHUA 3FUOA 1J1TA 3VKFC 1QDCA 4XXPA 2ZHNA 2DUOA 2VH9A 5GLZA 1FYUA 4YGBA 3WDXA 4K1YA 1O4ZA 4LBOA 1EPWA 4XTMA 5DZEA 2DUQA 2A6VA 1NXD1 2CWMA 4ISQA 2DVFA 1LHVA 2ZKNA 3AYCA 2W39A 4LBQD 4XYXA 3MW2A 1HDKA 4Y20A 1N47A 4Q8LA 5HCAA 3ENRA 3O5SA 5JOWA 2NP0A 3NV4A 1RINA 4LBMA 4M3CE 5EWSA 2OUHA 3PVNA 3LSEA 3WCSA 3O0XA 5DXDA 3M2MA 4GWNA 4LBQB 2R0FA 2ZZJA 5JOZA 1Q8QA 1GNHA 1V6LA 3GNEA 3ILNA 1IS6A 1OFSA 3KQRA 4Q2FA 4JRAA 4XE9A 5DUVA 2D6OX 2R16A 1ZM1A 4TYSA 5E89A 1UZYA 1MZ6A 5JLVA 1UX6A 1QNYA 3MW4A 5T5LA 3I4IA 1IKQA 4LBKA 1SLCA 2RHPA 1YYNA 4LBJA 4UW4A 3WNXA 4YG6A 5T55A 3VUOA 3AYDA 2ZGSA 2DTWA 1UMZA 1W6NB 3B00A 4FPLA 5H9QA 3RSJA 1DQ1A 1N1VA 1SBDA 2ZGMA 2WT0A 4Q1RA 3ILFA 3M3CA 4BQ1A 4ISRA 1CONA 1C4RA 3T1MA 1JW6A 4PBPA 3DGTA 3WG2A 3SNMA 2D6NA 3ZXKA 5JDBA 3BODA 2WJSA 1DQ2A 1JYCA 1S0FA 4C1XA 4GKYA 4MYEA 3N7MA 4SLIA 4CZSA 1LEDA 1QOTA 5DUUA 1C1FA 3H0OA 3V0BA 1A8DA 1W6QB 1UN1A 1V6NA 4L8QA 3WG4A 5CAZA 1MS5A 1S0JA 2GN3A 3OGGA 2UU8A 4BPZA 1G8WA 3AZWA 1OQ1A 3ZXJA 4YZ1A 1Z0HA 3WDWA 3Q9OA 2FMDA 1JOJA 5HCFA 4XZPA 1LGBA 2V73A 4YZ5A 4M3CB 3SH4A 3A0KA 2VW0A 2JE9A 2E6VA 2A7AA 1GBGA 3WDTA 1GZWB 2D44A 1N3PA 1W6OB 2ZBJA 1MS3A 3RQ0A 2EIGA 3ZXLA 2PHRA 4AVTA 1AX1A 2D3SA 2ZGLA 4BLJA 1PZ8A 1CN1A 3CNAA 2D3PA 4UW5A 5IK5A 4XJ9A 2DV9A 1FATA 4XJAA 2AENA 3FFZA 1OKQA 1W6PB 1C1LA 1CIWA 4YW3A 1DIWA 3HMYA 4Y1XA 1V6JA 2TEPA 1DQ6A 1MACA 3WG1A 2JDZA 3B9CA 5CBLA 1ULFA 1BXHA 1KDKA 1SLTA 3OYWA 4FOYA 3W58A 3D6EA 5T52A 4AGVA 3QLQA 1G7YA 4XJWA 1VAMA 2AH2A 3AZZA 5DZGA 3FLRA 2ZMKA 4GALA 1SCSA 3POSA 1I1EA 2DTYA 4GA9A 1YRZA 5BYNA 1LECA 1F31A 3FBYA 3TB0A 5HCBA 3B69A 4P14A 1LOFA 1YO8A 2ZGNA 3INAA 3BOPA 3UL2A 3WDYA 1WBLA 1LULA 3LCPA 4Y26A 3ATGA 2JECA 2P3JA 2WT2A 5FREA 2ZGUA 5GM0A 2D7FA 3PVEA 2EXJA 3AYEA 2ZABA 4FPYA 3KM5A 3R4SA 3FLPA 4GWMA 2NZ9A 5DUWA 1VIWB 1N3OA 4UW3A 1VLNA 1GV9A 2PELA 2P34A 1DGLA 3RRDA 3M3QA 1LHNA 3AZYA 1F9KA 4C1WA 2C9AA 1LJ7A 1U0AA 2DVBA 2W08A 1W0PA 2ZGQA 3ASIA 1WW6A 4LBNA 4U36A 2WLQA 1CQ9A 1KDMA 1AF9A 2CWSA 1WD4A 4NO4A 5DUXA 3SISA 2R1DA 4XJZA 2GNMA 3WHTA 3GALA 2YROA 2A5ZA 5CNAA 4BM8A 1AX2A 2ENRA 2DURA 2PHWA 2R0HA 3M3OA 1YXWA 3OY8B 4JCKA 5KXCA 2AREA 1QMJA 1LOAA 1QNWA 1LGNA 2PHUA 1SLIA 3O0VA 1QU0A 2ZACA 3FUQA 1AX0A 3MEPA 1VALA 2YZ4A 4PF5A 4YGEA 4Z8BA 3MPPG 1ONAA 2VUAA 4YG3A 2FHRA 5JMCA 5LK5A 1DQ0A 4GKXA 3V0BB 1KQRA 4WV8A 1WW4A 4U2AA 4ATFA 3WZ1A 3RMXA 3V0AA 1HQLA 5GLUA 3L2YA 3SH5A 3ZXFA 5KXEA 4AGRA 5DG2A 3WV6A 1DYKA 1G9AA 1PZ9A 3AZXA 4Y22A 2W68A 4XXAA 5CA6A 3C2UA 2ZHLA 2A3XA 2VXRA 1V00A 2ES3A 2GMEA 2NMNA 1YI7A 4R9CA 4AYUA 2DVGA 4Y1YA 1HQWA 2ZGPA 4YZ3A 4LBQA 3JUUA 2ZMNA 4XBQA 3WOGA 3SLIA 2A6WA 3O0WA 4XILA 4CRQA 3OY8A 4M00A 1ENRA 1PZ7A 1CPMA 1Q56A 1V6MA 2R1BA 1FNYA 1KITA 4DPNA 2B7YA 5FRAA 1WCSA 3T1LA 3IMNA 5EYXA 2YV8A 2EXKA 2GNBA 1XQNA 1ENQA 1W6NA 2I2SA 4XMAA 3USUA 5JVVA 1CR7A 4P9WA 3SITA 4M01A 3QCWA 1BKZA 1DFQA 1QOSA 3OPZA 2CNAA 1H9WA 3NV2A 3PJQA 4FPHA 4JC1A 4R9BA 5L73A 1GICA 1SBEA 1LOCA 1S0CA 2GNTA 3VKOA 2EAKA 1LCLA 2AR6A 3R05A 4K1ZA 4D69A 1FAYA 2AUYA 1N1SA 3NWKA 3D4KA 2A6YA 4DRRA 3AJZA 1AXYA 3WHUA 2JJ6A 4LBLA 1SCRA 2Z42A 5CB7A 1D2SA 3POWA 4XJUA 5H9RA 1N3QA 1GZCA 1DLLA 1F5FA 2PHFA 2ZHKA 3WVJA 2DUPA 2PHTA 4XDQA 5H9SA 1WW7A 4Q27A 4P9YA 5GZCA 2AGSA 2ZGKA 1CVNA 1DZQA 2OW4A 2D6PA 5SV8A 3AX4A 2PHXA 1QKQA 1GYKA 1SACA 2UWBA 3RMYA 2GNDA 4FPEA 3SH3A 4KBBA 2YXSA 1WLDA 4W65A 2R49A 1JUIA 2DU1A 4XJ8A 5F5QA 1ULDA 2VU9A 1I3HA 1UL9A 2ZGTA 2GDFA 1LOGA 2Q5TA 1QF3A 5IUQA 2ZGOA 1MZ5A 4Y24A 4YLZA 4DFSA 4OZXA 4YGCA 5E8AA 2SLIA 2ZAAA 4NOTA 4ATEA 4HL0A 4I30A 2EXHA 5DZFA 2NM1A
chains in the Genus database with same CATH superfamily
4L2NA 2HWC2 3NW4A 1DYPA 5FQ0A 5FOJB 1LEMA 1FX5A 2IUWA 1C8M2 4AI1A 5LWBA 2A70A 2HWF2 1KXGA 2RM23 1QXRA 1W8TA 4Z07A 2E7AA 2HWB3 4LO7A 4PQ9A 3CJXA 2P6HA 2IXHA 2WS91 4XOGA 4QU2A 4YW1A 1A3KA 1ULPA 2HWF3 2RM22 1HQNA 1W2NA 2QDNA 1NYWA 3OYWB 1LHWA 1BYHA 2D6MA 2QKDA 2CY6A 4XACA 1RTVA 2Y0IA 5F8PA 3J7HA 2PA7A 1CZSA 2HWB1 4HT1T 4YFWA 4Z2AA 4BQ5A 3ST7A 2FDKA 1UOFA 2HBUA 5D21A 2NMOA 3M3EA 3DF0A 4TLGA 5A1FA 4Q4W2 4OMCA 3T0AA 4Q4V1 3VDDC 3LA2A 3LGRA 1IS4A 2XG3A 1K5MC 1RUJ1 5EYYA 5FMOS 3CLPA 3OSDA 1QJU1 2DCZA 1PGL1 5FZ7A 2VTXA 2WC2A 1WMXA 2E32A 3BOWA 3A4UA 3QBQA 4HKOA 1F4AA 1MS4A 3KGZA 4Q4Y2 5K7PA 4LT5A 4IQPA 4Q4V3 3WQ1A 1GOHA 1GWKA 5LBCA 1K12A 4HN1A 4C91A 1QHDA 5FY9A 5GLVA 4XUTA 2VMFA 1XYOA 4FPCA 2VG9A 4B4PA 3PL0A 2V4VA 2Y6HA 5FBJA 4IGQA 2XWJB 1ZZCA 1GP4A 5GLWA 3VN4A 3ZSJA 4BQXA 3D3AA 4L11A 4AVSA 1W2TA 3F95A 4D94A 2P2KA 4QXCA 5A1AA 4LO5B 4L9BA 3AMMA 3AL5A 2ZMLA 4IEXA 4ITCA 4FQ4A 2VQTA 4IERA 2QQVA 1AXKA 1YNAA 4FQZA 3TEXA 3ZYPA 4B4RA 3AZVA 2WIIB 1V6IA 4MGTA 2QE3A 2CTVA 3VV1A 1W6OA 4HVQA 5L7OA 3IB3A 2DCTA 1JHJA 2W1UA 1AXZA 3ZFGA 2Q4SA 