2ZGOA

Crystal structure of aal mutant h59q complex with lactose
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLQIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the tumor cell apoptosis-inducing activity of an antitumor lectin from the edible mushroom Agrocybe aegerita
pubmed doi rcsb
source organism Agrocybe aegerita
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
total genus 42
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zgoA00
1SLAA 3I4IA 1F31A 1W6OA 1QOOA 2WSUA 2ZGPA 4HL0A 5H9PA 1A3KA 3OBTA 4LBQB 3BIWE 1ENRA 3WG4A 3FUQA 3GALA 2JDZA 3FBYA 4YW3A 3AP9A 1C1LA 2DVAA 2R49A 2HYKA 1LULA 2B7YA 1W6MA 4BPZA 1S0EA 3MW2A 1GZ9A 2W39A 4JC1A 4XE9A 4DFSA 4LBMA 1WD4A 5E89A 1WUVA 4YGCA 3FUOA 1QU0A 3R4UA 4XJ9A 2WLQA 2E7TA 4WZFA 3UK9A 4PBOA 5EWSA 2A75A 3ZYRA 2WT0A 1N1SA 3AJZA 5CA6A 1HQWA 3VUOA 4YGEA 1KDKA 2ZGTA 3AZZA 3OJBA 4YG3A 1LENA 3PVOA 1AVBA 1FATA 4M01A 3B3QE 3N7LA 4RA0A 5IK5A 2DU0A 4YZ2A 1ONAA 1DFQA 2GN3A 1PZ9A 2ZKNA 1CPNA 1DQ1A 2DUQA 1DYPA 3SLIA 5L73A 1CR7A 4H55A 4KBBA 3ZXKA 2DVDA 3OYWB 2VY0A 3RMXA 1UL9A 1LEDA 4UW4A 2CTVA 2G4IA 1CONA 4LBKA 4ZXKA 3WDVA 1JN2P 5GJ6A 2DYCA 3OBRA 3VV1A 2D3RA 1V6KA 1SBEA 3M3CA 4ITCA 1LU1A 4JCKA 3WHUA 1Q8QA 1V6MA 2R16A 5CNAA 3VKFC 3AFKA 4NOTA 3VKMA 3WDYA 2DUOA 4FVVA 2RHPA 1ZM1A 3AYCA 3OGGA 1QF3A 3AZYA 5FRAA 1Q8VA 1IOAA 1YIFA 1LECA 3OPZA 3WCRA 4OZXA 2ZAAA 5GLTA 2ARBA 2GMEA 4YGDA 3QLQA 2R0FA 1YI7A 2JJ6A 4P9YA 1N3OA 2DTYA 3V0AB 4FP2A 1VAMA 1G8WA 1WW7A 3T2TA 3RS6A 3KM5A 4AVTA 1LEMA 4FPFA 1ZA4A 2E51A 3RRDA 3ZXJA 4IQPA 2NMOA 5DUUA 1LHVA 3A4UA 3M3QA 1FV2A 5DG2A 2I2SA 1LTEA 3B01A 3N7JA 3M3OA 4ZKTB 4MYEA 2OW4A 4HANA 1W0PA 1I3HA 1ULCA 2LALA 3SITA 1LU2A 1DQ4A 3D4KA 2AGSA 3V64A 1KITA 3NWKA 2GMMA 5GLUA 1DQ5A 1LOFA 3R05A 2R1BA 4PQ9A 4ATFA 2UWCA 4ISRA 1SCSA 4AGVA 1PZ8A 4BLJA 1HKDA 4F83A 2GALA 4YLZA 3TAYA 4P9WA 4XTPA 1AF9A 1VALA 5DZEA 4AYUA 1BKZA 2EAKA 4TYSA 3MPPG 2NZ9A 1RINA 3M3EA 3ZXFA 1A78A 1QDOA 1GLHA 3AP7A 2PHRA 2ZA9A 1X50A 1MS4A 4XHXA 1BZWA 3WDXA 2W08A 3N7MA 1QOTA 1AJOA 1U0AA 1MS5A 2ZHLA 3OYWA 2WSVA 2ZGQA 2ARXA 4R9CA 3WUDA 4C1WA 1CVNA 5IK4A 4K21A 3POSA 3RG0A 4AVSA 5T5LA 2AR6A 4GKYA 4TZDA 3NV2A 1N3PA 2R1DA 3SISA 3AYDA 5JOWA 2NM1A 2SLIA 2ZGNA 1MS0A 1GANA 