2ZGMA

Crystal structure of recombinant agrocybe aegerita lectin,raal, complex with lactose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
b'MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
total genus 39
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgmA00
1YI7A 3M2MA 4Y20B 4XILA 4FOVA 3W59A 4YW1A 1AXKA 3A0KA 4HL0A 1Z78A 5DG1A 1G9CA 4XTPA 3WV6A 3OY8B 4M00A 1LOCA 2H0BA 5DXDA 1H9WA 3IM0A 4YGEA 4YM3A 5JLVA 2NZ9A 2CWSA 4PBPA 3WG1A 4C1WA 4GALA 4XXAA 4FOQA 1GV9A 2SLIA 2YXSA 4Y24A 3WCRA 2W39A 3OGGA 1WD3A 3POWA 2P2KA 4LBQD 3ZXEA 4D69A 1V6LA 3M3EA 1S0IA 1GYKA 1KQRA 5EYYA 1N3OA 2ZHMA 2DUOA 1LOFA 1XQNA 2NN8A 3AP9A 4GKXA 1LGNA 3WUDA 4BQ1A 2EIGA 1G7YA 2NP0A 5GLTA 4YGBA 4XDQA 3VKLA 5GLVA 1IS5A 2ENRA 3NV1A 3T2TA 2A7AA 1MACA 2W52A 4YZ4A 1GNZA 1CPMA 1N1TA 4PCRA 3OYWB 4Z8BA 2D6MA 2EALA 4PF5A 1UAIA 4GWMA 1LOAA 1V6OA 4PBOA 2WKKA 1S0EA 2A6VA 1UKGA 3ZVXA 2B7YA 2W68A 3C2UA 1GZCA 1QDCA 5DZFA 1DQ2A 3ZSLA 4FPLA 5GLUA 2ZGLA 1D2SA 4Y26A 1DQ5A 3AJZA 1SBDA 2WSVA 3RMXA 3RRDA 1I1EA 1UMZA 1S0CA 2CWMA 3TAYA 3Q9OA 4I30A 1V6MA 3HN1A 3I4IA 1S1AA 4U2AA 4UW5A 4DS0A 3D5OA 1MS8A 2YY1A 1C1LA 2XG3A 2D43A 3WCSA 1BKZA 1H9PA 1A78A 2EXIA 4RL7A 2PELA 3U4XA 2ZHNA 1QOOA 1YXWA 2VW0A 3FLTA 2NMOA 1CJPA 1V6KA 3ILNA 1KJLA 4XJWA 2ERFA 3V65A 3CNAA 1CIWA 1QMJA 3SITA 1GNHA 1FATA 3AYEA 1DQ0A 4AYUA 2GMMA 5T55A 4Y1ZA 2G4IA 2OW4A 1APNA 3BODA 1MS4A 5GALA 5HCAA 1JOJA 1KDKA 4WVVA 5DUVA 1IS4A 2GMPA 3R4SA 5GZDA 4XIOA 1LHNA 1SLIA 1DYKA 1GICA 1IKPA 1SBFA 3AK0A 4IQPA 4JRAA 1Q8VA 5IK5A 3IKWA 5JOZA 2DYCA 5LK5A 1MVQA 4LBLA 2ZGRA 1DYPA 4M3CB 1GZWA 2GMEA 1VLNA 4RA0A 4LBJA 3WHUA 4P9YA 4YLZA 1MVEA 1LHOA 1W0OA 1N3PA 3JU9A 3UJQA 2JE7A 4YM0A 1LGBA 5AVAA 4YW5A 1LHVA 1G9FA 1HLCA 2GDFA 2NMNA 2BQPA 2UURA 3WDWA 3MPPG 1MZ6A 4Q2FA 3AZWA 4ATEA 4CRQA 3BIWE 2EXJA 4LBQA 3I8TA 3VKFC 4YGDA 1ULCA 4XMAA 3M1HA 4WVWA 1LJ7A 3B9CA 2EXKA 5EYXA 1S0GA 4R9CA 1HDKA 3WUCA 3ZXKA 1GLHA 1S0BA 3OBRA 1WW6A 2A71A 2YROA 3NV2A 3RQ0A 2A6WA 2AENA 4BMEA 3N7JA 2YV8A 4W65A 3MW2A 2ZGKA 4XHBA 2AR6A 1MS9A 1WLCA 2DUQA 2CYFA 3N3HA 4ISQA 4Y1UA 4Y1VA 2AYHA 2FHRA 2PHXA 5JMCA 1SLCA 4BLJA 4DQAA 4XTMA 5KXEA 2ZGMA 2ZMLA 1JBCA 1GZ9A 4BOWA 5BYNA 4TYSA 1CVNA 1LTEA 2E7QA 1DIWA 1HQWA 1LCLA 1S0FA 1WW7A 2GALA 3T1LA 1G9DA 3MW3A 3WOGA 1QKQA 3V0BA 1J1TA 3WDXA 1W0PA 2JDZA 3D4KA 5GZEA 5KXBA 1SLLA 3SH3A 3V64A 3N7LA 3ZSKA 1AX0A 1SFYA 3PJQA 4R9AA 1W6QA 3VUOA 1BQPA 1SCSA 1RIRA 3WZ1A 1GZWB 4YZ1A 4ASMB 1WLWA 4LBMA 3SLIA 1FYUA 3ZSJA 3ZXFA 2AUYA 1N1SA 4FP2A 1AF9A 2GNMA 2E53A 3RS6A 4LBKA 2VW2A 2D6KA 2E51A 1PZ9A 4OZXA 3UJOA 2GN7A 1YO8A 2YMZA 2JKBA 4CTEA 2R0FA 2P3IA 3H0OA 2FMDA 4YG6A 2D3SA 4FPYA 2V5YA 4LBQB 5GZFA 1GKBA 2P37A 2A3WA 3GALA 3A4UA 1G86A 5GJ6A 3SNMA 2PHUA 1CR7A 3AFKA 2D6PA 2E7TA 5JDBA 1UX6A 4P9WA 1LEDA 2E6VA 3NWKA 2Z42A 2A3YA 1FX5A 4FPKA 2VUAA 1HKDA 2WSUA 5H9SA 4UW3A 3WDVA 1UN1A 3WNXA 3FLRA 2WQZC 1QF3A 4FPGA 3AP6A 3O5SA 1BZWA 2GNDA 2VW1A 2D6OX 2UWCA 2P3KA 1DQ6A 2WNEA 1JYIA 2D3RA 1QGLA 1SBEA 3INAA 3FFZA 1DGLA 2P3JA 4FQZA 2DV9A 3W58A 2ZKNA 1WW4A 2GN3A 3FBYA 1LOBA 1DFQA 3VKOA 1CN1A 1JYCA 2VH9A 3RSJA 3V0BB 4AGGA 1MS0A 1FV2A 1D0HA 2ZGTA 2CY6A 2C5DA 3ILFA 5T5LA 1G9BA 1S0DA 1VAMA 2D44A 3FUOA 1W6QB 1W6NA 4YZ5A 3LSDA 1PZ7A 1KJRA 2CTVA 3POYA 1ZM1A 2A70A 4XJUA 3LSEA 3AZYA 2D6NA 4AGRA 1ULGA 1AJOA 2CNAA 1W6MA 1G8WA 5H9PA 3RMYA 4GA9A 1Y7BA 2WT1A 3ZXLA 4AWDA 2GNTA 1DQ1A 2ZACA 4WZFA 3AZXA 1LGCA 4YG0A 1DBNA 1VIWB 2AGSA 3PVOA 1WD4A 2LTNA 4DRVA 1GSLA 5KXDA 3A0NA 2VXRA 5DUXA 2WLQA 4Y22A 4GWNA 5T54A 1JHNA 2ZGOA 5DZGA 3R4UA 1N1VA 3M3OA 3VKNA 3O0WA 5DG2A 1DZQA 4Q1PA 3MW4A 1NXD1 4FOWA 3PMEA 2DVBA 4TZDA 5CB7A 1MR5A 3ZSMA 3VV1A 1Q8QA 1F5FA 4LBNA 3WDUA 1C1FA 2A5ZA 3OY8A 4YW3A 1CONA 3IN9A 1QNWA 2DUPA 1LEMA 5GZGA 3R05A 1UPSA 1AXZA 1LHWA 3WDYA 3N35A 1AX1A 3IMNA 1O4YA 1WW5A 3M3QA 1FV3A 1N47A 4XE9A 1KRIA 1DLLA 1W6OA 3BOPA 4WV8A 5HCFA 3UL2A 4DRRA 5T52A 4YFZA 2GNBA 1V6JA 3JUUA 1BXHA 1LENA 2CL2A 1ONAA 2EXHA 1MS3A 3GNEA 5T5PA 3SH4A 1EPWA 4Q8KA 3AX4A 4YM1A 4YW4A 2DVDA 1LU2A 4M01A 3SH5A 2D7FA 4XBNA 2DU0A 4AGVA 2ZGNA 2JJ6A 3HR9A 2ZGSA 5F5QA 3QCWA 1WLDA 4FPJA 1W6NB 3V0AA 5DZEA 4NOTA 1V6IA 3IPVA 5EWSA 3AP7A 4Q27A 1LOFC 4CZSA 3ASIA 4XJ8A 4Q1RA 2PHFA 3ZPYA 2AH2A 2UU8A 5CA6A 2NM1A 1W6MB 4Q8LA 3RG0A 2PHTA 1QOSA 2R0HA 4Y1YA 1LHUA 1OQ1A 2R1DA 3AXDA 3WHTA 3AJYA 4DPNA 5IK7A 1JN2P 5IK4A 1JUIA 4YW2A 2D3PA 4YZ3A 1F31A 1ENSA 1OFSA 2C9AA 3M3CA 3L2YA 4XZPA 1Z0HA 1BJQA 1O4ZA 3LCPA 4BM8A 2XB6C 1B09A 4FPHA 5F9TA 4K1YA 5T5JA 2A3XA 1LODA 5L73A 2R49A 1MZ5A 3B01A 3UK9A 1Q56A 1YRZA 1WCSA 2DWRA 4FP3A 4XMIA 1WUVA 3NV4A 1LOGA 2ZZJA 1WBFA 4Y1XA 2JECA 4JCKA 4BMBA 3USUA 5FREA 2A75A 5E8AA 1DHKB 2EAKA 3D6EA 1WBLA 3PVEA 5GM0A 2NYYA 2LALA 4DFSA 3OJBA 2KM2A 1RITA 2V73A 2DTYA 3O12A 1S0JA 3FLPA 1UZYA 3AP4A 1A3KA 1W6OB 4FPFA 1Q8PA 1F9KA 1QOTA 1VALA 1AJKA 2WT0A 1CPNA 1YYNA 1AXYA 3AYCA 1C4RA 2A6ZA 3AYDA 2OUJA 2WT2A 1KITA 1U0AA 2D6LX 3OBTA 5E89A 1C57A 1CQ9A 1HQLA 1LECA 1N3QA 2R1BA 2VU9A 1UL9A 1SACA 2ARXA 3PVNA 4ZKTB 3V0AB 2A6XA 1LULA 3IPVB 4M3CA 1X50A 2OUHA 4R9BA 2PHRA 2VY0A 4Q26A 5H9RA 5SV8A 2ARBA 