2ZGMA

Crystal structure of recombinant agrocybe aegerita lectin,raal, complex with lactose
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-tumor lectin
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
total genus 39
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgmA00
1WD3A 1WLDA 4FPFA 1S1AA 2ZHNA 2P37A 1PZ7A 4M3CA 1CN1A 1V6KA 1GBGA 2XB6C 1N3QA 2DVGA 3OPZA 4NO4A 1GKBA 1LU2A 3OJBA 2FMDA 3AJYA 3PVOA 1J1TA 1RIRA 5FREA 1LTEA 2A5ZA 5H9PA 4XJ9A 5SV8A 2R0FA 2PHWA 5EXOA 2EXHA 2EF6A 4FOWA 2C9AA 5T52A 4JC1A 4CTEA 3WHUA 5T5JA 3USUA 5JLVA 2ZKNA 4D69A 2XG3A 2JECA 3OGGA 2YY1A 1O4YA 3M3EA 1MVQA 1FNYA 1G86A 1SLAA 3DUIA 3LCPA 5DUWA 2EXJA 1LGBA 2UWBA 3ZPYA 1N1YA 4YZ3A 3LSEA 2CL2A 1N1SA 1LULA 2NZ9A 3BOPA 2ZHKA 1LGCA 1LOFC 4BPZA 2YXSA 1GLHA 1HDKA 1VAVA 2D3SA 2DVAA 2OVUA 1LHOA 4K20A 1IS4A 2PHTA 3B3QE 4XBQA 4XHBA 3SH4A 2EALA 1LHUA 2V5YA 4XJWA 3BTAA 4UW5A 2E53A 3PVNA 1LOEA 3R05A 1LHNA 2ZHMA 4Y1XA 5H9SA 3TB0A 3AZXA 4JRAA 1WLWA 2R49A 1G8WA 4XE9A 1MS1A 3ZXEA 4FPGA 4YZ5A 3MW3A 1MS0A 1Q8SA 1DFQA 4FPCA 3A0KA 1ULDA 4TZDA 1WW5A 1G9FA 2E7TA 1C1LA 2LTNA 1LHWA 2DURA 2YZ4A 4P9YA 2D3RA 1UAIA 4RL7A 5F5QA 5IK7A 2LALA 4PBOA 1S0CA 1LCLA 1UMZA 4YM1A 1W6PB 4XBLA 3D4KA 1Y7BA 3WG4A 1WUVA 1QGLA 2D6LX 2WJSA 5DUUA 4GA9A 3N7JA 4K1ZA 2A75A 2BQPA 4AWDA 3WG1A 4YW2A 5T54A 5GZGA 1DBNA 4LBQB 1IKPA 2DTYA 4XYXA 5GLWA 3AXDA 1QDOA 2E6VA 5CB7A 4BM8A 2JE7A 1MZ6A 2P3IA 1ZM1A 2WSVA 1S0BA 3AZWA 5IK4A 3SH5A 2DV9A 2P34A 3BODA 1CVNA 1N3OA 3OY8B 4P14A 1G9DA 4XILA 2WKKA 1WW7A 3O0VA 3FBYA 3AP4A 1JYIA 2ENRA 3TAYA 3UK9A 2ARXA 2R1DA 1AXYA 1W6QB 1N3PA 2G4IA 4Q1PA 3WDWA 2A6YA 1FV2A 2E7QA 4U2AA 3IKWA 5JOXA 3V0BB 4Y20B 2NM1A 2GNDA 5DXDA 2P3KA 1W6PA 1W6OB 5CNAA 1AXKA 4AGGA 1D0HA 1VLNA 4YW3A 5T5PA 2UWCA 5GLTA 3T2TA 2D6MA 1TEIA 2ZMNA 1KDMA 5IK5A 2EXKA 2GMMA 2Z42A 1JYCA 2JJ6A 2V73A 4LBQA 1CPNA 5IK8A 2DWRA 2ZGQA 1CR7A 1FAYA 1F31A 4LBNA 4XIKA 3VKNA 3PVEA 3OBRA 3R4UA 4BOWA 2VU9A 1I3HA 1EPWA 4FPEA 3SISA 4DFSA 1KJLA 1SLTA 3APBA 3DGTA 2UURA 3POWA 1DQ2A 1JUIA 1OKQA 2A6ZA 3OY8A 4BMEA 1AX1A 1QF3A 1W6NB 1SBFA 2DU1A 3D5OA 3RMXA 2YV8A 2CNAA 2DUQA 4UW4A 5GM0A 2ES3A 2GMEA 2D6PA 2PELA 2PHFA 4LBLA 4YG6A 1W6QA 1ENRA 5CAZA 1GNHA 2YMZA 1YO8A 3O0WA 1BJQA 1V6OA 3N3HA 2CYFA 2VUAA 1O4ZA 2H0BA 1WLCA 2D3PA 2ZGNA 3V0BA 4Y20A 1LOFA 3WG3A 3POSA 1W6OA 1RITA 3O0XA 1LGNA 3ASIA 4PCRA 3M2MA 1VALA 2W08A 1JXNA 5DZGA 1JN2P 1ULEA 5HCFA 3WDXA 1H9PA 3V65A 4DS0A 4Z8BA 1FV3A 3N7MA 4XIOA 4TYSA 3SITA 2B7YA 3WHTA 1LECA 1QU0A 1X50A 1ONAA 2SLIA 4KBBA 4R9CA 1H9WA 4M3CF 4XTPA 5GLVA 5EYYA 3T1LA 1SLIA 1C1FA 4WV8A 2ZMKA 4GWMA 2ZGRA 1ENSA 4MYEA 1NLSA 1W6NA 1QNWA 1G7YA 1B09A 1JHNA 1Q8OA 4U36A 3I4IA 2WT1A 3O12A 2ZGPA 3KQRA 2DUOA 2CTVA 3RMYA 4FPKA 1LHVA 1UZYA 4FOQA 1DQ0A 3KM5A 4YW4A 3ZYRA 3MW2A 2D6OX 2VW1A 3GNEA 3JUUA 2R16A 4XMAA 3W59A 2D44A 2ZGMA 1SFYA 1NXD1 1YI7A 1SCRA 1S0DA 2I2SA 2UWAA 1MS4A 3AYDA 3IMNA 4BLJA 1N1VA 4Y1ZA 4Q1RA 4YM0A 1SCSA 3MEPA 1RINA 4WZFA 1G9AA 1PZ9A 3O5SA 2WSUA 1V00A 5CA6A 2ZGLA 1CIWA 1S0EA 5IUQA 5T5LA 1Q8VA 3VUOA 3AFKA 1HQWA 5FRAA 2E51A 2PHUA 3NWKA 5T55A 4AVSA 3N36A 4BQ1A 4DQAA 3WG2A 3ZYPA 4Q2FA 1DYKA 3JU9A 1G9BA 1UZZA 5DG1A 2GN3A 3V0AB 4FOYA 4ITCA 4R9BA 5DUXA 2NN8A 3BIWE 3AYCA 2OUJA 4FPJA 4AVTA 3WDVA 2GALA 3ZVXA 2ZHLA 2HYKA 1S0GA 5CBLA 2AREA 1IS6A 4FP2A 2ZA9A 4Y1VA 2JD4A 3N7LA 4XBNA 3WV6A 5JOYA 2DTWA 1A78A 1G9CA 2VY0A 3B00A 1HKDA 1KITA 1R1ZA 2AH2A 2A71A 2CY6A 1UL9A 4FP3A 4W65A 4ZXKA 4F83A 1URXA 2ZZJA 4XTMA 1ENQA 1V6IA 3WUDA 4XOGA 3VKLA 5HCAA 1QNYA 1AF9A 1LOAA 4GALA 1GNZA 1SBEA 3AZYA 2A6WA 5JOWA 4OZXA 4XJ8A 2TEPA 3CNAA 4XDQA 3VKMA 3WVJA 3ZXFA 2PHRA 2VW0A 1AJKA 1HLCA 2CWSA 4PQ9A 3SLIA 1F5FA 3AYEA 1AX2A 3ILNA 1LOCA 3Q9OA 3V64A 2CWMA 3V0AA 1WBFA 1FATA 2DVDA 2C5DA 3AJZA 5F9TA 1V6LA 5KXEA 5EWSA 5T5OA 5H9RA 1LU1A 1Q8QA 4GKYA 4LBMA 1AJOA 4XMIA 3U4XA 1UN1A 1W6MB 4WVVA 2AGSA 5KXDA 4M00A 2W68A 2OW4A 2VH9A 1SLLA 2ZACA 3WCSA 5DZFA 3ZXKA 2GNTA 4ZKTB 1CPMA 2AYHA 3M3OA 3LSDA 1MZ5A 2D43A 3FLTA 2EAKA 1DQ5A 3MPPG 4LBKA 3HN1A 3WDYA 5IT6A 2AR6A 1CONA 3AP6A 3QCWA 5GALA 1DQ4A 4GWNA 4YGCA 3NV3A 2R0HA 1CQ9A 4YFZA 1WW6A 4WVWA 4YG3A 5GZFA 2D6KA 2WT0A 1LJ7A 1LOGA 5GZDA 4FPYA 3I8TA 3ZSLA 2GDFA 5DUVA 1VIWB 3RS6A 2A3YA 1UKGA 1JOJA 3HR9A 2NMNA 3N7KA 4HANA 2A70A 1BQPA 4AGVA 4C1WA 1W6MA 4AVVA 1KRIA 2ZMLA 3FLPA 4NOTA 3ILFA 3OYWB 1QOOA 1YXWA 1CESA 4JCKA 2WQZC 3SH3A 2DYCA 3D6EA 4FOVA 1KQRA 2ZGKA 4BLIA 1SLBA 2ZABA 4XZPA 1N47A 4UW3A 3WDUA 5DG2A 1YYNA 4YW5A 1F9KA 1AVBA 1W0OA 3H0OA 5GJ6A 1QKQA 3B69A 4R9AA 3UJOA 2FHRA 5H9QA 2WNEA 2WLQA 4YM2A 1QOTA 1U0AA 3VV1A 3RSJA 5EYXA 1MS9A 1I1EA 3AP5A 1LOBA 1GZWB 4FPHA 1JW6A 4ISQA 2UU8A 2DUPA 1LEDA 3GALA 1MR5A 1MS3A 1GZ9A 3NV2A 1SLCA 4AYUA 3IPVB 3PJQA 1W0PA 1FYUA 2R1BA 3INAA 4YGBA 3WZ1A 4ATEA 4FPOB 1KJRA 2AUYA 1MS8A 4SLIA 1GYKA 1GZCA 1QDCA 3WOGA 1N1TA 2ZGUA 4YGEA 1DIWA 3OYWA 4XJAA 1BYHA 2DU0A 4K1YA 3IN9A 3RQ0A 2VW2A 3AYAA 4I30A 1S0JA 1C57A 3WCRA 2GNBA 4P9XA 2VXRA 4Y22B 1Q8PA 4HL0A 4R9DA 2D7FA 2DVFA 5JVVA 4L8QA 3HMYA 4H55A 1C4RA 1ULCA 1VAMA 2EIGA 3L2YA 4YZ2A 1Z78A 2A3XA 3VKOA 2ERFA 3WDTA 5L73A 4YZ1A 