2ZGMA

Crystal structure of recombinant agrocybe aegerita lectin,raal, complex with lactose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
total genus 39
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgmA00
2EIGA 4XBLA 1DQ4A 1FX5A 1W6PB 4M3CF 3NV2A 5T5LA 1N1VA 4M3CA 2SBAA 2FMDA 3AZXA 3OBRA 3T2TA 3AYAA 2ES3A 3ZXEA 3KQRA 4R9DA 2Q5TA 1QKQA 1G8WA 2PHFA 3AXDA 1GBGA 4FOQA 3ZXJA 2CNAA 2ZA9A 3BODA 4XJUA 2W39A 4CTEA 1GANA 3MW2A 3R4SA 1ENRA 4FOWA 5DG2A 4YW1A 5CB7A 1HQLA 1LENA 1N1SA 2D6PA 3L2YA 2A3XA 1I1EA 1ZA4A 4RA0A 4JRAA 5JVVA 2PHWA 2D6LX 3WHTA 2P3KA 1MS1A 3MW3A 4M01A 5DXDA 3VKNA 2JJ6A 1QMJA 2D6OX 1LOFC 2XB6C 4UW6A 2D7FA 5CAZA 1DYKA 5GZFA 5EYYA 2JDZA 1SCRA 2XG3A 2R49A 4YGBA 3FFZA 1FNYA 4YM1A 3PVOA 2AYHA 2D6MA 4FPGA 2P37A 4AYUA 3ZXFA 5FREA 3ZSMA 1KDKA 2A6VA 3B3QE 4BPZA 2CWSA 2ZHKA 3WDYA 4YFZA 1QU0A 1AX0A 1XQNA 5GLUA 3WDUA 4NO4A 1Q8VA 1IOAA 3WUCA 3MW4A 1MACA 1WUVA 5EWSA 2E51A 3JUUA 1MZ6A 1DQ2A 1WW5A 4WVWA 1WW6A 1KRIA 4ISQA 2P2KA 4Y20A 2WKKA 4ISRA 2W52A 2YROA 1W6NB 1V6OA 1QNWA 1S1AA 1G9AA 1S0DA 5EYXA 3WNXA 3OJBA 4K20A 1GSLA 4GA9A 5GZEA 1BXHA 4Y22B 1ULFA 3O0VA 4LBNA 3VKLA 3RG0A 1S0IA 2OVUA 2PHUA 2AUYA 1QOSA 3BIWE 2ZGQA 1AF9A 1YXWA 5GLWA 2E6VA 4FPYA 1QDOA 1VALA 3D6EA 1GYKA 4ASMB 2GMEA 3NV3A 2AH2A 4FQZA 3ZXLA 1G9BA 1MS9A 1LECA 1MS3A 4R9BA 1V6IA 3TAYA 1DLLA 3AZYA 4AGGA 4XHBA 2GNMA 1IS6A 1D0HA 4AVVA 2DTYA 2P3JA 5JOZA 4YLZA 3OBTA 2ZBJA 3WDTA 1SLIA 3ATGA 4GWMA 3N7MA 2CL2A 3NV4A 3DUIA 2ZABA 2NM1A 2DTWA 2A6WA 1DGLA 2WNEA 3WDXA 2NYYA 5JOWA 3O12A 4XBQA 2A3WA 3DGTA 2NMNA 1LHOA 1N3OA 4P9XA 1IKQA 2D44A 2DUOA 5DUVA 5IUQA 5AVAA 3AP9A 3MPPG 1GNHA 2WLQA 2ZGLA 2ZGMA 3IPVA 4LBQB 5CA6A 1G7YA 4YW5A 3UJQA 1LESA 3VKFC 2WQZC 5IK5A 2A6XA 1CIWA 4DRVA 1YYNA 1CONA 3N36A 2ERFA 3LSDA 5F9TA 2NMOA 1GZWB 4LBKA 1W6OA 4YG3A 2A5ZA 1AXYA 1V6KA 4LBQD 4BOWA 4BQ1A 1FNZA 4C1WA 4UW5A 1KJLA 2AENA 2DURA 4XIKA 4WZFA 5IK8A 3FUOA 2UWCA 4YM0A 4FPFA 3AP4A 4DRRA 2OUJA 2JECA 4XMIA 2VY0A 3SNMA 1HLCA 2AGSA 1UMZA 3BTAA 4KBBA 3IMNA 1IS4A 1GLHA 4DQAA 1JYCA 1DFQA 1LCLA 1CQ9A 2JKBA 1V6MA 1AX2A 2A70A 3GALA 1DBNA 3FLTA 4XOGA 3M2MA 4W65A 1WW4A 3AXEA 4M00A 2DU1A 3AYCA 4YM2A 4YZ5A 3IN9A 3PJQA 3WCSA 2R16A 3WV6A 5DUXA 3ILFA 3SH5A 1UN1A 4Q2FA 2WT2A 1IS3A 1AJOA 4ATFA 4ZKTB 3SITA 1R1ZA 3FBYA 3OYWA 2D6NA 2NZ9A 1Z0HA 4DPNA 1WLDA 1G9DA 2GDFA 1CVNA 1VAMA 2JD4A 3V65A 1JUIA 4FP2A 2DUQA 3USUA 3RRDA 4LBJA 1U0AA 3WG2A 4XZPA 1Q8PA 1APNA 4FPLA 5T5PA 3FLRA 2WT1A 1WLWA 3GNEA 2GNBA 2DWRA 2R0FA 1ENSA 1W6MB 2RHPA 1AX1A 2WJSA 1YRZA 3O0WA 5DUUA 2BQPA 1JBCA 4YZ1A 1A8DA 2A6ZA 1LHUA 2A6YA 4JC1A 2PHTA 1NLSA 1DQ5A 3AJYA 3RMXA 2YZ4A 2ZGSA 5T50A 1BZWA 3AFKA 3ZSLA 4Y22A 4Y1UA 1FYUA 3KM5A 3WCRA 2V73A 4Q8KA 1DZQA 1MZ5A 1PZ8A 1ULEA 3AYDA 4K1ZA 3WG4A 4H55A 4FPHA 1S0EA 5DUWA 3FUQA 3AJZA 4OZXA 2EXIA 5T5JA 3M1HA 4UW3A 4YW4A 5F5QA 4FVVA 1MS0A 3JU9A 1N3QA 5HCAA 2P3IA 4TZDA 4XXAA 3AP7A 4Z8BA 1A3KA 3ILNA 3LSEA 4PF5A 1VLNA 4XBNA 4XJWA 4Y1ZA 4YZ2A 2NN8A 1SLBA 2E7TA 1DIWA 2UU8A 3ENRA 3C2UA 4YGEA 3POWA 3AK0A 2ZACA 1QGLA 5E8AA 1G9CA 4XHXA 1H9PA 4FPKA 5E89A 5KXDA 1CPNA 3A0NA 1LOAA 1NXD1 5DZGA 2YXSA 4HL0A 4YGDA 3USUB 2D3SA 2UWBA 2H0BA 4XJZA 3ZSKA 1FAYA 3SH4A 4XTPA 4Y20B 4GKXA 4YG0A 1N3PA 4DFSA 1W6NA 2ARBA 2SLIA 2CYFA 4RL7A 1UZZA 1YI7A 2VH9A 4TYSA 1V6LA 4LBQA 2LALA 4AGVA 1W6MA 1JHNA 3AZWA 5IT6A 1GICA 1SLTA 2PELA 5CNAA 5SV8A 2ZHLA 1SACA 1WCSA 2FHRA 4F83A 1V6NA 2E7QA 2ZAAA 3POYA 4Q26A 3INAA 4FPJA 2EXHA 3T1LA 2A75A 3UJOA 5JOYA 1S0CA 5L73A 2ZMKA 1MS4A 4FQ4A 5GLTA 4YW3A 3SLIA 1OFSA 4P14A 3WG3A 5GZGA 2V5YA 1LTEA 4YZ4A 1CESA 1LGBA 1SCSA 3VV1A 3WDVA 4K21A 2D6KA 3WZ1A 4CRQA 1CN1A 1HQWA 2NP0A 3QCWA 1MS8A 1LGCA 4GALA 1WW7A 2WSUA 1V00A 4GWNA 4I30A 1G86A 3AP6A 2ZHMA 2GNDA 2A7AA 1LJ7A 3ILRA 4ATEA 3WOGA 3I4IA 3OPZA 4LBLA 4Q1PA 1W0OA 5EXOA 4XJ8A 1YO8A 2ZHNA 1TEIA 3R05A 2D3PA 1F5FA 1JN2P 2ZGRA 1WBLA 4BMBA 5BYNA 2P34A 1F31A 2A3YA 4AGRA 3CNAA 3V0AB 4Q1RA 3MEPA 1RINA 2ZKNA 3PVEA 3PMEA 5H9PA 3V0BB 3N35A 4UW4A 1FATA 3SH3A 4WVVA 1RITA 2ARXA 1QDCA 1W6OB 3ZXKA 2GN7A 3WDWA 2CY6A 1W0PA 3N3HA 2TEPA 1IKPA 1BYHA 4PBOA 2VW0A 5LK5A 5T5OA 5KXEA 3B01A 4GKYA 1UKGA 1HKDA 2E53A 3B69A 3O0XA 2I2SA 4Y24A 3POSA 3QLQA 1JOJA 3W59A 2GALA 2DVGA 2DVDA 3VKMA 1A78A 4BLJA 1DQ6A 1EPWA 1MVQA 1WD3A 1GKBA 1Q56A 4XXPA 3T1MA 3AYEA 3AX4A 4XDQA 1G9FA 3V64A 3D4KA 2W08A 1LOBA 1KITA 3H0OA 4FOYA 3ASIA 3TB0A 1C4RA 2YV8A 1URXA 2LTNA 1H9WA 2DVAA 4BM8A 2GN3A 4C1XA 1MVEA 2DYCA 1SBEA 5T54A 2ZGTA 1GZCA 4MYEA 4D69A 4PCRA 1ZM1A 1OQ1A 2ZMLA 3AZVA 3OGGA 1S0GA 1DQ1A 1F9KA 1Z78A 2ZGNA 1ULCA 3RS6A 1LULA 2YY1A 3BOPA 2EXKA 3R4UA 4U2AA 1LEDA 1KQRA 1AXKA 1Y7BA 3M3QA 1H30A 4XIOA 5DG1A 5GLZA 1MS5A 3WVJA 3V0AA 4SLIA 2GMMA 3V0BA 5GZCA 3WG1A 1DHKB 1DYPA 5GALA 1D2SA 2DVFA 1C1FA 1C57A 2W68A 3Q9OA 2WSVA 1DQ0A 1JXNA 2GNTA 2JE9A 2PHRA 2ZMNA 4AWDA 2D43A 3HMYA 1LEMA 1LU2A 4XJ9A 1SLLA 3RSJA 1X50A 1UPSA 1RIRA 3A0KA 4M3CE 1MR5A 2EF6A 2R1BA 1C1LA 2AR6A 2JE7A 2KM2A 2EXJA 5GJ6A 1W6PA 2DUPA 3VKOA 4M3CB 2OUHA 1GZ9A 1LOFA 3APBA 4LBMA 1W6QA 2CWMA 2VW1A 1FV2A 1SLAA 1UL9A 4ZXKA 1YIFA 1Q8SA 5GZDA 3ZVXA 