1V6NA 4M3CE 2UWBA 2ZAAA 3B00A 2OVUA 3QLQA 4FPCA 2PHWA 1W6PA 2ZMNA 4K20A 5HCBA 4R9DA 4UW6A 1N1YA 1Q8OA 2ZMKA 5IUQA 1GBGA 1RINA 2ZHKA 1DQ4A 4BLIA 4MYEA 3WG4A 2TEPA 3WLUA 2R16A 4GKYA 4P14A 3O0VA 4XBQA 3SISA 4ATFA 1BYHA 1AX2A 5GLZA 3AP5A 4ZXKA 1YIFA 4UW4A 2SBAA 3T1MA 1R1ZA 3APBA 1SCRA 3B69A 4XJAA 5KXCA 1MS5A 2YZ4A 5CNAA 1IOAA 1IKQA 3ZXJA 2ZHLA 2ZGUA 3DUIA 3N7KA 3USUB 1TEIA 2DTWA 4XOGA 4F83A 4SLIA 3NV3A 1KDMA 1OKQA 2ES3A 2HYKA 4YM2A 4YZ2A 3VKMA 2RHPA 5GLWA 3ZYPA 4AVVA 1FAYA 1SLAA 1URXA 4XYXA 4AVSA 4PQ9A 2WJSA 4XBLA 4XXPA 4XJ9A 5JOXA 2ZA9A 4FPEA 2DVAA 4Y20A 1V00A 3N7MA 1FNYA 1ENQA 5EXOA 3WVJA 4XHXA 4FVVA 4JC1A 3TB0A 3WDTA 3ZYRA 4YG3A 4FOYA 2W08A 1JW6A 4YGCA 1G9AA 3BTAA 5GZCA 3WG2A 1SLBA 4P9XA 1QU0A 3ENRA 5IK8A 5DUWA 4L8QA 5FRAA 5CBLA 4H55A 5JOWA 2DVGA 1CESA 5JVVA 5T50A 1QNYA 4K21A 1LOEA 3WG3A 2ZABA 4K1ZA 1MS1A 1GANA 2DU1A 3N36A 4ITCA 4ISRA 5E88A 1SLTA 3OPZA 1H30A 1JXNA 1PZ8A 2JE9A 1UZZA 4M3CF 2JD4A 2ZGQA 4YFWA 1Q8SA 3POSA 4KBBA 5IT6A 2AREA 2A6YA 1W6PB 2P34A 3B3QE 5T5OA 5DUUA 2ZGPA 3AZVA 3FUQA 1VAVA 4FQ4A 4C1XA 2DURA 2I2SA 4FPOB 4XIKA 3HMYA 2DVFA 1ULEA 1LU1A 1LESA 2ZBJA 3MEPA 1NLSA 4HANA 4XJZA 4U36A 5H9QA 4AVTA 2EF6A 3ATGA 3AXEA 3OYWA 1ZA4A 1IS3A 3KM5A 5CAZA 4BPZA 1ULDA 1I3HA 4GXLA 3AYAA 4NO4A 3KQRA 1AVBA 4LBOA 2UWAA 1ULFA 3O0XA 1ENRA 4Y22B 1FNZA 3DGTA 1AZDA 1IS6A 1QDOA 3AZZA 2Q5TA 5JOYA 3ILRA 1A8DA
chains in the Genus database with same CATH superfamily
4XILA 4P9LA 4XUPA 3TYJA 4I3PA 5DG1A 1XSQA 2HEVF 1Y43B 4E8CA 3UNPA 1SEFA 5D8AA 1LOCA 4YM3A 2NZ9A 2CWSA 1J84A 4IEXA 4MGSA 1QJY2 4C1WA 4C0BA 1VBB3 3O1SA 5FTTC 4LBQD 4QU2A 3ZXEA 4D69A 4F8AA 1Y4WA 1CJDA 1LR5A 4ZS3A 1ZZ9A 2XHKA 4RN5A 3ZFEB 2WS93 1AR61 1LOFA 3VHNA 1OFNA 1CD3G 3AP9A 3WNKA 4CU8A 3MPBA 1REEA 4KU8A 1UW8A 4XZUG 4XCAA 4CP2A 4QGMA 2EIGA 3IAQA 2VTXA 3IDCB 4XDQA 4QMAA 5LASA 2ENRA 3NV1A 1MEC1 3T2TA 2F4PA 1HRV2 1MACA 5HXVA 2ADEA 3BTZA 3RPQA 4YZ4A 2WFF1 1DZRA 1CPMA 4MX3A 4PCRA 3U0ZA 5C4WB 3LIGA 1ZVFA 4Z8BA 5BNPA 1UAIA 1F8VA 4GWMA 2G9GA 4QM9A 1S0EA 1PX3A 4GMP0 3ZVXA 3AC0A 3KS7A 4ZU7A 2WABA 1US2A 1QDCA 5IFTA 1G6NA 1DQ2A 2XWBB 4LHSA 4GJZA 4FPLA 5A32B 2ZGLA 3OUIA 1D2SA 1EV12 4K8RB 2VTXJ 2WINB 3RRDA 1I1EA 1UMZA 2JXAA 4OHXA 4I30A 3HN1A 1FOD1 2XR4A 2IUWA 4QDSA 4X6QB 4E8DA 2GP5A 3RVHA 3D5OA 3LEKA 1XYNA 2X09A 3NQHA 1J3RA 4R52A 1NLQA 5I8SA 4B7KA 1XC6A 2HWF2 5A7PA 1QOOA 3IZOA 3WF2A 3VBHA 1CJPA 1TME2 1KJLA 1AYN1 3V65A 5C8CA 4HBNA 3HQXA 4HZFA 1FATA 1GWMA 3KF3A 1RUF1 1HRI2 3PDQA 4UAPA 2ZAHA 4PDWC 3S6PA 5GALA 2JICA 5HCAA 1Z7S3 5DUVA 2RS12 2GMPA 4CSWA 3TEYA 3R4SA 3GZTB 3LA2A 5GZDA 4S2GA 1DYKA 1GICA 1IKPA 1SBFA 3AK0A 5IK5A 1NT0A 4AFCA 1DYPA 4HLTA 1K42A 4NHMA 4BQXA 1O7FA 3JD72 4RA0A 1HB3A 2XBO2 3N9LA 2W2IA 1PMHX 4LPLA 4WM8B 3WNMA 3IDAA 3H3LA 1TMF2 4NMIA 1N3PA 2HWB3 4Y5TA 3UJQA 3WD5A 1LGBA 4AQTA 1BMV1 4YW5A 5FZDA 3DPRC 2IVIB 3RZMA 1AR63 1NKGA 5A7SA 1VBC2 4Q2FA 5FV3A 1O3SA 2K46A 3J4UH 4XABA 1UU4A 4CCEA 1X82A 3MF9A 3IMMA 3OF1A 1C5HA 1K45A 5FK7A 4ATEA 1U5YA 3I8TA 3PIJA 2JB4A 3HT2A 4JAAA 1UX7A 4WVWA 3B9CA 2EXKA 5ANQA 5EIYB 1NQDA 1NCRA 1S0GA 2Q1ZB 3C7FA 1YC61 3CKHA 4R9CA 4CCLA 1WW6A 2JB8A 3CZJA 3H3ZA 2JG8C 2YV8A 4E4ZA 4W65A 4LEJA 2IXLA 3ZYFA 1ZBA1 3VD3A 4QQLA 1WLCA 3N3HA 2CYFA 3K75B 1PO21 3SCHA 3ZM8A 3GBWA 3X29B 3QACA 2HWC2 3ZMNA 1U5XA 3ZO0B 2ZKLA 2NPIA 1IQAA 4K6BA 1XB9A 3GHMA 3WNOA 2VZPA 4LE4A 3W5MA 3KCXA 1E57A 1RUG2 3PU3A 1QXPA 5FPXA 2QQOA 4TYSA 1FOD3 4UFIA 1W39A 2E7QA 1HQWA 2GALA 3T1LA 2GH2A 4XW3A 5F3GA 2WN2A 2WZ8A 3MW3A 3WOGA 3WW2A 1J1TA 1RUC1 4YVWC 2ADDA 3D4KA 4MHUA 4AOCA 4CXWA 5KXBA 3N7LA 3NL1A 4OQ8A 1SFYA 1AL0G 3THDA 4L11A 4D6SA 4FFGA 1BQPA 1SCSA 3UGHA 4YZ1A 1GZWB 1X9PA 3RI8A 3SLIA 3VBSB 4ASMB 3DECA 1PVC1 1ZZBA 2YFUA 1AYN3 4FP2A 2XJTA 4IEQA 4MGQA 2RS32 2X10A 4LBKA 1X8MA 3PURA 4XF1A 3RS6A 4NROA 2IXKA 3VDDA 1ND3C 4CUAA 1RUF3 2D40A 4UI9L 2D5HA 5FYHA 5FPUA 4CCOA 1ND2B 3UJOA 4Z92B 4A6OA 2GN7A 1RUI3 1YO8A 3KHCA 4GB32 1KS4A 3PUIA 2FMDA 2V4VA 5CADA 1YCIA 5C33A 1CAVA 5A1AA 1G86A 1WMXA 5GJ6A 4ARXA 3AFKA 4CDXC 3LAGA 1QJU2 1LEDA 4EE2A 2NQYA 2WA4A 1XYPA 3WR0A 4IV3C 5LRSA 4FPKA 1CZTA 2BGPA 2VUAA 5JXIA 2WSUA 5H9SA 2RR11 3WDVA 1UN1A 1RVF1 1VBE1 3VZNA 3THTA 3HAGA 3T2QA 1RXGA 4Q4X1 2WQZC 3VL9A 4HPKA 2YBKA 4FPGA 3AP6A 5FBZA 3T3YA 4YARA 1QHDA 4BQ3A 1HXS1 3N9PA 2UWCA 1AHSA 3NNJA 3PNAA 2HLEA 2WNUC 4AEDA 5HPOA 5J96B 5F32A 4JKMA 2J7MA 3W21A 2B5HA 1JYWA 4FQZA 4CE8A 3CQOA 4PT6A 2ZKNA 3CZUA 3I54A 1WW4A 4QPGB 3FBYA 1LOBA 2GC0A 5JSRA 5C9AA 2WWUA 4QX5A 1RUJ1 1VAKA 2BOJA 5SV5A 3FHQA 3RSJA 3V0BB 1MS0A 5DDJ1 5DAXA 1FV2A 2ZGTA 5T5LA 3AB0A 2XJQA 5BY5A 3MZHA 4QKNA 2XVLA 3MICA 4HN1A 1W6QB 2FDFA 2WZPP 4J1WA 1PO23 5FY9A 1PZ7A 3POYA 1JMUB 2A70A 1V9U3 3JCIA 4YNIA 3LSEA 3AZYA 1JZ5A 2D6NA 4AGRA 5J1XA 3WXPA 4CPBD 1W6MA 4NIHA 4LOSA 4GA9A 3NJZA 4AWDA 1XXNA 4WZFA 2LW8A 5I0DA 1LGCA 4YG0A 4DNYA 1CGPA 4XQDA 3PVOA 4RFT0 1KFXL 4AXOA 1CIYA 1QQP2 3OSDA 5KXDA 5DUXA 3VBRB 4Y22A 4D6QA 3MDPA 3GF6A 1F4AA 3ON7A 1RUC3 3FHAA 1CZSA 3R4UA 4Q4V1 3VKNA 4I2OA 1DZQA 1RXFA 1C5IA 2DCYA 3I59B 3PIGA 3PMEA 4P08A 4XQWA 3NKTA 3ZSMA 1HRV1 3WDUA 4YW3A 