1MS5A 2A3WA 2NYYA 4GKXA 1UPSA 1S0FA 3B9CA 3VKFC 1GSLA 1GZWA 1H30A 3A4UA 3W58A 4M3CE 1AX0A 4K21A 4PF5A 2ZGTA 4XJUA 3M3QA 4PBPA 3IPVA 5LK5A 3ENRA 2W52A 4Q27A 3ZXJA 4DRRA 5JOZA 2P3JA 3ILRA 4YFWA 2NP0A 1WCSA 1BXHA 3MW4A 3FUOA 3IM0A 4YW1A 1QOSA 2JKBA 2ARBA 3ZXLA 5BYNA 3ZSMA 1D2SA 2Q5TA 3PMEA 1OFSA 4P9WA 1LENA 1YRZA 4FVVA 2YROA 4Y22A 3WUCA 3NV4A 1WD4A 1QMJA 4Y24A 4CZSA 5DZEA 1LESA 3RG0A 3M1HA 1BKZA 5KXCA 1GANA 2RHPA 3AP7A 2PHXA 4LBQD 5E89A 3NV1A 1HQLA 3AXEA 5GZCA 1IS3A 1CJPA 2ZGSA 3C2UA 1ULFA 1GV9A 1OQ1A 3FFZA 4YGDA 1BZWA 3SNMA 2A7AA 4ASMB 3UJQA 1LEMA 2ZGOA 4Y1YA 1DGLA 2WT2A 1XQNA 1MACA 3ATGA 4C1XA 2JDZA 3POYA 1DQ1A 4Y26A 1AZDA 3R4SA 4RA0A 3FUQA 1LODA 4ATFA 1WW4A 4Q26A 2SBAA 5T50A 1IKQA 3UL2A 2DVBA 2NMOA 1S0IA 4YLZA 1DQ6A 4YZ4A 3AZZA 3N35A 4DPNA 1IS5A 3WNXA 1SBDA 5E8AA 5GZEA 4LBOA 4Q8KA 1KDKA 4FQ4A 1DYPA 4Y1UA 1Q56A 3QLQA 1DHKB 5E88A 4M3CB 2GMPA 4FQZA 1ZA4A 2ZAAA 1UX6A 3AX4A 4IQPA 5GLUA 5AVAA 4CRQA 2OUHA 4ISRA 4DRVA 4Q8LA 1FX5A 3T1MA 5HCBA 3WLUA 4XJZA 3RRDA 2AENA 3OBTA 1APNA 2EXIA 2A6XA 4FPLA 1V6NA 1IOAA 4M01A 3FLRA 4YG0A 3AP9A 5KXBA 1A8DA 1A3KA 3M3CA 1YIFA 1DZQA 4UW6A 5GLZA 1PZ8A 2W39A 1MVEA 3USUB 1V6MA 4XHXA 4XXAA 2P2KA 2D6NA 4BMBA 2GN7A 2ZBJA 1ULGA 3ZSJA 3AK0A 4GXLA 4XXPA 4YM3A 1WBLA 4LBJA 3ZSKA 5JDBA 1SACA 1Z0HA 1DLLA 2GNMA 3B01A 4AGRA 1FNZA 1AXZA 1JBCA 1V6JA 2JE9A 2KM2A 3AZVA 5JMCA 1GICA 3A0NA 2A6VA
chains in the Genus database with same CATH superfamily
1XE0A 3S30A 4XABA 4NPMA 4FPFA 1S1AA 3VN4A 2P37A 1YQ5A 4PIZA 1OFNA 5LEJA 5IWFA 2XB6C 2DVGA 3JB4C 1GKBA 1AR93 3POEA 4PF1A 4IEYA 3O1UA 1PVC1 5FREA 4KNCA 3AFGA 1LTEA 4TTGA 5H9PA 4XJ9A 1I9RA 2PHWA 1FMD2 2R0FA 4Q0SA 3ACLA 1HRV2 1DGRN 2XHKA 3BPZA 5CIRA 1RUC1 3C7FA 4JC1A 4HETA 2VXJA 5K0UB 3NVCA 1BMV1 5LBEA 1NOVA 5JLVA 4IE6A 3CEWA 3VHRA 5HV0A 2XG3A 1O5UA 5FXVA 4FTSA 2C26A 1O4YA 3M3EA 1SLAA 2WWUA 2WNUC 3LCPA 3KSCA 5IAVA 5LK7B 5L9VA 2UWBA 3ZPYA 3JQWA 3VBFA 1YFXA 4N53C 4JGZA 4I3GA 5CG8A 1LOFC 2NLRA 5FLHA 3LIGA 1GLHA 2D3SA 4UF0B 3SEPA 4XBQA 5CADA 2V5YA 5BNPB 1RVF1 2C9KA 4FFFA 2HYXA 2Z4FA 1POQA 2O0OA 4UW5A 3PVNA 4LK6A 5IYYA 4ZS3A 4QDQA 3MPBA 3JBG2 2R7EB 2VQ0A 3Q8AA 5LW9A 4JRAA 1D2QA 2R49A 4NE9A 1TNRA 2C0ZA 1MS0A 2BFUS 4FT8A 4CU6A 4NAMA 3FZ3A 5HPOA 4LT5A 2HWD2 2E7TA 3TN92 1EV11 2IC1A 2VM9A 4RL7A 3H50A 4A7ZA 5IK7A 1LCLA 4YM1A 1CGPA 3WG4A 3ZO0B 3MI8A 3CF6E 5FZCA 4O7XA 4K1ZA 3K46A 5LY2A 1TMF3 1JYTA 2JG8B 4KBZA 1JU4A 4NHKA 4AWDA 3PIJA 3WG1A 4A2UA 1ZRCA 5GZGA 2V4AA 1CIYA 3AXDA 3DXTA 5ERLA 5FZ9A 5CKNA 3ZYGA 2WLPA 1MZ6A 2XL9A 3VBSA 1ZM1A 1VBD3 5IK4A 5DAXA 2DV9A 2P34A 2QVSB 2VNGA 4PDWB 2RDRA 4KWUA 4EWAA 1G9DA 3VD5A 1AYM2 4MGZE 3ZYBA 3JB8A 4O65A 1GUIA 3KT4A 4RS5A 4CDUC 3TAYA 1PIV1 4MG2A 3RVHA 2BV4A 2R1DA 4Q1PA 1IG0A 5I0UA 1K5MB 4I0AA 3GZEA 2EVXA 4L0PA 2E7QA 5JOXA 3LDKA 1SMVA 2FDHA 3T09A 2NM1A 2GNDA 3DN7A 3LIHA 2Q8EA 4B8EA 4CU7A 3KGLA 2VTXA 1IPSA 5T5PA 2UWCA 4KQ7A 3T3YA 3H8UA 1HB1A 2W46A 5LWBA 5IK5A 2ZMNA 1KDMA 1NX9A 2Z42A 1JYCA 1V9U1 1NCRA 3KCYA 4LBQA 5AFBA 2ZGQA 2JWPA 1KD7A 2VQAA 3K4ZA 4QX1A 5FUPA 4AEJA 3R4UA 4BZ4A 1IG3A 2WZR2 3FL7A 1QJX1 3F2ZA 4L2NA 4DFSA 4A6SA 5AC92 1BLZA 2R063 4URTA 1DQ2A 4IV1B 1TNFA 1OKQA 2A6ZA 3OY8A 4BK5A 5C3RA 1AX1A 1QF3A 2R041 3D5OA 5JWPA 2YV8A 2Q8CA 2CNAA 3VDDC 4C91A 5FYZA 5CKQA 2ES3A 2D6PA 1XU2A 3WSOA 3NNGA 3ZX7A 1J3PA 1YO8A 2JB4A 2YMZA 5DABA 2BRTA 2VUAA 1RUNA 2D3PA 4HPKB 3BVCA 5IFTA 2Y6FA 1W6OA 4D6SA 3ZYIB 3CZUA 4HSJA 3IWZA 3ASIA 5L36A 1OLQA 4LO6B 5FBJA 3ZDVA 1AR61 3VDAA 1RGSA 5FUIA 2WO1A 1JN2P 1W2NA 1R092 2QFEA 1H9PA 5HCFA 3T0BA 5FYVA 1FV3A 4IEOA 1O6UA 3PTYA 4Z8BA 3O1TA 4XIOA 4IV3B 3I3EA 5KHKA 2JE8A 4SBVA 4CDWB 1X50A 3HIFA 1ONAA 4N90A 1UMIA 2K0GA 2VZVA 4M3CF 4PIXA 5GLVA 1W2OA 1C1FA 4YNIA 2ZMKA 4MGYE 5KHJA 4TSVA 4MYEA 2RS12 1EAH2 3MIDA 4QX5A 2VZ3A 5ACA1 2QDRA 2HWB2 4U36A 4AHZA 4JQRA 2Y34A 1C8NA 5J3UA 1QXJA 4MH0E 3KQRA 5JCTA 3I2KA 3ZYFA 4J6GA 5LRRA 4YW6A 2KD7A 1VMFA 3MIGA 4Y5TA 4FPKA 2WNOA 4KG0A 4AI8A 4FOQA 3KV4A 1AL0G 3KM5A 3NJYA 4N43A 4YW4A 3FHQA 4LO5B 3ZFEC 3MW2A 3NKTA 2D44A 2XONA 3OPTA 4YYOA 4NHYA 4RYDA 1YI7A 2I2SA 1MS4A 3B9IA 1N1VA 4ONUA 4Q1RA 3NKGA 1TME3 2RS32 5LBCA 4ARYA 1BEV3 3O5SA 5FZ3A 1O3QA 4AEDC 1FXZA 1ZBE3 1CIWA 4CCNA 5JR2A 1Q8VA 1UF2C 5BNNC 2OS2A 2RJLA 3AFKA 5FRAA 2PHUA 3NWKA 1ZRFA 1PVC3 2VNRA 2WL1A 3N36A 1DYKA 1RMU2 1UZZA 2Y6KA 1PGL2 2Q0AA 1UZWA 1HB4A 4FSJA 3V0AB 3CBNA 3RFRA 5DUXA 3N9QA 2ZX4A 3AYCA 2OUJA 4AVTA 3WDVA 2GALA 3ZFFB 5FKBA 1HXS2 2B42B 2BGPA 2HYKA 4JGYB 2AREA 2VZRA 3KF5A 4QXHA 3VBRA 4FP2A 4J1WA 2ZA9A 4DUXA 4Y1VA 2JD4A 2FDIA 1B35B 4XAAA 4XBNA 2ZX3A 4YVSC 5A32B 3OUJA 3WW2A 2DTWA 1BBT3 4QX0A 2RR12 1TQ5A 4XFCA 3L9JT 4CEWA 3B00A 5FMBA 4GZ9A 1HKDA 4IEXA 5LASA 4ZXKA 4F83A 1URXA 2E9QA 2ZZJA 3VL8A 4RGKA 2P1BA 2VCBA 4XOGA 5FMOL 5HCAA 3BPSA 1C8M2 2C6SA 2W3JA 3H3UA 1RVF3 2A6WA 5C4WC 5C8CA 4OZXA 2IWGB 3CNAA 4XACA 5CKMA 5FXZA 1AJKA 1ODMA 1HLCA 4WM8A 4PQ9A 1ND3C 1H2KA 1LOCA 2R073 3B7MA 2CWMA 4AG4A 1NUKA 1AYN1 3IIAA 5FYBA 5A1FA 3AL5A 1CJDA 2XOMA 3S5AA 4HVRA 1JOBA 1VBC3 1ZREA 4GH4A 1V6LA 2XJVA 5EWSA 3KHCA 1EV13 4QKBA 1LU1A 3U4XA 4LBMA 1AJOA 