5JLVA 3RQ0A 3UK9A 1LGNA 1LHWA 1AZDA 4Y26A 1VIWB 4Y1VA 3ZYRA 5GLVA 1S0FA 4ITCA 1W6QB 4NOTA 5HCFA 1N1TA 3B00A 1CR7A 4FOVA 1LODA 3SISA 3VUOA 1IS5A 5T55A 4PBPA 2UWAA 4K1YA 3U4XA 4HANA 5GM0A 1O4ZA 1S0JA 3WUDA 1FV3A 1WBFA 4Q27A 4CZSA 4PQ9A 5IK7A 1ENQA 3HN1A 3M3OA 1ULGA 4Q8LA 1AJKA 1SBDA 2DV9A 3WHUA 4XMAA 3I8TA 4P9YA 1HDKA 1GV9A 1BQPA 1O4YA 2VXRA 1AVBA 5CBLA 3N7KA 4YFWA 1V6JA 2YMZA 3M3CA 2ZGOA 3NV1A 5H9RA 3RMYA 1BJQA 1I3HA 4FP3A 1J1TA 1QF3A 4U36A 5H9QA 4YG6A 1N47A 2R1DA 1QOTA 4YZ3A 4L8QA 1LOEA 4DS0A 4FPEA 5KXBA 5JMCA 2VUAA 1Q8QA 2OW4A 2DVBA 1SFYA 1CPMA 1WLCA 2ZGKA 4XILA 3IM0A 4Y1YA 4AVSA 1JW6A 1KJRA 1LOGA 3WLUA 1ULDA 3N7LA 1LHNA 1PZ7A 2R0HA 3AP5A 1SBFA 3B9CA 4IQPA 2PHXA 5E88A 3ZPYA 2EAKA 4R9AA 4JCKA 1LHVA 3ZSJA 4YW2A 1N1YA 2ZGUA 5DZFA 3D5OA 3M3EA 2GMPA 2EALA 1S0BA 4YGCA 2B7YA 4XTMA 4BLIA 4AVTA 2VW2A 1OKQA 1UX6A 3N7JA 2ZZJA 5IK4A 1SLCA 3A4UA 3W58A 1ONAA 1WD4A 2CTVA 4LBOA 3HR9A 1PZ9A 4P9WA 2Z42A 1UZYA 1LU1A 4BMEA 2ZGPA 4XE9A 1QNYA 4WV8A 1QOOA 2D3RA 5KXCA 5JDBA 1CJPA 2VU9A 1AXZA 2C9AA 3OY8A 3NWKA 1B09A 3UL2A 1UAIA 1LOCA 3AZZA 3IKWA 4GXLA 5H9SA 4YM3A 1GNZA 2A71A 3IPVB 5DZEA 3ZYPA 1JYIA 1KDMA 3OYWB 3FLPA 3LCPA 2G4IA 2ENRA 1VAVA 2UURA 4FPOB 1Q8OA 3OY8B 4Y1XA 1BKZA 2C5DA 4XYXA 3PVNA 2AREA 2DU0A 4R9CA 5HCBA 2HYKA 5JOXA 1GZWA 4FPCA 3O5SA 2WT0A 5FRAA 5T52A 4XJAA
chains in the Genus database with same CATH superfamily
4WM7C 3OUHA 4P9IA 1DQ4A 2IXLA 2R061 4M3CA 3OBRA 2Q30A 5A3WA 3KQRA 3C7GA 3D0SA 4F3JA 2XVGA 5CKMA 1QKQA 1OOPC 2P4EA 2PHFA 4Z07A 2QQVA 4LT5A 5KHGA 2DBNA 4QD2A 4CUCA 3BODA 2ZA9A 1R1A2 4ES9A 2OX0A 2VD7A 2CV6A 4XJUA 5FLIA 4NIGA 2Y6JA 4FOWA 2HWB3 4YW1A 3L2YA 1XNKA 2A3XA 3CDZB 3POFA 3WF2A 1I1EA 4RA0A 5G04L 2DCJA 2R7EB 3ACLA 4GMP1 1AR93 4TWTA 2P3KA 1MS1A 4M01A 3VKNA 1NX9A 4EWDA 4DOUA 4AK3A 5A6XA 4UW6A 5CAZA 4DXTA 1AR91 1MQTC 1JU3A 2BP6A 2JDZA 3FL7A 1SCRA 3WQ7A 4EN7B 1V9U3 3GYDA 1HRI1 3FFZA 4OHVA 3KF3A 5JIUA 2AYHA 2D6MA 2YU1A 1TME3 4LIVA 5E1RA 2ZEWA 4A2UA 4AYUA 5EJ1B 2JWPA 3USSA 3O1SA 4J6GA 4IW3A 2IZWA 1VMHA 4YFZA 2DCZA 3WDUA 4Z82A 5A7SA 4CSWA 1PGL1 4V2WA 1PO21 2BFUS 5FZEA 1JYXA 1ZX5A 1A8MA 1MZ6A 1DQ2A 3IAQA 4QAWA 5IAVA 1NUKA 1VBB3 3U1XA 3UNPA 3LF7A 4IEPA 1KRIA 3MIEA 4N53C 3KHCA 4Y20A 2WKKA 3S7EA 5CG8A 2RM22 2E26A 4PLOA 3RPQA 4AZZA 1V6OA 1QNWA 1S1AA 2FCUA 1RL3A 2RJKA 2LROA 3OJBA 3WNLA 5A1LA 1W8UA 4Y22B 1ULFA 5LBEA 4E2GA 3BTYA 4QHOA 4WM7A 3TEYA 1REDA 4NAMA 3K4DA 4COZA 2G19A 1YXWA 5GLWA 3W5MA 4XC9A 4QPIA 2E6VA 3NJYA 1VALA 4FPYA 4UF0B 2GMEA 3NV3A 3VBRB 4FQZA 1FI2A 2Y8KA 1B35B 1FXZA 1XNBA 4R9BA 3UETA 3R4DB 3AZYA 1UO9A 2CHHA 3GDBA 3T2PA 1WCUA 3B9IA 1D0HA 4AVVA 4COUA 2P3JA 3U4SA 2Q4SA 4YLZA 2BFUL 4CEYB 2C24A 4A7KA 3OBTA 4BWOA 3WDTA 2QQKA 4QM9A 3ATGA 5F6LB 4D7YA 4XZUG 2RS12 3EXUA 3NV4A 3OUIA 4TLGA 2WINB 3WF0A 1DGLA 5FP9A 3ZFGB 3O12A 3KQ4B 4XBQA 5C3PA 1TE1B 1JYVA 4G3YC 4P9XA 2D44A 3LKJA 1PO12 3POBA 1GNHA 4FBFA 1XRUA 1G7YA 4QX1A 3UJQA 2Y38A 3J7LA 5EZWA 2A6XA 4KNCA 5JPMB 3THDA 1AL21 1CONA 5F32A 2ERFA 1YFXA 2B8MA 4K6BA 1W6OA 4QX7A 4RYDA 1H6XA 4IE7A 1OXCA 4JGYC 4UW5A 4HKWA 4EQVA 4TLFA 5FZKA 5L36A 1F5JA 2VQTA 2FDKA 4WZFA 4XQWA 2QUOA 2BBVA 4FPFA 3AP4A 2BV4A 2VY0A 2AGSA 2GC2A 2ZX2A 3BTAA 3HWJA 4MGYE 3ZFFA 4KBBA 1OUSA 1GLHA 5K8SA 3LGRA 1JYCA 1PO11 1FT9A 1POV3 4QPIB 1QJY3 4AI0A 4XFGA 1CQ9A 1T6GC 3CQOA 4XF1A 3LEKA 1PVC3 3POEA 3PHMA 1Y4WA 1WW4A 5EPAA 2WUHA 3IN9A 1D7PM 3GM8A 1VBA2 2R16A 3KGLA 3THCA 4QPYA 4A6SA 2BNNA 1QH7A 1UN1A 1PK6A 3OG2A 3UKVA 2WT2A 4ATFA 4B3NA 3MFAA 3T09A 1R1ZA 4AFBA 2WO3A 2RV9A 3ZFEB 1REEA 4DPNA 1WLDA 1YQ5A 5A3PA 2B45X 2Y6KA 4QXCA 3CHXA 1NQJA 3OOXA 3KV6A 1MQTB 4LJHA 1ULPA 3VD9A 5T5PA 1QQP3 3I97A 1RGSA 3NW4A 4XABA 2BUKA 4O9EA 3WINE 4CXXA 4RQPB 5FO8B 4D0QA 2LRPA 1DP0A 3HN3A 3IIAA 4JTNA 4Q4X3 1K12A 5FYCA 1OF4A 4FXKB 4OULA 4X6RB 1JS9A 4YZ1A 1PX4A 3LFMA 4RGGA 1F4HA 4QDSA 3C7OA 1NLSA 3AJYA 2CDPA 2ZGSA 1HB3A 1BZWA 2RS13 1J58A 1RUF3 1UPIA 3RVHA 3KHBA 5FZ0A 3MICA 1NCRC 2GC0A 4M4PA 3KM5A 1BBT2 2D5FA 5A7WA 4XAEA 3U0ZA 1ULEA 3ZSEA 4K1ZA 4RS5C 5DUWA 4X8PA 5JZGB 2XJQA 1YQCA 4UW3A 1XJAA 4L11A 1NA1B 5DQ0A 3EHKA 2ARAA 5LATA 4HBNA 1T2XA 2RE9A 4TZDA 4XXAA 1OH3A 2O8OA 5ERLA 5JMOA 1GP5A 1RJ8A 2JB8A 3ILNA 4XJWA 1L7RA 1Z7S3 2P5BA 3JD72 2NN8A 2E7TA 2EAAA 2UU8A 1E5RA 3C2UA 1H1AA 1X8MA 2TNFA 3EBRA 3GGLA 4KGGA 4MH0E 4CDWB 3M4FA 5CFDB 2K0GA 3AK0A 4N8MA 3K77A 4BQYA 1G9CA 4XHXA 2LW8A 1RXFA 1RMU2 4LA2A 1RVF3 4QQHA 1J3QA 1NLRA 2QQUA 2YG0A 3ZFEA 4DXRA 1RUOA 2J1UA 4E27A 4AHYA 4HL0A 4IEYA 2WQ4A 5A3UA 2UWBA 3WXPA 4XJZA 3WT3A 1R1A1 4V2VA 2VBPA 3QOPA 3ZXGA 4OHYA 4YG0A 3VHNA 1N3PA 1KS5A 5LA9A 3O1TA 1UZVA 3BPZA 4JKLA 3SCHA 1YQ6A 1V6LA 4JTOA 1O6UA 5HV0A 4KWKA 3W9AA 1JHNA 4W6XA 4S2DA 5IT6A 3TEWA 1GICA 5CNAA 1YQ8A 1JZ3A 4XJAA 1VMJA 3FHIB 2XWBB 1VBA3 1ULOA 1AL0G 1CAWA 4QB1A 4Q26A 3PIGA 1W8NA 1VBE1 4M0NA 2P6CA 2D5HA 4LQRA 5CFCA 2VMDA 3I2OA 3UJOA 1Y43B 5FYBA 1S0CA 4AI1A 3KLSA 1MS4A 3OB8A 4EN0A 4A42A 2JDNA 2XDVA 1ND3A 1UWWA 4HKLA 2IVIB 4P14A 4QKBA 3WG3A 1SDDB 3C7HA 4KG0A 1PVC1 3VV1A 3WDVA 2KA3A 5F3CA 1OOPB 1W9YA 3IDCB 4GALA 4Q0UA 5BNNB 2WSUA 3H3ZA 4I30A 