3IN9A 2BVVA 2RVAA 3U78A 5FLIA 3KV4A 3ZXAC 1PIV2 3MUY1 1AXZA 1AR81 1UZ0A 4QX1A 5J36A 1LHWA 1HQNA 4OI2A 1O4YA 1VR3A 1FPN1 4XE9A 3LEMA 3ACGA 1KRIA 1W6OA 4WVMB 2RM22 3J7NA 5BNNB 3ZN5A 1ZBE1 1NYWA 1EV11 4LHNA 5AC91 1E5SA 1NZIA 3JUUA 4RYDA 1LENA 2CL2A 1ONAA 3S7EA 1MS3A 4HXCA 2ATFA 3ILRA 4PDWA 5FJKA 3KB5A 3RZZA 5ACA2 4YM1A 4YW4A 3CJIB 5DQ0A 2D7FA 3UGFA 3LF7A 1XNBA 2KXLA 3DEMA 3AKSA 1F15A 3EMRA 2ZGSA 5F5QA 2HWD3 4Q4X3 2BYVE 1DGWA 4COUA 4XJ8A 1UYXA 2PHFA 4Q1RA 2QQMA 3U37A 1HXS3 2AH2A 3Q8FA 4CDUB 4OLLA 3S30A 2LUWA 2ZX3A 1BEV2 2PHTA 2R0HA 1B35C 3WHTA 1SG3A 5I0SA 1XBFA 3VB9A 2TNFA 4DXZA 5IK7A 5FXWA 2E7AA 3WQBA 1JUIA 1RJ8A 4DOUA 1OFSA 5FZOA 1JS9A 3M3CA 4BXFA 3ETQA 2FZ2A 4HKWA 1H8VA 2H6BA 3DPRA 3D0SA 4FPHA 1B09A 1RUJ3 3USSA 4AEMA 1W9WA 4UXAA 2JWPA 5L73A 4D7YA 1D4M2 4JGZB 1ZZ7A 1VE0A 2GC3A 4FP3A 3FBMA 4XMIA 1LOGA 1WBFA 4IEWA 3TN93 2A75A 3QOPA 2F6BA 3MFAA 5E8AA 1DHKB 2Q1MA 1U5IA 4QB6A 3RZLA 1FMD2 3P5BA 2NYYA 2LALA 1TMF1 4UOJA 1RMU3 2VMHA 4RSUA 4NHKA 3FLPA 2AEZA 4HETA 4RHV1 3WNPA 2ZEZA 1BVVA 1VBC1 1SQ4A 1VALA 3WF3A 4EROA 4XURA 1VB4A 4XDOA 3LZZA 2W1QA 4N90A 5JIUA 1YYNA 1GOHA 5CKMA 4OHVA 5JMOA 1XNDA 4BK4A 1RUE2 2A6ZA 5LATA 4NHLA 2YGLA 1GQHA 1KITA 2D98A 2VZ3A 4XDPA 4YRDA 5I93A 4MZUA 1YJKA 2HJIA 1WZXA 3H50A 1CQ9A 2HWE3 1JODA 1HQLA 2ID4A 2RDNA 3CIHA 5E89A 1SDWA 1KEXA 5IVYA 3VBFC 2ARXA 3IDEA 2E9QA 5F39A 3V0AB 2A6XA 2OUHA 4J25A 1WGPA 2V72A 4R9BA 4XUQA 5FY4A 2PHRA 4BIFA 5H9RA 1HX6A 1PGW2 1FPN3 4GMP1 3GBGA 2TUNA 1I5PA 5BNOA 5A1LA 3GCXA 2RDRA 2OVUA 5AC93 2WNVB 1ND3A 2BZDA 1Q8OA 4Y4YA 4SBVA 3TWIA 4TWTA 5FPZA 4COYA 5FBJA 2VMIA 2ZHKA 2JIJA 2PAEA 3NAPC 4MYEA 3WG4A 2TEPA 4GKYA 3WY6A 4CEYB 1YI9A 2WQ8A 4ATFA 4DUWA 1HJFA 2RMU3 3AP5A 3EBRA 1ZZCA 4ZXKA 4LKFA 3SMHA 1WCKA 1IGOA 2QKDA 1VBD1 3BTYA 4FXGB 4CDXA 4AHWA 1AR91 1DCSA 2ZHLA 3DUIA 1WWYA 4LQRA 1JZ3A 2EA7A 1TEIA 2HYXA 2XDVA 4S2HA 3ZFFC 1H4HA 4H14A 4IV3A 3VZKA 2KA3A 4AQ6A 1CAWB 2VECA 1W8OA 2ES3A 3B93A 2HYKA 2PAKA 2Y26A 2B46X 1SMVA 2VOVA 4IV1C 4AVVA 4YZ2A 5A1FA 3WP3A 5LCWL 5A80A 1J59A 4FFHA 1XSRA 4AVSA 5F5IA 1RUH1 2WYSA 2Z79A 3BGAA 4QWNA 4UFJA 2VUDA 2RS53 3POJA 4XJ9A 3VGIA 2ZA9A 2F17A 2DVAA 4QGNA 1V00A 1K5JA 3C8XA 1FNYA 1ENQA 2WNUA 5EJ3A 4ZY9A 3DKWA 4WM7B 2XH6A 1IG3A 2PQSA 3AM2A 3ZYRA 1AUYA 4RS5C 1JW6A 2BWAA 1Z7S2 5GKAC 1G9AA 3JZVA 4IL7A 1SLBA 4P9XA 2JEMA 3KCYA 4H55A 2PLV1 4LO5B 1HN1A 5FZBA 5JVVA 4L2NA 1LOEA 3J7LA 4HVRA 1GANA 4I3GA 2J42A 3MV11 3OGSA 4AEKA 2JE9A 5ERLA 4M3CF 2VTFA 2VNVA 3DV8A 2VM9A 3POSA 2H0VA 1NCQC 4LT5A 3DYMA 5DUUA 2HWB2 2EVXA 2WR9A 3AZVA 3M4FA 5FZGA 2WYFA 1AL22 2I2SA 4CDWB 4HN0A 4FPOB 4KG0A 4WBBA 1S2BA 1NZCA 3CF6E 2ZBJA 4QQHA 3KGLA 4XAEA 1NLSA 4HANA 1IZ3A 3I3EA 1R082 4HONA 5H9QA 3WSOA 4AVTA 3AMPA 5EQUA 1ZA4A 1W99A 3KM5A 4W8JA 3U11A 2CHHA 1PK6B 2ZCWA 5A7WA 5D21A 4A7KA 4LE3A 5FP4A 5FR3A 3OG2A 4GMP3 1AR72 3KQRA 1CAXA 1ENXA 1L7QA 4GH4C 1AVBA 4K3UA 4XACA 1JZ6A 5F6LB 5C3SA 1ULFA 2E63A 1NOVA 1XU1A 3VZJA 1IS6A 5I8YA 1GU3A 2OX0A 5KHGA 1BLZA 1A8DA 3HN3A 3PMSA 3P6BA 4FOVA 5FZCA 4BQ5A 1AXKA 1GR3A 1OUSA 3A0KA 1Z78A 4CCCA 4EN0A 2BTVC 3OY8B 1O59A 1NA1A 1H9WA 2ORXA 4Q0QA 3NJYA 1UOFA 4YGEA 4NIDA 4RGAA 4HFSA 4PBPA 3J7MA 3ZFGC 4AVBA 1AR93 1I6XA 3ZYBA 4CYDA 1S4CA 4GALA 4JDNA 4N43C 4Y3OA 1W05A 2SLIA 4YW6A 2YXSA 3AKRA 3WCRA 3OGGA 3ZOIA 1JU3A 3CU7A 1WD3A 4DY5A 3J26N 2I07B 3AL6A 4QB1A 1S0IA 2VVFA 1KQRA 2WIIB 3AL5A 3G7DA 2DUOA 2BNNA 1RUH3 3CMGA 1XE0A 1JOBA 4CA9A 2OZJA 4GKXA 1KFUL 2OA2A 4XUNA 5K0UC 2JD9A 3AMHA 3KT7A 2Q8EA 1B35A 1FT9A 5GLTA 4DIQA 4Y5SA 5JUVA 3S57A 2V5DA 4YGBA 4E2GA 4PLNA 2WDBA 1RUI2 3MO4A 2VOXA 5CFDB 5ISLA 3MIHA 1H2NA 4QKFA 1GNZA 2VCBA 3WX5A 3WW1A 2D6MA 2EALA 3G6JB 4PF5A 4BB3A 2KD7A 4OHWA 1LOAA 2BV4A 4NIGA 3JBG3 3MFCA 2D93A 4XQ4A 2Q30A 2VMEA 2W68A 2XLAA 3TNQA 3HQRA 1VRH2 5DZFA 3ZSLA 5GLUA 3OD4A 3R4DB 4QPWA 2G19A 1XNKA 4RQPC 4Y26A 3AJZA 3AMNA 4OHYA 1M06G 2IVJA 2CWMA 3TAYA 5M0TA 3I4IA 4HKLA 1XNTA 1HB1A 1TZOA 4NN0A 5I0UA 3LIHA 5LA2A 5CKNA 2Q0AA 4ET7A 1MS8A 5FZ3A 1C1LA 5LZ6A 3VD4A 2D43A 1EAH1 3WP4A 1BKZA 1RGSA 4V2WA 4Z07A 2VW0A 3MGUA 3IIAA 3ILNA 2R062 5CZKA 2JG9C 4O61A 2ERFA 3U1XA 4W6XA 5K7PA 1CIWA 1QMJA 2BEOA 3D0JA 3SITA 1GNHA 3TOJA 3AYEA 4OULA 1FMD1 1KGYA 3VBFA 1QJX1 5DMYA 5EHDA 4Y1ZA 2G4IA 1YQ2A 5CFCB 3VZLA 2FDGA 3T08A 1JOJA 4P9JA 4Y33A 4F7ZA 1ASJ1 1V9U2 1R1A1 4XFBA 2HKXA 1LHNA 3H8UA 3URFA 5IHRA 4FBFA 4IQPA 2J1UA 4AFBA 5A33A 1RHI2 2EIEA 2DYCA 4A2UA 5FOJB 2J22A 3LA7A 5FUIA 1JZ2A 4M3CB 1VLNA 5HI0A 3NAPA 3WHUA 1OXCA 2X05A 5J09A 1DDLA 1UIJA 4IEOA 3T2OA 1UKRA 1MVEA 4NRQA 1ZRCA 5AVAA 1UXZA 1U12A 5A70A 1KXGA 1G9FA 1Q43A 3MPPG 2ZX1A 3VBUB 2RJ2A 4AR2A 3KWVA 1Y9GA 4LLOA 4CRQA 3WINE 4LBQA 4YGDA 2XMLA 2YU1A 1LJ7A 2QQJA 4IV1A 4QD2A 3HWJA 4S2FA 4PIXA 5JAXA 2C6SA 2WUHA 4OI4A 3NV2A 4BYYA 4C91A 2Y60A 3RQ0A 1QWRA 2A6WA 2AENA 2K0GA 2TBVA 3N7JA 4I0AA 3EQEA 2RDSA 4NAMA 3MW2A 1R092 1OI6A 1MS9A 2DUQA 4EN9B 2IFRA 5LW9A 4HK8A 3MLLA 1VMFA 1UZVA 4QAWA 5C71A 5G04L 2FMYA 2X53S 4MG2A 4RS5A 1YQ8A 5JMCA 5C8CB 2C0ZA 2VZSA 4BLJA 2XUMA 5KXEA 1E5RA 2ZGMA 5FYBA 4UF0B 1CZVA 4LUKA 2HWD2 1JBCA 5FK8A 1J3PA 1GZ9A 4BQ2A 