5FY8A 2YU2A 3WNOA 2YHJA 5LATA 1F2NA 3IWZA 2IXCA 3KCYA 4BQ4A 5L9VA 4JKMA 2VMDA 3EO6A 3VL9A 3U10A 1RUH2 3VKLA 2ADEA 3NRUA 4GMP0 1CZVA 2HWB2 1UX7A 2O0OA 1V6OA 4ZU4A 3KCXA 3OG2A 2VGDA 4ET7A 2YBKA 3BU7A 5K0UA 1AR61 2W47A 4Q29A 4ASLA 3I8TA 1LOFC 4JVAA 3J8F1 1RMU2 5FXWA 1UW8A 2JE7A 1RUD3 1WLTA 1Y9GA 3WP5A 3HT2A 5KXDA 4FPOB 1LTEA 1AYM2 5FP3A 3AFKA 3HQRA 1ENSA 5FZ1A 1COV2 1LESA 1O4YA 1WLCA 3GJAA 2A71A 4XUPA 5BNQA 1H1IA 1QJFA 2BJSA 3BIWE 1RUG1 4FXKB 4M0NA 2EF6A 3U11A 2V5DA 1ASJ2 2V5YA 3LEGA 3WD5A 2RS12 1CD3G 2KR2A 2P37A 1ZNPA 1XSRA 4AHZA 3T2OA 4AFAA 5AC92 4E2QA 2VTFA 4EROA 4DQAA 4NJ4A 2OZJA 2XUMA 3ACLA 2VJXA 4GH4A 3HN1A 5A3PA 5BY5A 4AEDB 3SH4A 4Q26A 4NPRA 3IM0A 2YFZA 2VCCA 3DYOA 2WKKA 3TYJA 3CHXA 3NKTA 1CAUA 1W8OA 4LLOA 4YVSB 5F1RA 3KVBA 3V0BB 4UFMA 5HCHA 4NIGA 4HXCA 3NNFA 3BTAA 1X82A 4OHXA 3WQ7A 2OXBA 4A45A 1E57A 2HYKA 2R063 2Y6GA 2UY9A 2Z2SB 5DDJ1 1MVEA 1CESA 1TEIA 3WEZA 2IFWA 1G9FA 5AC93 1G9BA 3N7LA 4OI2A 1AUYA 2VAUA 4PIXA 4P9XA 5FLHA 3IN9A 5FLJA 1OH3A 4FVVA 5FLIA 3I3DA 3E6BA 1W6MA 1RGSA 2B45X 3O1SA 5GZEA 4FAGA 1XNTA 3DPRA 2Z5WA 3JU9A 4GWIA 3S7EA 4INDA 4FPFA 3RDIA 3T30A 1UKGA 2ARBA 3K46A 1JYNA 3HNBM 2VZVA 1MQTB 1JN2P 5CKQA 1AR73 4UBGA 4AHYA 4XF4A 4DRVA 3S57A 2FCTA 1R1ZA 2MEV3 2RR11 2RJLA 4DUVA 2D6KA 5IAVA 5KHIA 3KV6A 3TNPB 1APNA 1QQP3 4PJYA 5FZLA 1SLLA 4CDQA 2PLV3 4LQRA 3POIA 3R6SA 4K7JA 4GULA 2VY0A 2XUEA 4BMEA 1ST8A 1VRH2 1JXNA 4BU2A 5H9PA 2DFCA 3WQBA 3AP5A 2E53A 2FQPA 3WF0A 4Z92B 4YW5A 5FZEA 4GAZA 3C7GA 4FO9A 2ERFA 3Q8BA 4KMQA 1X50A 4CDWB 2RS11 4ASMB 3USSA 1PO12 4B7KA 4EWEA 5BNOB 5IFPA 1SBFA 4OQ9A 1G86A 2R061 4LO8A 4UXAA 4BLIA 1ZRDA 1D4M1 2NYYA 1RVF3 4DIQA 1FMD3 1LHOA 2JDNA 4D6RA 2WYFA 1X7NA 1JMUB 1OA2A 1RUC2 2G9FA 3IKWA 4MADA 4WVWA 1MZEA 1OKOA 1F5JA 3WUDA 4A7ZA 1W3XA 4LE4A 1J3QA 1Y7BA 2AEZA 4Y1ZA 5FP4A 4RS5C 4JDNA 1GMMA 3PHMA 1REEA 3KMHA 3O1RA 1WCQA 1JZ5A 1GOGA 1NAEA 1OPMA 4K1YA 1O4ZA 3WDXA 4AEDC 3ABZA 4ISQA 2CWMA 2ZKNA 1LHVA 5CKMA 1OH4A 2P4EA 1JZ8A 1YQ6A 1K5MA 5LY2A 3LFMA 1N47A 2B42B 1JYVA 4IV1B 4A42A 3NV4A 4LBMA 4HONA 5EWSA 3PLQA 2JDMA 3KGLA 1O8SA 3LSEA 3LDRA 4L97A 2CU5A 4GWNA 4KWLA 2R0FA 2FDJA 2ZZJA 2X09A 1OD5A 2D6OX 4TYSA 2EIEA 3P6BA 3JQWA 2WZR1 4PDWA 4IW3A 5FJHA 5T5LA 1JYXA 1TMF3 4CDUC 3S5QA 1SLCA 2XBO2 3RZKA 2PAMA 4XFHA 4GB32 4MGZE 2XHKA 5H9QA 3B00A 4FPLA 5FO7B 1N1VA 2ZGMA 4Q1RA 1C5IA 2TNFA 2WT0A 3M3CA 3C7FA 2VZSA 5JSRA 4ISRA 4CP9B 2DCJA 1C4RA 3M8LA 3NAPC 3NJVA 1HRI1 4PBPA 1MEC2 3DGTA 2JG8C 3WG2A 3JQXA 1IPSA 2D6NA 3UV9A 1C3HA 2WNUB 3VHRA 3LOIA 2VMIA 3WW1A 2ILMA 2QQLA 4MYEA 4A6OA 3M3IA 1YFXA 1ND3B 3PUQA 4LK7A 3VZNA 2G9GA 1C1FA 1SDWA 3J8F2 1JU4A 1HV0A 1V6NA 2VPVA 2RS53 1H6YA 2QJVA 2VC9A 2IWGB 5FAXA 2UU8A 4NPMA 1VE0A 4NR1A 4CU6A 5FZIA 1G8WA 3AZWA 1OQ1A 1PMHX 4QKDA 3KHBA 4YWAA 3JBG1 4IEOA 1UYPA 3DKQA 4HVOA 1Z7S3 4YVWB 5FYCA 1HXS1 4COWA 4TLFA 3I2FA 3MLJA 3KVAA 4K8FA 4NHKA 4Y5TA 1CWPA 2JE9A 3SC7X 5F6LB 5ACA2 2RDSA 4QB2A 4XW3A 3GGLA 3WNNA 3ITQA 1GZWB 5IHRA 1N3PA 1XNDA 2VTXJ 1MS3A 2JDKA 4BQ2A 2PHRA 2D3SA 3E6CC 4PF1A 4A4AA 3ZIWA 4QM9A 3ZFEC 1UOGA 1PO21 5IK5A 4XJ9A 3N9QA 3C7HA 2BVVA 3HT1A 4MGSA 4E4HA 4LEJA 3M7AA 4XDOA 4JDOA 5D1IA 1J84A 5A3TA 1CIWA 1PMJX 1H4GA 4A44A 3HMYA 4Y1XA 3JCIA 4JGYC 5J3UA 3W5MA 1PX3A 1DQ6A 1IPKA 2TEPA 1MACA 4LOTA 2D5HA 3B9CA 3LPFA 3T4HB 5LA1A 2JG9C 2OIIA 1ULFA 4QPGB 3FFQA 4FTBA 1JODA 3D6EA 3I3BA 2BWAA 3AZZA 2EIDA 4W4ZA 3FLRA 4BB3A 5C71A 3PJYA 1DDLA 1B35C 1SCSA 3POSA 5LBBA 1PGSA 4D7SA 2R062 2WO2A 1UMIA 3H3ZA 1J3PA 1HW5A 4RR3C 4Q5OA 4OI4A 1UY3A 1AR93 1W03A 4XQDA 2VCAA 4UAPA 5E1RA 4AL9A 3I3MA 2X53S 5A7WA 2JECA 2WT2A 5LBFA 4JGZC 2ZGUA 2ORXA 3QACA 1CAXB 3MF6A 3PVEA 3IMMA 3ZPOA 3R4SA 1ZVFA 2ZEWA 3FLPA 4XFGA 3PNAA 2HLEA 2NZ9A 4J25A 2B9VA 4XF9A 4UOJA 5A3WA 3RRDA 4ZS3A 1OLMA 1HB1A 2XLAA 4CEYC 2ZGQA 1J58A 2YYOA 1CZTA 3MIHA 3SKVA 3VD7A 4LBNA 4AOCA 4CDWC 5A3LA 2WLQA 1CQ9A 1VRH3 2CWSA 1WD4A 1VBA1 4P5HA 2D98A 1MQTC 4EN6B 2W95A 3BGAA 4ZZ8A 3ZLIA 3SISA 4C0HA 5FWJA 5F3GA 4XJZA 3WHTA 3A23A 4WVMB 1MPXA 2YROA 5DAVA 1RMU3 3V56A 4E8CA 2HWC1 1HN0A 2GP5A 1LGNA 2PHUA 1VRBA 2BRTA 3KLSA 1HJGA 5E16A 4YSFA 2R6QA 1ZREA 2ZACA 3BTXA 2Y8KA 2YZ4A 2HWC3 1WGPA 1OT5A 3MFAA 4YGEA 5D8AA 5JMCA 4PI2A 2QNKA 3ZR6A 1OMIA 1RUJ2 4WV8A 2BUKA 2O1QA 3AVRA 3RPQA 5K0UB 1QIQA 3E5UA 5SV5A 4ATFA 1O3RA 1UYZA 4AVCA 4ASKA 1O5LA 3SH5A 5KXEA 3MIBA 1KFXL 5DG2A 4OHZA 3WR0A 3PTYA 1PZ9A 4AGRA 3J7MA 1J3RA 2CAVA 3VDDA 2A3XA 1I9RA 1V00A 2GMEA 4H7MA 1ZZ7A 2Q8OA 1CIYA 2ZGPA 4Y33A 4LLFA 4Q0VA 3JUUA 5LZ6A 2VZ3A 4XBQA 5FXXA 3WOGA 3SLIA 2PQSA 4OYUA 4PLMA 1IGOA 2JB4A 4XILA 5FYUA 4M00A 1A8MA 4YVSC 1PZ7A 1CPMA 5FO8B 2WWSA 1RUC3 4KWKA 4WM8C 4X6RB 1W9TA 2C1FA 2WNVC 4LPLA 2B7YA 4DPNA 5AC91 1WCSA 3GYDA 1VBB3 2XJQA 1RL3A 1VPHA 