3VZNA 4CXYA 1AR81 1QQP2 1G86A 2EVXA 2VNOA 3HAGA 2GNDA 1D0GA 4YNIA 4L2NA 5IFTA 4TTGA 2YC4A 1IHMA 1UIJA 3HNYM 4Q4V1 1A34A 1HRV3 1DG6A 2FDHA 1DCSA 4LUKA 3E6BA 3W20A 2VAUA 2NPIA 3VBOC 5D21A 5F7UA 1BEV1 5F2WA 3WW1A 2VMCA 1F5FA 4GMP3 1CX4A 1QEXA 1WBLA 2A3YA 3CNAA 4AG4A 1BBT3 3MEPA 1ZYBA 2WNUA 2ZXQA 3PMEA 1XOYA 2ARXA 4F8AA 3ZXKA 3GZEA 3WD5A 3NKGA 4UWDA 4NHXA 4QPIC 1XB9A 5DPNA 2TEPA 2FBEA 4N7IA 4AHZA 2XJTA 5FQ0A 5KXEA 4Z92B 3VD3A 1J59A 3QH7A 4CCJA 3B01A 2MHFA 2VCCA 4V1PA 3OGRA 2CAUA 4IV1C 4JDMA 5FK7A 1RJ7A 3POSA 4BK5A 4C8DA 1TME1 1UY4A 2EIBA 4PIXA 4BLJA 1RMU3 2P3YA 1DQ6A 3D82A 1MVQA 4IGOA 4L99A 4N43C 1Q56A 3JZVA 3ZKYA 2RVAA 3QACA 1WGPA 1US2A 4IDZA 3VZOA 5LBFA 4OVEA 3LEGA 5A7WB 4OFGA 4P9GA 1PGW2 1LOBA 2VZPA 5IVCA 2VVFA 1C4RA 5IATA 1Z7S1 2LTNA 4LKDA 1H9WA 5EFUA 4BM8A 2GN3A 5LA0A 4I2OA 4I3GA 4BCUA 2DYCA 2HWB1 1SBEA 1UU5A 2WZR2 3I3QA 1RUJ1 5B4XA 2GH2A 4NN0A 4AAXA 3LE0A 2AEYA 3GJBA 5A7PA 3VBSA 4LKSA 1REFA 2YY1A 3BOPA 4CEYC 4U2AA 4BDVB 4HVRA 4GD4A 4XIOA 3WVJA 5A6YA 5GLZA 1RUF1 5DG1A 1MS5A 3NMBA 2XVKA 4QU2A 1FMD2 4SLIA 4LPLA 4W6WA 1D2SA 2DVFA 2VOWA 3NAPB 2HH9A 2XL9A 1C57A 1RXGA 1HB2A 5E6HA 5EV7A 5LRSA 2JD9A 5AFBA 4AE2A 3MF6A 2GNTA 1RUE1 1GOHA 3I2KA 3I49A 4AWDA 4NHMA 2X09A 4CEWB 1C28A 1LEMA 1EV11 2Y34A 3CJIB 4OHWA 2CU5A 5JR2A 2KXLA 1X50A 2RR12 5K0UA 4IE6A 1MR5A 2AR6A 2VGDA 4AEDC 2KM2A 2QQJA 2DUPA 5A3LA 1GZ9A 4XF0A 3KV9A 5AC92 4ZZ8A 3WQ1A 3K51A 1QJU3 5JUVA 5FTTC 1NYWA 5C4WC 1AHSA 1YIFA 1NCRB 4K7JA 3J7NA 2DFCA 1LGNA 1VRH1 3N9NA 3RQ0A 4QPGB 3ZYRA 2VMFA 3C7EA 5GLVA 1EAH3 3RZKA 1DU3D 1BMV2 1W6QB 4NOTA 5HCFA 3TN91 4NRPA 1BHGA 1LODA 3NNMA 3SISA 3ZR6A 2EIEA 4XVHA 5FK8A 2UWAA 3U4XA 5GM0A 5FZ7A 1K5MB 4R4ZA 2B4KA 1POV1 1WBFA 3LDBA 4CUBA 5J37A 3MZHA 2DCTA 4XFCA 5IK7A 5FWJA 1UMIA 1D4M1 1TG7A 1W8WA 3HN1A 4Q8LA 4RR3B 1GR3A 2DV9A 1UOGA 4N7UA 1RUNA 4P9YA 1GV9A 4WVMB 2QBXA 1AVBA 4UOJA 3D8CA 2XHKA 3H3LA 1ZRCA 2HEYF 3HQXA 3M3CA 1DGWX 2R072 3NV1A 2Z79A 4GH4A 3JD71 2Z5WA 1I3HA 4L97A 4QX2A 1J1TA 4JRLA 5H9QA 1XYPA 4O7XA 2R1DA 5FBJA 4L8QA 3RZGA 1US3A 4LNVA 3U11A 1QIQA 4A3XA 5JAXA 4QQLA 3WSOA 3IM0A 3SKJE 2OIIA 1NZCA 5IJRA 4LK6A 3N7LA 2B42B 3AKSA 2XJUA 3GHNA 2RDNA 3IIIA 4RGKA 5E88A 1W8FA 1FMD3 2PHXA 3LA2A 1HB4A 4RHV3 3ZPYA 2FDIA 3BI3A 4AOCA 2ZGUA 2V4AA 4AVAA 1IPJA 3KV4A 1Y9QA 4QQOA 3M3EA 1L7QA 2UYAA 4QHZA 2VMHA 1XYNA 1H6YA 1O7FA 5FUPA 4AVTA 1OA4A 1OKQA 2RS51 1RUG3 5FP7A 1YI9A 1SLCA 4Q0VA 4UYBA 5FYHA 3VDDA 1WD4A 4QPWA 2I74A 3U10A 3UV9A 3P1IA 2RR13 3HR9A 5JXJA 4P9WA 5KHHA 1WCKA 2Q8EA 5FZ9A 2BWCA 4BMEA 3RFRA 5JSOA 4XE9A 4FT8A 2GC1A 4WV8A 1UXXX 3SKVA 2VUJA 4XACA 1WMDA 2WAAA 5AC93 1CJPA 1AXZA 4LO6B 4NHLA 1QJU2 4X8NA 3OY8A 4E8DA 1B09A 1UAIA 1YFWA 5H9SA 3HIFA 1Y3TA 4C0BA 2NLRA 2WWUA 3IPVB 4Q4W2 4SBVA 4NIIA 2X10A 3WCSA 4FPOB 1Q8OA 3LIHA 1BKZA 1O5LA 5HCBA 2DU0A 1MPXA 2ZX3A 1GZWA 3I2IA 4JQTA 2WT0A 4ZU5A 2BNOA 5FRAA 3DV8A 2ILMA 1BEV2 1G6NA 3OD0A 4ZXKA 2VUCA 1UYZA 2EIGA 5FP8A 4ATEA 1W6PB 1B35C 2ZX4A 3FWEA 4M3CF 2SBAA 2FMDA 1YHFA 2B9UA 2XKOA 3AYAA 2ES3A 3AZXA 5CFCC 4XF4A 2IUWA 3S6PA 1FOD1 1X33A 2Q5TA 1NOVA 2VZSA 2Y6HA 2ZZQA 4N90A 4YSFA 1O91A 4RN5A 2R073 3ZXJA 3VDBA 4ZS2A 3MW2A 1ZBA1 2W94A 1ENRA 5DG2A 4MGIE 4ASLA 5CB7A 4E8CA 1HQLA 4RSUA 2D6PA 1KXGA 3AKPA 5FP4A 1TNFA 3WNKA 3CZJA 5JVVA 5JZGC 4HK9A 3T3YA 5FYIA 5DXDA 2W1WA 2WZ8A 2RMU1 1QMJA 2D6OX 1LOFC 1COV1 5F3IA 2D7FA 5FO7B 1VBE2 2VZTA 2J1RA 4NJ4A 4BXFA 2ZTNA 5C8WA 5KHIA 2VZOA 1H0BA 4RHV2 2XG3A 2D40A 3HD8B 2QCSB 4ONUA 5FZ4A 2K9ZA 3WNMA 4EJRA 1PMJX 2PAMA 3PVOA 3AC0A 3VZKA 4QB6A 5B2GB 5FREA 1KDKA 3PVBB 5ABJC 4BPZA 4XURA 1W8TA 2ZHKA 3MIHA 4UBGA 4CDQC 5FZLA 4FFGA 1QU0A 1AX0A 3LB9A 5GLUA 1Q8VA 1OKOA 3MW4A 4XUQA 1GQPA 2VL4A 1MACA 5L7OC 5LWBA 2VCAA 5EIYB 4KGQA 2EA7A 1HJFA 1HRV2 4LHNA 3OGVA 2GC3A 1RMU1 4WVWA 1SFPA 5IVEA 3UKNA 5ACA1 2Q0AA 2YROA 1W6NB 3GJAA 1POV0 1S0DA 4FFHA 4MOAA 1S2EA 1TMF1 5EYXA 4UF0A 2IFRA 3WNXA 1W39A 4K20A 1GSLA 5GZEA 2JDAA 1K45A 2JEMA 3O0VA 4LBNA 3TBDA 3ZDSA 1NKGA 4IE5A 2X05A 3KWVA 1DZRA 4HSLA 3K46A 5FO9B 2Q1ZB 1FPN1 3HQUA 2YC0A 1S0IA 2OVUA 2PHUA 2AUYA 5A3MA 1QOSA 1UD1A 2FZ1A 3BIWE 3CIHA 3CKHA 4Q4W3 3D6EA 3QBQA 3ELNA 1U5YA 4ASMB 4O9GA 4NE9A 1MS9A 3HT1A 3TAYA 4CYDA 1V6IA 4RS5B 1DLLA 3WQ0A 4E4ZA 5IAXA 3D0JA 4AGGA 1JYTA 4XHBA 5C8CB 1H2KA 1RUD3 2OS2A 2GNMA 1IS6A 2YUEA 5J48A 2DTYA 2RG4A 1BEV3 3T4HB 2IFWA 2ZEYA 2JDPA 4LOSA 5KHKA 1OD3A 3VB9A 2ZBJA 5I8SA 2G1MA 3VBHC 1SLIA 4GWMA 3WF3A 1AYN1 4D6RA 1HXS3 4MGTA 1QWRA 2CL2A 1UQXA 3OEBA 5F1RA 3F95A 3FBMA 4UI9L 2DTWA 3ZN5A 2WNEA 3WDXA 1ND2B 5JOWA 4R8HA 1LHOA 1N3OA 1STMA 1IKQA 3P6BA 5DUVA 5IUQA 4AFAA 4L92A 3AP9A 2ZGLA 3IPVA 4XUTA 2WQZC 4LOTA 1UNBA 2WZR3 1CIWA 4DRVA 1XE8A 1YYNA 5LCWL 4DZGA 3PUIA 2BWAA 4QXKA 2NMOA 3KGZA 5FXXA 4GQ7A 1UCXA 4JQRA 2PLV3 4CCNA 1V6KA 4CU9A 2E33A 4JHZA 3A7QA 2QQIA 4D8MA 1KJLA 4OHXA 1M06G 2AENA 2DURA 3JCIA 1RUD1 4LXLA 1IPKA 4Y3OA 3KB5A 5DAPA 1YWKA 4YM0A 5A32B 2HYXA 4DRRA 3O1MA 5BNPA 4XMIA 1HLCA 1D2QA 4FCAA 4CU8A 1RHI1 3PTYA 1VP6A 4UFIA 3RI9A 4LLOA 1DFQA 1DF0A 1LCLA 4NIDA 1VBB1 2JKBA 2A70A 4GH4C 2FQPA 3BPSA 4BQ5A 4COWA 5DN2A 4FAHA 