1SPPA 4BOWA 5BYNA 3PUHA 4COVA 1S0FA 1LCLA 3PTRB 4AW7A 4Y5Z0 2BNMA 1EAH3 1SLLA 5FFOC 1O5UA 4QKDA 3SH3A 1NX9A 4DXTA 4EV0A 2MEV1 5KHJA 4I09A 5FPVA 3WZ1A 1MQTC 2R043 2OQ6A 1H6YA 2W47A 4GZ9A 1O8SA 2XL9A 2AUYA 2IC1A 4QXHA 1N1SA 1D7PM 2VD7A 2WZR1 4ES8A 1O3TA 5JPMB 3NVCA 3VDAA 2VW2A 2D6KA 4LO8A 2AZ5A 1E5HA 1YWKA 3KT1A 4QT6A 3J9SA 4OZXA 4H2AA 5LBFA 4A3ZA 2CV6A 4K40A 3VHOA 2FCVA 2YMZA 5JZGA 2WAOA 3TN92 3H0OA 4L97A 4YG6A 2WLPA 2ZX2A 2D3SA 1R1A3 4GAZA 1WA6X 5F3EA 4GH4A 2P37A 3B02A 3GALA 2IXJA 3HNMA 1POV0 3SNMA 5K9YA 5FYYA 1CR7A 1NCRB 1RMU2 2E7TA 1UX6A 2QQWA 1UXXX 4ONUA 4QPIA 2A3YA 1FX5A 2W1WA 5LY2A 3ZR5A 3A22A 4UW3A 3IB3A 1TNRA 2RDQA 4QDQA 3RYKA 3FLRA 5IATA 5FZ9A 2VGDA 1COV3 1VP6A 1PO12 2VMDA 5FZKA 1GNYA 2JDYA 2G9ZA 5FKBA 4A6SA 2P3KA 1JYIA 2G1MA 4N43A 3INAA 5FYIA 2HWE2 3VBOC 3AMMA 4QX8A 4JTOA 4E9KA 2Y33A 2QBXA 1OOPC 4LA3A 2VUCA 2QZ3A 4KBZA 4CCNA 5C3RA 2P17A 2GN3A 2VO5A 1DFQA 2Y64A 3VKOA 1US3A 1W8FA 2VH9A 2WWSA 3JQWA 4O7XA 1Y3TA 5EP9A 5KHIA 4JDOA 5TSWA 1Y9QA 4AGGA 2PN5A 1W04A 5FY5A 2C5DA 3ILFA 5K0UA 4M4PA 5FZHA 4YVSC 3O1TA 1W6NA 4YZ5A 3AKPA 1O5LA 2CTVA 1KJRA 2YGMA 4UFKA 1ZM1A 2Y6HA 4AI0A 4XJUA 1FI2A 1W03A 3ZN6A 2ZOEB 1AJOA 2CNAA 2QZ2A 5FMDA 1G8WA 5H9PA 2QVSB 3VDDB 1Y7BA 5FY0A 4HSJA 4JGYB 1F4HA 5IW0A 2WRAA 4IEPA 5K8SA 3LD8A 4HMZA 2VCAA 2BU9A 2Y6JA 3C7GA 4IERA 1WD4A 1ACCA 4FT8A 4DRVA 2Q8OA 1IPSA 3A0NA 2VXRA 1OUXA 3NNGA 2WLQA 2QTWB 3ORJA 4GWNA 2BBVA 1T6GC 5A6XA 1JHNA 2PYTA 2ZGOA 4RQPA 5DZGA 2VXJA 1AYM1 3ZX7A 2XUEA 4WZCA 1VRBA 2X8KA 3MW4A 1NXD1 4X8PA 2MEV3 5FWJA 4CCJA 4D6RA 2W1UA 3FN9A 4GULA 5CB7A 3U07A 4CP9A 2RS52 1C1FA 2A5ZA 2WZR3 4P5YA 3ALQA 4ZXEA 4AI1A 1YLLA 4HPKB 3HEIA 3KF5A 1W8ZA 4FFIA 5FP8A 5A7OA 3WDYA 3E5XA 1ULPA 1W2NA 3M3QA 4IEYA 1N47A 4AEDB 2VQTA 2JG9A 5DAQA 3SCFA 2QQKA 4QPGC 4OUSA 3WNNA 1NUKA 1MEC3 4HVQA 2GNBA 1BBT2 2WFF3 5T5PA 5C9AB 1HW5A 2E32A 3O1MA 2DVDA 1VB2A 4D0QA 3SH5A 1J58A 3J8F2 3LPGA 4XBNA 4C90A 2DU0A 2ZGNA 2W95A 2ZZQA 4QHOA 4FI9A 2ZX0A 3ECQA 3QCWA 4FPJA 3ZYGA 4MGZE 4ZONA 1V6IA 3IPVA 2JX9A 3AP7A 4FTBA 3WEZA 4BQYA 4EZ4A 3ZPYA 2ZEYA 4BH9A 5FO7B 1A6CA 2K2SA 1W6MB 4Q8LA 3RG0A 2RV9A 1QOSA 3W9AA 5LA9A 1OQ1A 4CVUA 3AXDA 5EFUA 3ZN4A 2R6QA 3FC0A 3UYJA 4DPNA 1JZ8A 5IK4A 1WCUA 2D3PA 1QJFA 2I45A 4NRPA 4AFDA 2Y6GA 5J48A 4KI5M 1EUUA 3F2ZA 3LCPA 4BM8A 3CHXA 1BCXA 1EUTA 4K1YA 4ZZ8A 1LODA 5CEHA 5FQ0A 3BOWA 1ZRIA 3UK9A 1WCSA 3NV4A 2ZZJA 4Y1XA 2ORZA 4BXSV 4BMBA 5ABJC 5BV6A 2YU2A 4ZZ5A 2GZWA 5APAA 2UY8A 1NY72 1WBLA 4Q4Y1 2N7GA 1JTZX 4DFSA 3AMQA 3GBFA 5HXMA 3AFGA 3O12A 4KL1A 1C8M1 5D1IA 1W6OB 4FPFA 5LB6A 2PMWB 1F9KA 2WT0A 2J1SA 1ZREA 1CPNA 4CPBA 2P1BA 1ULOA 2BRTA 3WP6A 4YSFA 2DBIA 3AYCA 5EZWA 3T09A 3LDKA 4LJHA 3CJIC 2WT2A 4PDWB 2FDIA 1U0AA 3I49A 5F8PA 2VL4A 1F5JA 2VMGA 2VC9A 5FYCA 1XYOA 4N9HA 3B7MA 2E33A 1LECA 5FYUA 2VU9A 1UL9A 3KMHA 5FDBA 5IVBA 2PXJA 1LB2A 3BUCA 1TG7A 4UFMA 4OQ9A 1UMHA 4R4ZA 2ARBA 1MQTA 1QXRA 1V6NA 2BOIA 2UWBA 2DCTA 1GUIA 1RUD1 5CU1A 1VBA2 3SEEA 5FAXA 4QX0A 5FYTA 3I3QA 1UWWA 5FZOB 2ZMKA 3FHIB 3JBG2 4ZU5A 1H4GA 1DQ4A 3LOIA 1ZBA3 2PAMA 3HBZA 2R16A 4P14A 4XBQA 3SISA 3BKZA 1QJY1 4NIAA 5GLZA 5KWRA 3LDRA 4C0HA 3MIFA 4UW4A 3T1MA 1R1ZA 4FSJA 3HVDA 3B69A 4XJAA 2ZJCA 5KXCA 1MS5A 2QUOA 4Z1VA 4AI8A 5CG8A 2LS6A 1OH3A 2B45X 2BFUS 4LTAA 3WQ7A 4N8MA 5CYYA 4OHZA 3ZXDA 4RR3B 4CXYA 3I2KA 4YM2A 1PMJX 5I0TA 2RHPA 5GLWA 5FYMA 4KMQA 3LPFA 4ORFA 1RUNA 1URXA 5FO8B 5HV4A 4XYXA 4KGQA 4PQ9A 2A73B 4JQTA 3EJKA 3Q8AA 4CU9A 2R072 1NXMA 4FPEA 4G3YC 1P8JA 3MV01 3RNSA 4Y20A 3N7MA 3NMBA 3WW4A 5EXOA 4DB5A 2IFWA 3ROUA 1RUOA 5L9RA 3AVRA 3P3NA 1PVC3 4FVVA 3VBOA 1NG0A 3TB0A 4NPMA 2RG4A 1OOPA 2W08A 4BDVB 3V56A 3SEPA 1OSGA 3WG2A 4ES9A 3LEIA 5F1RA 5IK8A 1O3QA 5CBLA 4B1LA 2HEWF 4BK5A 2DVGA 1CESA 2BWCA 3A7QA 1UOBA 1K5MB 4K21A 3ABZA 3WG3A 4CU7A 2R30A 5FXVA 1YFWA 3I2IA 1MS1A 1H2MA 4G9SB 3N36A 1KD7A 4K1ZA 2C9KA 2ZEWA 4YVSA 3O1OA 2HEYF 2FD8A 1C8M3 3FMGA 3OPZA 4AVCA 5LBBA 3GZAA 5BNOB 1UZZA 1ZRDA 4YFWA 4XEZA 4QHBA 4E4SA 1ND3B 2RR13 2Z5WA 1H2KA 1RVF3 1ZZ8A 1VBE3 2C1FA 4CEYC 1W8WA 2HWF1 5FZ8A 2AC1A 3ES4A 1FXZA 1ULEA 4MGIE 3POGA 4PJYA 3MEPA 5JSPA 3K4ZA 1TME1 4FCAA 2EF6A 3AXEA 3EB7A 3LGRA 3OYWA 1IS3A 2UYBA 4Q4W2 3OGRA 4NWWA 4CDXB 1ULDA 1WMDA 4CEWB 1HRI1 2XJUA 4IV3B 1HV0A 4EN7B 4CCKA 2XWJB 4LBOA 1PMIA 2RS11 4MADA 1A34A 3FE5A 1RUD3 3LKJA 2UWAA 1H0BA 2W46A 1ENRA 3KVAA 1OVPA 3BPZA 4DY3A 4Q0SA 2ZX4A 3DGTA 4URTA 5DDJ3 4QX2A 1GP6A 2Q5TA 5E6HA 2PQQA 4PIZA 3RYRA 5AVPA 4WM7C 4JRLA 2B8MA 3M2MA 2OT7A 3W59A 4YW1A 4JDMA 4MO3M 3EXUA 1W9FA 1G9CA 1QJY3 5FZ0A 1EPZA 3JD71 3WV6A 4M00A 2XBO1 3OEAA 4O9EA 3RZHA 3ZYHA 2VBDA 3B9IA 4OZOA 4IE4A 2JG8A 5J7MA 2ZTNA 1YIPA 2BP6A 3WG1A 2VQAA 4FOQA 1GV9A 3KV6A 2O0OA 2W39A 2P2KA 4P02B 5FLJA 1V6LA 5F6KA 5C5TA 3M3EA 2D97A 1VBB2 5EYYA 2ZHMA 3I2DA 5A3OA 4A3XA 2DFBA 4MGKE 2L9LA 3SQOA 1XQNA 2NN8A 2R042 4Q4V3 3P1IA 1X9TA 2DCJA 3OEBA 1W2TA 2WS92 1YUDA 4QDRA 1DLCA 3WUDA 4TLGA 4BQ1A 2WBKA 1G7YA 4LA2A 1HRV3 3PTYA 3IBMA 1BBT1 3OPTA 3VKLA 4N7UA 1POV1 5GLVA 3J7HA 1IS5A 5CG9A 4YVWA 3RWNA 3SHRA 2YG0A 4MH0E 1W3VA 3PU8A 3K51A 1AR83 3ZDSA 4GWJA 5CIRA 3IIIA 