5A80A 1NCQA 4PQQA 5EJ1B 3VB9A 4QD2A 4ZKTB 2WINB 4XUPA 1CPMA 3C8XA 4IEVA 2R30A 3MO4A 3ZDSA 2D43A 3FLTA 3ITQA 3UGGA 1X36A 1DQ5A 4DO0A 3AVSA 5C6CA 1RUD2 5L7OC 5IT6A 4FCAA 1JH5A 3AP6A 1JS9A 5GALA 1D4VB 4CP1A 4GWNA 2WS92 4LO4B 4XEZA 4YGCA 2R0HA 4A41A 1NLQA 3VZOA 4YFZA 1RHI1 1CAVB 1WW6A 2IXHA 4YG3A 5FO8B 5L9RA 3T08A 4YSFA 3HQXA 2WN2A 1YLLA 2YGMA 2DCZA 2ZEYA 4ZONA 3USSA 3ACGA 1YCIA 5A33B 3ZSLA 2GDFA 5DUVA 3HWJA 1PIV3 2W47A 1UKGA 1ZRRA 1POV0 4LEJA 2RMU1 3WW4A 3HR9A 3MIHA 4F8AA 5J36A 2YC0A 2ZAHA 1SPPB 4AGVA 1W6MA 3MIFA 4AVVA 3WF1A 3W20A 4RR3C 2K46A 2ZMLA 1XXNA 3O1SA 2MNGA 1OVSA 4QPGA 4UI9L 5FPAA 1KQRA 3EHKA 1ST8A 2VR4A 1V9U3 2ZABA 4XZPA 5CFDB 1N47A 4UW3A 3O7OA 2VOKA 3PNAA 4RQPA 4YW5A 3PTRB 2F4PA 5A3WA 3OTFA 1Y9MA 3NJVA 1W0OA 5BV6A 3B69A 1H6XA 1QJX3 1ZZ7A 3NNFA 4NIDA 2OT7A 3E97A 4HG6B 5H9QA 2WLQA 1F5JA 1QJU2 2FZ1A 1U0AA 2X53S 5KC5A 4K8RB 5EYXA 4FFHA 1W9FA 2R043 1LOBA 4Q4W1 4DUWA 1E5SA 1JW6A 4QKFA 3RPQA 1EAH1 3GALA 1D4M3 1MR5A 1WMEA 3HJRA 1SLCA 3FBMA 2PHDA 5A7WB 4AYUA 2P6HA 3PJQA 3I3MA 1FYUA 5FZ4A 1L7QA 1QJFA 2OX0A 4BQWA 5JMOA 2AUYA 3KS7A 4PI0A 4GB31 3W5NA 4IETA 1QDCA 1N1TA 4KL1A 1FOD2 1E5RA 4CP9A 4LR4A 2JG9A 1W9YA 2DU0A 4BIFA 1Z7S2 3RQ0A 2VW2A 1UCXA 3B5LB 2ZKLA 2GNBA 4P9XA 5FLIA 2HWF3 4R9DA 5JVVA 4FO9A 3U4SA 1ULCA 5FZFA 2RS52 4HN1A 2YFUA 4EWDA 2A3XA 3ES4A 3LFIA 3VKOA 2ERFA 1BCXA 5L73A 1AR72 1QXPA 2NYYA 3RZMA 2Y6JA 2XJUA 1GSLA 1IQDC 1H30A 1EPZA 1H8TC 2GC2A 1AX0A 4TLFA 2G9GA 4XJUA 4KWLA 1FMD3 1E57A 1M4WA 2BVBA 3NQHA 4JX0A 3J7NA 1HRI1 1UOBA 2FDKA 5LK5A 4BK4A 3ENRA 2VQUA 3LA2A 4Q27A 3AMMA 4UYBA 3ZXJA 2QQMA 1AR82 4YFWA 4JDOA 1BXHA 1U5ZA 3ZYJB 2EA7A 2JKBA 1PO11 2IXLA 4NJ4A 4CXYA 5FZDA 3PU8A 3GYDA 4CYDA 2Y33A 4RHV1 1WD4A 3GBWA 5JI7A 4MGKE 3TWIA 4Y24A 3DL3A 3E6CC 2HWE1 1LESA 1XPWA 5M0TA 4YVWA 2DBNA 3RG0A 3E1F1 3LEGA 1BKZA 4XQDA 3VBUA 4I09A 2F4LA 2RHPA 2WNVB 2JDUA 5EV7A 4E4ZA 3NV1A 4HMZA 3JBG3 1CJPA 2AZ5A 3ZM8A 4PI2A 3CMGA 3SNMA 2WDBA 4CEYB 1QJY1 5FY1A 1LEMA 2HWD3 1ZVFA 4Y1YA 1UQXA 2OPWA 2OQ7A 3OG2A 3U78A 5E6HA 5GKAC 4AR2A 3VBOB 1WA6X 5AFEA 3MLKA 5B4XA 1WW4A 3WQBA 3C7GA 1DZRA 2DVBA 2IFWA 2NMOA 2VD7A 4XUTA 5C71A 1DQ6A 2JX9A 4TXWA 3AZZA 5K0UC 2Q1MA 3KMHA 2EIBA 1SBDA 5E8AA 4E4SA 2Q1ZB 3IAPA 4LBOA 4Q8KA 3I2OA 1KDKA 2JDPA 4FQ4A 1DYPA 1ZZ6A 3BCWA 3QLQA 1DHKB 4OUEA 4M3CB 1ZA4A 4IQPA 1UX6A 5GLUA 4CRQA 2HBUA 4DINB 2QQJA 4L97A 4XJZA 2XBO1 3RRDA 4DEVA 1AYN3 4GJZA 2WIIB 5D8AA 5FXWA 2ZEZA 4ZPIA 4FPLA 2QE3A 3FE5A 4Q4V1 5BNPC 4PHZA 1IOAA 4YWAA 4YG0A 2WR9A 3AP9A 1A3KA 3M3CA 4BQ2A 4OHYA 1DZQA 2ETEA 3HOBA 3N9NA 5BNNB 1WGPA 1VPHA 1DF0A 5J48A 3T4HB 1VB2A 1R1A2 3CO2A 3Q8CA 2D6NA 2CSGA 4LA2A 3VZJA 4DUVA 1VRH1 3ZSJA 1CD3G 1K3IA 2VC9A 2Y6LA 3IDBB 4YM3A 2MEV1 4QU2A 1ASJ2 2WQ8A 4D6RA 1Z0HA 2OXBA 4AGRA 2JE9A 4IL7A 1WWYA 1GICA 4KWKA 3RNSA 3QD6A 2QJVA 3ZR5A 2X5IB 4HT1T 4CA9A 4ET7A 1JYNA 1ZZ8A 1WLDA 2DF7A 5I0TA 4IW3A 1U5XA 3THPA 4KU7A 1CAUA 1RHI3 2WZR3 3WW3A 1PZ7A 2VAUA 1IZ3A 5F2WA 3S7EA 5A70A 2JG8C 4W6XA 2BDRA 3OPZA 1OD3A 4QPIB 1QQP2 5LEKA 1OD5A 1VE0A 3AJYA 3PVOA 1YFYA 1QHDA 5C3QA 2A5ZA 5SV8A 4URAA 5EXOA 2EXHA 2EF6A 2RMU3 1X8EA 2C9AA 2DCYA 5IVBA 3LAGA 3W21A 4CTEA 2QQVA 5A6ZA 4PDWC 2VPVA 2ZKNA 3ZLIA 4S2DA 2Q8DA 3P1IA 4P5HA 4M4PA 5DUWA 1MVQA 1G86A 4RGAA 4BQ4A 4CCDA 2WO2A 3D8CA 5C8WA 2EXJA 4MX3A 5FZOB 4DZGA 1K5MC 4YZ3A 2J22A 1N1SA 1PK6A 1R093 4LKFA 3WF2A 1LGCA 4BPZA 2YXSA 3J4UH 1HDKA 1BK1A 1I5ZA 2DVAA 1TG7A 2OVUA 1LHOA 2ORXA 2RS51 2PHTA 4K20A 4LMFA 3VBHB 5JSOA 2EALA 4XJWA 4Q4W3 3ZFGB 2PAMA 1YI9A 2VZTA 2W95A 2RS13 1EAH3 5FYSA 4Y1XA 1GU3A 3WF4A 2XVGA 3TB0A 3AZXA 5DPNA 5C3PA 1WLWA 3IDEA 2RM21 3CJXA 3PMSA 3GHNA 3ORJA 1WW5A 1G9FA 1SFPA 4IV1C 3S6PA 1H6YA 2IUWA 4GB33 3CJIA 1UAIA 3N9LA 1JZ4A 2PTMA 4INDA 2LALA 4H3WA 4NR1A 1GWMA 4LKDA 4MGQA 1UMZA 3I97A 3THDA 1W6PB 1Y7BA 1NZCA 4TWTA 5FYTA 2XR4A 4AHWA 5B4NA 3MBWA 4LIVA 4LKEA 1A6CA 1RUG2 5T54A 3A21A 4GMP0 4QXCA 5GLWA 2RS33 1VAKA 1GWLA 1MQTA 2E6VA 5CB7A 2JE7A 2WAAA 1XC6A 1RUF1 3AZWA 3NAPB 1RJ8A 2Y6GA 5IATA 1N3OA 4MXVA 4XILA 5LATA 1WW7A 2QQLA 5KWRA 3FWEA 4IV3C 5FP8A 1JYIA 4QQLA 1HRI3 5K7PA 4CDWC 3VZKA 4J25A 4E4HA 2ARXA 1NYWA 1W6QB 5FIXA 1N3PA 3PUHA 4QHBA 2G4IA 4LLOA 5L9BA 3WNOA 3U0ZA 3PUSA 4RFRB 1FV2A 4AOCA 3IKWA 4WM7A 1OQEA 1OOPB 3KT1A 3V0BB 1GQHA 1PO13 4NWVA 1QIQA 4HONA 2G1MA 5FZ6A 1D0HA 2XGXA 2VBDA 5C5TA 3H8OA 2D6MA 5IW0A 1JZ5A 3KCXA 2JJ6A 5C9AB 2V73A 3RJRA 5IK8A 3BTYA 1FAYA 4LBNA 1U12A 4N7IA 2HWE3 2RE9A 1CAWB 3SHRA 1W9TA 4BOWA 2VU9A 1OKOA 3KWVA 3OPWA 4FPEA 4AK3A 3SISA 4META 3DGTA 1JUIA 3UKNA 4BMEA 3ECQA 2JDAA 4AI9A 2DU1A 1W6NB 1SBFA 3ZN6B 5DN2A 5JI9A 1XU1A 3EXUA 3H3ZA 1UYYA 5CEHA 1QJY3 2J1SA 2VMGA 1AL21 2PELA 3ACHA 3Q8FA 2WNUA 1ENRA 3OUHA 2G9FA 4LK7A 4NROA 1XBFA 4I3PA 3PJYA 1V6OA 4CDXB 2J42A 2CYFA 4Q0UA 1RUJ2 2H0BA 1WLCA 2ZGNA 3HQRA 4N53A 4NRMA 1UOFA 4Y20A 4GWJA 1LOFA 3J8F2 3HBKA 1RXGA 3POSA 3WP3A 4BYYA 4DXSA 2IVJA 1LRHA 3ZFFC 3M2MA 3TYJA 1NKGA 1VBA2 1VALA 4HOOA 1TME1 4R8HA 3WP5A 1BEV1 2FCUA 4JGYC 3SQOA 4DS0A 4XFAA 4FXGB 3HBZA 3WDXA 1ND2B 1B35C 1ZBE1 4X6QB 5G05L 1OA3A 5FZHA 2WS93 3I59A 4TYSA 2B7YA 1LECA 1QU0A 