5C3SA 2GZWA 2DU1A 4DUXA 1JZ4A 4CXWA 4YZ5A 2K2SA 1ND3C 3VHPA 1QJY1 3ZDVA 4XUOA 4J25A 3VBUB 1UF2C 1GZTA 1JTZX 1U12A 1UXZA 2E7AA 5A6QA 5I0DA 5CISA 1IS3A 1AJOA 2AEZA 3FBYA 3OYWA 2ZX1A 5FBZA 1HXS1 2W92A 4EROA 1ND2A 1VAMA 3VLBB 1DGRN 1NCQB 1TQ5A 1ZNPA 2BEOA 4CE8A 3KVBA 3RRDA 4FTEA 3NVCA 1EAH2 3CLPA 1Q8PA 3NQHA 3OBZA 5FUNA 2WT1A 2FCVA 2Y64A 4JGZA 3M3IA 3MGUA 1BBT1 2DWRA 1ENSA 3LFIA 4P9LA 4GJYA 2WFPA 5I91A 5D8AA 1HX6A 2VOTA 5DUUA 2BOIA 2BQPA 3ZM8A 1MQTA 3OBAA 3MV01 1UKRA 2OA2A 2A6ZA 2C9KA 4AI8A 3A22A 5FMCA 3P3PA 1U5IA 1NA1A 3GCWA 5FJHA 2FDGA 2J1TA 2VOVA 3ZIWA 3ZSLA 4RGAA 1GP4A 2V73A 1MZ5A 1WCDJ 1PZ8A 2JICA 1S2KA 2W1SA 5KHJA 4CDWA 3MIDA 5T5JA 1UZWA 2WNVB 1GU3A 4IV3A 5CFDA 1BVVA 3THTA 5HCAA 5JSRA 2P3IA 1OLRA 3AP7A 3LSEA 1NCRA 2ORZA 2VOKA 4RS5A 5FXZA 4CDXC 5IVVA 1AYN3 3RYPA 3ENRA 3IBMA 3DECA 3POGA 4HN0A 3X29B 3NRUA 4AI3A 4WVZA 5FYMA 3FE5A 1RB8G 1LB2A 4L9BA 1C8M1 5E8AA 3NNLA 1SDWA 2PHDA 4HN1A 1ZVFA 4OQ8A 4FPKA 2WO2A 1PX3A 1K5MA 4XUNA 1C8M3 4AEDA 1PGL2 4YGDA 2D3SA 1PGSA 2DDUA 2RMU2 3A21A 3POIA 5LEJA 1UY2A 1PMHX 2WFF1 1FAYA 3SH4A 3WP6A 3O1RA 1ASJ3 4Y20B 4YVSA 3AL5A 4DFSA 2VULA 4RL7A 2CYFA 1GOGA 1ODMA 1YI7A 2VH9A 3URFA 1F35A 4LBQA 1RUG2 1W6MA 3AZWA 4WM8B 2R043 1JYNA 4HPKB 2VTXJ 4PLNA 4TN7A 5ABJA 4CPBD 3I3EA 1SACA 3OPWA 4F83A 1UOJA 4WM7B 3PUSA 2QZ3A 1O59A 3T1LA 5A70A 5C3RA 3ME2A 3KCXA 3WNPA 5FMOL 4BE3A 3AMMA 5JOYA 3CZUA 4NMIA 4FQ4A 4NWWA 4MXWB 4HG6B 1AR62 4R4XA 4Y5TA 1B35A 3MIFA 2E31A 4YVWC 5GZGA 1LTEA 3DXUA 3OF1A 1RUE2 3WZ1A 2VQ0A 1HQWA 3QH6A 4QX3A 1F2NA 3WW3A 4CRQA 1MS8A 4CCDA 1WW7A 4FO9A 5FLHA 4GWNA 1V00A 4Z2AA 1RUH3 2A73B 2ZHMA 1LJ7A 2DFBA 1OURA 2Q1MA 3KMHA 2ZEZA 2J1AA 1O3SA 1EP0A 2RS11 3LDRA 1W04A 5A3OA 4I0WB 4DB5A 4AHWA 2W3JA 4O61A 3H1MA 1DDLA 2TUNA 5BNNC 1ZZ6A 3W5NA 2P34A 1VR3A 2JE8A 4AGRA 3V0AB 3H8OA 4AEDB 1NQDA 2WN3A 2ZKNA 3PVEA 3CBNA 3SC7X 5H9PA 1RITA 2BDRA 1QDCA 3I2HA 5EP9A 5JXIA 2Y60A 4OI4A 3SQOA 3WDWA 4RFT0 3ZLIA 1BYHA 2VW0A 5K9YA 2QQNA 5FP3A 3AB0A 4QQPA 3ZOIA 1UKGA 5FPBA 3B69A 3ROUA 1AYN2 1H4HA 2I2SA 2MNGA 4OQ9A 3QLQA 3W59A 2XONA 2G9FA 2GALA 3DYMA 2XQXA 2WYSA 2YPJA 1VBE3 3H8XA 3RJ2X 4MXWA 4MGQA 2JG9B 3ETPA 1EPWA 1PMIA 2J1VA 1WD3A 5BY5A 3RDIA 5A1AA 1C8M2 2XOMA 2ZEXA 2HWF3 3MDPA 5F2SA 4HXCA 4MADA 4WBBA 4YRDA 2RMU3 2ATFA 4P5HA 1JZ7A 3TB0A 2YV8A 4I01A 4JHTA 2DVAA 4KQ7A 1BK1A 3ZXDA 1HRI2 2FMYA 2R042 3FFQA 3AKRA 3H8UA 5T54A 5BNQA 4MYEA 4XDOA 4PCRA 3UESA 1ZM1A 2ZMLA 2ET7A 5EJZB 4IUGA 1DQ1A 1OC1A 2ZGNA 1A6CA 4OZOA 4PIYA 3RS6A 1SHWB 1Y7BA 1AXKA 2Z2SB 3M3QA 4KU7A 3V0AA 3CF6E 1AR63 1JOBA 4S2GA 1AL23 3F2ZA 3U75A 1W03A 3DYPA 3NO8A 4Y4YA 2XGXA 1DHKB 4DUVA 3OD4A 2VVEA 1RUE3 3ZN4A 4AF9A 1AR83 2GP3A 3S5QA 3T4VA 2UYBA 3MI8A 4A6OA 2X5IC 4AQ2A 4YVSB 2IXJA 1HQNA 2PHRA 2ZMNA 3D3AA 5FMBA 3LD8A 1UU6A 3HMYA 5FY1A 4BB3A 1XE0A 2Y6FA 1LU2A 3RSJA 2OPKA 1UPSA 3ES1A 3J26N 1RUD2 1IPSA 2R1BA 2EF6A 4M3CE 4KMQA 4CCMA 1VB4A 3RWNA 1SFNA 4YPJA 2QDNA 4M3CB 2OUHA 1P8JA 1ZRRA 1SPPA 1CAUB 3APBA 4LBMA 3E6CC 1W6QA 1HXS2 2WWSA 3AKTA 5KC5A 1W3VA 2E63A 5KWRA 3ON7A 4Q0SA 2QFEA 2HEVF 3FJSA 1O3RA 1LKNA 3R0RA 1W06A 2VBDA 1X9TA 1UW8A 1LHWA 4QM8A 1XC6A 5K4LA 1AZDA 1C8NA 1VIWB 5I0UA 4IV1B 2D97A 3TEZA 1OBNA 4LHKA 4BK4A 3PMSA 1EYBA 3MBWA 1W9TA 4FSJA 1WCQA 4W8JA 1OPMA 3I2JA 2ZS6B 5T55A 5J36A 1FOD3 5AFEA 4HANA 2F6BA 1ENXA 2O1QA 1O4ZA 2WC2A 5C4WB 3E97A 4Q27A 2PLV2 1O8PA 3ZXAC 1RHI3 4CP0A 3P5BA 5FYUA 1ENQA 1ULGA 2XUMA 4AXOA 2RDQA 3ZFEC 3ZN6B 1PIV3 1R081 1ALYA 1I6XA 2WABA 5FUIA 2X29A 3U14A 5BUVA 4B29A 1O4YA 2YB7A 5C8CA 1I5ZA 5CBLA 5A33B 4J1XA 4BYYA 4QB2A 1V6JA 2HKXA 1CAWB 1OVPA 4RR3A 2DBIA 4IESA 4XUPA 1PGW1 5CFCB 1H2NA 3VBRC 4LE3A 4QX8A 2DF7A 1VRH3 2YBSA 3ETQA 2CGOA 4B4QA 1HRI3 3VDAA 1IQAA 4DS0A 2HWE1 4YZ3A 4D94A 1CAVB 4FPEA 2VUAA 1Q5OA 1Q8QA 2CDOA 2W1QA 3NKTA 1X36A 1SFYA 2ZGKA 4XILA 1OA2A 2OYZA 1FPN2 3WLUA 3ABZA 3K2OA 4OI1A 1GUIA 2JDYA 3GXUA 2R0HA 3AP5A 1SBFA 2HWE2 3CU7A 1DYOA 3LAGA 4HVQA 4R9AA 4Q0QA 1LHVA 3ZFGC 3ZSJA 2R6QA 1N1YA 3PLQA 2VOXA 4C91A 4YWAA 4E4DX 4IXLA 4AI2A 3M7AA 2GMPA 1OVSA 1S0BA 2EALA 4YGCA 4EZ4A 2B7YA 3LZZA 2WRAA 4ARXA 4BLIA 3GF6A 4W50A 3N7JA 4COVA 1ZZ7A 1BVP1 1V0AA 2ZZJA 4LA3A 5BNPB 5F8PA 3A4UA 3W58A 4EWEA 2CTVA 4NPRA 5C70A 3JB4C 4LBOA 1PZ9A 1LNSA 3DL3A 3GZAA 1UZYA 2QKDA 2BW8A 2XMLA 2P6HA 3ITQA 5APAA 2WL1A 2R30A 2QNKA 4AQSA 3PURA 4MGZE 5FZIA 5IVBA 3WQBA 3ACIA 5CYYA 1HV0A 5JDBA 1CZTA 4JX0A 3TEXA 2C9AA 3C3VA 3VBHA 3LIGA 2CGNA 5JI9A 1YJLA 4GXLA 5FZ6A 1EUUA 4MO3M 1GNZA 1DZTA 5BNOB 4LEJA 4CU7A 2ADDA 1S2BA 2XKPA 4M4RA 3FLPA 2XBO3 5FZBA 2ENRA 1VAVA 4CA9A 4NROA 3OY8B 5ANQA 4ES8A 4A4AA 4UFKA 2P1BA 1FOD2 2AREA 3J9SA 3PVNA 5JOXA 4Q0PA 1GP6A 4IE0A 1NXMA 3WR0A 5T52A 1RHI2 3UKTA 2Q8CA 3NJXA 2KR2A 4AHXA 4XBLA 5T5LA 5LBCA 3ZXFA 3O7OA 1N1VA 3WW4A 2AACA 3T2TA 4E4HA 2VCMA 4EWAA 2JDKA 4I0BA 1XU1A 4P02B 3HT2A 4R9DA 2XVLA 1SMVA 4GZ9A 3KT1A 4UFMA 4FOQA 3J4UH 3KVAA 1O4TA 4AQ6A 1ASJ2 2W39A 3OEAA 1VRH2 5FOBB 3R4SA 4B1LA 1JOPA 3CMGA 1UX7A 4RR3C 1K5JA 1N1SA 3LWCA 3H9AA 1OHFA 1QXRA 5F39A 4LMFA 1ZA4A 3MO4A 1QJU1 3TN92 4KWJA 4BIOA 5CKNA 2L9LA 1Y9MA 2D6LX 4CDQB 1E5SA 