3EBRA 2QQWA 2YV8A 1YI9A 2WLPA 4EN0A 1D2QA 1YFYA 2HBTA 3K51A 3PUAA 3USUA 1SPPB 5JVVA 3NJXA 1NUKA 4IE4A 4P9WA 4OVEA 3LWCA 3HOBA 4P9IA 1RHI2 1BKZA 1QOSA 4MSVA 5A3OA 5BXXA 3NV2A 3VKOA 5HPOA 1GICA 3D0JA 3NAPA 2OA2A 2JG8B 5LA9A 4BXSV 1RB8G 1FAYA 2AUYA 1H2NA 2EICA 3WP4A 3LE0A 1POV3 1HRV3 2PLV2 5EJ1B 2RJ2A 2GC1A 1F5FA 1QEXA 1RUH3 2PHTA 3NSTA 4FI9A 4HKWA 3HNMA 2XJUA 4Q27A 4QPWA 4XDQA 5GZCA 5JSPA 1US3A 3IAPA 1OQDA 2Z4FA 4AVAA 2VD7A 3LIHA 1EP0A 1CVNA 2ZXQA 5AVPA 3I2JA 2OW4A 2BFUL 2D6PA 4NHMA 2PHXA 1SACA 1GYKA 2XBO3 3I2GA 1XOYA 2GNDA 5FZCA 3C7OA 1WLDA 4LORA 1GQPA 1JUIA 3P1IA 5ABJC 4XJ8A 4ZY9A 4IEWA 1DP0A 2XLFA 4MV2A 4Y24A 3K48A 1UZ0A 3K4DA 4OZXA 3GCWA 1OA4A 1UZWA 4CP1A 1I5PA 3E97A 5HXMA 3E1F1 1ZBE3 5FPLA 1YUDA 1JZ7A 4GQ7A 2NM1A 5EJ3A 5JWPA 1KS4A 3ZYBA 5ACA1 5KHHA 2G19A 3GM8A 2JD4A 3WINE 5KWRA 1S0DA 4I3PA 1V6KA 3VD4A 4JKKA 4YGDA 3KV5A 5A3MA 1IKPA 2DVDA 2QFEA 3UGGA 4A3ZA 4BOWA 2VZTA 4DZGA 2YG0A 2EA7A 2ETEA 2W1QA 4Q4V2 3KWVA 4TSVA 5A80A 1ULEA 4DXZA 1R1A2 2X5IA 1V9U3 2BU9A 4WVVA 1D7PM 5DAWA 2Q1FA 4YARA 5AFBA 3OBTA 1YCIA 3AXEA 1B09A 1ASJ3 1S0BA 3VHNA 2JEMA 3AMNA 3I2KA 2IVJA 1YQ5A 2Y26A 4YG0A 4FBFA 4N90A 2A75A 5APAA 2OYZA 2KD7A 3OOXA 1AR83 3P3PA 4DEQA 4IE6A 1NCQA 1VP6A 2DDUA 4CDUB 3RZHA 3OD0A 4LE3A 3NKGA 5TSWA 2ARCA 4CXYA 3N9PA 4ZXKA 2HWE2 1CAWB 4KWJA 1A34A 1NY71 3FHAA 3I54A 4F83A 2UY8A 4WVMA 3AJYA 1X33A 5LCWL 1V0AA 3D8CA 5I8SA 3W5NA 4IEYA 2FDIA 4FAHA 2FDFA 4COYA 2W87A 2P6CA 2XBO1 3WQ0A 2H6BA 3MLKA 1XNAA 4IEUA 4F3JA 4TZDA 2CDPA 1NQDA 1W8WA 3B5LB 2BGOA 3CKHA 4K20A 1M06G 3WW4A 4AI9A 2PQQA 5LA0A 3H3UA 4CCLA 3DPRC 1IQAA 1JHNA 1O3SA 3TRSB 1W3VA 1PX4A 5FYTA 4XHXA 1O5UA 2YPJA 4ORFA 4COUA 4YM3A 1C8NA 3DCQA 1VBE2 1YJLA 1JZ4A 2HWF1 4N9HA 1Q8OA 5T5OA 3H1MA 4Q8KA 3BALA 3PURA 2WS93 3N7KA 4FPKA 2Y33A 4CCJA 1S55A 2WZPP 5JMOA 1GKBA 1UZVA 3W59A 1A6CA 4CCKA 2A73B 4RL7A 2LUWA 4P02B 4CTEA 3KT1A 4KBZA 4R52A 1VAKA 5EV7A 1AR62 4G4FA 3OTFA 1JUHA 5K4LA 2VUDA 4B8EA 2PFWA 3BPSA 3KZ4C 2E7QA 3LZZA 3WCRA 5DG1A 4AK3A 1WLWA 4D7YA 3N9OA 1BHGA 1DBNA 2J1AA 4GH4B 2Y38A 3USUB 5C8CB 4Q4Y3 1BMV2 4YFZA 1LOBA 4HANA 1UY0A 4XFBA 4BISA 4JHZA 4RSUA 3WDVA 2WT1A 1W9YA 3APBA 4WM7C 1UO9A 2XKOA 1RUH1 4DS0A 1CX4A 4HVRA 2I74A 2O14A 4AI2A 3HBZA 2R7EB 4QQHA 3U4XA 3QH6A 1W9SA 3VKNA 2VQAA 4CYDA 1ULGA 2D3RA 3AK0A 4IV3C 5IAXA 3OPTA 3MDPA 2KM2A 5J7MA 4AFCA 1XPWA 4EWDA 2W0XA 1WBFA 3P5BA 1C8M3 4MGQA 5FTTC 4HK8A 3RS6A 4DEVA 5CFCA 3RWKX 3VBRB 2WNUC 3ZYIB 2XPJA 2OVUA 4YM1A 2SBAA 3ILRA 4H55A 3WLUA 4YPJA 1KJRA 3FWEA 4IV3B 3DECA 4QPGA 2RS32 3PIGA 3POJA 1Q5OA 3TBDA 3ZSLA 3ZSMA 2D97A 5LBEA 3GBWA 3MW3A 4XMIA 2G4IA 1PVXA 5AFEA 2GMPA 2DVAA 1BBT2 2UURA 5G05L 1L7LA 3A7QA 4FOQA 1NCQB 4D6SA 1NLSA 4XVHA 5T5JA 2RS52 3ALQA 1W8ZA 3PMSA 1AL21 4MZUA 1ZX5A 2LROA 5BNOC 4Y1UA 2CL2A 4LHSA 3TEZA 2ZHMA 3NQHA 4BIFA 4JGZA 1COV1 1S0IA 1UU6A 4M4PA 5BNOA 3W20A 1LAJA 1GLHA 4YZ4A 2D43A 4RN5A 3CMGA 4OLLA 1PNFA 3AM2A 1S2BA 2QQUA 3WF3A 3I49A 5IVJA 1QDOA 2ZS6B 3VBRA 1E5RA 3MYXA 4MXWA 3ZSKA 1H4HA 3AP4A 4JQRA 1POV1 1AL23 4XAAA 4R8HA 2QCSB 2BV4A 2H0BA 5I0SA 4YM2A 3LDBA 3N3HA 4XBLA 3RZLA 1Q8VA 1O91A 3NNJA 2VZOA 4AQSA 2QTWB 2AYHA 2JENA 2V4AA 4JTNA 4D3WA 1IS3A 3KQ4B 4RS5B 4A6SA 1PVC2 1UY4A 1NA1C 1ZBA1 2XH6A 5FBZA 5LRRA 3WNMA 1VBE3 3ORJA 4O7XA 5L7OB 4WM7B 4CDQC 2IXIA 1AJKA 1R64A 4FPJA 4P08A 4S2FA 1B35B 5EJZB 5JPMB 3H8UA 2VO5A 4Q4W1 3MIDA 3UKTA 1YWKA 2R073 5IW0A 4AHWA 3AFGA 3ZFGC 4HOOA 3ZM8A 5GZFA 1VBD1 2OPKA 3JBG2 4EV0A 3H1WA 1NOVA 3HIFA 3LKJA 3OGSA 4I0WB 4YVWC 4PLOA 3VD5A 2RS31 3FUOA 1WCKA 4XXPA 1W39A 4X8NA 3SCHA 2DUOA 1UU5A 5GLZA 1OVPA 1DF0A 4LBOA 5A32B 2B4KA 1EPWA 2CGNA 5HBAA 3H8XA 5DZEA 2DUQA 3FHQA 1NXD1 4UWDA 1ODNA 4QPIA 4I2OA 1I5ZA 3AYCA 2W39A 3OPWA 4IEPA 4MVTA 4DUXA 4Y20A 3ZYFA 4Q8LA 4AAXA 3VBFC 3AKPA 3MUY1 4M0HA 1RINA 2LS6A 1UY1A 4BWOA 1RJ7A 3B02A 4W6XA 4LR4A 1NLRA 5DQ0A 5FMDA 5JOZA 3MIGA 1W05A 3ILNA 2E31A 3OBAA 3KQRA 1IS6A 4XE9A 3SKJE 3LA3A 4JRAA 5JZGA 4RGAA 5E89A 3IDEA 3S6PA 3POBA 3MW4A 1GU3A 3ZXGA 1RUI2 1YYNA 4LBJA 1AL0G 5K8SA 2R041 2VNVA 1OLQA 4YG6A 5T55A 3OGJA 3VUOA 2ZGSA 2DTWA 1UMZA 1W6NB 1X36A 4QX0A 4RR3B 3RSJA 1NCRC 1OUXA 5KC6A 3G7DA 1EAH2 3VBHB 5HV0A 1CONA 4Q4X1 5CG9A 1TZOA 1JW6A 2VQ0A 3VBSA 3SNMA 2AZ5A 4CXWA 1R082 3A21A 4N53C 1EAH1 4Z1VA 1JYCA 4RQPA 5FYHA 1S0FA 2W91A 4C1XA 5J98B 2ZX4A 2GU9A 4FXGB 3VBOC 4BHPA 4QDQA 2YGMA 1ENXA 4IGOA 5DUUA 3KSCA 1BLZA 1VR3A 3H0OA 5FMBA 5FYZA 4CCOA 1A8DA 4IXLA 1W6QB 1UN1A 5FY0A 3ZFEA 5C33A 4FTEA 5CAZA 1MS5A 3OBZA 3U1XA 1GWLA 1QJEA 4V1PA 1OF4A 1QY4A 1U12A 5FCCA 4MHRA 4XCBA 4WM8B 3TN93 5FDBA 3HJRA 3C7EA 3MLLA 3ZXJA 4YZ1A 1Z0HA 3GJBA 3I59B 5JXGA 2RG4A 2FZ2A 2FMDA 3LD8A 1JOJA 1RHI1 2JDHA 4XZPA 3RYPA 4A7KA 1NG0A 3FMGA 2WR9A 1LGBA 3HD8B 3VGIA 