2FQPA 3PDQA 4IGQA 4LORA 2FDJA 2BTVC 4R9CA 5CISA 4WZCA 2QBXA 3O1PA 3BTXA 2OPKA 1SLIA 2VTFA 2XBO3 1WCQA 4GWMA 4WV8A 2O1QA 2ZGRA 1ENSA 3SCHA 1QNWA 1OUSA 2WYFA 1NA1B 1CZSA 4Q4V3 4GQ7A 3POGA 3LOIA 3O12A 2O14A 5K9YA 4KG8A 3H8RA 2R32A 4AQTA 1O59A 2CDPA 4I0BA 3QOPA 2ZOEB 1BBT1 3EQEA 4XFHA 1UZYA 1MEC2 2AACA 2YB7A 3J26N 5FMDA 3E5XA 5FY9A 1VRH3 5EIYB 3IDCB 2MEV3 3W59A 4XMAA 4C0HA 5F7UA 1T6BX 1HQNA 3POIA 5CVRA 5BXXA 2VGDA 1SCSA 3RI9A 4WZFA 1EYBA 2W2IA 4CDUA 5F37A 5JUVA 2V09A 2BGOA 2WSUA 3ZYHA 3HPNA 5CA6A 3PUAA 1W8ZA 2R071 1S0EA 5IUQA 3VUOA 5JAXA 2Y26A 1R082 1HQWA 2L9LA 4LJHA 5FPLA 1VBC1 3H1MA 4AVSA 3ZYPA 5C70A 5DG1A 3GBGA 5FWEA 2IXJA 1ZZCA 4QGNA 5EHDA 4FPJA 4CP2A 2VOVA 2F17A 1V70A 1JZ8A 2GH8A 1PO21 2I74A 5CYYA 3ZVXA 4COYA 4LUMA 2ZHLA 3SKJE 1VB4A 1S0GA 1IS6A 1F4AA 2JB8A 2X29A 2BW8A 4QXBA 3N7LA 1PVXA 3D82A 1CZTA 3BOWA 3WR0A 2VY0A 1Q43A 2B5HA 1R1ZA 2AH2A 2CY6A 4FP3A 4LUKA 1RUE2 1IGOA 3VHOA 3WNMA 4EN8B 4Z92B 2QNKA 4QQPA 4AVCA 2Y6HA 2QCSB 4KWJA 3WUDA 3TEWA 3VKLA 2GAUA 1QNYA 4QT6A 4UFJA 1LOAA 3FC0A 4GALA 3S57A 2RS53 4XETA 4X8PA 2VMCA 1COV1 3EBRA 4NN0A 1K45A 2YBSA 5F1RA 2TEPA 5CFDC 5FK8A 1JUHA 3UGFA 1LNSA 1W8TA 3I2HA 5FY8A 3AYEA 1AX2A 4AI2A 5JZGB 2FMYA 2RM23 1WBFA 4LO8A 3ZMNA 3AJZA 5F9TA 1RUI1 5KXEA 3H8XA 5T5OA 3ZIXA 3UESA 1OQDA 2V5DA 4XMIA 4EE2A 1UN1A 5CFCB 4WVVA 1F8VA 1YFWA 4JRLA 1SLLA 2ZACA 5AVPA 1XNBA 5HI0A 5BPXA 3MYXA 1UXXX 2ILMA 1O3RA 3WT3A 4RFT0 2QDNA 1UNBA 4M0NA 4BE3A 1J58A 3HN1A 3AMHA 3OF1A 2BVVA 1UY1A 1DQ4A 4AQ6A 4D7SA 2P3YA 4XUOA 4CPBD 5APAA 1RUF3 1OA4A 1PMHX 1GOFA 4MHRA 1O4TA 2QQOA 2VVEA 3NNJA 2WT0A 5FZBA 3I3QA 1D4M1 2ADDA 4GD4A 3OB8A 3NSTA 4O9EA 5FQ0B 5JIAA 1FPN2 2YYOA 4OMCA 1IHMA 4XURA 5FYIA 3ZFEA 1VIWB 2A3YA 1JOJA 2QKDA 1UOGA 1A34A 1UZVA 1M06G 2NMNA 5F3GA 2BFUL 3IIIA 4JDMA 4B7EA 4CDQB 2A70A 4FTEA 3MGUA 1BQPA 4C1WA 2H0VA 2ARAA 4FBFA 3FLPA 3N9MA 1KS4A 2HWC2 4AEDA 1CESA 1ULPA 3SH3A 4QAWA 3ROUA 2HWF1 2ZGKA 3RDIA 1W99A 5BNNA 1XE8A 3WDUA 1YYNA 4UFKA 3DPRB 2XKOA 2V4VA 4JHTA 5C3SA 5GJ6A 1UIKA 2KXLA 3DV8A 4B4PA 3UJOA 1GWKA 5FMOS 2OQ6A 4YM2A 3TEYA 5EP9A 3WF0A 1QOTA 4A42A 1FMD1 3AP5A 2XMLA 1GZWB 4DXZA 4FPHA 1HRV1 2VZPA 3OGVA 1I6XA 1XYNA 1G9CA 3RZLA 5ABJB 5JXGA 1ULOA 3LDRA 1AL23 4XQ4A 1GZ9A 4YVSA 2Y38A 3T2PA 2RJ2A 3BTZA 2FDFA 4B4QA 3IPVB 5FYCA 5IVCA 3KQ4B 3TRSB 3ELNA 1H4HA 5K8SA 3WZ1A 4AL9A 2XL7A 5JXJA 2WNVC 4C8DA 4COVA 1GYKA 1R1A3 4JKLA 4XCAA 1YJLA 5FV3A 3OYWA 4XJAA 4CEYC 1BYHA 2W94A 2J7MA 3LDBA 5C4WA 3PU3A 5F6KA 2VZOA 3WCRA 1F35A 1ZBA2 1S0JA 1VBB2 4I30A 1SDWA 2HBTA 5FCCA 4AI0A 4DNYA 4CU9A 4Y22B 1Q8PA 3UKTA 2XWJB 3ME2A 2DVFA 1ND3A 3PUIA 2K2SA 4L8QA 5D1IA 4H55A 4V2WA 3VBOC 5J7MA 3L2YA 2EIGA 4YZ2A 1BVVA 3ES1A 1NG0A 4UFIA 1Z78A 4QXKA 5JSPA 5IVEA 3JBG1 5BUVA 1MS5A 4PLMA 1UPSA 3KZ4C 1CAXA 2WA3A 3A4UA 3TNPB 5IFPA 5FWJA 4M3CE 5DDJ2 3R6SA 3H3LA 2ZGTA 3LFMA 3I3BA 2D98A 2HWD1 2JENA 4XDPA 3TN91 3M3QA 5F5AA 3T0DA 2YG0A 2HJIA 4O61A 1FT9A 3D0SA 4K8FA 2W91A 2NP0A 5A6YA 5C33A 5L7OA 3I2GA 1AHSA 2J1UA 3U07A 4OI0A 3MW4A 4EWEA 3IM0A 4XZUG 5FJKA 5KHIA 1XNCA 3SXWA 3ZXLA 1L3JA 1OMIA 2BGCA 2O8QA 3E5UA 2VCAA 4Q4X2 1OHFA 3PMEA 5BNOB 4P9WA 3BB6A 2HH9A 1S4CA 2C1FA 4QX7A 2XLGA 4N7UA 4S2GA 3JD72 4CZSA 2QQWA 3N9PA 5HV4A 4IERA 1AYM1 2WBKA 3ZR6A 2CAVA 1PX4A 4JHZA 2VVFA 3PVBB 1PX3A 3J7MA 3THCA 3WQ0A 1LB2A 2X5IC 1SFNA 4RR3A 3GZAA 1H2MA 4JKKA 4YGDA 1ULFA 3U1XA 4ASMB 1BZWA 1PO23 2DDUA 3NO8A 1PGW2 2QQKA 4H14A 2ZGOA 3S0MA 4LE3A 1DGLA 4QPIC 4C1XA 2Y0IA 4K7JA 1AZDA 3R4SA 4ZHNA 1VRBA 1RUH2 2YPJA 5SV5A 4MVTA 2B8MA 5LA2A 1X9TA 3ZXGA 5F3CA 4YLZA 4BA6A 1YQ8A 2YGLA 3WF3A 1GQGA 4YZ4A 4Q0VA 1RUG3 2WZR1 3VZNA 1O5LA 3WNXA 4EV0A 3D0JA 3R0RA 5A1LA 5AC91 1VJ2A 1COV3 1PMIA 4DXRA 1SDDB 1EUTA 2GMPA 1XYPA 5AVAA 2EAAA 2OUHA 4Q8LA 3WLUA 4D3WA 5HCBA 5CG9A 1WCUA 1GZTA 4CCMA 3VL9A 3VD4A 5I8YA 4AE2A 1APNA 5LCWL 3T4VA 3VBHC 1RUI3 3WNKA 4OHWA 1AR92 1YQ2A 3ZFGC 2W1QA 1W2TA 4XFBA 5GLZA 3HQUA 1PZ8A 2W39A 3GBFA 5FP4A 1OLMA 1Y3TA 1WCDJ 2ZBJA 1ULGA 4N8MA 3AK0A 4LXLA 4CUCA 4S2HA 3GHMA 4P9IA 1R091 1RL3A 4XXPA 1WBLA 3LA7A 1YHFA 3ZSKA 3QH7A 4YARA 2OKXA 4XQWA 3NJXA 3VBFB 1JBCA 1PNFA 2KM2A 2VMDA 2WFF2 3URFA 1H8TA 4JGZB 4NPRA 1GQPA 3A0NA 1DGWA 3BUCA 3EYPA 2A6VA 1MS9A 1EY2A 4GJYA 1GP5A 1JZ7A 3MDPA 2ZHNA 1OH4A 2RS11 2X09A 3SEEA 1OBNA 2ZZQA 1YFUA 3X29B 2HWB1 2VTXJ 4NO4A 3M3IA 2VE1A 2J1VA 4P00B 4E8CA 2FMDA 2IZWA 5I0SA 2B9VA 4BH9A 5FP9A 3TBDA 3U75A 4OYUA 2GSYA 3A23A 3CKHA 5T52A 3AMNA 5KC6A 1RJ7A 2QZ3A 2LRPA 2Q4SA 3E6DA 3I2JA 2PQSA 2W5FA 3NAPC 4QGMA 4MXWA 5LA9A 1RUJ3 3WHUA 3USUA 1HN1A 1WMFA 4WVMA 3GZTB 4NUBA 4D69A 4NMIA 2OZJA 5DQ0A 1J84A 1X33A 1FNYA 3DUIA 4AFCA 5JSRA 1OUXA 5FZIA 2RS31 3GCWA 1ZBA1 1OVPA 3M70A 1K5JA 2PLV2 1OOPC 1ODNA 2XH6A 1KFUL 1J83A 1VAVA 1TMF2 4JZRA 5FY0A 4XHBA 3SH4A 1W3VA 3VBSB 4KI5M 3HEIA 1LHUA 3KF3A 4BJ0A 4BQ5A 1RMU1 5A3TA 1PGL1 3BTAA 1U5YA 1HRV3 2D40A 5C9AC 3QH6A 4A3ZA 3H7YA 3R05A 3RZKA 1DU3D 2XKPA 2ZHMA 4OI4A 4W8JA 5H9SA 5FPXA 1VBD2 2VOWA 4RS5B 3IMMA 1HXS1 1Y4WA 4OUMA 4XF3A 3POJA 4FPGA 4E8DA 4M4RA 2P17A 1DFQA 3Q8EA 4Y5Z0 4TZDA 1WMXA 1Y9GA 1C1LA 4UBGA 5K0UA 2RR11 1RUOA 2D3RA 