2WZEA 3MW3A 4QGLA 4XAAA 4EN8B 2XB6C 1FPN3 3MUZ1 4BQXA 1DYKA 4CEYA 4CEWC 2Q1FA 3VBHB 3VL8A 4MUVA 4XCAA 3VBFB 5FZDA 1X7NA 5C6CA 2R49A 4Y4RA 4YGBA 1FNYA 1UYXA 4YM1A 2F17A 4FPGA 5K0UB 2P37A 2A1XA 2HBTA 3CJXA 5DAVA 3B3QE 5CU1A 3JBG2 1L7LA 2W1UA 3WDYA 3ORJA 5F5AA 1RUH2 1EV12 2JDUA 4NO4A 2R041 1AYM3 1XNTA 3HNBM 5EWSA 3BN6A 3PU3A 5FZ3A 2FDFA 1CAVA 2YGMA 4JDNA 4QMAA 5FY0A 2W52A 3MYXA 1W2NA 1X8EA 1NAEA 1LR5A 4GA9A 1H4GA 3U78A 5FPXA 2K46A 4XFAA 3VKLA 1HN1A 2Y6GA 4QU1A 3HEIA 2WIIB 4BISA 2XBO2 1H1IA 4NPLA 2AH2A 2WZPP 4GULA 1G9BA 1LECA 1MS3A 2OKXA 3S57A 3KV5A 3ZYGA 4CDQA 2CAVA 5C9AB 5DAWA 5FZMA 3N9PA 4OMCA 5JOZA 2F4PA 5L9BA 3C7FA 5FZHA 4AFDA 4DO0A 3WF4A 1W9SA 1PK6B 3H7YA 3RNSA 3DPRB 1HW5A 2OZ6A 1CGPA 3AMHA 1YUDA 4GMP0 4DEQA 2BOJA 2ZABA 4LIUA 4AR2A 1DGRA 1W2UA 2C1FA 2HWF2 2H0VA 2NYYA 3LQCA 2VNRA 3DGTA 2NMNA 1OH4A 2DUOA 4IEWA 2GP5A 3OSDA 4QXBA 5AVAA 4P08A 4IETA 5L7OB 2WLQA 5CA6A 4BQ3A 1R093 4YW5A 3MV11 1LESA 3VKFC 2BZDA 2NQYA 1VPHA 3I3BA 1O3TA 4URTA 1AR61 1GWKA 3LA7A 3BIEA 3LSDA 5F9TA 2WLPA 1OF3A 3VBOB 4LBKA 3ST7A 5F37A 4YG3A 3BTZA 2O8QA 2A5ZA 4LBQD 3FC0A 4BOWA 4BQ1A 3H42B 3HBKA 4MGSA 2W9XA 4C1WA 5LEKA 1R64A 4XIKA 4FAGA 5F5CA 5HXMA 2UWCA 4CDUC 3AMNA 1AL22 4IEZA 4XF3A 5AC91 2XHNA 4NHKA 3K4AA 1AR82 5A1FA 3PJYA 3JBG3 2VZRA 2F4LA 4MXVA 2WFF2 3OCPA 4CP9A 5IVFA 1V6MA 3PTRB 5F5IA 2BERA 3FLTA 3VBRA 5HCHA 4GJZA 4PIZA 1W3XA 4W65A 1AYM2 2OXBA 5CVRA 4XFHA 2JIJA 3AYCA 3SEEA 2X53S 1BCXA 1AUYA 2PA7A 3PJQA 5C5UA 1YEWA 4LKEA 2ZX0A 3WV6A 5DUXA 4BJ0A 4DY5A 4FI9A 1NCQA 2J22A 1GFF2 1KGYA 3O1OA 1W8OA 3IMMA 4IEQA 3IDBB 2ZOEB 4NAOA 4WM8C 4ZKTB 2XUEA 4NRMA 2ID4A 3SITA 2NZ9A 2YU2A 4UBHA 3CEWA 1KEXA 4Q4Y3 1C5IA 1H8TA 4GB32 5EQUA 3UT0A 3V65A 1GWMA 2JD4A 1RUC1 1YFYA 4FP2A 2DUQA 4MZUA 3THPA 4A41A 3OTFA 2QE3A 1M4WA 3B5LB 4XZPA 4FFFA 1APNA 1JHJA 4FPLA 5DABA 3VDDC 4Q5OA 5L19A 2VQUA 3CJIC 3RZLA 2RHPA 1AX1A 1XNDA 2WJSA 3O0WA 3KS7A 1JBCA 4QKFA 2X5IB 3L2HA 3PUAA 5C9AC 5FCCA 2RM21 4JC1A 2PHTA 1W90A 1DQ5A 4I3PA 1MZFA 4LO4B 3O1PA 2CGPA 3T2OA 1PIV2 1D4VB 1SZBA 1XNCA 3IB3A 4Y22A 3WCRA 4A7YA 3VZJA 3O14A 3HOBA 4H55A 4FPHA 3VGIA 1S0EA 4CP9B 3FUQA 4MHUA 4OZXA 2EXIA 5K0UC 1ZREA 5F5QA 2W87A 2E32A 4FVVA 3U07A 3VUOA 4B8EA 1R092 4J1WA 4XCBA 5LA1A 3E6DA 4CCKA 4Z8BA 1UYPA 4ZONA 1A3KA 1J1LA 2WAOA 4PF5A 1VLNA 4XF9A 3ZO0B 4Y1ZA 1SLBA 3DF0A 4LULA 5D2AA 4G4FA 4YGEA 1VB2A 3POWA 4PLMA 1JH5A 2PAKA 2ZACA 1QGLA 1C3HA 2HJIA 4Q4X1 1CPNA 1H1MA 1LOAA 2HWE3 3A0NA 4LITA 4MX3A 5DZGA 2IXIA 2YXSA 4BZ4A 1WA4A 3MPBA 5FZGA 4IE4A 1ST8A 4K3UA 4JGZC 3N4MA 2BTVC 1E5IA 3ZSKA 2C6SA 4XTPA 4GKXA 1W6NA 4TYSA 1HRV1 3ACFA 4D6QA 4Q4V3 5L7OA 4AGVA 2LALA 1IG0A 2W91A 1ACCA 4AEJA 4HMZA 2GAUA 1SLTA 5SV8A 4A44A 4B1MA 4D6SA 2ZHLA 2FHRA 3M70A 4IEUA 1V6NA 4KG8A 2WS92 3INAA 2A75A 2Z69A 3EB7A 4Q29A 4KH9A 1WMEA 1XBFA 3N9MA 3ZIXA 3ZMNA 4JKKA 5E16A 5FPZA 5L73A 1NCQC 1V70A 5LZ6A 4WM8A 5GLTA 1XSQA 1CWPA 4YW7A 5FYSA 4EN9B 1OFSA 4C90A 4ORFA 2V5YA 4AVBA 4Q4Y2 4GB33 3VL9A 1ZBA2 3ZFFB 3JQWA 5JZGA 1EUTA 2WNVC 1CN1A 4MV2A 4QHBA 1XU2A 3WY6A 3QCWA 5FLJA 1LGCA 3IZOA 1NE4A 3AMPA 1RUJ3 5T3NA 4N9IA 3ZYIB 4QDRA 2A7AA 1NZIA 1YCIA 4XFFA 1WA6X 1H2MA 1YFUA 5JXHA 3RZJA 1OLME 1OFNA 4Q1PA 4P00B 1VJ2A 3ZYJB 1X9PA 3NJZA 5C7GA 4G9SB 2VR4A 4GIQA 4XJ8A 1YO8A 1OLMA 3R05A 4Q4Y1 4B7EA 2D3PA 1CZVA 3M8LA 4B4RA 1JN2P 1JZ8A 2ZGRA 4BMBA 5BYNA 1O5UA 3UGFA 1VMFA 2J7MA 4CDUB 1RINA 3H1WA 2TBVA 3V0BB 3N35A 4LHLA 1C5HA 4UW4A 4WVVA 1YLLA 3SH3A 4LO8A 2GN7A 4GH4B 4UFJA 2CY6A 1W0PA 2ARCA 5LK5A 4PBOA 1UIKA 4LO5B 5T5OA 3E5XA 1OLQA 3Q8EA 1K5MC 4S2FA 5C5TA 3VD4A 3TN93 2E53A 1HKDA 3FZ3A 1NY71 5FZOA 5KR7A 4L0PA 4QWNA 1JOJA 2UY9A 5HBAA 2DVGA 2BPA2 4YVWA 2DVDA 3BVCA 4B4PA 4UAPA 3EO6A 1A78A 2ZCWA 1ND3B 4XXPA 5JR7B 3T1MA 3AX4A 1G9FA 2VBBA 3V64A 3W21A 2JIGA 4K8RB 2W08A 3S30A 1WZXA 4OUEA 1UY0A 1YC61 4LK7A 4OUSA 4CP2A 1KITA 3H0OA 4FOYA 3JXSA 4O65A 2JG9A 1URXA 1EV13 5D1IA 2DCKA 5FV3A 2OT7A 3AMQA 2PYTA 3VDDB 1CZSA 1EY2A 5EJ3A 4ZY9A 1GZCA 1XNAA 5CIRA 3CL1A 4D69A 1ZA7A 3AZVA 1OQ1A 2WS93 1NA1C 4LTAA 1F9KA 1Z78A 4GB31 2C4XA 3OGJA 3TWIA 1LULA 1CD3G 2EXKA 3R4UA 4N53A 1YJKA 5L9VA 1LEDA 1KQRA 3SCFA 2V4VA 1H30A 1R082 3WX5A 1H8VA 3NAPC 1KFUL 2WNUB 1W99A 3WNOA 2GMMA 3V0BA 5GZCA 3WG1A 1DYPA 4E2QA 4Z2WA 3OUJA 1ZBA3 1C1FA 2XL7A 4NIHA 1J84A 3I3DA 3T0DA 5DAQA 5FPUA 3Q9OA 2R071 1VBA1 2YDEA 4C0HA 2J1EA 5JXGA 1XXNA 2JE9A 2D93A 3P3NA 5FY5A 2HWC3 2GSYA 4PDWB 1SQ4A 2QQLA 5AVPA 1SLLA 1OSGA 1RIRA 1NT0A 1IGOA 4PI0A 4LKFA 4D7SA 1C1LA 4I02A 1HJGA 4K8FA 4YVWB 2EXJA 5FMDA 1W6PA 5CZKA 3VKOA 2XXZA 1PM4A 4XFIA 5I8TA 1LOFA 2H6BA 4PJYA 1AR72 1ZZCA 2KD7A 1OQDA 4QKDA 3VZMA 4XW3A 5IFPA 2FD8A 3Q8BA 4Y5SA 2BNMA 3RGBA 2V5DA 5GZDA 4NVPA 4QPGC 5JLVA 2PN5A 1OPOA 1YNAA 5G05L 3UK9A 5IYYA 4Y26A 4AEKA 4DXSA 2Z4FA 4Y1VA 1I5PA 4IV3C 5D8AC 4F7ZA 4MHRA 2ET1A 1ZZ9A 1N1TA 1QHDA 1CR7A 2BYVE 3DYOA 3Q8FA 4FOVA 3VDCA 1IS5A 4EE2A 3S0MA 3KT7A 4D7TA 4EN6B 2R32A 5F3EA 3SCGA 4HZFA 3MIBA 3K4ZA 1UY1A 1H8TC 2QDRA 3RJRA 1S0JA 1AR71 3KD4A 4HVOA 4CZSA 4PQ9A 5I0RA 3M3OA 4N53B 1L3JA 5TSWA 1SBDA 3WHUA 4CPBA 4N9HA 2JENA 3I8TA 1CAXB 1BQPA 