5JCTA 4QB6A 3TN91 4DXTA 2JE8A 1LB2A 5JXJA 4E9KA 1JYTA 2E33A 5C70A 5I93A 1AL22 4RS5A 1NY72 1DU3D 5F5IA 3DXUA 1W6OB 1VJ2A 3PU8A 3HQUA 5D2AA 4BCUA 1WZXA 3RVHA 5FXVA 3ZXLA 4AVTA 2ZGLA 4BLJA 4XQ4A 1CN1A 2FZ1A 2D3PA 4KI5M 5FQ0B 3SQOA 4ARYA 1UOJA 1H2KA 2AENA 1QWRA 4JKLA 4XJAA 5FPAA 1OKQA 1R091 4B29A 3CZUA 2Z69A 5IVFA 4YW3A 1C1LA 4HZFA 4KU7A 4UBHA 3T08A 4Q4X3 2BBVA 3VZJA 3O1MA 1RJ8A 2UYAA 4XF3A 1W2OA 2JDZA 2VR4A 2ZCWA 3CIHA 2TUNA 1VMJA 1WA4A 3H9AA 2VMEA 4JZRA 5DMYA 1BXHA 3OYWA 1PM7A 3W58A 4CDXC 1YFUA 3FZ3A 2X5IB 4LHLA 4URTA 4WM8A 5T52A 3WNKA 4XJWA 4AGVA 2AH2A 1HJFA 4KU8A 1BEV3 5CADA 2ZMKA 4NHYA 1PHMA 5LA2A 1ZZ8A 1I1EA 1SFNA 2V09A 1VBB2 1EPZA 5BYNA 5A33A 2FDGA 3O7OA 3TB0A 5HCBA 4Q0QA 2C4XA 5LASA 3VBUB 4AEJA 4LOSA 1LOFA 1YO8A 4PIZA 4TN7A 1NXMA 3POGA 3UT0A 2MEV2 2Y60A 3UL2A 3Q8AA 2PAKA 4KWUA 2RS51 2X29A 5FREA 5GM0A 4F7ZA 4ARXA 4OQ8A 1EYBA 2EXJA 3AYEA 4LO4B 3GCXA 5FYIA 2KA3A 4LKEA 1CGPA 3NAPB 1PVC3 1LRHA 4XC9A 2HEVF 2ZKLA 3ELNA 2F4PA 2HJIA 4NROA 1VLNA 3VDCA 5L7OC 2P34A 1DGLA 3M3QA 1C5HA 2Q1ZB 3AZYA 1F9KA 5F2SA 4C1WA 2C9AA 1TNFA 2W08A 1W0PA 3HBKA 3S5AA 1H1MA 4IGPA 1WW6A 1RVF1 1AF9A 3WF4A 3AKTA 3T0DA 2BVBA 4NO4A 1J59A 2WN3A 5DUXA 3OGRA 3BTZA 2OT7A 2XLGA 1NLQA 2BNMA 3MBWA 3UESA 4H14A 2A5ZA 2J42A 4BM8A 2ENRA 3M3OA 4JCKA 1IHMA 1LOAA 1SLIA 3ZKUA 1QU0A 4QX8A 3FUQA 1AX0A 3CJIB 5F2WA 5FWEA 1WMDA 2P1BA 1ONAA 4LNVA 2DCKA 3UKVA 5LK5A 1GUIA 1BVP1 2DF7A 4GKXA 2R042 5BNPC 4QPIB 1RUD2 1P8JA 1RXFA 5KBFA 3WZ1A 5JZGC 1AHSA 1HQLA 3FL7A 1XE0A 5FZDA 5GLUA 4LUKA 1DYKA 3EQEA 2Q8EA 5CA6A 1PMIA 5FP8A 3C2UA 5FK7A 5DPNA 5FZHA 2ES3A 4DY3A 3QD6A 2ZX0A 1S4CA 3AVSA 4Y1YA 2WQ4A 3AMHA 4JTOA 3PU3A 4J6GA 4RQPB 2FD8A 2A6WA 2J1RA 5IYYA 4CRQA 2Q8CA 1PO11 3OY8A 2XJTA 1O8PA 1T6GC 2BERA 5FO9B 3BI3A 2RS33 1Q56A 2IXJA 1O4TA 4P9JA 3GZEA 2AEYA 3PTRB 4LMFA 4QGMA 3S7IA 3WW2A 1KITA 1KGYA 3HVDA 1YQ2A 3K4ZA 2EXKA 2GNBA 1EV11 1D4VB 1ENQA 3ACHA 1W6NA 4P5YA 4ZPIA 2I07B 2WWJA 4IESA 5J48A 3MZHA 3L9JT 3SITA 3VBOB 4M01A 4NUBA 4CA9A 2VCBA 1ZBA3 4JC1A 3WP6A 4P00B 2GNTA 4LJHA 3T09A 4AI0A 4EN9B 4QWNA 1S2EA 3GXUA 5F6KA 4GJYA 2VNRA 3JB4C 4XABA 4J1XA 1N1SA 3NWKA 3VZLA 1CAXA 1QXPA 2A6YA 5DAXA 4IEVA 2F6BA 4I02A 1YHFA 3MFCA 2JJ6A 5CB7A 1SCRA 2Z42A 1D2SA 4XJUA 5H9RA 2PHFA 2ZHKA 2DUPA 2HWE1 1WW7A 4P9YA 3H8OA 2AGSA 2B5HA 1O7FA 2ZEXA 4LIVA 4HSLA 3ZN6A 5ABJB 3U14A 2WA3A 3WF2A 3MUZ1 1RUI3 2UWBA 2DCYA 3LAGA 3T2PA 4FPEA 1NT0A 2C9KA 1GP6A 2C24A 4KBBA 3SH3A 3FN9A 4W65A 1NE4A 2WABA 4EZHA 2ZX2A 2LW8A 2VU9A 1UMHA 1I3HA 4Q0PA 4GB31 4NWVA 1UL9A 5EZWA 4YW6A 1OSGA 1QF3A 4Y4RA 1JZ3A 4YLZA 1MZ5A 4L0PA 5DAPA 1BEV1 5BPXA 5LEJA 3OEBA 3IT8A 4JDMA 5E8AA 2SLIA 2VECA 2ZAAA 1PIV2 2VNGA 3KCCA 4NOTA 5FYVA 4ATEA 2VBDA 3ZKYA 3MV01 4HL0A 4I30A 4URAA 1VBC3 4IEQA 4DMIA 2RVAA 3ECQA 1ZRFA 2VXJA 2C0ZA 4K6BA 2Q8DA 3VKMA 4RD7A 2J1EA 5A7PA 3TWIA 4GWJA 1EUTA 5A7SA 2XQXA 5FKCA 4CEYB 1RUE1 2YY1A 4GMP1 4D6QA 2JDPA 4ZU5A 4K21A 1XBFA 3SEEA 1UIKA 5DDJ2 4JGYA 4QGNA 1G9DA 2YBPA 1HIXA 3AYAA 2OPWA 4UT5A 5C4WA 3BIEA 2HEYF 4IL7A 4QGLA 4TXWA 5CVRA 3C8XA 5F3EA 4AWDA 5FPUA 5JXHA 1MVQA 2WNVB 4DUWA 3VBSC 4A7YA 2HKXA 3KB5A 4XIKA 5DN2A 5KR7A 5FP9A 4LHNA 4I0BA 4G9SB 3VBUC 1T2XA 1UKRA 5T5PA 1AZDA 4P9LA 2RR12 2YC4A 4BMBA 1UWWA 1WUVA 3SHRA 3RWNA 4ZZ5A 5IK8A 4TWTA 3RG0A 3ZR5A 2QDRA 5GJ6A 3D82A 3T2TA 5KHJA 3B01A 4QQOA 1AVBA 2JG9A 3CU7A 2QQJA 1K45A 4O9EA 3LOBA 5IK4A 1DQ4A 1WD3A 1ZRIA 1H8TA 1DGWX 1NCRB 4ZS2A 3RGBA 2FBEA 1JBCA 1DZTA 1OPOA 4E2GA 3ME2A 4BIOA 2KXLA 3AMPA 1RUI1 1FV3A 3N9NA 1Y3TA 1SLBA 4CCMA 2P3IA 5JOXA 4DB5A 4RR3A 4CDQB 3SCGA 3NV1A 4NMIA 1MS8A 5FPBA 4HFSA 2DU0A 4LXLA 3WUCA 4UFKA 4Y3OA 1W2UA 1NA1A 4QX3A 2AACA 3TEWA 1QXJA 3RJ2X 3ZO0B 4QU1A 2XB6C 1WCDJ 2GH8A 4AGGA 3PMEA 1SDDB 1N1TA 4Q4W3 4ZONA 4N43B 3S30A 5B4NA 3TNQA 3K77A 1Z78A 5FUIA 4KG0A 3RJRA 5F3IA 1UZZA 1MS0A 2VVEA 3PIJA 1JYIA 1WW5A 2GC3A 5FP7A 4CP9A 3VDBA 3WDUA 4QDSA 5EQUA 1DQ5A 1UPIA 2WA4A 3T0BA 3WP3A 3CBNA 1HB4A 4ES9A 5ACA3 5I0TA 5FV3A 3M1HA 1PGL2 4Y20B 2PAEA 3B9IA 3DEMA 1FI2A 3I59A 4R9AA 2A3WA 3HEIA 3JZVA 1ZBE1 5FFOC 3U07A 1KRIA 2LTNA 2EAAA 4QKFA 4R9DA 1H30A 2RJKA 1NZIA 1PK6C 1S0EA 1WWYA 2BNOA 3G6JB 5AVAA 5C3OA 2ET1A 4ZHNA 2K2SA 2CSGA 1VBC2 4YW2A 3GHNA 2PMWB 4AVVA 1URXA 3A0NA 3U75A 3IPVA 2BPA2 4Y1VA 1D0HA 3AP7A 3VBFA 2JKBA 4AQ2A 5A6YA 2MEV1 5A6QA 5CFDC 3ACFA 2QQPA 2C6SA 2VNOA 4NWWA 2HWE3 4WZFA 4KQ7A 3CZJA 1XSQA 3J4UH 4IV1A 3D0SA 4CDWA 4XETA 5JI9A 1LU2A 5T54A 3V64A 4JX0A 5C9AB 2BTVC 2GZWA 3N36A 4CUCA 1AJOA 1FV2A 1QJU2 4OFGA 5LRSA 2CYFA 2OUJA 1MS1A 4RHV3 1GZWA 2W3JA 4DINB 2WDBA 5I0UA 4WBBA 2WFF3 1D4M3 1RIRA 3IPVB 5LB6A 4YW4A 5GZGA 1BMV1 3H8RA 1LGCA 3A22A 5CFCC 2J1TA 4S2HA 1VBD3 4ZU7A 5FR3A 1XJAA 4QB1A 3ZPYA 1XU2A 1BZWA 2P3KA 1UAIA 2GN7A 1O59A 