2HWC1 1PK6C 2F4LA 4MGYE 4Q0VA 2FCTA 4PBOA 5A3TA 4OFGA 1ZBE3 2A6VA 1EV13 2CSGA 4LLFA 1JU4A 1EP0A 1GZCA 1JYXA 2CGPA 1CAXB 2C24A 2VNGA 5A6YA 5ABJA 1CX1A 1RUG1 1SBDA 1YJLA 2WO1A 3RMXA 3C7EA 5FMOL 1S0CA 2W5FA 4L99A 1V6MA 4XVHA 1S1AA 1XU2A 2YYOA 3ZLIA 2HWF3 5KR7A 4UW5A 5IVFA 4A42A 4Z2WA 5LA1A 1H9PA 1TME3 1A78A 4RL7A 1NA1B 2PELA 1UU6A 2O8QA 3LA3A 1YXWA 3ACFA 5FJHA 2RS31 2VCCA 4MVTA 2NMOA 4XFHA 2Z69A 1VMHA 4EJRA 3BVCA 4XJWA 4IDZA 1HRI3 1OQDA 3CNAA 4HSLA 2ET7A 2RS13 3EO6A 1DQ0A 2QQNA 4GB31 2VCMA 5L7OC 3DCQA 3LOBA 2OW4A 3BODA 3NNLA 5E16A 1MS4A 1UY2A 4H7LA 4L0PA 1KDKA 4WVVA 1GFF2 2PHDA 5FIXA 4K8FA 4AF9A 3TEZA 1HB2A 4XIOA 2VQ0A 4IE0A 1H1MA 1QJU1 3CLPA 4JRAA 1B35B 2Y6KA 1Q8VA 3GCWA 2XJPA 3RZJA 3JD73 4JHTA 1MVQA 1SFPA 2XBO3 2ZGRA 4LBLA 5FZ7A 2GMEA 2FQPA 1OLQA 1TMF3 3C7OA 4OMDA 3UKTA 2WWJA 4KH9A 4LBJA 4AVAA 2Q1FA 4NPRA 5LY1A 1Y9MA 4P9YA 2VZVA 4RHV3 4YLZA 1EY2A 4KWJA 1LHOA 1W0OA 4LOTA 4CU6A 4KG8A 1TVGA 3NNFA 1VBC3 3JU9A 3RDIA 5A3PA 2QQUA 4UBHA 4DXRA 3A21A 1LHVA 2GDFA 1HLCA 1WCQA 2NMNA 2BQPA 2UURA 4YYOA 1W9TA 4INDA 3WDWA 4CP1A 5LEKA 3AZWA 2Y34A 1OMIA 3SXWA 2QCSB 4D8MA 1CWPA 1QJEA 2YC0A 3VKFC 1AR62 1QJZA 3RZKA 2CAUA 3M1HA 4IXLA 5FPAA 3K3NA 5EYXA 3WUCA 1HDKA 5FOBB 3ZXKA 1POV3 2Z2SB 2VVEA 3I2HA 4XAAA 1XPWA 5DAPA 5JI7A 3OBRA 5F2WA 2A71A 4MGTA 1DZTA 4D94A 2YC2A 1OA2A 4OI0A 4BHPA 2ZGKA 2AR6A 2W9XA 3EYPA 1EYBA 3PJYA 1UOJA 3TRSB 5IYYA 2WFF2 1UMIA 3U10A 2FHRA 2PHXA 4IW3A 1JZ7A 2FDHA 3TEXA 3FX3A 5IAXA 2PHLA 1QIQA 1ZX5A 3O14A 4A45A 2H6CA 5CFCC 4XTMA 5LK7B 4B29A 1YEWA 1O4TA 1WKYA 1QQP1 4EWEA 1IG0A 2DDUA 3L9JT 3PUAA 4LR4A 2WNOA 2X5IC 5FPBA 2RJKA 1CVNA 3K48A 4TXWA 1VBD3 2YPJA 1QKQA 1X8EA 5A33B 1H8TC 1W0PA 1FOD2 5FP9A 1NE4A 1X36A 2OQ7A 2RE9A 1AX0A 3KZ4C 1UD1A 3POFA 3CBNA 3PJQA 4R9AA 4CEYA 5JPNB 2YHJA 1PIV1 3ZSJA 3NAPB 3ZXFA 2P6HA 4DUXA 1AF9A 2E53A 3KVBA 4AHZA 3O1RA 2E51A 1PZ9A 2JDHA 4GB33 1AYN2 3VBUC 3R6SA 1UNBA 2RM21 2MPFA 5FP3A 3MLKA 2VMCA 2VZQA 3ZKUA 5DN2A 3DYPA 1RUF2 2R0FA 2P3IA 2WO2A 3OTFA 4CTEA 4IE7A 2UYAA 4DZGA 1BK1A 4FPYA 2V5YA 1QJU3 3L2HA 1YNAA 1W8NA 2E26A 4LBQB 5GZFA 3FJSA 2A3WA 4XPVA 3A4UA 5FWEA 1JUHA 4IV1B 1XJAA 2PHUA 4K9SA 3ZKYA 2PLV3 1ST8A 4N53C 4CDQC 5JDBA 3NWKA 4I0BA 2Z42A 3HJRA 4CUBA 5IVVA 5C3QA 3JB8A 3KQ4B 3N9NA 4WM7A 3WNXA 2VBPA 5ANNA 5JSOA 3HBKA 2MNGA 4LORA 4TN7A 1QF3A 3I97A 1BEV1 4B7EA 5C8CC 5F5CA 5B2GB 2VW1A 2D6OX 4QPYA 3UV9A 1W06A 5FMOS 4EQVA 1DQ6A 3QD6A 2D3RA 3ZIXA 1QGLA 1SBEA 4LHKA 1BMV2 3H8OA 4ZU4A 2DFCA 4JVAA 3C7HA 3I3MA 5D8AB 2J1TA 2R7EB 2X29A 5B4NA 4EN6B 1CN1A 1D4M1 1JYCA 3HNYM 3ME2A 5LEJA 1Q5OA 3ZDVA 2V4AA 1D0GA 1D0HA 1JHJA 3N4MA 3ES1A 3W5NA 1VAMA 4NWVA 3ZFEC 2D44A 3FUOA 2OZ6A 1UO9A 2XLFA 1BHGA 3HOBA 4JQRA 4PI2A 4FXKB 4W6YA 2OPWA 1ZBA2 2A1XA 3NSTA 2YBPA 4LK6A 4R8HA 1PO22 4A44A 5DAWA 3KGZA 4W4ZA 2NLRA 4LO6B 5C3PA 4P9IA 1CAUA 2ZACA 1REDA 1PM4A 1A8MA 1QQP3 2QFEA 2XOMA 1VIWB 2AGSA 5JZGB 1GSLA 1RUE1 5LBEA 4ASKA 2YB7A 1PX4A 3OGVA 5A6ZA 4GH4B 5C4WC 3K46A 5T54A 4DUVA 5C8WA 3H1MA 4UT5A 2BPA2 3M3OA 1IHMA 2QQIA 3O0WA 2YC4A 5DG2A 3RJ2X 1U5ZA 3M8LA 4Q1PA 4FOWA 4QPIB 2B4KA 5BNPB 1UY3A 3PUQA 4TZDA 1RUC2 2QQLA 3ST7A 4MXWA 4CUGA 5IVJA 3VV1A 1S55A 1F5FA 4LBNA 5HCHA 3OY8A 3R0RA 1CONA 2YPDA 1DGWX 1PGW1 4LNVA 2XVKA 4V1PA 1LEMA 5GZGA 2VQUA 3ZFFA 2FBEA 4E4HA 2BVBA 1WW5A 4IGQA 1REFA 4QX7A 2MHFA 4QXCA 4EYUA 1DLLA 2VG9A 3VZMA 3BOPA 4WV8A 5HCFA 5C3OA 3UL2A 4YFZA 1MZFA 1BXHA 2EXHA 5L7OA 2XXZA 3SH4A 1GMMA 4I02A 3ITQA 1TNFA 1TE1B 2I74A 3GZUC 1LU2A 4HKOA 4PQQA 4M01A 5FMBA 5K4LA 1H1IA 3CL1A 3H42B 4AGVA 3DXUA 2B42B 2JJ6A 5K0UB 4EZHA 2WC2A 4AE2A 1W2AX 1W6NB 2BW8A 3ZSEA 3MIDA 2QJVA 1OLMA 2RR12 4Q27A 4CZSA 3ASIA 3H7JA 1NAEA 3MYXA 5A3WA 4BIOA 3VDDC 2UU8A 5KHHA 4JGYC 1T6BX 4Q4X2 3ZN6B 3SCGA 3VL8A 1X7NA 2GC1A 1OLME 4Z82A 4Y1YA 5LRRA 4AFMA 3CEWA 1HXS2 5AFBA 3PLQA 4META 4XF0A 5FUPA 4ZHNA 2C9AA 4QU1A 3RYPA 1D4VB 3Q8CA 5CKQA 1NCQA 1Z0HA 1BJQA 1D4M3 1GWLA 1W90A 4JKKA 1WLTA 1X33A 1Z7S1 4WM8C 4RQPB 5T5JA 5ACA1 2WAAA 4LK7A 3H8XA 4XFGA 1PGSA 2R49A 1MZ5A 3B01A 1RUJ2 1Q56A 2Q8DA 3N9OA 2EIBA 2LM3A 5DDJ2 4CP9B 4EN8B 2JECA 1FMD3 3CDZB 4JCKA 1QJX3 3USUA 5FREA 2WA3A 4Y4RA 4PIYA 2GSYA 3WF0A 2EAKA 5KHKA 2ZEXA 1OBNA 2WFPA 5FKCA 5GM0A 4LITA 2Y0OA 5FY1A 1ASJ3 4AEDC 4BQ4A 1RITA 4COZA 2DTYA 3WT3A 2AACA 2IZWA 1A3KA 3KV9A 2JG9B 5EPAA 1VPHA 1GWKA 2HWB1 1Q8PA 1AJKA 1RUE3 2KR2A 1AL21 5CFCA 3M70A 5C9AC 2XKOA 4LIUA 1AXYA 3H9AA 1C4RA 3AYDA 1UCXA 1R081 2IXIA 3GM8A 2JDUA 3E97A 3VN4A 2X5IA 1MPXA 3E5QA 4Q4V2 2D6LX 3VZOA 1OD5A 3U4SA 5FXZA 3ZFGA 3PVNA 3N9MA 1SACA 4ZKTB 5IFPA 4QQOA 1H8TA 3BB6A 3IPVB 4M3CA 1AR71 4XFCA 1Q3EA 4AEJA 3H8RA 1W9SA 1QH6A 2GP3A 2VY0A 4Q26A 3KT4A 5SV8A 4M3CE 1AR82 4OCTA 4RD7A 4A7ZA 4P9GA 3A23A 4NIIA 1FPN2 2P6CA 4HVOA 3QLQA 4FPCA 2PHWA 1W6PA 2ZMNA 4EWDA 4R9DA 4UW6A 1N1YA 1ZBE2 2PA7A 4NAOA 5IUQA 3VBSC 2Y38A 2Z4FA 4BLIA 5AC92 4QXBA 1BYHA 4DMIA 4BA6A 5FQ0B 1YQ5A 2O14A 4LUMA 2SBAA 4YWAA 5FYZA 5C7GA 5J3UA 1SCRA 1ND2C 1UQXA 4J1XA 1IKQA 2RMU2 4N53A 4CDQA 4KWUA 1JYTA 3U75A 2BFUL 4KWLA 2ZS6B 4SLIA 2ET1A 1HJGA 1WMFA 3HT1A 3ZYPA 2VPVA 3WQ1A 1CAVB 1W8HA 3CJXA 3ZXGA 