5HPOA 2VXRA 1WMXA 3VD5A 3RYRA 4YFWA 2IC1A 4NIAA 1E5HA 2D98A 1OD5A 3BGAA 3HBZA 5H9RA 2BJSA 3RMYA 1JZ5A 2WFF3 5IW0A 3DPRA 3VBFC 3MHZA 5FQ0B 3NSTA 1QF3A 4CCOA 3VHRA 4YG6A 1N47A 2JG9C 1QOTA 5A33A 4DMIA 1LOEA 2JG8C 4UT5A 5KXBA 1J3PA 2OW4A 1CPMA 2QZ2A 4AVSA 4FTBA 1DGWA 1F15A 4KWLA 3FN9A 2HWF1 2VMIA 2WN2A 2W46A 2WA3A 1NG0A 2C26A 5FY4A 3PIJA 1X82A 4HFSA 1O3QA 4FTSA 1R083 1KD7A 4QKNA 2YFUA 3VBOA 3G7DA 3NNFA 4ZZ5A 5DZFA 3D5OA 2VUDA 4BXSV 4QGMA 1UU4A 4I09A 1GNYA 3IDAA 4XTMA 4H2AA 5FZAA 5CADA 3Q8CA 1UX6A 1PO22 3BU7A 3E5UA 2HWC2 5IK4A 3I3MA 4MVTA 1TNRA 4ZPIA 1ONAA 3KT4A 5FPVA 4PT6A 2Z42A 5GKAC 3N9OA 5C33A 1QNYA 3VBSB 1QOOA 4N43A 3GZUC 2D3RA 5FDBA 5KXCA 2VU9A 4AFMA 4JGYA 4MG2A 1ZRFA 2EIDA 2WR9A 4QDQA 4YM3A 4ZU7A 1ZBE1 3H8RA 3DPRC 3FMGA 1NY72 2A71A 5DZEA 3ZYPA 1GQHA 1JYIA 1KDMA 3E1F1 2XPJA 1VBC1 1PVXA 2G4IA 3LCPA 2UURA 4Y1XA 4XYXA 2VXJA 5FZ1A 3ZX7A 5C3QA 2C5DA 5K7PA 1G9AA 5C8CC 2HYKA 4DNYA 4FFIA 3PUQA 4UFHA 2XLGA 1TMF3 1G9DA 5BNOA 3PNAA 5FY9A 3H7JA 1FX5A 1XPWA 3NV2A 2PHLA 5CEHA 1YQ2A 2RR11 3ZXEA 3T08A 3KF5A 1UMHA 5J7MA 1QJX2 3FHAA 2VM9A 4PF1A 2R063 2RS33 3B93A 1G8WA 2IXKA 3NNGA 2Y0OA 3AXDA 2VECA 3WW2A 1GBGA 3TNQA 3DCQA 4H3WA 2JDMA 4GWIA 5LBBA 2CNAA 1WKYA 1GANA 4CTEA 4QT6A 1Y9GA 4Q4V2 2YHJA 2E9QA 1LENA 1QJX1 2I45A 2PQQA 4MLOA 3VBFA 4R52A 4JRAA 3ZYFA 4BQ2A 2PHWA 2YC2A 3WHTA 4DXZA 1S4CA 4KBZA 1GWLA 2JJ6A 3TOJA 5L9RA 5GZFA 1QH6A 5FY7A 3I59A 4XDPA 3MIGA 5FYYA 2V09A 3GBWA 5EYYA 1VBD3 1QJZA 3WF1A 1POQA 2BBAA 4OMDA 3DKWA 1VBC2 4XETA 1W8ZA 2BGCA 2ETEA 4Q4W1 3BB6A 3T0BA 2A6VA 1CIYA 3PDQA 3ZSMA 4CDXA 3RZHA 2CWSA 1SG3A 1Q43A 1XQNA 1RUJ2 2G9ZA 2GU9A 1IOAA 2IXCA 2QTWB 2RJLA 3WUCA 1RYYA 1WUVA 2Y0IA 1OQEA 3L9JT 2J42A 2E51A 2XBO1 3JUUA 1WW5A 4BHPA 1KFXL 2XH6A 3VHOA 1WW6A 1ZRIA 2BGOA 2VE1A 4ISQA 5J3UA 2P2KA 2WYFA 3BYWA 4ISRA 1Q3EA 4INDA 5FPLA 3J8F3 5FYTA 4IGQA 4OYUA 3I54A 2VQAA 2YBKA 2HEWF 1BXHA 4A7ZA 4MSVA 3T0AA 5I93A 1GOFA 2XLFA 2UY8A 3G6JB 3H3UA 3IT8A 3RG0A 4K40A 2XLAA 4XPVA 1JI6A 3HNMA 2ZGQA 1AF9A 1QY4A 3WP4A 2HBUA 1EPZA 1QDOA 2I07B 2PFWA 4QGNA 3O1UA 1GYKA 5SV5A 1JU4A 3ZXLA 3B94A 3J7HA 5FOJB 2DCYA 1WWYA 1CX1A 4UFLA 5FXWA 2VO5A 2MEV2 4AAPA 5LK7B 1TMF2 4ZU4A 4KL1A 2NP0A 3UYJA 3K75B 4GWJA 1COV2 2VC9A 3K48A 1ODNA 4EZHA 1JODA 3VBUA 2O0OA 4RQPC 3B7MA 3AM2A 2VCBA 5BNOC 4DEVA 3N7MA 3H50A 1PIV1 3DUIA 2NM1A 1QJX3 3BCWA 5C9AA 5FY8A 2A6WA 2LS6A 3VBSC 3U37A 2A3WA 2W95A 5ISLA 2PQSA 5A7NA 3GBGA 2XJRA 5JCTA 3MPPG 2XJSA 2ZGMA 4LBQB 1VRBA 2B39A 4XQDA 1IZ3A 4GAZA 5IK5A 1WLTA 5DDJ3 1IG3A 1VBD1 2IVJA 3N36A 3ZFGA 1ASJ1 1GZWB 5B4NA 5HXVA 1AXYA 2AC1A 3RZMA 2H6CA 1FNZA 4M0HA 5FAXA 4K9SA 2VTFA 5BNPC 3OGSA 5F3GA 5LASA 2XR4A 5IK8A 3FUOA 4BA6A 1SEFA 1VBD2 2OUJA 2JECA 3SNMA 1QXJA 2ORXA 4E2SA 1UMZA 3NJVA 2VPVA 5JWPA 2WWJA 3IMNA 4BQWA 1IS4A 4DQAA 2XJPA 1RC6A 2X8KA 2V72A 3GALA 4KI5M 4XOGA 1AX2A 5F6KA 5FZCA 1DBNA 4I0AA 2WNVA 4IV3B 3M2MA 4JDOA 3AXEA 4M00A 3O1VA 4JV4A 1E57A 4IERA 2VZUA 2W0XA 4YM2A 1ZRDA 3IDEA 1H8TB 2MPFA 3ILFA 1HIXA 3KCCA 3SH5A 2FZ2A 4ZS3A 4Q2FA 2Y33A 3VBUC 3GHMA 4NUBA 2WBKA 1AR73 2JG8B 2C0ZA 2D6NA 2BGPA 4PQQA 3TYJA 5LY1A 1Z0HA 2RJ2A 1GMMA 4OUMA 4EV0A 3BALA 5FXVA 2RS52 2GDFA 1CVNA 2XQRA 2AZ5A 1JUIA 4OLLA 5FYVA 3USUA 2X5IA 4LBJA 1U0AA 5M0TA 3OPTA 3WG2A 1ZBE3 3FLRA 1WLWA 4HLTA 3FHQA 4AL9A 3GNEA 2GNBA 4ET7A 2R0FA 1FMD1 5I8YA 4KWUA 1KS4A 1W6MB 4HK8A 3J7MA 1RUI2 1YRZA 4HPKA 4LR4A 2Y26A 5ABJB 1UYYA 4WZCA 2IWGB 4CUAA 1OA3A 3AFGA 1COV3 3N9QA 1IQDC 1A8DA 3FX3A 1LHUA 1H2LA 2PAEA 2A6YA 2JDHA 2LUWA 2QQWA 5ANNA 3RMXA 2YZ4A 3LPFA 5T50A 4LO7A 2QQOA 4RQPA 2HLEA 1W9FA 4PDWA 3AFKA 3LOIA 3KCYA 4Y1UA 5DDJ1 1FYUA 5JIAA 3TNPB 2QVSB 2Q8OA 1DZQA 4Q8KA 3AYDA 3VN4A 4OI0A 4BU2A 3WG4A 5ACA2 4XQ4A 2JXAA 3LOBA 3AJZA 1XYOA 3M1HA 4YW4A 4A3ZA 1MS0A 5I0SA 1RUC3 3JU9A 1N3QA 2ZJCA 5FJKA 4ZXEA 4JVAA 3AVRA 3JQXA 1U5XA 3EJKA 4CCCA 5DDJ2 5FMOS 3SEPA 4RHV1 3SMHA 4XBNA 5BPXA 1VE0A 3GBFA 4YZ2A 5FR3A 1DIWA 1TVGA 2B5HA 1W2OA 1D4M3 2XJVA 4BH9A 1YIPA 2VZVA 4JKMA 5A3NA 1H9PA 3S7IA 4COYA 4KU8A 5E89A 2OQ7A 5KXDA 1DLCA 1CJDA 1NXD1 3ECQA 2W5FA 1HN0A 2PMWB 5A7QA 3HPNA 4HKOA 1JMUB 3USUB 4E4SA 4HT1T 1ZZ8A 2H0BA 2PLV1 2VZQA 1HV1A 4IL7A 4NRQA 4LLFA 1EAH1 3BU0A 3GZTB 5HI0A 3I7DA 1RUI1 2ARBA 2SLIA 3UGHA 1CAXA 1UZZA 3WP3A 3JB8A 3ACHA 3ZR5A 1PO23 1W8HA 2WQ8A 4WVMA 1AYM1 4QX0A 3KZ4C 1W05A 2PELA 1WCSA 2E7QA 2XWJB 2ZAAA 1AR92 3POYA 3I2GA 4HETA 4FPJA 1MZEA 2EXHA 4AVCA 5FKCA 4CCLA 4BQ4A 2J1SA 4URAA 2OPWA 2ZMKA 1UOFA 4NR1A 1PM7A 3POJA 4PDWC 1OUXA 4YW3A 3SLIA 5A32A 5J98B 5JPNB 3K3NA 4YZ4A 1CESA 3ZYBA 5BV6A 1LGBA 1SCSA 5J96B 1W28A 4K21A 2D6KA 3EYPA 2P17A 2YBPA 5FYZA 4CU6A 1ZBE2 1UOBA 3E5QA 4YYOA 5A3TA 3AP6A 1W0NA 4BIFA 3DKQA 3ILRA 4NHYA 3SXWA 3WOGA 4LHSA 1RUI3 3I4IA 3OPZA 1VBB2 4LBLA 3ZMOA 1ZZBA 1W0OA 1OOPA 2RDSA 2ZKLA 3RYKA 5EXOA 3UGGA 3PL0A 5BNNA 1I9RA 3AL6A 3PUHA 2ZHNA 4OHZA 1NLQA 1TEIA 3EQEA 3HVDA 3ZN6A 5JI7A 4XFBA 1K3IA 1F31A 5IWFA 1OI6A 2JG8A 3TRSB 4Q1RA 4NPMA 4H7MA 4PI2A 2R062 2BU9A 2RS32 4AQTA 4RD7A 3BTXA 1FATA 1HB1A 4JZRA 5ACA3 4AW7A 4LE4A 2B9VA 1W6OB 5FZ8A 4DINB 5C3OA 4N43B 3BUCA 3WEZA 5BXXA 2FDJA 