1OOPB 4FPGA 1ZBE2 3NNGA 1DGRA 4W8JA 2E9QA 3GZUC 5CYYA 1MR5A 4UW6A 4C0BA 3O1PA 3LEIA 4MXWB 3GF6A 4YM0A 4R4XA 3IZOA 3LQCA 4AFDA 5GALA 5FMOL 4CU9A 2WS92 3AMQA 1W8UA 4XF0A 3ZIXA 1W6QA 1REFA 2ET7A 4AFBA 2O8QA 3DXTA 2GAUA 4QT6A 5J36A 3ZSEA 1LU1A 1OD3A 2YC2A 4LTAA 4N7IA 4PCRA 4HPKA 3D5OA 2A6ZA 2WNUA 1COV3 1FNZA 1GNZA 1TG7A 2C5DA 1REDA 3R4UA 1K3IA 2XMLA 4MX3A 1PK6A 2P17A 3POFA 4KH9A 3I3QA 2JKXA 3LEMA 1TE1B 4AQTA 2ZGRA 2AC1A 2GSYA 1FT9A 1PNGA 5FPVA 2XDVA 1POV0 4M3CA 4C8DA 2WNVA 2QVSB 1H8TC 1S0GA 5HV4A 2NLRA 1RITA 5KXBA 3OUIA 3U78A 4O61A 2JDAA 2OQ7A 3POYA 2NN8A 4PBOA 1MZFA 3HAGA 2DWRA 4AE2A 3EYPA 3N7JA 4XQWA 4FOWA 3RZZA 2RDRA 1RUF1 3JD73 5CZKA 1G9CA 4FP3A 1CX1A 4BXFA 1GSLA 5F37A 2E7TA 3OBRA 5F9TA 3Q8CA 3AB0A 4LA3A 4OHVA 1PM4A 1W0OA 5JR2A 5FZ8A 4OCTA 2E26A 3AXDA 3KT7A 4NIDA 3PVOA 3AP9A 1PGW1 1UF2C 3ZFGB 3J7LA 4XUOA 3ZFFA 4AI8A 1US2A 3MGUA 1KJLA 3MPBA 1S1AA 1RUF3 1GWMA 3JD71 5J09A 5C8CA 3J26N 1W6MB 1JZ2A 5FZAA 5FZGA 1RMU1 3B7MA 4XIOA 3V65A 4XZUG 3UNPA 1RUG3 2W52A 1PO23 1QGLA 1HKDA 1ZA4A 2UWCA 2X8KA 5E88A 1J1TA 1VBA3 3GHMA 2VULA 3RI9A 2Y6LA 2D40A 4TTGA 1F35A 5LW9A 5JI7A 2XJSA 5ANNA 1ND3A 1CAUB 4XTMA 4Y5Z0 2BWCA 2VOTA 4MGIE 1YJKA 1Q43A 1UU4A 3K3OA 4LBQD 2BEOA 1NCRA 2PXJA 4E4SA 3ZN4A 2B8MA 3P3NA 3UGHA 4M3CE 4BZ4A 2OUHA 4F8AA 1SZBA 1ZBA2 2YC0A 3OUJA 3PVNA 2RMU2 1ZRRA 3M2MA 3BU0A 4AFMA 3IAQA 3GNEA 1SHWB 4LKSA 2L9LA 3THCA 3RYKA 4NIIA 5JLVA 5IVVA 3VBHC 1QNYA 1IG3A 3RI8A 3SEPA 4IETA 4OUSA 2QUOA 3I4IA 3RZMA 2G9ZA 4LKDA 4O65A 5I8TA 1V9U1 1FXZA 4QX7A 1EAH3 1FOD1 2QQOA 4IEZA 2QZ3A 4B1MA 4G3YC 1KEXA 3E5XA 3AYDA 4BJ0A 5A6XA 2BGCA 3U0ZA 3ILFA 1R083 5A7OA 4BQ1A 4J1WA 4QM8A 4EJRA 4AI3A 5FZ0A 4DY5A 5KC5A 3T1MA 3T4VA 3ZN6B 3NMBA 1EV12 3BN6A 3MIEA 1PGW2 1OQEA 2OZ6A 5JDBA 2ZX3A 5G04L 1OLME 1LKNA 2XKPA 1DQ2A 1D0GA 2A1XA 4GKYA 3N7MA 4SLIA 1AYN1 4CZSA 4EN8B 1QOTA 1H8VA 1VBC1 2VOXA 5C8WA 2VMCA 3HWJA 4L8QA 4KNCA 2X05A 2B9UA 1QJX1 1DZRA 2GN3A 3PUSA 2LRPA 4BPZA 4QQ2A 1LR5A 1UXXX 1J1LA 2QQKA 3FBMA 4L99A 3WNPA 2CGPA 4OHWA 3IBMA 3WDWA 3Q9OA 5CFDA 5J37A 3JBG3 4BE3A 1MEC3 2JDYA 1XC6A 1EUUA 3THPA 3KD4A 3OGVA 4YZ5A 2W5FA 1WA6X 3WSOA 3A0KA 1AR81 2VW0A 1TMF2 4DOUA 3CJIC 2D44A 1YC61 4CP2A 4CUAA 2VQUA 3FE5A 1B35A 3ZYJB 1TME1 2ZBJA 3BB6A 4CSWA 1R081 1BK1A 1XU1A 1R093 3CNAA 3UYJA 4UW5A 4XFAA 4BK4A 2DV9A 3ES1A 4NE9A 3ZFFC 4P9GA 2BZDA 2WBKA 5I0DA 2PN5A 4OUMA 4KG8A 3BUCA 1BCXA 5EIYB 1DIWA 5EFUA 4ES8A 1QJY1 1V6JA 4CU8A 4I01A 4I09A 2VZQA 3K2OA 5A7QA 5CBLA 2W94A 1KDKA 2VMHA 1ODMA 1XB9A 1VB4A 3CDZB 1VAMA 1H8TB 3IIAA 5DZGA 5KHKA 4QKBA 2R32A 3VD3A 4LULA 4RYDA 1YRZA 4N9IA 4CUBA 1LECA 4LK6A 1ND3C 3Q8FA 3FBYA 4V2VA 2OKXA 4XPVA 1MQTA 2ZGNA 4O9GA 2WL1A 3BOPA 1GFF2 1TME2 1LULA 3LCPA 2P3JA 3W9AA 4QPYA 2ZABA 4FPYA 3KM5A 4IE5A 1AYN3 3ZDVA 5DUWA 1VIWB 1N3OA 2YGLA 3EB7A 1H1AA 5C8CC 5A7NA 5C3RA 1RVF2 1RUF2 1LHNA 1W90A 2VE1A 3H3LA 3FC0A 1NA1B 4UI9L 2W46A 5FZOB 2PTMA 4A3XA 1DCSA 1LJ7A 1U0AA 1WMFA 2DVBA 3ZXAC 1HRI3 2RV9A 3Q8EA 1TQ5A 3IDCB 4U36A 2XVKA 3BKZA 5A1LA 1XE8A 1XXNA 2JWPA 5C6CA 5J1XA 4PI0A 3N9LA 4CP0A 3TEYA 4AEDA 5JUVA 1VMFA 3ZFEB 2J7MA 5DDJ3 5T3NA 2PHWA 3OF1A 3B94A 2R0HA 2W1SA 3K4AA 3OY8B 4AW7A 5KXCA 2GC0A 2AREA 1QMJA 1XNCA 4MXVA 1OURA 3DYPA 3O0VA 1EV13 1UNBA 3MEPA 1VALA 2YB7A 3R0RA 4PF5A 4RFT0 1TVGA 3SMHA 3MPPG 1VBB1 4BH9A 4Z8BA 3HN3A 3SXWA 2WQ8A 1DQ0A 1AYM1 2QQNA 1W2AX 4U2AA 1WCUA 4YYOA 1ULOA 4GB33 1G9AA 2CV6A 4L92A 4D8MA 3BCWA 2QBXA 2Y6KA 2W68A 1H2MA 4IDZA 3RZGA 2IXLA 4K40A 2ZHLA 2NMNA 4FT8A 4AYUA 3PDQA 1HQWA 5L9BA 1M4WA 4YZ3A 2BNNA 1OF3A 2ZMNA 3POEA 4UFLA 1OLRA 5LEKA 2W92A 3NL1A 5FY4A 2WAAA 1ENRA 5FZBA 2QZ2A 3THDA 1OOPC 1FNYA 2X5IC 3OUHA 4B3NA 1Z7S2 1AR63 3R4DB 4CDXA 5BNPA 3T1LA 2Q0AA 4QAWA 3IMNA 3HQXA 5JIAA 2JIJA 2WINB 3I3EA 4CPBA 5CISA 5CIRA 5EPAA 4YVWA 2Q30A 4N43A 4IE0A 3PUIA 5KHGA 3MO4A 4HLTA 3PJQA 4R9BA 2Y6FA 3ZYGA 1H9WA 1IPJA 4N53B 4K9SA 5FOBB 1S0CA 2RE9A 3K3NA 4A2UA 4WZCA 2EAKA 4AR2A 1LCLA 4RGGA 2AR6A 4QDRA 4D69A 2BDRA 4LA2A 3D4KA 4WM7A 4AQ6A 3H50A 3OB8A 1I6XA 1AXYA 3VB9A 2ZAHA 5FYBA 3WHUA 5BNNA 2BOJA 5I91A 4LBLA 5C3QA 3POWA 3V0BA 3ES4A 3WVJA 4NN0A 1OFNA 3JD72 1C8M1 5H9SA 1PK6B 1BBT3 2VOKA 2VZUA 4OMDA 3VDAA 3BTYA 2Q1MA 4PDWC 3GZTB 4ZXEA 2ZGKA 4HPKB 4CEYA 3ACIA 3U37A 5CG8A 3EJKA 3FHIB 5SV8A 3VZMA 1QKQA 5LY1A 4AXOA 3RMYA 5A33B 4DXRA 4B7EA 4MO3M 3DYMA 4IE7A 2R49A 3NO8A 1YQCA 5FZ4A 4AHXA 5F5QA 1ULDA 1V9U2 2ZGTA 3O1OA 2Q5TA 4NAMA 4NAOA 1QQP2 2ZGOA 2HEWF 5IUQA 3LPGA 4N53A 2FDHA 3GDBA 5IWFA 2XR4A 1DG6A 5L9RA 1X8MA 4HMZA 2W2IA 4PLNA 2GP3A 5CFCB 1QJZA 2BOIA 2RMU1 1ZZ9A 5DAQA 4QHZA 5DZFA 4PQQA 3I2DA 1W04A 2VCMA 2XJVA 4X6QB 4XTPA 3KF5A 1SQ4A 1Y4WA 1CAVB 1NZCA 3CO2A 4E27A 4BYYA 2WFF2 2DBIA 3ZXEA 2YFUA 3ZVXA 4BA6A 1HXS2 5C7GA 2J22A 