4XBLA 5A3MA 1VJ2A 3OB8A 1PHMA 4QB2A 5EJZB 4B3NA 5BXXA 5FMCA 2R32A 3KLSA 1JYNA 1W28A 1F35A 4AFAA 4LKDA 3WVJA 4IEZA 1RUI1 4IUGA 4XHXA 2EAAA 3ACLA 3K4AA 4HK9A 4JC1A 3WDTA 5J37A 4MHRA 4YG3A 1YQCA 4FOYA 1T2XA 1OA3A 3FWEA 3BTAA 1UOGA 4NJ4A 1ZRRA 4X6RB 5GZCA 4BISA 1QU0A 5DUWA 3KD4A 5FRAA 3VHPA 2Q4SA 4B8EA 5I91A 5T50A 3RJRA 1QNYA 1VRH1 5L9BA 4RFRB 1MZEA 2P3YA 3BU7A 5FZMA 3ZR6A 2DU1A 3QH6A 4FTSA 1UY0A 2GAUA 2W0XA 3MHZA 3ZFEA 2W92A 4ITCA 1POQA 5E88A 1MQTB 1S2EA 3NNMA 3E5UA 5EJ1B 2VOWA 1PZ8A 2VZTA 5G05L 5FZEA 4OI1A 2IXCA 1UIKA 3AKQA 3ZIWA 5F7UA 2BGOA 5JXHA 2ZGQA 2FDKA 3FZ3A 3JXSA 1Q8SA 1AL23 4RHV2 2AREA 4XETA 3JB4C 2A6YA 2P34A 3B3QE 2ZGPA 3FUQA 3GJAA 4TLFA 1VAVA 4FQ4A 4DXSA 1ZYBA 4IEUA 1R083 2DURA 4IGOA 3T0DA 4RGKA 1LU1A 1OHFA 1RL3A 1LESA 2VOTA 4MLOA 4XJZA 2R061 3M7AA 2O8OA 4NVPA 3ATGA 5C4WA 4A7YA 5CAZA 3UKNA 3OUHA 4YPJA 4J6GA 1AR73 4OMCA 2JENA 4XUOA 1E5IA 2VAUA 4RR3C 1I3HA 4BPZA 5JCTA 4GXLA 4CCDA 3T2PA 2B9UA 3VBRC 1GP4A 1CX4A 4UFLA 5A32A 4MV2A 1GQGA 1PNFA 3S7IA 4COWA 2DCZA 3O0XA 4HG6B 4QXKA 3VD9A 4Y22B 1V9U1 4AI3A 4BE3A 4BZ4A 1AZDA 2JDNA 1WMEA 1UU5A 3AZZA 1RHI1 3POEA 1VMJA 3BIEA 5L36A 1YI7A 4Y20B 1RB8G 2WO7A 5LWBA 1DGRN 4HL0A 3VD5A 3VBOB 5HV0A 4XTPA 1LRHA 4FTEA 2H0BA 5DXDA 3NJVA 3IM0A 1OOPB 2BDRA 1UF2C 2EICA 5JLVA 3MI8A 5JXJA 1K5MC 4HT1T 3ZPOA 3VDCA 1IQDC 4XXAA 2CU5A 5BNNC 3BALA 4Y24A 4UYBA 1VBD2 3IDBB 4BWOA 1UYZA 3POWA 1AR92 3H1YA 2QNKA 3B5LB 4OYUA 2DF7A 4YVSB 1GYKA 5BNOC 1N3OA 2AEYA 5A7NA 4FAHA 4A41A 5C5UA 1AYM3 4XUTA 2RJLA 1LGNA 4JGYA 5CVRA 1UYYA 1GZTA 2W87A 1RUH2 3LEGA 3K77A 3UGGA 1XOYA 2NP0A 1ZZ6A 4R4XA 2JDKA 2Y6FA 1W3XA 4CDUC 3SKVA 4PLMA 1R091 3KHBA 1XNCA 3T4VA 3SKJE 2A7AA 5HBAA 1ZNPA 2CDOA 2W52A 2W1SA 2XQRA 1N1TA 3OYWB 4KQ7A 4WM8A 3WF1A 1QY4A 4CEWC 1VRH3 2VBBA 1V6OA 1DGRA 2B39A 2WKKA 3MIBA 5A6QA 2DBNA 1UKGA 2PLV2 2B7YA 3C2UA 4UWDA 5KC6A 2HWD1 4QHZA 4GJYA 3D3AA 4WVZA 1DQ5A 3DPRB 2WSVA 2VE1A 4JGZC 2QQVA 1J83A 3IAPA 2JDAA 1M4WA 1IPKA 3Q9OA 2W3JA 1XE8A 3MLJA 3MIEA 4GQ7A 5C70A 5IWFA 4U2AA 4DS0A 4LMFA 5FZFA 4I0WB 4C8DA 1XNAA 2YY1A 2XG3A 1GOGA 3WCSA 2R063 3LWCA 2EXIA 3E6DA 3U4XA 5FZ6A 1F2NA 2ZHNA 2V09A 3FLTA 2JG8B 1OC1A 1V6KA 3HQUA 1GP5A 3GHNA 2ETEA 4D7TA 3MIGA 3EHKA 3VHRA 4DEVA 4V2VA 2YDEA 3M3IA 4AYUA 2GMMA 5T55A 3TN91 3TNPB 1APNA 3VBUA 3ZMOA 4UBGA 1IS4A 1K3IA 4AK3A 3UKVA 1BK0A 1RHI3 4XFAA 1RMU1 5F37A 1SLIA 2VULA 3C3VA 4PF1A 4AZZA 1W8UA 3IKWA 5JOZA 4LHLA 2PFWA 2QE3A 4YW7A 5LK5A 2ILMA 2PTMA 1XRUA 4Q4Y3 4YVWB 4OVEA 1GZWA 4XF3A 4FFFA 3BU0A 4MOAA 3VBSA 1PO11 4H7MA 3DYOA 1KS5A 4B1MA 4BU2A 3NKGA 4JX0A 2WNVC 2JE7A 3H1WA 1HN0A 4YM0A 4CCMA 2HWE1 3K4DA 5KBFA 1ND2A 4FO9A 3BTXA 3NRUA 4G4FA 1DU3D 2HH9A 1MZ6A 4NHXA 5ABJB 3NW4A 3BIWE 2J1VA 2EXJA 2ZPXA 3O7OA 3P3PA 1ULCA 3UT0A 4XMAA 1OVSA 4D3WA 4XFIA 2ZXQA 1NQJA 2YUEA 1JH5A 4E4DX 1GLHA 1OF4A 1S0BA 2CGNA 1R093 2W91A 3IT8A 1NA1C 2YROA 4F3JA 2Y6LA 4B4RA 4BMEA 1DYOA 4H3WA 1UPIA 4MSVA 3THPA 4Q29A 5BNQA 3H7YA 4XHBA 4ISQA 2OS2A 4Y1UA 4LO7A 3RI9A 4E2QA 4Y1VA 2GU9A 2AYHA 1C28A 1RC6A 4P5HA 3OBAA 2RMU1 4QGLA 5C6CA 3VDBA 2C26A 1SLCA 3B94A 4DQAA 4AL9A 1JI6A 3AVSA 2EIDA 2ZMLA 2WNUB 2BUKA 4BQWA 1H1AA 4X8NA 4QPGA 3LFMA 4KU7A 4AHXA 2JIGA 1QEXA 5FO9B 1LTEA 3WF4A 1DIWA 1WW7A 4AI9A 4AHYA 1G9DA 3PVBB 4EWAA 4NHYA 3V0BA 1QXJA 3WDXA 2JDZA 1O8PA 5GZEA 2ARCA 1V0AA 2RS51 3HPNA 4M0NA 3GGLA 3T4HB 3V64A 3ZSKA 3BI3A 2LRPA 3KSCA 1W6QA 4PI0A 2Y0IA 5CISA 3VUOA 3S5AA 1RIRA 3WP5A 2XJSA 1ODMA 1EAH2 1WLWA 4LBMA 5DPNA 1FYUA 4AQ2A 3I3BA 1LKNA 4TTGA 4JTNA 2GNMA 1OD3A 3UETA 1SHWB 4ZS2A 5FY8A 4KGGA 5LBCA 3N9QA 4CDWC 3ACHA 2JKBA 4RR3A 4DEQA 1ALYA 1QJX2 3T0BA 2J1EA 1UY1A 1JZ4A 2YFZA 3DL3A 5FZAA 3VBRA 1GKBA 3ZYIB 2GH8A 2XJRA 5FZIA 4Z2AA 1ASJ2 1PNGA 1R1A2 2D6PA 3J8F1 5FLHA 4P9WA 2E6VA 3I59A 4B4QA 2E31A 1DG6A 5A7WB 1HKDA 1PO13 4KNCA 3LDBA 1NE6A 2BERA 2OXBA 4ASLA 3DF0A 2JDMA 3VLBB 1BVP1 5FXXA 3O5SA 1BZWA 2GNDA 2JDPA 5I0RA 1COV2 1QH7A 4LULA 5F2SA 1YFYA 4QKBA 2IWGB 2FDJA 4XCBA 1R64A 4MUVA 2WNEA 2WZEA 1K5MA 4WVMA 1PGL2 3PL0A 1JYVA 4M0HA 4MXVA 4UF0A 5BNNA 1WA4A 3MUZ1 3FFZA 2W94A 1DGLA 2P3JA 2DV9A 1C3HA 3W58A 3KV5A 5A3NA 1C8NA 4ZPIA 3THCA 2VMFA 3ELNA 5B4XA 4AQSA 1OT5A 4JZRA 4IETA 4LO4B 3CJIA 2CY6A 4E2SA 1G9BA 1J1LA 2QDRA 3GJBA 1S0DA 2Y8KA 5JR2A 2QQPA 2ARAA 2XPJA 3PUSA 3HNBM 1NY71 3H3UA 3LSDA 4LKSA 2XGXA 4QQPA 5FZ1A 4CDUA 5AFEA 5L9VA 1ULGA 4PLOA 1RJ7A 4B4PA 2LROA 2VZOA 3RMYA 3ZXLA 1L7LA 2WT1A 3BCWA 2GNTA 1DQ1A 4CEWA 4GWIA 3AZXA 1DBNA 5CFDC 3D8CA 4L9BA 2FZ1A 2LTNA 1LNSA 1PVXA 2XVGA 1WCDJ 4IE5A 2XHNA 1TQ5A 4E27A 4JHZA 1DF0A 3ACIA 4N7IA 1N1VA 3F95A 3VD7A 4JGZA 2DVBA 4Q5OA 1I9RA 1MR5A 3POIA 1Q8QA 3K3OA 5KC5A 5A3LA 2MEV2 4KWKA 1OQEA 1SDDB 1QNWA 2DUPA 4LXLA 3S5QA 3R05A 1UPSA 3IWZA 4QQ2A 2WZR2 4CP0A 3N35A 1AX1A 3IMNA 1VBA1 1NLRA 3JQXA 5T3NA 1FV3A 4DO0A 3JBG1 1BBT3 1W2OA 5D8AC 5J98B 4DRRA 2BGCA 2J1AA 4IESA 5T52A 3E1F1 3GXUA 1V6JA 5FUNA 2HWC3 3J8F3 3GNEA 5FYSA 2HBTA 2VOKA 1EPWA 1MEC2 3RWKX 2VNRA 3AX4A 3I7DA 4Q8KA 3FFQA 3BPSA 4P00B 4FAGA 4Q0UA 1OA4A 3I2JA 1OKOA 3HR9A 1WLDA 3SC7X 3V0AA 5DZEA 4NOTA 3VBHB 5EWSA 3OUJA 1RUG3 1LOFC 1OPOA 3VBFB 