3T2QA 4H14A 1VAKA 2Y6LA 3N3HA 1IKPA 3VZLA 2HWD2 1RUG1 4JGZB 4GKYA 5KBFA 3O0XA 3IAPA 1NE6A 2VNGA 5D8AB 5A6ZA 4Y24A 1QJFA 4ZHNA 4HSJA 4JAAA 3LEIA 4DIQA 3VKMA 5JSPA 1O8SA 1T6BX 2YYOA 3Q8AA 1SPPB 1CAUA 4QXHA 5LA2A 2QQMA 2VZ1A 4P5YA 1GKBA 3ZPOA 4CP1A 3AYEA 3AVSA 5FZOB 4XDQA 3D4KA 2BVVA 1VBC3 3ZKUA 4ARYA 2VMGA 4Z1VA 2BRTA 1J83A 3ASIA 1PO13 2MEV1 3DXTA 1TZOA 5CG9A 1QXPA 5LRRA 4C1XA 5FPAA 1MVEA 3LDKA 2ZGTA 1PNFA 5J09A 1RUH1 4P9JA 1WMFA 3MF9A 1RVF1 3DN7A 3KSCA 2YPDA 1QJEA 3PU8A 2PTMA 3I2DA 1S0GA 3OGGA 5FIXA 5C4WA 5FKBA 3J8F2 4YARA 3K3OA 1ULCA 2RS31 3WP5A 2B46X 2YGLA 1W2TA 1OMIA 4B7KA 3BKZA 5LB6A 3AKQA 4LUMA 5GALA 5CKQA 3CJIA 2VJXA 1JZ2A 2W68A 4X6QB 2ADEA 2WSVA 1QJY2 4CVUA 1LAJA 3I59B 3MUY1 4OCTA 1DQ0A 1JXNA 1OT5A 1PVC2 3S5AA 2QQPA 5C71A 2D43A 2VG9A 1XE7A 4YVSC 2O14A 3I2FA 3DEMA 4E9KA 3NAPA 4XJ9A 2MEV3 2IXHA 4CDWC 1BMV1 3A0KA 3ACGA 5A7OA 4CDXB 1BLZA 2JE7A 4D3WA 5GJ6A 2VTXA 2VVDA 1JZ6A 5IHRA 3N9LA 5HV4A 5A80A 2JKXA 4TSVA 2WS91 5J1XA 4AI9A 5LY2A 3RZZA 4CEWA 4XEZA 2CWMA 2VW1A 1FV2A 1GQGA 2YFZA 1SLAA 1UL9A 4RFRB 1JUHA 2JX9A 1LRHA 1MEC2 1Q8SA 1S55A 3IWZA 2BVBA 3LPGA 4HOOA 2Q8DA 3ZVXA 4ASKA 5EHDA 2WO7A 4IEOA 1JYWA 1S0FA 4ITCA 4PHZA 5FWEA 2ZPXA 3B00A 4QX5A 1PHMA 2HWD3 3LEMA 5CFDC 2EICA 1U5ZA 2WDBA 1W9WA 4PBPA 3HJRA 4K1YA 5KC6A 4Q4X2 3H1YA 4QPGA 3WUDA 1FV3A 4H7LA 2ZAHA 2N7GA 4TXWA 1AJKA 4XMAA 4NWVA 1RUF2 1W2AX 2W2IA 4W4ZA 1HDKA 5DAXA 4DUWA 5FFOC 4IGPA 1XSRA 2OZJA 4DY3A 3ES4A 3N7KA 5I0TA 3CO2A 2YMZA 2ZGOA 1BJQA 1R1A3 4W6YA 3R6SA 4FP3A 3RWKX 2HWB2 2WZR1 3NNJA 1V9U1 3MLJA 1ND2C 4U36A 4Y5Z0 1BK0A 1Z7S2 3JD73 4LORA 5JMCA 4OI2A 2DVBA 1WLCA 2WNUC 4Y1YA 1UZ0A 1F4AA 3RI8A 1JW6A 1KJRA 1LOGA 1PK6C 3ZFFC 5DMYA 2OQ6A 1ULDA 2RDRA 4S2HA 4HONA 2WA4A 3EMRA 5FZFA 1LHNA 2PXJA 1PZ7A 1RVF2 2FCTA 3B9CA 4IQPA 4FXGB 4META 2EAKA 2HWC1 4JCKA 1V9U2 4AFCA 2RS53 4YW2A 1UY3A 3J8F1 1R091 3LA3A 3MLLA 4IEXA 1F8VA 1TME2 2W47A 4IV1A 2WNOA 3HQRA 1RTVA 3NL1A 2VNVA 2VW2A 3ZYHA 4UXAA 4CUGA 4YW6A 2LM3A 2WO1A 2VZ3A 2CSGA 4CDUA 2VMEA 5IVYA 3QD6A 1LU1A 2ZGPA 3GCXA 3MLKA 2RM23 3ALQA 3SHRA 4QQ2A 2G9GA 4A45A 2GH8A 3B02A 5LW9A 3NWKA 4AEMA 1MEC3 3UL2A 2HWD1 1LOCA 3BOWA 3WNNA 3AZZA 3IKWA 1QQP1 4EYUA 5IVJA 1PNGA 3VD7A 3JBG1 3A23A 3V56A 1J3RA 1RUC2 3OYWB 4JGYB 1MEC1 3T30A 4Y33A 4MGKE 4R9CA 1K42A 4FPCA 3O5SA 4IEVA 2JB4A 3C8XA 4CCEA 2QJVA 3MFCA 1D4M2
chains in the Genus database with same CATH topology
4WM7C 4P9IA 1DQ4A 2IXLA 2R061 4M3CA 3OBRA 2Q30A 3KQRA 3D0SA 4F3JA 2XVGA 1QKQA 1OOPC 2PHFA 4Z07A 4LT5A 5KHGA 4QD2A 3BODA 2ZA9A 1R1A2 4ES9A 4XJUA 2CV6A 5FLIA 4FOWA 2HWB3 4YW1A 3L2YA 1XNKA 2A3XA 1I1EA 4RA0A 2DCJA 3ACLA 4GMP1 1AR93 4TWTA 2P3KA 1MS1A 4M01A 3VKNA 4EWDA 4DOUA 4AK3A 4UW6A 5CAZA 1AR91 1MQTC 2JDZA 3WQ7A 1SCRA 4EN7B 1V9U3 3GYDA 1HRI1 3FFZA 4OHVA 5JIUA 2AYHA 2D6MA 4A2UA 1TME3 5E1RA 4AYUA 3USSA 4J6GA 2IZWA 4YFZA 2DCZA 3WDUA 4Z82A 1PGL1 1PO21 2BFUS 1ZX5A 1A8MA 1MZ6A 1DQ2A 1VBB3 1KRIA 4IEPA 3MIEA 4N53C 4Y20A 2WKKA 3S7EA 5CG8A 2RM22 4PLOA 3RPQA 1V6OA 1QNWA 1S1AA 1RL3A 2RJKA 3OJBA 4Y22B 1ULFA 4E2GA 4WM7A 1REDA 4COZA 1YXWA 5GLWA 4QPIA 2E6VA 4FPYA 1VALA 2GMEA 3NV3A 3VBRB 4FQZA 1FI2A 1B35B 1FXZA 1XNBA 4R9BA 3R4DB 3AZYA 3B9IA 1D0HA 4AVVA 4COUA 2P3JA 2Q4SA 4YLZA 2BFUL 4CEYB 4A7KA 3OBTA 4BWOA 3WDTA 4QM9A 3ATGA 5F6LB 4D7YA 2RS12 3EXUA 3NV4A 2WINB 1DGLA 3ZFGB 3O12A 4XBQA 1TE1B 4G3YC 4P9XA 2D44A 3LKJA 1PO12 4FBFA 1GNHA 1XRUA 1G7YA 3UJQA 2Y38A 5EZWA 2A6XA 4KNCA 5JPMB 1AL21 1CONA 2ERFA 1YFXA 2B8MA 4K6BA 1W6OA 4JGYC 4UW5A 4HKWA 4TLFA 5L36A 1F5JA 4WZFA 4XQWA 2QUOA 2BBVA 4FPFA 3AP4A 2VY0A 2ZX2A 2AGSA 2GC2A 3BTAA 4MGYE 3HWJA 3ZFFA 4KBBA 5K8SA 1GLHA 3LGRA 1JYCA 1PO11 1FT9A 1POV3 4QPIB 1QJY3 4AI0A 4XFGA 1CQ9A 1T6GC 4XF1A 1PVC3 3PHMA 1WW4A 3IN9A 1VBA2 2R16A 3KGLA 4QPYA 2BNNA 1QH7A 1UN1A 1PK6A 3UKVA 2WT2A 4ATFA 4B3NA 3MFAA 1R1ZA 4AFBA 3ZFEB 1REEA 4DPNA 1WLDA 2B45X 1NQJA 1MQTB 5T5PA 1QQP3 3NW4A 1RGSA 2BUKA 4O9EA 3WINE 4RQPB 5FO8B 4JTNA 3IIAA 4Q4X3 4FXKB 4OULA 4X6RB 4YZ1A 4RGGA 1NLSA 3AJYA 2ZGSA 1BZWA 2RS13 1J58A 1RUF3 1UPIA 3MICA 1NCRC 2GC0A 3KM5A 1BBT2 2D5FA 3U0ZA 1ULEA 3ZSEA 4K1ZA 4RS5C 5DUWA 4X8PA 5JZGB 2XJQA 4UW3A 4L11A 1NA1B 3EHKA 4HBNA 2RE9A 4TZDA 4XXAA 2O8OA 1RJ8A 3ILNA 4XJWA 1Z7S3 3JD72 2NN8A 2E7TA 2EAAA 2UU8A 4KGGA 3C2UA 1H1AA 1X8MA 2TNFA 3EBRA 4MH0E 4CDWB 3M4FA 5CFDB 2K0GA 3AK0A 1G9CA 4XHXA 4LA2A 1RMU2 1RVF3 4QQHA 1J3QA 1NLRA 3ZFEA 1RUOA 4E27A 4AHYA 4HL0A 4IEYA 2WQ4A 2UWBA 3WXPA 4XJZA 3WT3A 1R1A1 4OHYA 3QOPA 3ZXGA 4YG0A 3VHNA 1N3PA 1KS5A 3BPZA 3SCHA 1V6LA 4JTOA 4KWKA 3W9AA 1JHNA 4W6XA 4S2DA 5IT6A 1GICA 5CNAA 4XJAA 3FHIB 2XWBB 1VBA3 1AL0G 1CAWA 4Q26A 1VBE1 4M0NA 5CFCA 2D5HA 3UJOA 1Y43B 4AI1A 1S0CA 3KLSA 1MS4A 4EN0A 1ND3A 4HKLA 4P14A 3WG3A 4KG0A 1PVC1 3VV1A 3WDVA 2KA3A 1OOPB 3IDCB 4GALA 4Q0UA 5BNNB 2WSUA 3H3ZA 4I30A 3VZNA 1AR81 1QQP2 1G86A 2EVXA 2VNOA 3HAGA 2GNDA 1D0GA 4YNIA 4L2NA 1IHMA 1UIJA 4Q4V1 1HRV3 1DG6A 4LUKA 3E6BA 2NPIA 3VBOC 1BEV1 3WW1A 1F5FA 4GMP3 1CX4A 1WBLA 2A3YA 3CNAA 4AG4A 1BBT3 3MEPA 1ZYBA 2WNUA 3PMEA 2ARXA 4F8AA 3ZXKA 3WD5A 3NKGA 4QPIC 5FQ0A 5KXEA 2TEPA 2FBEA 