2OX0A 1VBA2 2C26A 4W50A 5EHDA 2E51A 1JI6A 4C90A 1PIV1 4X8PA 2W1WA 3UK9A 5LK7B 5HI0A 1EY2A 1L3JA 3JXSA 2D93A 2LALA 3LSDA 4JHTA 4SBVA 3ZN5A 1ND2C 5IVBA 1QH6A 1OI6A 1UD1A 2JG8A 1W9FA 1W6PA 2RM21 4GXLA 4UFHA 2WZ8A 5B2GB 3FJSA 1HB3A 1DGRN 2ARXA 1Y43B 3LFIA 4Z82A 4UFIA 1JOPA 1IS5A 2IXKA 2BQPA 4QHOA 1C57A 1W99A 4I3GA 5IK7A 5A7WB 5IVCA 5A3NA 2GMMA 5DABA 2CHHA 4KGQA 4WVZA 1N1YA 1RUJ3 4LIUA 3ZYRA 1UOBA 5GZDA 3UJQA 5T50A 3L2HA 3VHPA 3E5QA 5JR7B 2ZA9A 2I45A 3OJBA 1HLCA 1FPN1 1YIFA 2P3YA 2VVDA 3FLTA 2ARAA 2DFBA 4W6YA 4COVA 1W8FA 3LIGA 2UYBA 4AG4A 4KGGA 4IV3A 4NRPA 1RXGA 1S2KA 4XHBA 2PYTA 1PIV3 1UYYA 3OD4A 3VBOA 3C3VA 1K5JA 2G1MA 4CCNA 1A78A 5JOYA 5FPZA 1YFWA 4CEWA 1W8NA 1OC1A 2ADDA 2EALA 4QPIC 1CJDA 2K9ZA 1O3QA 5A70A 1SG3A 1FOD3 3DV8A 1TNRA 3AP6A 4CDXB 2D6LX 4QPGC 4B1LA 3LA7A 1SPPA 1W06A 4CE8A 3ZX7A 1HRV2 3MF9A 2QQMA 5C5UA 1E5IA 1AYN2 5F5CA 1Y9QA 5L19A 1H0BA 1NE6A 4XBNA 2H0VA 2TBVA 4BDVB 3MICA 4EQVA 1YIPA 3VBRC 2R043 4K3UA 2Y34A 2O8OA 1MEC1 2WUHA 5FZMA 4EE2A 5JPNB 3S0MA 4QMAA 1RHI3 3H1YA 3I2OA 4GH4C 1LENA 3O14A 3V0AB 1V70A 4RA0A 4YRDA 1SLAA 5CU1A 1W8HA 1Q8SA 2VBPA 2VZRA 2D5FA 3ON7A 2NPIA 4YZ2A 1UQXA 4HSJA 4XDPA 1RUC1 4YNIA 2A3YA 2WNEA 4N8MA 3GBFA 3O12A 3KT4A 5FZFA 2VUCA 2DYCA 1NCQC 1UCXA 2WZEA 1UPSA 3QH7A 4LKFA 1XYPA 2WYSA 2VZ1A 1IOAA 1VAVA 5C4WB 4B4QA 3ACGA 3LF7A 2XQRA 4JGZB 4EN7B 5C9AA 3NJZA 4JV4A 4E4DX 5JSOA 3F2ZA 3X29B 3URFA 1K5MB 4QQLA 5ANQA 5B4XA 2XL9A 5IT6A 4BQ3A 3BYWA 3H7JA 4HBNA 4AZZA 1MS9A 1CJPA 2EXIA 4CDUA 3UJOA 5C3PA 1JOBA 3WX5A 1RYYA 1VBE1 2JXAA 2A6XA 3AKRA 4FFIA 5GLTA 3CL1A 5FMCA 4JRLA 3TAYA 1JU3A 4GD4A 1BJQA 1GQGA 4CXXA 4Y22B 1GZ9A 2YU1A 2WO7A 4QKNA 4A41A 3NV3A 5JIUA 2GALA 4HN0A 4Q1PA 5A32A 3ZXDA 2XONA 4PHZA 4YVSA 1H2LA 4JGYB 1DHKB 1L7RA 3M70A 4MOAA 4AVBA 4XCAA 5I0RA 3LEKA 2F17A 4I0AA 4Q0UA 4MH0E 2IC1A 4QHBA 1JTZX 3RNSA 4ZKTB 4NRMA 1T6BX 3BVCA 4KL1A 2P5BA 2WFF1 2WQZC 4NHLA 3VZKA 2UWAA 1VMHA 1R1A3 3B3QE 2B46X 4RHV1 1UIJA 4H2AA 1LOEA 2XL7A 1ULCA 3M4FA 1JS9A 2LM3A 4RFRB 1AR92 4OULA 4XUNA 5K0UC 4Q4X2 1XNKA 2N7GA 1HRI2 4LUMA 4NPLA 4NIAA 4FP2A 1SFYA 1GOFA 1NX9A 4QQPA 4XFFA 1BQPA 4GZ9A 3HR9A 4IV1C 2VL4A 1OVSA 1QJY2 2W9XA 3I97A 1QOOA 3AL6A 2WN2A 2JICA 3EMRA 4COZA 1ALYA 2XJRA 3RZJA 3DUIA 1KD7A 2VW1A 5FY1A 4XUQA 4OUEA 3IDBB 2WSUA 4CVUA 4FSJA 2WO1A 3UKNA 2YMZA 4NHXA 2ZEYA 4H7LA 2WSVA 3ROUA 2BW8A 3KF3A 3UETA 3ETPA 3WG3A 2YPDA 1XE7A 4GIQA 5ABJA 2BYVE 5C4WC 1SMVA 1LODA 5FKBA 2XJPA 3N35A 4M3CF 1DGWA 1ZZ6A 3EXUA 4UYBA 1O6UA 4FOVA 1U5ZA 2ZPXA 2IZWA 1CPNA 5EXOA 2VW2A 5L36A 1GANA 1H9PA 1OBNA 1Q8PA 2B39A 4AEMA 1LHUA 3VKFC 1QQP1 3VD9A 1QDCA 3MV11 5JXIA 2EVXA 1BEV2 2ZHNA 1SEFA 3NVCA 2VH9A 1DLCA 1GQHA 1Y9MA 1FYUA 3GZAA 4YGBA 2E63A 5IVYA 3WNLA 4AF9A 3J9SA 2VOWA 4BQWA 4QX5A 2A6VA 1Q3EA 1UYXA 2DVFA 4MUVA 2CGOA 4XYXA 4CEWC 2WZR2 3MW2A 1HDKA 4D7TA 5HCAA 5IJRA 1W9WA 3NNLA 4MGKE 1Z7S1 3ENRA 3O5SA 1GR3A 2MNGA 3KV9A 3H42B 5JOWA 2NP0A 3T2QA 1F8VA 5FK8A 3WCSA 3J8F3 3O0XA 5DXDA 1KS5A 5FUNA 4LBQB 2HWD3 3VBFB 3IDAA 1Q8QA 1GNHA 1V6LA 4Q2FA 1ND2A 5DUVA 1OFSA 1E5HA 2F4LA 2GH2A 4BQYA 4CEWB 2YUEA 2R16A 1ZM1A 3WY6A 2ZJCA 1UZYA 1MZ6A 1UX6A 3ZMOA 2HWD2 5CEHA 4OHYA 2WAOA 2XXZA 3TOJA 1IKQA 4Z2WA 4LBKA 4PDWB 2ZEZA 3OEAA 3WT3A 2RHPA 2V72A 4UW4A 3WNXA 3W21A 5FUPA 1ACCA 3EHKA 2Y64A 1DQ1A 1SBDA 4S2GA 4RGKA 5JAXA 3DN7A 2H6CA 2WFPA 1U5IA 2R30A 5F5AA 5D8AB 3VL8A 4CPBD 5BNNC 2IVIB 4W6WA 2XVGA 3ZXKA 4JAAA 1RUE3 3BODA 2MPFA 4QXKA 3KHCA 3N4MA 1GP5A 5C5TA 5F39A 2WJSA 2JG9B 4QD2A 2VM9A 3THTA 1LEDA 2MHFA 1GZTA 1STMA 2RMU3 2EIBA 3I7DA 2Y0OA 3CF6E 4V2WA 3WG4A 1S0JA 2NQYA 3OGGA 4EYUA 5M0TA 4QXBA 1GNYA 1LNSA 2HWD1 4NVPA 4Y5SA 4HKLA 5CKNA 5BV6A 3CQOA 5HCFA 1PO22 1YLLA 3H7YA 4LHKA 2V73A 4MG2A 3WXPA 5EP9A 5FJKA 3VZOA 4M3CB 3FX3A 4H3WA 2WNOA 4XFCA 3ZFFB 1QJX3 1G6NA 4GJZA 2E6VA 2VBBA 2A7AA 1GBGA 3WDTA 1IZ3A 2XHNA 1FPN2 2HH9A 4E4ZA 4QXHA 1WMEA 2JIGA 3LDKA 4XURA 1YEWA 3RQ0A 5BUVA 2EIGA 4UF0B 1D4M2 1AX1A 1POQA 1WKYA 3HNYM 1BBT1 1PZ8A 1UY2A 1XRUA 3B93A 1X9PA 2WO3A 3KV4A 1W0NA 4Q0SA 3I2IA 3NJYA 1JYWA 1FATA 4PT6A 3U4SA 2WRAA 3FFZA 2OQ6A 5ERLA 1W6PB 1X8EA 2VVFA 1TMF1 3AC0A 3ZMNA 1F15A 4META 4CCDA 4QX2A 2WZR3 1TME3 1QJX2 2XOMA 3WG1A 2JX9A 1OXCA 2K46A 2K0GA 5FZOA 3ZDSA 4XFIA 1DYOA 1FMD2 4FOYA 1SLTA 4GMP3 4DO0A 4OZOA 3WW3A 5F7UA 3QLQA 1G7YA 5FIXA 4PIYA 4GALA 1QH7A 3VLBB 1FPN3 1U5XA 2DTYA 2X10A 3UGFA 3CJIA 4GA9A 3T3YA 1F31A 3B69A 4P14A 4JQTA 3SCFA 2FCVA 2ZTNA 2ZZQA 3INAA 3RYRA 2CAUA 1WBLA 2BBAA 4Y26A 3WDYA 3ATGA 3DKWA 4Y4YA 1HV1A 2PLV1 3MIFA 2BFUS 4XAEA 2D7FA 1AR82 4MLOA 5A6ZA 4OI0A 2ATFA 3DL3A 2GC2A 1ASJ1 4GWMA 4UW3A 1GV9A 1X9TA 2PELA 3NNMA 1RUOA 3ZYHA 1OOPA 5C3SA 1F4HA 4DNYA 3OCPA 1AR72 2CDOA 1ZZBA 1XNBA 3ASIA 4CCEA 5I8YA 2WWUA 1FMD1 4RQPC 