2BJSA 5CA6A 2WL1A 2NM1A 3LFIA 2VUJA 2J1RA 3HIFA 3S0MA 1LHUA 2R1DA 5JZGC 1CAUB 3AJYA 3POBA 2R071 5FY7A 1JN2P 3MF6A 4YW2A 2WNVA 4YZ3A 1F31A 1ENSA 1W9YA 5A7QA 3L2YA 4XZPA 2Q8CA 4ARYA 3RZGA 2OYZA 3T0AA 4AAPA 1O4ZA 2XB6C 3O1VA 2RS33 5F9TA 5BNPC 3AKTA 4QPIC 1K12A 1W8TA 2A3XA 3D82A 3OCPA 1HB4A 2VZRA 1YRZA 2DWRA 2VZUA 3BYWA 3TEWA 1WUVA 4NR1A 2XONA 4RGGA 3ETPA 1O3RA 3RFRA 4LKEA 4MXWB 5JI9A 1W0NA 1OLRA 3W20A 3ZYJB 2VVDA 2WO3A 1XE7A 3D6EA 3FL7A 1CAWA 3DN7A 1RTVA 5F3CA 3PVEA 5EV7A 1D2QA 4IE6A 3ZFFB 4IGPA 1HIXA 3OJBA 2KM2A 2V73A 1UYPA 4OUEA 4XC9A 1S0JA 4JV4A 1UZYA 3AP4A 2OIIA 4OUMA 1QOTA 2WN3A 2XL7A 2P4EA 1W2UA 5LA0A 3VBHC 2DCKA 4URAA 5L7OB 4GD4A 1LAJA 1IPJA 2FCUA 2OUJA 5IVEA 3OPWA 3GYDA 4CUCA 4XFFA 4Q4W1 4XF4A 1AYM2 4BCUA 2VNOA 3OBTA 4L92A 1C57A 2R1BA 4RS5B 1N3QA 1UZWA 1O6UA 5JIAA 1LULA 1O91A 1X50A 2UY9A 1RYYA 1VBA3 3LE0A 3LQCA 3O1UA 4N9IA 2OKXA 5I8TA 1SPPB 2ZAAA 3DKQA 4HOOA 3B00A 4O9GA 1ZRFA 2CGOA 5HCBA 2XLGA 1J3QA 4K20A 4NE9A 1L7RA 4QM8A 3KCCA 1GOFA 1GBGA 1RINA 5JWPA 1ZA7A 4NPLA 1NCQB 3WW3A 3T30A 4CDWA 3DXTA 3WLUA 2GC2A 3UESA 1S2KA 3O0VA 1V70A 3QBQA 1AX2A 2HBUA 3GDBA 3TBDA 1YIFA 4IEVA 2QDNA 3APBA 4O65A 1SZBA 4W50A 3K2OA 1DP0A 2YZ4A 5CNAA 1IOAA 1PK6A 5BPXA 3ZXJA 1YFXA 2ZGUA 4Q0PA 3N7KA 3USUB 3I2OA 2DTWA 1VBB1 2IXHA 3OBZA 2K9ZA 4XOGA 4F83A 2JKXA 3NV3A 1KDMA 1OKQA 3CO2A 4QX3A 2G9FA 2R041 5FP7A 3VKMA 1FAYA 4A4AA 1SLAA 1YFUA 1NCRC 2R073 2WS91 4XF9A 5E1RA 2WJSA 5FYVA 3NO8A 3E6CC 4XXPA 3OD0A 5IVCA 5JOXA 4K7JA 2BBAA 1YQ6A 5IAVA 4M4RA 3WNLA 2VZ1A 4W6WA 4GIQA 3GZEA 2CDPA 1HV1A 1PIV3 4DINB 5A3UA 2OPKA 5FZ4A 4JKLA 5F5AA 2XQXA 1OURA 4YGCA 4AAXA 2X5IB 1PVC2 2WQ4A 3OGJA 5L19A 5DABA 2RM23 3ENRA 4L8QA 2VJXA 4NUBA 5JOWA 1PM7A 4BJ0A 3ZFGB 5D2AA 1H8TB 4N43B 2ZABA 4S2DA 1H2LA 1OPMA 1OF3A 3I3DA 3I2FA 3Q8EA 5IJRA 4ISRA 5ACA3 4D7SA 1GQPA 4Q4Y2 3BN6A 5BUVA 1H6XA 3Q8BA 1COV1 1SLTA 1H30A 1JXNA 1STMA 2JD4A 3U14A 1PGL1 4TSVA 2JE8A 4KBBA 5DAVA 5IT6A 1C8M2 3QH7A 4AG4A 1W6PB 5T5OA 2XKPA 1ODNA 2YBSA 1SFNA 3OOXA 4LIVA 4NRMA 3LB9A 1UY4A 2VR4A 4C1XA 4CDQB 3MBWA 4XIKA 5CFDA 3HMYA 2BNOA 2DVFA 2D5FA 1BEV3 4Q4W3 1RVF2 2P5BA 1VBE2 4AI2A 5JXGA 4U36A 3O1PA 5F3IA 2O1QA 3NJXA 4N53B 5JR7B 2C4XA 3RGBA 2XJVA 3WQ0A 3AYAA 4NO4A 4PHZA 5FPLA 1JOPA 5FZLA 5FCCA 1I5ZA 3HD8B 4CXXA 4UFHA 2B9VA 1L3JA 2CAVA 1FNZA 3E6BA 4I01A 1YHFA 3PHMA 1QDOA 1RUD2 3I2GA 5JOYA 1OH4A
chains in the Genus database with same CATH topology
4XILA 4P9LA 3TYJA 4I3PA 5DG1A 2HEVF 1Y43B 1SEFA 5D8AA 1LOCA 4YM3A 2NZ9A 2CWSA 4IEXA 1QJY2 4C1WA 4C0BA 1VBB3 5FTTC 4LBQD 4QU2A 3ZXEA 4D69A 4F8AA 1CJDA 1LR5A 1ZZ9A 2XHKA 3ZFEB 2WS93 1AR61 1LOFA 3VHNA 1OFNA 1CD3G 3AP9A 3MPBA 1REEA 4KU8A 1UW8A 4CP2A 4QGMA 2EIGA 3IDCB 4XDQA 4QMAA 2ENRA 3NV1A 1MEC1 3T2TA 2F4PA 1HRV2 1MACA 5HXVA 3RPQA 4YZ4A 2WFF1 1DZRA 1CPMA 4MX3A 4PCRA 3U0ZA 5C4WB 4Z8BA 1ZVFA 5BNPA 1F8VA 1UAIA 4GWMA 2G9GA 4QM9A 1S0EA 3ZVXA 4GMP0 4ZU7A 3KS7A 1QDCA 1G6NA 1DQ2A 2XWBB 5A32B 3VBUA 4FPLA 2ZGLA 1D2SA 1EV12 2WINB 3RRDA 1I1EA 1UMZA 2JXAA 4OHXA 4I30A 3HN1A 1FOD1 4X6QB 3D5OA 1XYNA 1J3RA 4R52A 5I8SA 4B7KA 2HWF2 1QOOA 3VBHA 1CJPA 1TME2 1KJLA 1AYN1 3V65A 5C8CA 4HBNA 3HQXA 4HZFA 1FATA 1RUF1 1HRI2 2ZAHA 4PDWC 3S6PA 5GALA 2JICA 5HCAA 1Z7S3 5DUVA 2RS12 2GMPA 3R4SA 3GZTB 3LA2A 5GZDA 4S2GA 1DYKA 1GICA 1IKPA 1SBFA 3AK0A 5IK5A 4AFCA 1DYPA 4HLTA 4NHMA 1O7FA 3JD72 4RA0A 2XBO2 4WM8B 1TMF2 1N3PA 2HWB3 3UJQA 3WD5A 1LGBA 4AQTA 1BMV1 4YW5A 3DPRC 1AR63 1O3SA 1VBC2 4Q2FA 3J4UH 1UU4A 1X82A 3MF9A 3OF1A 4ATEA 1C5HA 1U5YA 3I8TA 4JAAA 3HT2A 4WVWA 3B9CA 2EXKA 1NQDA 1NCRA 1S0GA 2Q1ZB 4R9CA 1WW6A 3H3ZA 2JG8C 2YV8A 4E4ZA 4W65A 4LEJA 2IXLA 1ZBA1 4QQLA 1WLCA 3N3HA 2CYFA 1PO21 3SCHA 3GBWA 3X29B 3QACA 2HWC2 1U5XA 3ZO0B 2ZKLA 2NPIA 1IQAA 4K6BA 3GHMA 4LE4A 3KCXA 1E57A 1RUG2 1QXPA 5FPXA 4TYSA 1FOD3 1W39A 2E7QA 1HQWA 2GALA 3T1LA 2GH2A 4XW3A 3MW3A 3WOGA 3WW2A 1J1TA 1RUC1 4YVWC 3D4KA 5KXBA 3N7LA 3NL1A 1SFYA 1AL0G 4L11A 1BQPA 1SCSA 4YZ1A 1GZWB 3VBSB 3RI8A 3SLIA 4ASMB 1PVC1 1ZZBA 1AYN3 4FP2A 2XJTA 4IEQA 2RS32 3RS6A 4LBKA 1X8MA 4XF1A 3VDDA 2IXKA 1ND3C 1RUF3 2D40A 2D5HA 1ND2B 3UJOA 4Z92B 2GN7A 1RUI3 1YO8A 4GB32 1KS4A 2FMDA 5CADA 1YCIA 1CAVA 1G86A 5GJ6A 3AFKA 4CDXC 3LAGA 1QJU2 1LEDA 2NQYA 2WA4A 1XYPA 3WR0A 4IV3C 4FPKA 2VUAA 2WSUA 5H9SA 2RR11 3WDVA 1UN1A 1RVF1 1VBE1 3VZNA 3THTA 3HAGA 4Q4X1 2WQZC 3VL9A 4HPKA 5FBZA 4FPGA 3AP6A 4YARA 1QHDA 1HXS1 2UWCA 1AHSA 3PNAA 2WNUC 4AEDA 5J96B 2B5HA 4FQZA 2ZKNA 3I54A 1WW4A 4QPGB 3FBYA 1LOBA 2GC0A 5JSRA 5C9AA 4QX5A 1RUJ1 1VAKA 5SV5A 3RSJA 3V0BB 1MS0A 5DDJ1 1FV2A 2ZGTA 5T5LA 3AB0A 2XJQA 5BY5A 3MZHA 2XVLA 3MICA 4HN1A 1W6QB 2WZPP 4J1WA 1PO23 1PZ7A 3POYA 2A70A 1V9U3 3JCIA 4YNIA 3LSEA 3AZYA 2D6NA 4AGRA 3WXPA 1W6MA 4GA9A 3NJZA 4AWDA 1XXNA 4WZFA 1LGCA 4YG0A 4DNYA 1CGPA 4XQDA 3PVOA 4RFT0 1KFXL 4AXOA 1QQP2 5KXDA 5DUXA 3VBRB 4Y22A 3MDPA 3GF6A 1RUC3 3R4UA 4Q4V1 3VKNA 4I2OA 1DZQA 1C5IA 2DCYA 3I59B 3PMEA 4XQWA 3NKTA 3ZSMA 1HRV1 3WDUA 4YW3A 3IN9A 2BVVA 5FLIA 3ZXAC 1PIV2 1AXZA 1AR81 5J36A 1LHWA 1HQNA 4OI2A 1O4YA 1VR3A 1FPN1 4XE9A 1KRIA 1W6OA 4WVMB 2RM22 5BNNB 3ZN5A 1ZBE1 1NYWA 1EV11 