1WLTA 4QHOA 1MEC3 5F5QA 1W90A 4BIOA 5D21A 4FAHA 3GM8A 5DUUA 1XJAA 5EJZB 4ZZ5A 1RYYA 4Q0PA 1W8HA 3MZHA 2QQNA 4HVOA 3AVRA 4CDXC 1O3TA 1UWWA 1OH3A 1C8M1 2XUEA 3OOXA 4I0WB 2B4KA 1XNDA 4W6WA 4YW2A 1NCRB 1DBNA 4LBQB 4W50A 4XYXA 4F3JA 1S2KA 1QDOA 4RD7A 1DYOA 3MICA 4UF0A 4BM8A 3JZVA 5BNPA 4LULA 3SH5A 2RV9A 3GXUA 1VMHA 4Y3OA 4Q4Y2 2LS6A 3BODA 1CVNA 3OY8B 4P14A 5FLJA 2VL4A 1ND2C 3H1YA 3TN93 3O0VA 3FBYA 5FY4A 1W04A 1VR3A 3AP4A 2ZPXA 2AC1A 2ENRA 3AMPA 2R062 3UK9A 1P8JA 3PLQA 3ACFA 4H7LA 3O14A 4LNVA 4ZS2A 2GH2A 5LA1A 3WDWA 1US3A 3BYWA 2DCJA 4NIGA 2Z79A 1LKNA 5A7PA 5FYMA 3UNPA 1KFXL 4UT5A 1NA1C 5DXDA 2YBKA 1W6OB 2H6BA 1RUD1 2YPDA 3CZJA 2QQUA 2WFPA 3U11A 3T2TA 4MO3M 2JG8A 2KA3A 2WS91 2EXKA 3HNMA 2GMMA 4P9LA 5G04L 4CP0A 5A6QA 5LA0A 3KV6A 2H6CA 2JDMA 5F5CA 1CPNA 3CL1A 2DWRA 1CR7A 5FY7A 3VKNA 3PVEA 3OBRA 4QX2A 1AYM3 2F6BA 2W0XA 2YC2A 5C7GA 5F39A 1I3HA 1EPWA 4E2SA 4DEQA 4XDOA 2LUWA 3DCQA 1SLTA 3APBA 3B02A 3POWA 4IE7A 4PDWA 5J37A 3RMXA 2DUQA 3SCGA 2JXAA 4UW4A 1XNAA 1UU5A 4LBLA 2PHFA 1X8MA 5CAZA 1GNHA 1W03A 1ZX5A 2BERA 5D2AA 1POV3 3O0WA 1BJQA 1K5MA 3N3HA 5F8PA 4COWA 2BYVE 1UY3A 1W3XA 4N43B 3WG3A 1UY4A 1RITA 1R64A 1DG6A 1QWRA 3O0XA 1LGNA 4Q5OA 2RDQA 5FP3A 3SMHA 3BI3A 5J09A 5DZGA 2W08A 1JXNA 3GF6A 4BHPA 5LY1A 2YFZA 3ACIA 2VNOA 1ULEA 3K48A 5JXIA 3MV01 3V65A 5AC93 1QJU1 3PUQA 3NW4A 3WHTA 2G9ZA 3O1OA 2UYAA 4MADA 1WKYA 1UO9A 3DF0A 2SLIA 4KBBA 1H9WA 3EJKA 2CGNA 1WA4A 4K6BA 4QDSA 1OT5A 2CHHA 5EYYA 4OQ8A 4IV1A 3IDAA 4KH9A 3E6BA 1W8NA 4AFAA 1NLSA 4R4ZA 3P3NA 3LGRA 1JHNA 4W4ZA 3I4IA 1Y43B 1DGRA 4N9HA 1TE1B 1TVGA 3HT1A 5K4LA 1PVC2 3WX5A 2CTVA 2TUNA 1O8SA 4QKNA 3ZIWA 1FOD1 3J7HA 2IVIB 2UY9A 4NIAA 3KHBA 3VBRB 1HIXA 3DKQA 5FDBA 4HPKA 1Z7S1 1DQ0A 1JODA 1YEWA 1RUC2 5JZGC 4JQTA 2D6OX 2VW1A 3GNEA 3NNMA 4CEWB 1BMV2 4HKWA 4OULA 2ZGMA 1SFYA 1NXD1 3OEBA 4XAEA 2VZQA 1YIPA 4CCEA 4ASKA 4FTBA 1PM7A 1S0DA 4NPLA 5CFCC 4BLJA 3IMNA 3MLLA 4BXSV 1CWPA 4QU1A 1AR71 2W1SA 4YM0A 3MEPA 1KEXA 1RINA 2PXJA 1US2A 1PZ9A 2PAKA 4IV3A 4MGSA 4GMP1 4OZOA 4CDWA 1V00A 1JI6A 2VMHA 5C8CB 2HWB3 5T5LA 4OFGA 1BK0A 1HV0A 2JDYA 2DFBA 4XVHA 3OD4A 4BQ1A 1ZZBA 2E51A 5I8SA 2XXZA 2G19A 1C5IA 4WM8B 2IXCA 4Q2FA 3JU9A 1RVF2 4H2AA 1W2AX 2BNMA 1C3HA 2GN3A 3LE0A 4FOYA 1AR81 4LITA 2GC0A 5FMCA 2Y0OA 3BIWE 3MUY1 4GH4B 4HLTA 3QACA 1CX4A 5CBLA 3ZN4A 4UOJA 4QM8A 1XSRA 5L19A 1NCQB 1HX6A 4R4XA 4HN0A 4H7MA 1KXGA 4QGLA 3P5BA 1YNAA 4EZ4A 5JOYA 4E9KA 1EV12 1A78A 1Y9QA 4P08A 1KITA 4B4RA 4D7TA 2A71A 1QEXA 1J1LA 1UL9A 1ZBA3 3K75B 1VBB3 2WUHA 3AL6A 1UYZA 2ZEXA 4CDQC 4ES9A 3IBMA 1IQAA 4HKLA 3VGIA 5J96B 3CIHA 5BY5A 1AF9A 4D7YA 1SBEA 2XLFA 3AZYA 1E5IA 1HB2A 5JOWA 1RMU3 1I5PA 2Y64A 4MLOA 1VP6A 4IE4A 2GC1A 1Q3EA 2CWSA 4XF4A 3TEXA 1NQJA 3DPRC 3ILNA 3FN9A 3Q9OA 3V64A 2Z5WA 5IVYA 3ZXDA 1HXS3 4L92A 3W5MA 3O1VA 5A6XA 3KV5A 4JVAA 3SCFA 3V0AA 3UKVA 5DAPA 2QTWB 1GP6A 4IEWA 4G4FA 2D5HA 2RR13 3ZFFA 3TEZA 5H9RA 1Q8QA 1NT0A 4JGYA 5IHRA 1PIV2 1HV1A 1W6MB 3P6BA 3QBQA 4M00A 1B35A 3TNQA 5A32A 5ABJC 2OW4A 3OEAA 4Z1VA 2WZPP 2FBEA 1IPKA 4QPGB 4AI3A 1OA2A 2AYHA 1XNTA 3M3OA 3LSDA 4Q4X3 1UU4A 2LM3A 1C8M3 1H2LA 5CZKA 4ORFA 1W39A 4RQPB 2DFCA 3T30A 4D0QA 3JCIA 3VHNA 3NV3A 4IGOA 4L11A 5FXXA 4PIYA 4B1LA 4Z2WA 4BDVB 2HKXA 5GZFA 2D6KA 1NE6A 2VMEA 1LJ7A 1LOGA 5GZDA 1QJX2 2P5BA 3C7OA 1X7NA 2XJSA 4ES8A 2ADEA 2A73B 3UGHA 5HXMA 2Q30A 4A6OA 2R042 3U14A 1R1A1 3N7KA 4HANA 3MIBA 4HK8A 1JU3A 3AKSA 1ASJ1 1VBE2 1RUD3 4Y5SA 4MGTA 1RUH3 3ILFA 4NOTA 1QOOA 2O8OA 4C0BA 4CP9B 2JG9B 2WQZC 5IVFA 1K12A 4FOVA 2IFRA 4YW7A 5HBAA 1HB3A 3IB3A 4BLIA 1SLBA 4COZA 5FZEA 1OURA 2VZSA 2LROA 1F9KA 5EQUA 3VZMA 4CCLA 5FZ0A 2V72A 2PAEA 3H0OA 4AAPA 1UYPA 3K2OA 1QQP1 4R9AA 1AR62 4NHXA 2WNEA 1CAVA 1S55A 5BNOC 3VV1A 3KT7A 4IEPA 2GP5A 1I1EA 3M7AA 5A33A 2DUPA 2ZJCA 1JZ3A 1HW5A 1MS3A 2B9UA 5A3NA 3J9SA 2QZ2A 1W0PA 2R1BA 2I07B 4ZU4A 4YGBA 5ACA2 1AUYA 3G6JB 5FPUA 2N7GA 1KJRA 4FPOB 4AVAA 1U5IA 5F6LB 1SPPA 3GCXA 3FJSA 2ZGUA 1DIWA 2WZ8A 4P02B 5LZ6A 5EZWA 2WN3A 5B2GB 3MFCA 3AYAA 4HKOA 2OA2A 5CFDA 2A1XA 2WFF3 2VXRA 4HL0A 1QJU3 4PLNA 4JDNA 3HD8B 1TZOA 4JKMA 1C4RA 2J1RA 1NE4A 1VAMA 4OLLA 2WABA 4X8NA 4AI1A 1QJZA 2WRAA 4YVWB 2VOXA 3PIGA 3WDTA 3VBUB 3HN3A 2A3WA 4GKXA 3B9CA 1S0FA 4CCJA 4BISA 5A3UA 3W58A 2EIEA 3NMBA 5JPMB 3O1MA 2XJPA 3HVDA 4LIUA 4PF5A 3RWNA 4Q29A 1DLCA 3WNNA 5A7WA 2RG4A 3DXUA 2CGPA 2B46X 3VD7A 2ATFA 2VUJA 5J1XA 2JDHA 2KR2A 1JYWA 2VG9A 1FOD3 1NQDA 4NIIA 2PFWA 5JOZA 1Z7S3 3ILRA 2MHFA 5FY5A 1T6GC 1WCSA 3HNYM 4HFSA 1L7LA 4ZU7A 3FUOA 4A7KA 3N4MA 4YW1A 1QOSA 1RXFA 4KGQA 1XE7A 1RUG1 4CU8A 5BYNA 4XW3A 2B39A 4HK9A 4EZHA 4LO7A 1OFSA 3VDDA 4BWOA 1LENA 4C90A 4LQRA 3WUCA 2YROA 1UOJA 2PLV3 3NV4A 1AR73 2FCTA 2ZTNA 1QMJA 3AM2A 1UW8A 4GMP3 3WY6A 1H8VA 3B93A 1S2BA 3GJBA 5I93A 1QH7A 1OLRA 3Q8BA 3ALQA 3M1HA 2NQYA 3N9OA 4EN0A 5KXCA 1FI2A 1QXRA 4BCUA 2PHXA 3VBFC 1REEA 5E89A 1MZFA 3LEMA 4JGZC 5A3PA 3RJ2X 1HQLA 1PGSA 1SQ4A 5D8AB 2HLEA 2P4EA 2ZGSA 3C2UA 2CDOA 1AR83 1GV9A 1YUDA 1YC61 3OD0A 4FXKB 2A7AA 4IE5A 4MZUA 4P9JA 4QX8A 2OIIA 3FX3A 3RGBA 4OMDA 3DKWA 3SC7X 3UJQA 1CX1A 1AYN2 1ZRIA 1X9PA 5DMYA 1W9SA 1SEFA 