1KDMA 5A3UA 5IVEA 2XVLA 2R1DA 5FY7A 2GNMA 3KS7A 3DPRB 3GALA 1XYNA 2R071 4RHV2 4N7UA 5CNAA 3VBSB 1ND2B 1AX2A 4FCAA 2DURA 4EZ4A 1YXWA 3E6DA 3CEWA 1QNWA 2FCUA 5HXVA 3J7NA 4AAPA 1RC6A 3O1TA 2Z79A 1NQJA 2XGXA 4M4RA 3WF1A 2RDQA 5BNPB 4UFJA 3LB9A 2VUAA 4YG3A 2FHRA 4E2SA 5F32A 4QX1A 1RUNA 2RS13 5CFDB 1KQRA 1WW4A 3VBHA 2JD9A 5F3CA 4HK9A 4BK5A 3RMXA 3V0AA 2VZPA 3L2YA 5FXZA 3RFRA 1ZA7A 3ZXFA 2RR13 3WV6A 3AZXA 4Y22A 1AR71 4XXAA 3PVBB 2VXRA 3GBGA 3PUHA 4R9CA 5FZ9A 1YI7A 1ZYBA 2DVGA 2FMYA 3MHZA 3MI8A 4IUGA 4LBQA 2ID4A 4EWAA 5IATA 3O1UA 2IFRA 1IQDC 2Y6JA 4S2DA 1IG0A 1PO13 1SFPA 3O0WA 2J1SA 4MHUA 4K8RB 1JZ6A 2R072 1V6MA 2ZX1A 4ONUA 1AYM3 1CAWA 2R1BA 5FYYA 4XF1A 5K9YA 2JB8A 4CU7A 5FY5A 4E8DA 5FRAA 5D8AC 5BNNB 1HRV1 4NIHA 1NKGA 5EYXA 1J83A 1H6XA 4MGYE 5ISLA 3N9MA 1XQNA 3TN92 2I2SA 4N43C 4XMAA 4LO6B 3VDDB 1HX6A 5FZ6A 1CR7A 4FFHA 4OI1A 4CCCA 3QCWA 1DFQA 2ZOEB 3OPZA 2CNAA 4FPHA 1KFUL 4HETA 3IIIA 5L73A 4LITA 2J1VA 4NRQA 1SBEA 1LOCA 5FYMA 5FZ3A 2YBSA 5E6HA 3R05A 4K1ZA 1VRH1 5JZGB 2J1UA 5IFTA 3K75B 4CUGA 1QJY3 4DRRA 1OA3A 1W28A 1RUE2 3AJZA 3QOPA 5FZKA 1O3TA 3I2HA 1R092 1K42A 4YW7A 1HN1A 2DBNA 1OUSA 1N3QA 1GZCA 1DLLA 1U5YA 2QQIA 2VMGA 3ETQA 5GKAC 3VBUA 1E5SA 2YDEA 4UF0A 1PVC1 1CAVA 3HPNA 1RUG2 1DZQA 4Q4Y1 1OHFA 3AX4A 3BPZA 3ZOIA 5FYSA 1L7QA 2PHLA 1HB2A 1VB2A 3AKSA 2YXSA 4HG6B 1ZRCA 4DXSA 2BP6A 1HXS3 1BK0A 3VHOA 2DU1A 2JDUA 3JB8A 1VBD2 2HYXA 3AKQA 4FFFA 4D0QA 5J96B 1FOD2 1R1A1 2XWBB 5FPXA 2GDFA 1LOGA 2VOVA 1RUD1 1C28A 5C9AC 2VUJA 4DFSA 4FFGA 4FTSA 2OS2A 2ORZA 2RDNA 1QJU3 4YGCA 4AEKA 1JH5A 2PHDA 3O1VA 1AR91 1UXZA 2EXHA 4XEZA 4R4ZA 1YQ8A 1BVVA 2BGPA
chains in the Genus database with same CATH topology
4L2NA 2HWC2 3NW4A 1DYPA 5FQ0A 5FOJB 1LEMA 1FX5A 4AI1A 1C8M2 2A70A 2HWF2 1KXGA 2RM23 1QXRA 4Z07A 2E7AA 2HWB3 4LO7A 4PQ9A 3CJXA 2IXHA 2WS91 4XOGA 4QU2A 4YW1A 1A3KA 2HWF3 2RM22 1HQNA 2QDNA 1NYWA 3OYWB 1LHWA 1BYHA 2D6MA 2QKDA 2CY6A 1RTVA 2Y0IA 2PA7A 2HWB1 4HT1T 4YFWA 3ST7A 2NMOA 3M3EA 3DF0A 4Q4W2 4Q4V1 3VDDC 3LA2A 3LGRA 1IS4A 2XG3A 1K5MC 1RUJ1 5EYYA 5FMOS 3CLPA 1QJU1 2DCZA 1PGL1 2WC2A 3BOWA 3A4UA 3QBQA 4HKOA 1MS4A 3KGZA 4Q4Y2 5K7PA 4LT5A 4IQPA 4Q4V3 3WQ1A 4HN1A 4C91A 1QHDA 5GLVA 1XYOA 4FPCA 2VG9A 4B4PA 2XWJB 1ZZCA 5GLWA 3VN4A 3ZSJA 4L11A 4AVSA 4D94A 2P2KA 4LO5B 4L9BA 3AMMA 2ZMLA 4IEXA 4ITCA 4FQ4A 4IERA 1AXKA 1YNAA 4FQZA 3ZYPA 4B4RA 3AZVA 2WIIB 1V6IA 2QE3A 2CTVA 3VV1A 1W6OA 4HVQA 5L7OA 2DCTA 1AXZA 3ZFGA 2Q4SA 2YHJA 1F2NA 3IWZA 2IXCA 3KCYA 3VL9A 3EO6A 3U10A 1RUH2 3VKLA 4GMP0 2HWB2 2O0OA 4ZU4A 1V6OA 3KCXA 2VGDA 3BU7A 5K0UA 1AR61 4Q29A 4ASLA 3I8TA 1LOFC 4JVAA 3J8F1 1RMU2 5KXDA 1UW8A 2JE7A 1RUD3 1WLTA 3WP5A 3HT2A 4FPOB 1LTEA 1AYM2 3AFKA 1ENSA 1COV2 1LESA 1O4YA 1WLCA 2A71A 5BNQA 1H1IA 3U11A 3BIWE 1RUG1 4FXKB 4M0NA 2EF6A 1ASJ2 2V5YA 3WD5A 2RS12 1CD3G 2P37A 1ZNPA 4AHZA 4AFAA 5AC92 4E2QA 4EROA 4DQAA 2OZJA 2XUMA 3ACLA 4GH4A 3HN1A 5BY5A 4AEDB 3SH4A 4Q26A 4NPRA 3IM0A 2WKKA 3TYJA 3NKTA 1CAUA 4LLOA 4YVSB 5F1RA 4OHXA 3BTAA 1X82A 3WQ7A 1E57A 2HYKA 2R063 2UY9A 2Z2SB 5DDJ1 1MVEA 1CESA 1TEIA 5AC93 2IFWA 1G9FA 1G9BA 3N7LA 4OI2A 1AUYA 4PIXA 5FLJA 4P9XA 5FLHA 3IN9A 4FVVA 5FLIA 3E6BA 1W6MA 1RGSA 2B45X 5GZEA 4FAGA 4F83A 3DPRA 2Z5WA 3JU9A 3S7EA 4INDA 4FPFA 3RDIA 1UKGA 2ARBA 1MQTB 1JN2P 1AR73 4UBGA 4AHYA 4XF4A 4DRVA 1R1ZA 2MEV3 2RR11 2RJLA 2D6KA 5KHIA 3TNPB 1APNA 1QQP3 4PJYA 1SLLA 4CDQA 2PLV3 3R6SA 4K7JA 4GULA 2VY0A 4BMEA 1VRH2 1JXNA 5H9PA 2DFCA 3AP5A 2E53A 2FQPA 4Z92B 4YW5A 4FO9A 2ERFA 4CDWB 1X50A 2RS11 4ASMB 3USSA 1PO12 4B7KA 4EWEA 5BNOB 1SBFA 1G86A 2R061 4LO8A 4UXAA 4BLIA 1ZRDA 1D4M1 2NYYA 1RVF3 1FMD3 1LHOA 1X7NA 4WVWA 1OA2A 1RUC2 2G9FA 3IKWA 3WUDA 1MZEA 4A7ZA 1F5JA 4LE4A 1J3QA 1Y7BA 4Y1ZA 4RS5C 4JDNA 3PHMA 1REEA 3KMHA 1OPMA 3WDXA 4K1YA 1O4ZA 4AEDC 4ISQA 2CWMA 2ZKNA 1LHVA 1K5MA 1N47A 2B42B 4IV1B 3NV4A 4LBMA 5EWSA 3PLQA 3KGLA 4L97A 3LSEA 4GWNA 4KWLA 2R0FA 2ZZJA 1OD5A 2D6OX 4TYSA 3JQWA 2WZR1 4PDWA 5T5LA 1TMF3 4CDUC 2XBO2 1SLCA 2PAMA 4XFHA 4GB32 4MGZE 2XHKA 5H9QA 3B00A 4FPLA 5FO7B 1N1VA 2ZGMA 4Q1RA 1C5IA 2TNFA 2WT0A 3M3CA 5JSRA 4ISRA 2DCJA 1C4RA 3M8LA 3NAPC 1HRI1 4PBPA 1MEC2 3DGTA 2JG8C 3WG2A 3JQXA 3UV9A 2D6NA 1C3HA 2WNUB 3VHRA 3LOIA 2VMIA 3WW1A 2ILMA 4MYEA 3M3IA 1YFXA 1ND3B 3VZNA 2G9GA 1C1FA 1SDWA 3J8F2 1HV0A 1V6NA 2VPVA 2RS53 2QJVA 2IWGB 5FAXA 2UU8A 4NR1A 1G8WA 3AZWA 1OQ1A 3JBG1 4IEOA 4HVOA 1Z7S3 4YVWB 1HXS1 4COWA 4TLFA 3MLJA 4NHKA 4K8FA 2JE9A 5F6LB 5ACA2 4XW3A 1GZWB 1N3PA 1XNDA 1MS3A 2PHRA 2D3SA 3E6CC 3ZIWA 4QM9A 3ZFEC 1PO21 5IK5A 4XJ9A 2BVVA 3HT1A 4LEJA 3M7AA 4JDOA 5D1IA 1CIWA 1H4GA 3HMYA 4Y1XA 3JCIA 4JGYC 5J3UA 2TEPA 1DQ6A 1IPKA 1MACA 2D5HA 3B9CA 2JG9C 2OIIA 1ULFA 4QPGB 3FFQA 4FTBA 3D6EA 2BWAA 3AZZA 1DDLA 3FLRA 3PJYA 