4N7IA 2XJTA 1J59A 4Z92B 3QH7A 3B01A 2MHFA 4V1PA 2CAUA 4IV1C 4JDMA 1RJ7A 3POSA 1TME1 4PIXA 4BLJA 1RMU3 1DQ6A 3D82A 1MVQA 4L99A 4N43C 1Q56A 3JZVA 3QACA 1WGPA 3VZOA 4OVEA 4OFGA 4P9GA 1PGW2 1LOBA 2VVFA 1C4RA 1Z7S1 2LTNA 5EFUA 1H9WA 4I2OA 4BM8A 2GN3A 4I3GA 4BCUA 2DYCA 2HWB1 1SBEA 1UU5A 2WZR2 1RUJ1 2GH2A 4NN0A 3VBSA 1REFA 2YY1A 3BOPA 4CEYC 4U2AA 4HVRA 4XIOA 3WVJA 5GLZA 1RUF1 5DG1A 1MS5A 4QU2A 2XVKA 1FMD2 4SLIA 4W6WA 1D2SA 2DVFA 2VOWA 3NAPB 2XL9A 1C57A 5EV7A 5LRSA 5AFBA 4AE2A 3MF6A 2GNTA 1RUE1 4AWDA 4NHMA 4CEWB 1C28A 1LEMA 1EV11 3CJIB 4OHWA 2KXLA 1X50A 2RR12 5K0UA 1MR5A 2AR6A 2VGDA 4AEDC 2KM2A 2DUPA 5A3LA 1GZ9A 4XF0A 5AC92 3WQ1A 3K51A 1QJU3 5FTTC 1NYWA 5C4WC 1AHSA 1YIFA 1NCRB 4K7JA 3RQ0A 2DFCA 1LGNA 1VRH1 4QPGB 3ZYRA 5GLVA 1EAH3 1DU3D 1BMV2 1W6QB 4NOTA 5HCFA 3TN91 3SISA 1LODA 2UWAA 3U4XA 5GM0A 1K5MB 4R4ZA 1POV1 1WBFA 3MZHA 5J37A 2DCTA 4XFCA 5IK7A 1D4M1 3HN1A 4RR3B 4Q8LA 1GR3A 2DV9A 4N7UA 1RUNA 4P9YA 1GV9A 4WVMB 1AVBA 3D8CA 2XHKA 1ZRCA 2HEYF 3HQXA 3M3CA 1DGWX 2R072 3NV1A 2Z79A 4GH4A 3JD71 2Z5WA 1I3HA 4L97A 1J1TA 4JRLA 5H9QA 1XYPA 2R1DA 4L8QA 4LNVA 3U11A 4A3XA 5JAXA 4QQLA 3IM0A 2OIIA 1NZCA 3N7LA 2B42B 3AKSA 2XJUA 3GHNA 3ZPYA 5E88A 2PHXA 1FMD3 3LA2A 4RHV3 2ZGUA 4AVAA 1IPJA 1Y9QA 4QQOA 3M3EA 2UYAA 2VMHA 1XYNA 1O7FA 4AVTA 1OA4A 1OKQA 2RS51 1RUG3 1YI9A 1SLCA 4Q0VA 3VDDA 1WD4A 2I74A 3U10A 3UV9A 2RR13 3HR9A 4P9WA 5KHHA 1WCKA 2BWCA 4BMEA 5JSOA 4XE9A 4FT8A 2GC1A 4WV8A 2VUJA 1WMDA 5AC93 1CJPA 1AXZA 4LO6B 4NHLA 1QJU2 4X8NA 3OY8A 1B09A 1UAIA 1YFWA 5H9SA 3HIFA 1Y3TA 4C0BA 2NLRA 3IPVB 4Q4W2 4SBVA 3WCSA 4FPOB 1Q8OA 1BKZA 1O5LA 5HCBA 2DU0A 2ZX3A 1GZWA 2WT0A 4ZU5A 2BNOA 5FRAA 3DV8A 2ILMA 1BEV2 1G6NA 3OD0A 4ZXKA 2EIGA 4ATEA 1W6PB 1B35C 2ZX4A 3FWEA 4M3CF 2SBAA 2FMDA 1YHFA 2B9UA 2XKOA 3AYAA 2ES3A 3AZXA 5CFCC 4XF4A 3S6PA 1FOD1 1X33A 2Q5TA 1NOVA 2ZZQA 4N90A 4YSFA 1O91A 2R073 3ZXJA 3MW2A 1ZBA1 1ENRA 5DG2A 4MGIE 4ASLA 5CB7A 1HQLA 4RSUA 2D6PA 1KXGA 3AKPA 1TNFA 5JVVA 5JZGC 4HK9A 5DXDA 2RMU1 1QMJA 2D6OX 1LOFC 1COV1 2D7FA 5FO7B 1VBE2 2ZTNA 5C8WA 5KHIA 1H0BA 4RHV2 2XG3A 2D40A 3HD8B 2QCSB 4ONUA 4EJRA 2K9ZA 2PAMA 3PVOA 3VZKA 5B2GB 5FREA 1KDKA 3PVBB 5ABJC 4BPZA 5J3UA 4UBGA 2ZHKA 3MIHA 4CDQC 1QU0A 1AX0A 3LB9A 5GLUA 1Q8VA 3MW4A 5L7OC 1MACA 4KGQA 2EA7A 1HRV2 4LHNA 2GC3A 1RMU1 4WVWA 3UKNA 5ACA1 2Q0AA 2YROA 1W6NB 1POV0 1S0DA 5EYXA 3WNXA 1TMF1 2IFRA 1W39A 4K20A 1GSLA 5GZEA 2JEMA 3ZDSA 3O0VA 4LBNA 3TBDA 4AHZA 1DZRA 4HSLA 5FO9B 2Q1ZB 1FPN1 2YC0A 1S0IA 2OVUA 2PHUA 2AUYA 5A3MA 1QOSA 1UD1A 2FZ1A 3BIWE 4Q4W3 3D6EA 3QBQA 3ELNA 1U5YA 4ASMB 4O9GA 4CYDA 1MS9A 3HT1A 3TAYA 1V6IA 4RS5B 1DLLA 3WQ0A 4E4ZA 3D0JA 4AGGA 4XHBA 5C8CB 1H2KA 1RUD3 2GNMA 1IS6A 2YUEA 5J48A 2DTYA 1BEV3 2IFWA 5KHKA 2ZBJA 5I8SA 3VBHC 1SLIA 4GWMA 1AYN1 1HXS3 1QWRA 2CL2A 5F1RA 3FBMA 2DTWA 3ZN5A 2WNEA 3WDXA 1ND2B 5JOWA 4R8HA 1LHOA 1N3OA 1IKQA 5DUVA 5IUQA 4AFAA 4L92A 3AP9A 2ZGLA 3IPVA 2WQZC 2WZR3 1CIWA 4DRVA 1XE8A 1YYNA 4DZGA 2BWAA 4QXKA 2NMOA 3KGZA 4GQ7A 1UCXA 4JQRA 2PLV3 1V6KA 1M06G 1KJLA 4OHXA 2AENA 2DURA 3JCIA 1RUD1 1IPKA 5A32B 3KB5A 1YWKA 4YM0A 4DRRA 5BNPA 4XMIA 1HLCA 1D2QA 4FCAA 1RHI1 3PTYA 1VP6A 3RI9A 4LLOA 1DFQA 1DF0A 1LCLA 1VBB1 2JKBA 2A70A 4GH4C 2FQPA 4COWA 4FAHA 2GZWA 2DU1A 4YZ5A 2K2SA 1ND3C 3VHPA 1QJY1 3VBUB 1UF2C 1U12A 1JTZX 2E7AA 1IS3A 1AJOA 3FBYA 3OYWA 2ZX1A 5FBZA 1HXS1 4EROA 1ND2A 1VAMA 3VLBB 1DGRN 1NCQB 1TQ5A 1ZNPA 2BEOA 3RRDA 4FTEA 3NVCA 1EAH2 3CLPA 1Q8PA 2WT1A 4JGZA 3M3IA 3MGUA 1BBT1 2DWRA 1ENSA 4P9LA 5I91A 2WFPA 5D8AA 1HX6A 5DUUA 2BQPA 1MQTA 1UKRA 2OA2A 2A6ZA 4AI8A 3P3PA 1U5IA 1NA1A 2VOVA 3ZIWA 3ZSLA 4RGAA 2V73A 1MZ5A 1WCDJ 1PZ8A 2JICA 1S2KA 5KHJA 4CDWA 3MIDA 5T5JA 2WNVB 4IV3A 5CFDA 1BVVA 3THTA 5HCAA 5JSRA 2P3IA 1OLRA 3AP7A 3LSEA 1NCRA 2VOKA 4RS5A 4CDXC 1AYN3 3RYPA 3ENRA 3IBMA 4HN0A 3X29B 4AI3A 4WVZA 3FE5A 1RB8G 1LB2A 4L9BA 1C8M1 5E8AA 1SDWA 2PHDA 4HN1A 1ZVFA 4FPKA 1K5MA 1C8M3 4AEDA 1PGL2 4YGDA 2D3SA 1PGSA 5LEJA 2RMU2 2WFF1 1FAYA 3SH4A 3WP6A 1ASJ3 4Y20B 4YVSA 4DFSA 2VULA 4RL7A 2CYFA 3URFA 1YI7A 2VH9A 4LBQA 1RUG2 1W6MA 3AZWA 4WM8B 2R043 4HPKB 5ABJA 4PLNA 1SACA 4F83A 4WM7B 2QZ3A 3T1LA 3ME2A 3KCXA 5FMOL 4BE3A 3AMMA 5JOYA 4FQ4A 4NWWA 4MXWB 1AR62 4R4XA 1B35A 3MIFA 4YVWC 5GZGA 1LTEA 3OF1A 1RUE2 3WZ1A 2VQ0A 1HQWA 3QH6A 3WW3A 1F2NA 4CRQA 2NP0A 1MS8A 1WW7A 4FO9A 5FLHA 4GWNA 1V00A 1RUH3 2A73B 2ZHMA 1LJ7A 2DFBA 2Q1MA 3KMHA 1O3SA 1EP0A 2RS11 4I0WB 4DB5A 4AHWA 3H1MA 1DDLA 2TUNA 5BNNC 1ZZ6A 2P34A 1VR3A 4AGRA 3V0AB 4AEDB 1NQDA 3PVEA 2ZKNA 5H9PA 1RITA 1QDCA 4OI4A 3WDWA 4RFT0 1BYHA 2VW0A 5K9YA 3AB0A 4QQPA 1UKGA 3ROUA 3B69A 1AYN2 1H4HA 2I2SA 2MNGA 3QLQA 3W59A 2G9FA 2GALA 2YPJA 1VBE3 3RJ2X 4MXWA 2JG9B 1EPWA 1PMIA 5BY5A 1WD3A 3RDIA 1C8M2 3MDPA 2HWF3 4WBBA 4YRDA 2RMU3 2ATFA 4P5HA 3TB0A 2YV8A 4I01A 2DVAA 4KQ7A 1BK1A 3ZXDA 1HRI2 2FMYA 2R042 3FFQA 3AKRA 3H8UA 5T54A 5BNQA 4MYEA 4PCRA 1ZM1A 2ZMLA 2ET7A 1DQ1A 2ZGNA 1A6CA 3RS6A 4PIYA 1Y7BA 1AXKA 2Z2SB 3M3QA 4KU7A 3V0AA 3CF6E 1AR63 4S2GA 1AL23 3NO8A 4Y4YA 2XGXA 1DHKB 3OD4A 2VVEA 1RUE3 3ZN4A 4AF9A 1AR83 2UYBA 3MI8A 2X5IC 4AQ2A 4YVSB 2IXJA 1HQNA