4MV2A 4FAGA 1DQ1A 2PN5A 4QB2A 4RA0A 3A7QA 4DXTA 1PHMA 3FUQA 1LODA 4ATFA 4AVBA 2SBAA 4DY5A 4W6YA 1IKQA 3UL2A 3VLBB 2VBPA 2XJTA 3N35A 4XPVA 4FFIA 4DPNA 2WQ4A 1UX7A 5GZEA 2FCVA 2K9ZA 2Y8KA 4O9GA 4Y1UA 1CAUB 1W0NA 2Z69A 1X82A 4LA3A 4J1XA 2YUEA 1JYXA 2ZAAA 1JOPA 3WXPA 2UY8A 2Q1FA 4ISRA 4IESA 2WNVA 4Q4Y3 4DRVA 3CLPA 3UYJA 1SHWB 1RHI2 2AENA 4HZFA 3MUZ1 2WO3A 4CEYA 2GU9A 5LBFA 1RUJ1 3DECA 3VBSC 4MHUA 1NXMA 5A1AA 3NL1A 4M01A 4UFLA 3FLRA 3ZSEA 3POFA 3J8F1 4EYUA 5KXBA 2YU1A 4CUGA 5C3OA 4P9GA 4XHXA 2RMU2 2P2KA 5TSWA 1VBA1 5FK7A 1STMA 4RS5C 5FYHA 1VBE1 3VBOA 3LF7A 2BBVA 1EP0A 4BXFA 4AEMA 4LBJA 5JDBA 1D0GA 1SACA 1DLLA 4PLOA 5FOJB 3AZVA 1AXZA 1V6JA 3KLSA 1PK6B 3DEMA 5JMCA 2DCTA 3K4AA 5FZGA 2X10A 2ZS6B 1XB9A 1WD3A 3LPGA 4IEUA 3UV9A 4AFBA 4Y33A 2VULA 3OUIA 2BUKA 4EJRA 2HEVF 4M3CA 1CN1A 1V6KA 4XFIA 1GBGA 1N3QA 4JTOA 1LU2A 3OJBA 1REFA 4AXOA 1NCRC 1J1TA 1JMUB 1RIRA 2XVLA 4QKDA 5T3NA 4DY3A 2ZXQA 4UFMA 1O8PA 1YWKA 1WZXA 4Q4W2 5I0RA 2AEYA 1MEC1 2ZCWA 3C3VA 4FOWA 2CGOA 3MLJA 4MSVA 4QDRA 3H9AA 4QQHA 2PHLA 1RB8G 4HSLA 1H1MA 4F7ZA 2E26A 4E2GA 3CJIB 5T5JA 1ASJ3 3S5QA 3C7EA 3AKRA 2Z2SB 3RZJA 2JECA 4XUQA 3OGGA 3WQ1A 2YY1A 2BZDA 2WZEA 4BQXA 4AF9A 1EUUA 4GB32 1QY4A 4A3XA 3ZOIA 4NIHA 2FZ2A 1LGBA 4BU2A 5FOBB 1N1YA 3IZOA 3LSEA 2CL2A 1LULA 2NZ9A 3BOPA 2ZHKA 2X5IA 1QQP3 2XHNA 2HEWF 4WBBA 1MQTB 1R081 1ZYBA 2PYTA 1IS4A 1REDA 3B3QE 3I3DA 2VUDA 4Q0QA 3LQCA 1OPOA 3WW1A 3DYPA 4QPIA 1W2UA 2E53A 1LOEA 4ZZ8A 4OHVA 1LHNA 3M8LA 5FTTC 1G8WA 1OI6A 4XE9A 1MS1A 2EIDA 5F5IA 3ZXEA 3MW3A 4YZ5A 3H7JA 1Q8SA 1OXCA 4FI9A 3A0KA 1ULDA 4FPCA 5DAQA 3WD5A 2GZWA 1QH6A 3OBZA 1H1IA 2LTNA 1LHWA 2DURA 2YZ4A 4P9YA 3LWCA 1HRI2 2W92A 4WM7B 2VCCA 4LPLA 1RUE1 4PBOA 4NVPA 1RUC3 1S0CA 2QQPA 3MFAA 3KD4A 4CUAA 4K40A 4XBLA 3D4KA 2RDSA 2XVKA 1UXZA 1WUVA 1QGLA 2D6LX 2WJSA 4FFGA 4GA9A 2VNVA 3N7JA 1G6NA 3F95A 2JDKA 4XC9A 2A75A 2BQPA 2PMWB 5FZOA 1PO12 5J98B 3OGJA 3CDZB 5CU1A 1BVP1 1NY72 1IKPA 2DTYA 4N43C 2R6QA 4BB3A 4A4AA 2RJKA 4RHV2 2BEOA 3VBHA 2EICA 2JKXA 5IVVA 2P3IA 2WSVA 1S0BA 2BWAA 4D94A 4EN6B 3ZFGA 2BJSA 4OQ9A 5FJHA 2BOIA 2HWE2 4UFHA 4PT6A 2WKKA 1JYVA 2W87A 3AC0A 5FFOC 4BQYA 2ZX1A 1POV1 4HXCA 4TN7A 1UY0A 4A45A 1LAJA 4X6RB 1ZRDA 3T2QA 2CV6A 1AXYA 2WNUB 4G9SB 4B29A 1ENXA 3C7HA 2A6YA 5IJRA 3O1RA 3ZPOA 3U37A 2RDNA 4N53B 4U2AA 1QJY2 4Y20B 1W28A 4TLGA 2P3KA 3IAQA 1W6PA 2XQRA 4LTAA 5CNAA 1AXKA 3AB0A 4AGGA 1VLNA 4YW3A 4CSWA 3OCPA 5GLTA 5E16A 3B94A 1TEIA 4QQOA 1OC1A 4UXAA 3W9AA 3VBRC 3I7DA 4XIKA 4D6QA 1F31A 3I2IA 2YBPA 3WQ7A 3I59B 1L7RA 1UIJA 1MPXA 5FPVA 4E4DX 4D8MA 4CEWC 5ISLA 1FPN1 1W8WA 2CU5A 3KVAA 3T2OA 4MOAA 3HT2A 1KJLA 2P6CA 3NAPA 4OUSA 2UURA 3BN6A 4EN9B 4AW7A 2YDEA 4IEQA 1KS5A 4ARXA 2ORZA 4EN7B 4XF0A 2BPA2 2Y60A 5F3EA 5GM0A 3GGLA 3WNPA 2GMEA 2J1AA 2VJXA 2XBO2 4YG6A 1W6QA 5C8CC 1H4GA 3JQXA 3K51A 3SKVA 4CPBA 1SZBA 2HWC1 4GULA 1C28A 5FZ8A 1O4ZA 4WM8C 4Q4V2 3V0BA 1OOPA 3I54A 5EJ3A 3I2FA 1W8UA 3PURA 4AAXA 4DOUA 1J3QA 1GR3A 5JIUA 4GH4C 4PCRA 1DGWX 2ID4A 4B1MA 4QB6A 2JICA 1VRH2 1NCQC 3ABZA 5C9AA 4HBNA 3VDCA 2MEV2 5KR7A 4N9IA 3T0AA 1J59A 1PMJX 3N7MA 3SITA 3LZZA 4LHSA 3MIEA 4LOTA 4XF9A 1CAWA 2DBIA 4XUNA 4CDUB 4NHLA 3E5QA 3LPFA 4CCKA 3L2HA 4XTPA 1HN0A 3ETPA 3T1LA 4NRQA 4WVZA 5A7OA 1W6NA 3ZN6A 1G7YA 1B09A 4JV4A 1Q8OA 2I45A 2WT1A 3RYRA 1YQCA 4LE4A 4YRDA 2ZGPA 3J8F3 4KGGA 2DUOA 4S2FA 3NRUA 1UPIA 4CDXA 3RMYA 2XWBB 3CHXA 2GC3A 3G7DA 1LHVA 3FFQA 3LEIA 3MF6A 1VBA3 3MF9A 1VBE3 2B45X 2DCKA 1VBB1 3ZYRA 2W1UA 2YHJA 1XNKA 3JUUA 4A7YA 1HJGA 2R16A 4R52A 5A7QA 4G3YC 5C5UA 3CU7A 3PHMA 1SCRA 5ANQA 3WP4A 2IXKA 2UWAA 3AYDA 3LOBA 4DB5A 1ND2A 1O91A 4Y1ZA 1OLME 5FYUA 1AR63 3BGAA 3VDDB 4NAOA 1UD1A 4QPGC 3RZZA 1G9AA 5FZ7A 5DDJ1 2ZGLA 3HNBM 1GFF2 4Z07A 1DDLA 2BBAA 2UYBA 4I2OA 4RQPC 5T55A 4DQAA 3P3PA 3WG2A 1XOYA 1NA1A 1G9BA 3LKJA 1RTVA 3NJZA 4ITCA 4R9BA 2E33A 2NN8A 4COUA 5ACA3 4ZXEA 4RN5A 5I91A 2WAOA 3FHAA 3OGRA 2RM22 1UU6A 4Q4X1 1VMJA 4AHXA 4AFMA 3WV6A 4XFFA 3KB5A 1Q5OA 1W8FA 3WEZA 5BNQA 4E27A 4M0HA 4OHXA 1K42A 2E32A 1V0AA 4W65A 4K9SA 3JD71 2VCMA 1GNYA 4XTMA 1JHJA 1ENQA 1ZA7A 1IPJA 1V6IA 2W9XA 3K3NA 3VHPA 2C4XA 3WP6A 2VVDA 1R083 1NY71 4LHNA 4LHLA 3WNLA 1GNZA 5I8TA 5HCHA 4AQSA 2JG9C 5IVJA 4NRPA 2TNFA 3S7IA 1NLRA 4XJ8A 3AKTA 4XDQA 3TOJA 3VKMA 2D93A 5FPZA 3WVJA 3ZXFA 2PHRA 4CCOA 4NWWA 4ZY9A 2VW0A 2PQQA 3VZLA 2C24A 3SLIA 1F5FA 5FZAA 1RUF2 4XCBA 2VZUA 1PGW1 4OVEA 5FO7B 3ZFEB 1A8MA 4YPJA 5KHGA 4CE8A 4L99A 1FATA 2DVDA 2C5DA 5EFUA 5FZ1A 3VD9A 2XJRA 4GKYA 4AHYA 1RUH1 3RZGA 3K3OA 5A7SA 1RUE3 2JEMA 4AFDA 3BKZA 1NAEA 2AGSA 5KXDA 3I49A 1D7PM 2W68A 3ZXKA 2VH9A 3WCSA 5DZFA 2GNTA 2YU2A 4KU8A 4Y4RA 3I2DA 4AEDB 4OCTA 3EB7A 5FZMA 3K4DA 4AQ2A 4B7KA 1W06A 1MZ5A 1YQ6A 1GOHA 1LR5A 2PA7A 3OBAA 2EAKA 2JIJA 3MPPG 4LBKA 4QQ2A 4AZZA 5A3LA 1F15A 2XQXA 3WDYA 2E31A 4MUVA 2AR6A 1CONA 3QCWA 4JAAA 2RVAA 5FP7A 4CXXA 5DAWA 2AEZA 1CQ9A 4WVWA 5F3IA 1OF4A 2WWSA 2MPFA 3H42B 4LHKA 4FPYA 5IAXA 3I8TA 2WYSA 4QHZA 1AR91 5JZGA 3RS6A 4YVSB 4Z2AA 4YVWC 1F4HA 1GMMA 1OSGA 3VBUC 3OSDA 1AL22 1XYOA 3ZMOA 5FAXA 1DCSA 5CFCA 5A7NA 2E63A 2ET7A 3DYMA 1KRIA 1RC6A 1BHGA 