1B35C 1SCSA 3POSA 1PGSA 4D7SA 2R062 3H3ZA 1J3PA 1HW5A 4RR3C 4OI4A 4XQDA 1AR93 5E1RA 2X53S 2JECA 2WT2A 4JGZC 2ZGUA 3QACA 1CAXB 3MF6A 3PVEA 3R4SA 1ZVFA 3FLPA 4XFGA 3PNAA 2NZ9A 4XF9A 3RRDA 2XLAA 4CEYC 2ZGQA 1J58A 2YYOA 4CDWC 3MIHA 4LBNA 5A3LA 2WLQA 1CQ9A 1VRH3 2CWSA 1WD4A 1VBA1 4P5HA 2D98A 1MQTC 4EN6B 3SISA 4C0HA 4XJZA 3WHTA 4WVMB 2YROA 1RMU3 3V56A 2HWC1 1LGNA 2PHUA 3KLSA 5E16A 4YSFA 2R6QA 1ZREA 2ZACA 2YZ4A 2HWC3 1WGPA 3MFAA 4YGEA 5D8AA 5JMCA 2QNKA 3V0BB 1OMIA 1RUJ2 4WV8A 2BUKA 2O1QA 3RPQA 5K0UB 1O3RA 3E5UA 5SV5A 4ATFA 1O5LA 3SH5A 5KXEA 3MIBA 1KFXL 5DG2A 4OHZA 3WR0A 3PTYA 1PZ9A 4AGRA 1J3RA 2CAVA 3VDDA 2A3XA 1I9RA 1V00A 2GMEA 4H7MA 1ZZ7A 2Q8OA 2ZGPA 4LLFA 4Q0VA 3JUUA 4XBQA 3WOGA 3SLIA 4PLMA 1IGOA 4XILA 4M00A 1A8MA 4YVSC 1PZ7A 1CPMA 5FO8B 2WWSA 1RUC3 4KWKA 4WM8C 4X6RB 2C1FA 2WNVC 5AC91 4DPNA 2B7YA 1WCSA 3GYDA 1VBB3 2XJQA 1RL3A 3EBRA 2YV8A 1YI9A 2WLPA 4EN0A 1D2QA 1YFYA 3K51A 3USUA 5JVVA 4P9WA 4OVEA 3LWCA 4P9IA 1RHI2 1BKZA 1QOSA 4MSVA 5BXXA 3NV2A 3VKOA 1GICA 3D0JA 3NAPA 2OA2A 2JG8B 1RB8G 1FAYA 2AUYA 1H2NA 3WP4A 1POV3 1HRV3 2PLV2 2GC1A 1F5FA 1RUH3 2PHTA 3NSTA 4HKWA 4XDQA 2XJUA 4Q27A 5GZCA 5JSPA 1OQDA 4AVAA 1EP0A 1CVNA 5AVPA 2OW4A 2BFUL 2D6PA 4NHMA 2PHXA 1SACA 1GYKA 2XBO3 2GNDA 1WLDA 1JUIA 5ABJC 4XJ8A 4IEWA 2XLFA 4MV2A 4Y24A 3K48A 4OZXA 1OA4A 4CP1A 3E97A 1ZBE3 1YUDA 4GQ7A 2NM1A 5EJ3A 5JWPA 1KS4A 5ACA1 5KHHA 2JD4A 3WINE 5KWRA 1S0DA 4I3PA 1V6KA 4YGDA 5A3MA 1IKPA 2DVDA 2QFEA 4BOWA 4DZGA 2EA7A 2ETEA 4Q4V2 4TSVA 1ULEA 4DXZA 1R1A2 2X5IA 1V9U3 4WVVA 5AFBA 4YARA 3OBTA 1YCIA 3AXEA 1B09A 1ASJ3 1S0BA 3VHNA 2JEMA 3AMNA 2Y26A 4YG0A 4FBFA 4N90A 2A75A 2OYZA 1AR83 3P3PA 1NCQA 1VP6A 4CDUB 3OD0A 4LE3A 3NKGA 5TSWA 4ZXKA 2HWE2 1CAWB 4KWJA 1NY71 3I54A 2UY8A 4WVMA 3AJYA 1X33A 3D8CA 5I8SA 4IEYA 4FAHA 4COYA 2XBO1 3WQ0A 2H6BA 3MLKA 4IEUA 4F3JA 4TZDA 1NQDA 3B5LB 4K20A 1M06G 3WW4A 2PQQA 3H3UA 3DPRC 1IQAA 1JHNA 1O3SA 3TRSB 4XHXA 1O5UA 2YPJA 4ORFA 4COUA 4YM3A 1C8NA 1VBE2 1YJLA 2HWF1 4N9HA 1Q8OA 5T5OA 3H1MA 4Q8KA 3BALA 2WS93 3N7KA 4FPKA 1S55A 2WZPP 1GKBA 3W59A 1A6CA 2A73B 4RL7A 2LUWA 4CTEA 3KT1A 5EV7A 4R52A 1VAKA 1AR62 4G4FA 3OTFA 1JUHA 4B8EA 2PFWA 3KZ4C 2E7QA 3LZZA 3WCRA 5DG1A 4AK3A 1WLWA 4D7YA 1DBNA 4GH4B 3USUB 2Y38A 5C8CB 4Q4Y3 1BMV2 4YFZA 1LOBA 4HANA 4XFBA 4RSUA 3WDVA 2WT1A 3APBA 4WM7C 2XKOA 1RUH1 4DS0A 1CX4A 4HVRA 2I74A 4AI2A 3HBZA 4QQHA 3U4XA 3QH6A 3VKNA 2VQAA 4CYDA 1ULGA 2D3RA 3AK0A 4IV3C 3MDPA 2KM2A 5J7MA 4AFCA 4EWDA 2W0XA 1WBFA 1C8M3 5FTTC 4HK8A 3RS6A 5CFCA 3VBRB 3ZYIB 2WNUC 2XPJA 2OVUA 4YM1A 2SBAA 3ILRA 4H55A 3WLUA 1KJRA 3FWEA 4IV3B 4QPGA 2RS32 1Q5OA 3TBDA 3ZSLA 3ZSMA 2D97A 3GBWA 3MW3A 4XMIA 2G4IA 1PVXA 5AFEA 2GMPA 2DVAA 1BBT2 2UURA 4FOQA 1NCQB 1NLSA 5T5JA 2RS52 3ALQA 3PMSA 1AL21 4MZUA 1ZX5A 5BNOC 4Y1UA 2CL2A 2ZHMA 4BIFA 4JGZA 1COV1 1S0IA 1UU6A 5BNOA 1GLHA 4YZ4A 2D43A 4OLLA 1PNFA 3AM2A 1S2BA 1QDOA 2ZS6B 3VBRA 3MYXA 4MXWA 3ZSKA 1H4HA 3AP4A 4JQRA 1POV1 1AL23 4R8HA 2QCSB 2H0BA 5I0SA 4YM2A 3N3HA 4XBLA 1Q8VA 1O91A 4AQSA 4JTNA 2AYHA 2JENA 4D3WA 1IS3A 4RS5B 1PVC2 1ZBA1 1NA1C 2XH6A 5FBZA 5LRRA 1VBE3 5L7OB 4WM7B 4CDQC 2IXIA 1AJKA 4FPJA 4S2FA 1B35B 5JPMB 3H8UA 4Q4W1 3MIDA 3UKTA 1YWKA 2R073 4AHWA 3AFGA 3ZFGC 5GZFA 1VBD1 2OPKA 3JBG2 4EV0A 3H1WA 1NOVA 3HIFA 3LKJA 4I0WB 4YVWC 4PLOA 2RS31 3FUOA 1WCKA 4XXPA 1W39A 4X8NA 3SCHA 2DUOA 1UU5A 5GLZA 1DF0A 4LBOA 5A32B 2CGNA 1EPWA 5HBAA 5DZEA 2DUQA 1NXD1 4QPIA 4I2OA 1I5ZA 3AYCA 2W39A 4MVTA 4IEPA 4Y20A 4Q8LA 3VBFC 3AKPA 4M0HA 1RINA 4BWOA 1RJ7A 3B02A 4W6XA 4LR4A 1NLRA 5JOZA 3MIGA 3ILNA 3KQRA 1IS6A 4XE9A 3LA3A 4JRAA 5JZGA 4RGAA 5E89A 3IDEA 3S6PA 3MW4A 3ZXGA 1RUI2 1YYNA 4LBJA 1AL0G 5K8SA 2R041 1OLQA 4YG6A 5T55A 3OGJA 3VUOA 2ZGSA 2DTWA 1UMZA 1W6NB 1X36A 4RR3B 3RSJA 1NCRC 5KC6A 3G7DA 1EAH2 3VBHB 1CONA 4Q4X1 5CG9A 1JW6A 2VQ0A 3VBSA 3SNMA 2AZ5A 1R082 4N53C 1EAH1 4Z1VA 1JYCA 4RQPA 1S0FA 4C1XA 5J98B 2ZX4A 2GU9A 4FXGB 3VBOC 4BHPA 2YGMA 1ENXA 5DUUA 3KSCA 1VR3A 3H0OA 1A8DA 4IXLA 1W6QB 1UN1A 3ZFEA 5C33A 4FTEA 5CAZA 1MS5A 4V1PA 1QY4A 1U12A 5FCCA 5FDBA 4WM8B 3TN93 3MLLA 3ZXJA 4YZ1A 2FZ2A 1Z0HA 3I59B 2FMDA 1JOJA 1RHI1 4XZPA 3RYPA 4A7KA 1NG0A 3FMGA 3HD8B 1LGBA 5JCTA 3VGIA 3TN91 1LB2A 4E9KA 5I93A 1AL22 4RS5A 1NY72 1DU3D 1W6OB 1VJ2A 4BCUA 3ZXLA 4AVTA 2ZGLA 4BLJA 4XQ4A 1CN1A 2FZ1A 2D3PA 5FQ0B 4XJAA 1H2KA 2AENA 1QWRA 1OKQA 1R091 4B29A 2Z69A 4YW3A 1C1LA 4HZFA 4KU7A 4UBHA 2BBVA 4Q4X3 3VZJA 1RJ8A 2UYAA 4XF3A 2JDZA 2ZCWA 2TUNA 1WA4A 3H9AA 1BXHA 3OYWA 1PM7A 3W58A 4CDXC 1YFUA 3FZ3A 2X5IB 4LHLA 4URTA 4WM8A 5T52A 4AGVA 4XJWA 2AH2A 4KU8A 1BEV3 5CADA 2ZMKA 1PHMA 1ZZ8A 1I1EA 1SFNA 2V09A 1VBB2 1EPZA 5BYNA 5A33A 3O7OA 3TB0A 5HCBA 4Q0QA 3VBUB 4AEJA 1LOFA 1YO8A 4PIZA 1NXMA 2MEV2 3UL2A 5GM0A 2PAKA 4F7ZA