4LHNA 5AC91 3JUUA 1LENA 2CL2A 1ONAA 3S7EA 1MS3A 5I91A 2ATFA 4PDWA 5ACA2 3KB5A 3RZZA 4YM1A 4YW4A 3CJIB 2D7FA 1XNBA 2KXLA 3AKSA 2ZGSA 5F5QA 2HWD3 4Q4X3 2BYVE 1DGWA 4COUA 4XJ8A 4Q1RA 2PHFA 4CDUB 4E4SA 1HXS3 2AH2A 4OLLA 3S30A 2LUWA 2ZX3A 1BEV2 2PHTA 2R0HA 1B35C 3WHTA 5I0SA 4DXZA 5IK7A 2TNFA 2E7AA 1JUIA 1RJ8A 4DOUA 1OFSA 3M3CA 3ETQA 2FZ2A 4HKWA 1H8VA 2H6BA 3DPRA 3D0SA 4FPHA 1B09A 1RUJ3 3USSA 4AEMA 4UXAA 5L73A 4D7YA 1D4M2 4JGZB 1ZZ7A 2GC3A 4FP3A 4XMIA 3FBMA 1LOGA 1WBFA 4IEWA 3TN93 2A75A 3QOPA 2F6BA 3MFAA 5E8AA 1DHKB 2Q1MA 1U5IA 1FMD2 2NYYA 2LALA 1TMF1 1RMU3 2VMHA 4RSUA 4NHKA 3FLPA 4HETA 4RHV1 1BVVA 1VBC1 1SQ4A 1VALA 4EROA 1VB4A 3LZZA 4N90A 5JIUA 1YYNA 4OHVA 1XNDA 1RUE2 2A6ZA 4NHLA 2YGLA 1GQHA 1KITA 2D98A 4YRDA 5I93A 4MZUA 1YJKA 2HJIA 3H50A 5E89A 1CQ9A 1HQLA 2HWE3 1SDWA 3VBFC 2ARXA 3IDEA 2E9QA 3V0AB 2A6XA 2OUHA 4R9BA 1WGPA 4BIFA 2PHRA 5H9RA 1HX6A 1PGW2 1FPN3 4GMP1 3GBGA 2TUNA 5BNOA 2OVUA 5AC93 2WNVB 1ND3A 4Y4YA 1Q8OA 4SBVA 3TWIA 4TWTA 5FPZA 4COYA 2VMIA 2ZHKA 2PAEA 3NAPC 4MYEA 3WG4A 2TEPA 4GKYA 3WY6A 4CEYB 1YI9A 4ATFA 2RMU3 3AP5A 3EBRA 1ZZCA 4ZXKA 3SMHA 1WCKA 1IGOA 2QKDA 1VBD1 4FXGB 4CDXA 4AHWA 1AR91 2ZHLA 3DUIA 2EA7A 1TEIA 4S2HA 4AQ6A 3ZFFC 1H4HA 4H14A 4IV3A 3VZKA 2KA3A 1CAWB 2VECA 2ES3A 3B93A 2HYKA 2PAKA 2Y26A 2B46X 1SMVA 2VOVA 4IV1C 4AVVA 4YZ2A 3WP3A 1J59A 4AVSA 1RUH1 2Z79A 4XJ9A 3VGIA 2RS53 2ZA9A 2DVAA 4QGNA 1V00A 5EJ3A 1FNYA 1ENQA 2WNUA 3DKWA 4WM7B 2XH6A 3AM2A 3ZYRA 1AUYA 4RS5C 1JW6A 2BWAA 1Z7S2 5GKAC 1G9AA 3JZVA 4IL7A 1SLBA 4P9XA 2JEMA 3KCYA 4H55A 2PLV1 4LO5B 5JVVA 4L2NA 1LOEA 4HVRA 1GANA 4I3GA 4AEKA 2JE9A 4M3CF 3DV8A 3POSA 2H0VA 1NCQC 4LT5A 5DUUA 2HWB2 2EVXA 3AZVA 3M4FA 1AL22 2I2SA 4CDWB 4HN0A 4FPOB 4KG0A 4WBBA 1S2BA 1NZCA 3CF6E 2ZBJA 4QQHA 3KGLA 3ZN4A 1NLSA 4HANA 1IZ3A 5H9QA 1R082 4AVTA 3AMPA 1ZA4A 3KM5A 3U11A 1PK6B 2ZCWA 4A7KA 4LE3A 4GMP3 1AR72 3KQRA 1CAXA 1ENXA 4GH4C 4K3UA 1AVBA 5F6LB 1ULFA 2E63A 1NOVA 1XU1A 3VZJA 1IS6A 5I8YA 5KHGA 1A8DA 3PMSA 4FOVA 1AXKA 1GR3A 3A0KA 4EN0A 1Z78A 2BTVC 3OY8B 1NA1A 1H9WA 4Q0QA 4YGEA 4RGAA 4HFSA 4PBPA 3ZFGC 4AVBA 1AR93 1I6XA 4CYDA 4GALA 4JDNA 4N43C 5LRSA 2SLIA 2YXSA 3AKRA 3WCRA 3OGGA 3CU7A 1WD3A 4DY5A 3J26N 2I07B 1S0IA 2VVFA 1KQRA 2WIIB 3G7DA 2DUOA 2BNNA 1RUH3 2OZJA 4GKXA 1KFUL 2OA2A 5K0UC 3AMHA 3KT7A 1B35A 1FT9A 5GLTA 4YGBA 4E2GA 4PLNA 1RUI2 5CFDB 2VOXA 3MIHA 1H2NA 1GNZA 3WX5A 3WW1A 2D6MA 2EALA 3G6JB 4PF5A 4OHWA 1LOAA 3JBG3 3MFCA 2D93A 4XQ4A 2Q30A 2W68A 2XLAA 3TNQA 1VRH2 5DZFA 3ZSLA 5GLUA 3OD4A 3R4DB 1XNKA 4RQPC 4Y26A 3AJZA 3AMNA 4OHYA 1M06G 2CWMA 3TAYA 3I4IA 4HKLA 4NN0A 5I0UA 2Q0AA 1MS8A 1C1LA 2D43A 1EAH1 3WP4A 1BKZA 1RGSA 4Z07A 2VW0A 3MGUA 3IIAA 3ILNA 2R062 2JG9C 2ERFA 4W6XA 5K7PA 1CIWA 1QMJA 2BEOA 3D0JA 3SITA 1GNHA 3TOJA 3AYEA 4OULA 1FMD1 3VBFA 1QJX1 4Y1ZA 2G4IA 5CFCB 3VZLA 1JOJA 4P9JA 4F7ZA 1ASJ1 1V9U2 1R1A1 4XFBA 2HKXA 1LHNA 3H8UA 3URFA 4FBFA 4IQPA 4AFBA 5A33A 1RHI2 2DYCA 4A2UA 5FOJB 3LA7A 4M3CB 1VLNA 5HI0A 3NAPA 3WHUA 5J09A 1DDLA 1UIJA 4IEOA 1UKRA 1MVEA 1ZRCA 5AVAA 1U12A 1KXGA 1G9FA 1Q43A 3MPPG 2ZX1A 3VBUB 4LLOA 4CRQA 3WINE 4LBQA 4YGDA 4IV1A 1LJ7A 4QD2A 3HWJA 4S2FA 4PIXA 5JAXA 4OI4A 3NV2A 4BYYA 4C91A 3RQ0A 4CDQB 1QWRA 2A6WA 2AENA 2K0GA 2TBVA 3N7JA 4I0AA 3EQEA 3MW2A 1R092 1OI6A 1MS9A 2DUQA 4EN9B 2IFRA 4HK8A 3MLLA 2FMYA 2X53S 4RS5A 5JMCA 5C8CB 2C0ZA 4BLJA 2XUMA 5KXEA 2ZGMA 4LUKA 2HWD2 1JBCA 1J3PA 1GZ9A 4BOWA 5BYNA 4COVA 1S0FA 1LCLA 4AW7A 4Y5Z0 2BNMA 1EAH3 1SLLA 5FFOC 1O5UA 3SH3A 4EV0A 2MEV1 5KHJA 4I09A 3WZ1A 1MQTC 2R043 2XL9A 4ES8A 2AUYA 2IC1A 1N1SA 2WZR1 1O3TA 5JPMB 3NVCA 2VW2A 2D6KA 4LO8A 2AZ5A 1YWKA 3KT1A 4QT6A 3J9SA 4OZXA 2CV6A 4K40A 3VHOA 2YMZA 5JZGA 3TN92 3H0OA 4L97A 4YG6A 2WLPA 2ZX2A 2D3SA 1R1A3 4GH4A 2P37A 3B02A 3GALA 2IXJA 3SNMA 1POV0 5K9YA 1CR7A 1NCRB 1RMU2 2E7TA 1UX6A 4ONUA 4QPIA 2A3YA 1FX5A 4UW3A 1TNRA 3RYKA 3FLRA 2VGDA 1COV3 1VP6A 1PO12 2P3KA 1JYIA 4N43A 3INAA 2HWE2 3VBOC 3AMMA 4JTOA 4E9KA 1OOPC 4LA3A 2QZ3A 2P17A 2GN3A 1DFQA 3VKOA 2WWSA 3JQWA 2VH9A 1Y3TA 5KHIA 4JDOA 5TSWA 1Y9QA 4AGGA 2PN5A 2C5DA 3ILFA 5K0UA 4YVSC 1W6NA 4YZ5A 3AKPA 1O5LA 2CTVA 1KJRA 2YGMA 1ZM1A 4AI0A 4XJUA 1FI2A 3ZN6A 2ZOEB 1AJOA 2CNAA 2QZ2A 1G8WA 5H9PA 2QVSB 3VDDB 1Y7BA 5K8SA 4HSJA 4JGYB 4IEPA 4HMZA 4IERA 1WD4A 4FT8A 4DRVA 2Q8OA 3A0NA 2VXRA 2WLQA 4GWNA 2BBVA 1T6GC 1JHNA 2PYTA 2ZGOA 4RQPA 5DZGA 1AYM1 3ZX7A 4WZCA 2X8KA 3MW4A 1NXD1 4X8PA 2MEV3 3U07A 4GULA 5CB7A 2RS52 1C1FA 2A5ZA 2WZR3 3ALQA 4AI1A 1YLLA 4HPKB 3WDYA 3E5XA 3M3QA 4IEYA 1N47A 4AEDB 2JG9A 3SCFA 4QPGC 4OUSA 1MEC3 4HVQA 2GNBA 1BBT2 2WFF3 5T5PA 5C9AB 1HW5A 2DVDA 1VB2A 3SH5A 1J58A 3J8F2 4XBNA 4C90A 2DU0A 2ZGNA 2ZZQA 2ZX0A 3ECQA 3QCWA 4FPJA 3ZYGA 4MGZE 1V6IA 3IPVA 2JX9A 3AP7A 4FTBA 3ZPYA 4BH9A 5FO7B 1A6CA 2K2SA 1W6MB 4Q8LA 3RG0A 1QOSA 3W9AA 1OQ1A 3AXDA 5EFUA 2R6QA 3FC0A 4DPNA 5IK4A 2D3PA 2I45A 4AFDA 5J48A 3LCPA 4BM8A 1BCXA 4K1YA 1LODA 5FQ0A 3BOWA 3UK9A 1WCSA 3NV4A 2ZZJA 4Y1XA 4BMBA 5ABJC 5BV6A 2GZWA 2UY8A 1NY72 1WBLA 4Q4Y1 2N7GA 1JTZX 4DFSA 3AMQA 3GBFA 3AFGA 3O12A 4KL1A 1C8M1 5D1IA 1W6OB 4FPFA 1F9KA 2WT0A 1ZREA 1CPNA 3WP6A 4YSFA