3OYWB 1YXWA 3LA3A 2WFF1 4IDZA 4JCKA 4QPWA 4OHZA 5C4WB 2DYCA 3D6EA 1H1AA 3H1WA 1OPMA 5KBFA 2XPJA 5A3MA 5DG2A 1PM4A 4IGPA 4PJYA 5F2SA 3ON7A 1ND3B 3PL0A 1AVBA 2VO5A 1QKQA 1TME2 2VZ1A 1BEV2 1FPN3 3U10A 2FHRA 3KV9A 2X05A 4Y4YA 2ZX2A 5I0DA 1ZBE2 2OZ6A 2JIGA 3RSJA 4E2QA 5FQ0A 5JR7B 1CAXB 3GDBA 4NHMA 4ISQA 2UU8A 1H0BA 2BU9A 3R4DB 1LEDA 3ZKUA 3NV2A 5DAVA 1O3SA 4QPYA 3CQOA 4OI1A 3INAA 2HWC3 3KGZA 4GIQA 2Q8OA 3UT0A 4CDQA 4ATEA 3LB9A 1MS8A 5FR3A 5L7OB 4SLIA 1WMDA 1GZCA 5D8AC 3WOGA 2BNOA 4YGEA 5FZLA 1BBT2 4A44A 2PLV1 2CAUA 4K1YA 2XUMA 3IN9A 3RZHA 5FBZA 1C57A 1TMF1 1ZZ9A 2VMIA 2D7FA 3DPRA 4UAPA 1UKRA 2J1TA 3K77A 1ZNPA 3HMYA 2QQIA 4OI2A 5FO9B 1YJKA 1UY2A 2BP6A 2E7AA 2GP3A 2ET1A 4V2VA 1QJEA 1ALYA 4YZ1A 3FMGA 1VBD1 2BWCA 2VMFA 3THTA 3VKFC 4MGIE 1PNGA 3AMQA 1GZWA 1GOGA 2FD8A 2R072 2NPIA 4K21A 4RR3B 4I02A 5ABJA 1WCKA 4L9BA 5A3OA 4PBPA 3IPVA 1VBC2 5FKCA 2HEYF 4UBHA 1O7FA 3WINE 2ZEWA 2W52A 3D3AA 4I01A 4DRRA 5LB6A 2P3JA 4B3NA 1E5HA 3KCCA 4LLFA 1PO22 2ARBA 1MZEA 3ZXAC 3ZSMA 1D2SA 2Q5TA 3VDBA 4CUBA 5F32A 3RYKA 1YRZA 3RYPA 4EQVA 4FVVA 5FUNA 4Y22A 4AEKA 1J3RA 3GZUC 2X8KA 1W8OA 2VOTA 2WC2A 3V56A 3MV11 5LBBA 4Q4Y1 3AKQA 5DZEA 5DDJ3 2BOJA 4CXWA 3BU7A 4KMQA 1GANA 1S2EA 1HJFA 2FDGA 2VECA 3AP7A 4UWDA 5FYYA 2BNNA 3AKPA 2R061 1PK6C 1COV2 4LBQD 3OGSA 2JDNA 4QWNA 2OYZA 3ZN5A 3AXEA 5GZCA 1IS3A 2VBBA 4EROA 1CZVA 1OQ1A 2J1EA 3FFZA 1W9WA 2LW8A 5ANNA 1DP0A 1T2XA 1JZ2A 3ST7A 5LRSA 4LOSA 1F2NA 2XJQA 4JTNA 4ASLA 2WT2A 1XQNA 1MACA 3ATGA 3J7LA 2D97A 2JDZA 3POYA 4RGGA 3ZKYA 1RUI2 4Y26A 4Z82A 3UETA 1UZ0A 2XDVA 4V1PA 3EMRA 5FPBA 3BIEA 4IUGA 4Q26A 3EO6A 5FZKA 5HXVA 5T50A 4QB1A 1S0IA 3JD73 3M4FA 5BNOA 3A22A 1ACCA 3BALA 4GAZA 4LKSA 4QX3A 1V9U2 3CJIC 3ETQA 4BQ3A 2IXIA 1IS5A 1H8TB 3JXSA 4GWIA 1W05A 1C5HA 1Q56A 2WA4A 3GJAA 4QM9A 2ZX0A 4RHV3 5E88A 1SG3A 4XFGA 4FQZA 3AX4A 2W1WA 3T1MA 1FX5A 2ARCA 2JD9A 5JXHA 1KGYA 4IE0A 5JPNB 4DMIA 1DZTA 4IEZA 3OBTA 4P5YA 4QMAA 4CVUA 5EPAA 1H2NA 1D4M2 1MQTC 2EXIA 3DYOA 3FHIB 3MHZA 4XF1A 1XRUA 4IXLA 2A6XA 2D5FA 3NNLA 1V6NA 2TBVA 4RSUA 3RI8A 3VD3A 1A8DA 2QUOA 1JTZX 1YIFA 4UW6A 2WO7A 3RWKX 2VUCA 4MXWB 1MVEA 4DIQA 3USUB 4WVMB 1V6MA 1UMHA 1JZ6A 1NZIA 4XXAA 3LD8A 4BMBA 4CCCA 2GN7A 5KHHA 3LEKA 2YC4A 3IT8A 4GXLA 4K3UA 4HVQA 1UYXA 2VQTA 3HAGA 3KVBA 3POBA 2GNMA 3B01A 1XSQA 3BU0A 1FNZA 2WWJA 1GP4A 2XLAA 5E1RA 4WM7C 2HWF2 4ZU5A 1OF3A
chains in the Genus database with same CATH topology
3S30A 4FPFA 1S1AA 3VN4A 2P37A 4PIZA 1OFNA 5LEJA 2XB6C 2DVGA 3JB4C 1GKBA 1AR93 4IEYA 1PVC1 5FREA 4KNCA 3AFGA 1LTEA 5H9PA 4XJ9A 1I9RA 2PHWA 1FMD2 2R0FA 4Q0SA 3ACLA 1HRV2 1DGRN 2XHKA 3BPZA 5CIRA 1RUC1 4JC1A 4HETA 5K0UB 3NVCA 1BMV1 1NOVA 5JLVA 3CEWA 3VHRA 2XG3A 1O5UA 4FTSA 1O4YA 3M3EA 1SLAA 2WNUC 3LCPA 3KSCA 5LK7B 2UWBA 3ZPYA 3JQWA 3VBFA 1YFXA 4N53C 4JGZA 4I3GA 5CG8A 1LOFC 2NLRA 5FLHA 1GLHA 2D3SA 4XBQA 5CADA 2V5YA 5BNPB 1RVF1 2O0OA 4UW5A 3PVNA 3MPBA 3JBG2 2VQ0A 4JRAA 1D2QA 2R49A 1TNRA 2C0ZA 1MS0A 2BFUS 4FT8A 3FZ3A 4LT5A 2HWD2 2E7TA 3TN92 1EV11 2IC1A 4RL7A 3H50A 4A7ZA 5IK7A 1LCLA 4YM1A 1CGPA 3WG4A 3ZO0B 3MI8A 3CF6E 4K1ZA 1TMF3 2JG8B 4NHKA 4AWDA 3WG1A 4A2UA 1ZRCA 5GZGA 3AXDA 3ZYGA 2WLPA 1MZ6A 2XL9A 3VBSA 1ZM1A 1VBD3 5IK4A 2DV9A 2P34A 2QVSB 2VNGA 4PDWB 4EWAA 1G9DA 1AYM2 4MGZE 3JB8A 3KT4A 4RS5A 4CDUC 3TAYA 1PIV1 2R1DA 4Q1PA 5I0UA 1K5MB 4I0AA 2EVXA 2E7QA 5JOXA 1SMVA 2NM1A 2GNDA 3DN7A 4B8EA 3KGLA 5T5PA 2UWCA 4KQ7A 3H8UA 5IK5A 2ZMNA 1KDMA 2Z42A 1JYCA 1V9U1 1NCRA 3KCYA 4LBQA 5AFBA 2ZGQA 1KD7A 2VQAA 4AEJA 3R4UA 4BZ4A 2WZR2 1QJX1 4L2NA 4DFSA 5AC92 2R063 4URTA 1DQ2A 4IV1B 1TNFA 1OKQA 2A6ZA 3OY8A 1AX1A 1QF3A 2R041 3D5OA 5JWPA 2YV8A 2CNAA 3VDDC 4C91A 2ES3A 2D6PA 1XU2A 3ZX7A 1J3PA 1YO8A 2YMZA 2VUAA 1RUNA 2D3PA 4HPKB 1W6OA 3ZYIB 4HSJA 3IWZA 3ASIA 5L36A 1OLQA 4LO6B 1AR61 1RGSA 1JN2P 4AXOA 1R092 2QFEA 1H9PA 5HCFA 4Z8BA 1FV3A 4IEOA 3PTYA 4XIOA 4IV3B 5KHKA 4SBVA 4CDWB 1X50A 3HIFA 1ONAA 4N90A 4PIXA 2K0GA 4M3CF 5GLVA 1C1FA 4YNIA 2ZMKA 4MGYE 4TSVA 4MYEA 2RS12 1EAH2 3MIDA 4QX5A 5ACA1 2QDRA 2HWB2 4U36A 4AHZA 4JQRA 1C8NA 5J3UA 1QXJA 4MH0E 3KQRA 5JCTA 4J6GA 5LRRA 3MIGA 4FPKA 4AI8A 4KG0A 4FOQA 1AL0G 3KM5A 4N43A 3ZFEC 4YW4A 4LO5B 3MW2A 3NKTA 2D44A 4YYOA 1YI7A 2I2SA 1MS4A 3B9IA 1N1VA 4ONUA 4Q1RA 3NKGA 1TME3 2RS32 1BEV3 3O5SA 1O3QA 4AEDC 1FXZA 1ZBE3 1CIWA 1Q8VA 1UF2C 5BNNC 2RJLA 3AFKA 5FRAA 2PHUA 3NWKA 1ZRFA 1PVC3 2VNRA 2WL1A 3N36A 1DYKA 1RMU2 1UZZA 1PGL2 2Q0AA 4FSJA 3V0AB 5DUXA 2ZX4A 3AYCA 2OUJA 4AVTA 3WDVA 2GALA 3ZFFB 1HXS2 2B42B 2HYKA 4JGYB 5CBLA 2AREA 3VBRA 4FP2A 4J1WA 2ZA9A 4Y1VA 2JD4A 1B35B 4XBNA 5A32B 2ZX3A 4YVSC 3WW2A 2DTWA 1BBT3 4XFCA 2RR12 1TQ5A 4CEWA 3L9JT 3B00A 1HKDA 4IEXA 4ZXKA 4F83A 1URXA 2E9QA 2ZZJA 3VL8A 4XOGA 5HCAA 5FMOL 1C8M2 3H3UA 1RVF3 2A6WA 5C4WC 5C8CA 4OZXA 2IWGB 3CNAA 1AJKA 1HLCA 4WM8A 4PQ9A 1ND3C 1H2KA 1LOCA 2R073 3B7MA 2CWMA 4AG4A 3IIAA 1AYN1 1CJDA 4HVRA 1VBC3 1ZREA 4GH4A 1V6LA 2XJVA 5EWSA 1EV13 3U4XA 1LU1A 4LBMA 1AJOA 1NCQA 4QD2A 4ZKTB 2WINB 1CPMA 4IEVA 2R30A 3ZDSA 2D43A 3FLTA 1X36A 1DQ5A 5C6CA 1RUD2 5L7OC 5IT6A 4FCAA 1JH5A 3AP6A 4CP1A 5GALA 1D4VB 4GWNA 2WS92 4LO4B 4XEZA 4YGCA 2R0HA 5FO8B 3VZOA 4YFZA 5KHJA 1RHI1 1CAVB 1WW6A 2IXHA 4YG3A 4YSFA 3HQXA 1YLLA 2YGMA 2DCZA 3USSA 1YCIA 5A33B 3ZSLA 2GDFA 5DUVA 3HWJA 1PIV3 1UKGA 1ZRRA 1POV0 4LEJA 2RMU1 3WW4A 3HR9A 3MIHA 4F8AA 5J36A 2YC0A 2ZAHA 4AGVA 1W6MA 3MIFA 4AVVA 4RR3C 2ZMLA 1XXNA 2MNGA 4QPGA 1KQRA 3EHKA 1V9U3 2ZABA 4XZPA 5CFDB 1N47A 4UW3A 3O7OA 2VOKA 3PNAA 4RQPA 4YW5A 2F4PA 3OTFA 1W0OA 5BV6A 3B69A 1QJX3 1ZZ7A 3E97A 5H9QA 2WLQA 1F5JA 1QJU2 2FZ1A 1U0AA 2X53S 5KC5A 5EYXA 2R043 1LOBA 4Q4W1 1JW6A 3RPQA 1EAH1 3GALA 1D4M3 1MR5A 1WMEA 1SLCA 3FBMA 2PHDA 4AYUA 3PJQA 1FYUA 2AUYA 3KS7A 4GB31 4IETA 1QDCA 1N1TA 4KL1A 1FOD2 4LR4A 2JG9A 2DU0A 4BIFA 1Z7S2 3RQ0A 2VW2A 1UCXA 3B5LB 2ZKLA 2GNBA 4P9XA 5FLIA 2HWF3 4R9DA 5JVVA 4FO9A 1ULCA 2RS52 4HN1A 4EWDA 2A3XA 3ES4A 3VKOA 2ERFA 1BCXA 5L73A 1AR72 1QXPA 2NYYA 2XJUA 1GSLA 1H30A 1EPZA 1H8TC 2GC2A 1AX0A 4TLFA 2G9GA 4XJUA 4KWLA 1FMD3 1E57A 1M4WA 2BVBA 1HRI1 5LK5A 3ENRA 4Q27A 3LA2A 3ZXJA 3AMMA 1AR82 4YFWA 4JDOA 1BXHA 1U5ZA 3ZYJB 2EA7A 2JKBA 1PO11 2IXLA 3GYDA 4CYDA 4RHV1 1WD4A 3GBWA 5JI7A 4MGKE 3TWIA 4Y24A 3DL3A 3E6CC 2HWE1 1LESA 4YVWA 3RG0A 1BKZA 4XQDA 3VBUA 4I09A 2RHPA 2WNVB 5EV7A 4E4ZA 3NV1A 4HMZA 3JBG3 1CJPA 2AZ5A 3SNMA 4CEYB 1QJY1 1LEMA 1ZVFA 2HWD3 4Y1YA 5GKAC 3VBOB 5AFEA 3MLKA 1WW4A 1DZRA 2DVBA 2IFWA 2NMOA 1DQ6A 2JX9A 5K0UC 3AZZA 2Q1MA 3KMHA 1SBDA 5E8AA 4E4SA 2Q1ZB 4LBOA 4Q8KA 1KDKA 4FQ4A 1DYPA 1ZZ6A 3BCWA 3QLQA 1DHKB 4M3CB 1ZA4A 4IQPA 1UX6A 5GLUA 4CRQA 4DINB 4L97A 4XJZA 2XBO1 3RRDA 1AYN3 2WIIB 5D8AA 4FPLA 2QE3A 3FE5A 4Q4V1 5BNPC 1IOAA 4YG0A 3AP9A 1A3KA 3M3CA 1DZQA 2ETEA 1WGPA 1DF0A 5J48A 5F1RA 1VB2A 1R1A2 3CO2A 4LA2A 2D6NA 3VZJA 1VRH1 3ZSJA 1CD3G 3IDBB 4YM3A 2MEV1 4QU2A 1ASJ2 1Z0HA 4AGRA 2JE9A 4IL7A 1GICA 4KWKA 3RNSA 3QD6A 2QJVA 2X5IB 4HT1T 1ZZ8A 1WLDA 2DF7A 5I0TA 1U5XA 3THPA 4KU7A 1CAUA 1RHI3 2WZR3 3WW3A 1PZ7A 1IZ3A 3S7EA 2JG8C 4W6XA 3OPZA 4QPIB 1QQP2 5LEKA 1OD5A 3AJYA 3PVOA 1YFYA 1QHDA 2A5ZA 5SV8A 5EXOA 2EXHA 2EF6A 2RMU3 1X8EA 2C9AA 2DCYA 3LAGA 4CTEA 4PDWC 2VPVA 2ZKNA 4S2DA 4P5HA 5DUWA 1MVQA 1G86A 4RGAA 3D8CA 5C8WA 2EXJA 4MX3A 4DZGA 1K5MC 4YZ3A 1N1SA 1PK6A 1R093 1LGCA 4BPZA 2YXSA 3J4UH 1HDKA 1BK1A 1I5ZA 2DVAA 2OVUA 2RS51 1LHOA 4K20A 3VBHB 2PHTA 5JSOA 2EALA 4XJWA 4Q4W3 3ZFGB 2PAMA 1YI9A 2RS13 1EAH3 4Y1XA 2XVGA 3TB0A 3AZXA 1WLWA 3IDEA 2RM21 3CJXA 3PMSA 3GHNA 1WW5A 1G9FA 3S6PA 4IV1C 4GB33 3CJIA 1UAIA 2PTMA 4INDA 2LALA 4H3WA 4NR1A 1UMZA 1W6PB 1Y7BA 1NZCA 4TWTA 4AHWA 1A6CA 1RUG2 5T54A 4GMP0 5GLWA 2RS33 1VAKA 1MQTA 2E6VA 5CB7A 2JE7A 1RUF1 3AZWA 3NAPB 1RJ8A 1N3OA 4MXVA 4XILA 1WW7A 5KWRA 3FWEA 4IV3C 1JYIA 4QQLA 1HRI3 5K7PA 4CDWC 3VZKA 2ARXA 1NYWA 1W6QB 1N3PA 4QHBA 2G4IA 4LLOA 3U0ZA 1FV2A 3IKWA 4WM7A 1OQEA 1OOPB 3KT1A 3V0BB 1GQHA 1PO13 4NWVA 1D0HA 2XGXA 2D6MA 3KCXA 2JJ6A 5C9AB 2V73A 3RJRA 5IK8A 1FAYA 4LBNA 1U12A 4N7IA 2HWE3 2RE9A 1CAWB 3SHRA 4BOWA 2VU9A 4FPEA 4AK3A 3SISA 4META 3DGTA 1JUIA 3UKNA 4BMEA 3ECQA 2DU1A 1W6NB 1SBFA 3ZN6B 5JI9A 1XU1A 3EXUA 3H3ZA 1QJY3 2VMGA 1AL21 2PELA 2WNUA 1ENRA 2G9FA 4I3PA 3PJYA 1V6OA 4CDXB 2CYFA 4Q0UA 1RUJ2 2H0BA 1WLCA 2ZGNA 4N53A 4Y20A 1LOFA 3J8F2 3POSA 3WP3A 4BYYA 1LRHA 3ZFFC 3M2MA 3TYJA 1VBA2 1VALA 1TME1 4R8HA 3WP5A 1BEV1 4JGYC 4DS0A 4XFAA 4FXGB 3HBZA 3WDXA 1ND2B 1B35C 1ZBE1 4X6QB 1OA3A 2WS93 3I59A 4TYSA 2B7YA 1LECA 1QU0A 2FQPA 2BTVC 4R9CA 4WZCA 2OPKA 1SLIA 2XBO3 4WV8A 4GWMA 2O1QA 2ZGRA 1ENSA 3SCHA 1QNWA 1NA1B 4Q4V3 4GQ7A 3LOIA 3O12A 5K9YA 4KG8A 2R32A 4AQTA 4I0BA 3QOPA 2ZOEB 1BBT1 3EQEA 4XFHA 1UZYA 1MEC2 3J26N 3E5XA 1VRH3 3IDCB 2MEV3 3W59A 4XMAA 4C0HA 1HQNA 5CVRA 5BXXA 2VGDA 1SCSA 3RI9A 4WZFA 1EYBA 4CDUA 2V09A 2WSUA 5CA6A 2R071 1S0EA 5IUQA 3VUOA 5JAXA 2Y26A 1R082 1HQWA 4AVSA 1VBC1 3H1MA 3ZYPA 5DG1A 3GBGA 2IXJA 1ZZCA 4QGNA 4FPJA 4CP2A 2VOVA 1V70A 2GH8A 1PO21 2I74A 3ZVXA 4COYA 4LUMA 2ZHLA 1VB4A 1S0GA 1IS6A 2X29A 2BW8A 3N7LA 1PVXA 3D82A 3BOWA 3WR0A 2VY0A 1Q43A 2B5HA 1R1ZA 2AH2A 2CY6A 4FP3A 4LUKA 1RUE2 1IGOA 3VHOA 4EN8B 4Z92B 2QNKA 4QQPA 4AVCA 2QCSB 4KWJA 3WUDA 3VKLA 2GAUA 1QNYA 4QT6A 1LOAA 3FC0A 4GALA 2RS53 4XETA 4X8PA 3EBRA 1COV1 4NN0A 2TEPA 5CFDC 1JUHA 4AI2A 3AYEA 1AX2A 5JZGB 2FMYA 2RM23 1WBFA 4LO8A 3ZMNA 3AJZA 5F9TA 1RUI1 5KXEA 5T5OA 3ZIXA 1OQDA 4XMIA 1UN1A 5CFCB 4WVVA 1F8VA 1YFWA 4JRLA 1SLLA 2ZACA 5AVPA 1XNBA 5HI0A 5BPXA 3MYXA 2ILMA 1O3RA 3WT3A 4RFT0 2QDNA 4M0NA 4BE3A 1J58A 3HN1A 3AMHA 3OF1A 2BVVA 1DQ4A 4AQ6A 4D7SA 1RUF3 1OA4A 1O4TA 2VVEA 2WT0A 1D4M1 4O9EA 5JIAA 5FQ0B 3NSTA 1FPN2 2YYOA 1IHMA 3ZFEA 1VIWB 2A3YA 1JOJA 2QKDA 1M06G 2NMNA 2BFUL 4CDQB 4JDMA 4B7EA 4FTEA 2A70A 3MGUA 1BQPA 4C1WA 2H0VA 4FBFA 3FLPA 1KS4A 2HWC2 4AEDA 1CESA 3SH3A 3ROUA 2HWF1 2ZGKA 3RDIA 5BNNA 1XE8A 3WDUA 1YYNA 3DPRB 2XKOA 5GJ6A 1UIKA 2KXLA 3DV8A 4B4PA 3UJOA 5FMOS 4YM2A 1QOTA 1FMD1 3AP5A 4DXZA 1GZWB 4FPHA 1HRV1 1I6XA 1XYNA 1G9CA 5ABJB 4XQ4A 1AL23 4YVSA 1GZ9A 2Y38A 4B4QA 3IPVB 3TRSB 3ELNA 1H4HA 5K8SA 3WZ1A 2XL7A 2WNVC 4COVA 1GYKA 1R1A3 1YJLA 3OYWA 4XJAA 4CEYC 1BYHA 5C4WA 5F6KA 3WCRA 1ZBA2 4I30A 1S0JA 1VBB2 5FCCA 1SDWA 4DNYA 4AI0A 4Y22B 1Q8PA 3UKTA 2XWJB 3ME2A 2DVFA 1ND3A 2K2SA 4L8QA 5D1IA 4H55A