2CWSA 4FPCA 5GZDA 2VH9A 2ZGOA 5T5JA 2V73A 1S1AA 1W6QB 4M3CA 1LOEA 3PMEA 1KRIA 1JW6A 3PVNA 2ZZJA 1AXKA 4Z8BA 5KXEA 3V0AA 4YW1A 3CNAA 2D43A 2P3KA 5HCAA 1JYIA 4XIOA 4R9BA 4UW3A 3ZYPA 3A0KA 1N1YA 4CRQA 1O4YA 4GWMA 3WCSA 3NV4A 1WBLA 1IKPA 2A6WA 5HCBA 1SLIA 1O4ZA 1NLSA 1UX6A 2C9AA 1YXWA 1KJLA 4FPJA 5CBLA 1JUIA 1V6LA 1LESA 3PJQA 1GNZA 2NYYA 1AX1A 1LOCA 1SLTA 1LGBA 3MW3A 2GNMA 2YXSA 3IPVA 5DZFA 4PF5A 5DG1A 2P34A 4LBLA 2OUJA 1CPMA 2YV8A 4RL7A 1G9CA 1G7YA 4XJWA 4YG6A 4GKXA 4DS0A 1V6NA 3D5OA 2PHXA 1ENQA 1CIWA 3FLPA 1MS3A 1D0HA 2Z42A 3WDUA 3V0BA 1N1VA 5GZCA 1DQ2A 1MZ6A 2GNDA 5BYNA 2ZGRA 1IS5A 1S0FA 4BM8A 3AYAA 3N35A 4ASMB 1G9AA 5JDBA 1JOJA 2GNTA 3INAA 4M00A 1B09A 5H9RA 4Y1ZA 4LBOA 1ULDA 2A3XA 4WVWA 1HQLA 1XQNA 1MS9A 3WZ1A 4YFWA 5IK7A 1SCRA 1LJ7A 1QOSA 4Q26A 4XBQA 2H0BA 1DBNA 2E53A 3WG3A 2EXJA 4Q8LA 3WVJA 2D3PA 3DGTA 2ZMKA 4YW2A 2NMNA 4XJUA 3SH3A 1IS3A 1LGCA 4GALA 4L8QA 1LOFC 3L2YA 1SLBA 3N7KA 5GZFA 4GA9A 5H9QA 1AZDA 5SV8A 2JECA 1NXD1 3C2UA 1G9DA 1N3QA 5F5QA 4YW4A 5E8AA 1W6NA 1V00A 2CY6A 1IS6A 1RIRA 3IM0A 4FPEA 4JRAA 1V6OA 2A3YA 2KM2A 2W68A 2CNAA 4XBNA 3FLRA 1N1TA 1TEIA 2XB6C 2ERFA 4ATEA 5T54A 2DVFA 1AXZA 4M3CB 2D6NA 1I1EA 4WV8A 2EXKA 3ATGA 4FOQA 2JD4A 1AX2A 1UPSA 1S0IA 3AP4A 2PELA 1Z78A 2R0HA 1KQRA 1UAIA 3BTAA 1QNYA 5CB7A 3ZSMA 1W6QA 5T50A 1BQPA 1AJKA 1SBFA 2DTWA 2P37A 5DZGA 4K1ZA 2ZGLA 4DRVA 2A6XA 4BMBA 4Y1YA 3AZWA 3ILNA 1SLCA 1GZWA 1JYCA 2GDFA 3AX4A 3VKOA 3ENRA 2UU8A 3U4XA 5F9TA 3IN9A 1UN1A 4Q1PA 1KJRA 1QGLA 3W58A 4FP3A 3O5SA 4AVVA 5GALA 1DZQA 1WD3A 2A7AA 5GLWA 5JVVA 2DVGA 1SBDA 2LTNA 3WG2A 2AREA 5GLZA 4XXPA 3N36A 2CL2A 1Q8SA 1GBGA 1SFYA 5HCFA 1AX0A 4U2AA 2TEPA 2OVUA 2A5ZA 4XOGA 1V6JA 4XIKA 4FPYA 4K20A 4XXAA 5DXDA 3RSJA 4AGRA 4P9XA 4YM0A 4NO4A 4UW5A 1GICA 3ZPYA 3ZVXA 4I30A 1V6IA 1DHKB 3V65A 1VAVA 2E6VA 1D2SA 2AYHA 3LCPA 4YG0A 3USUA 5KXCA 5JOYA 2P3JA 4YFZA 5GLVA 4WVVA 3RMYA 2DV9A 1UMZA 4R9AA 1CJPA 1JXNA 1LGNA 2D6KA 3M2MA 2P3IA 3IPVB 1G9BA 1W6MB 4FPGA 1WBFA 4K1YA 2A6YA 3O12A 2EALA 3WG1A 1VIWB 4XZPA 2EIGA 1G86A 3O0WA 2PHWA 5EYYA 1WCSA 1SACA 1W0OA 1A8DA 2A70A 2ZGUA 1MS8A 1UZZA 2P2KA 1WW5A 4FOYA 2WKKA 3Q9OA 2JE9A 3LSEA 3OY8B 4Y20B 4XILA 1BYHA 2XG3A 2W52A 1LCLA 3T1LA 1DQ0A 1CESA 3AP5A 3WV6A 3AZXA 2ZMNA 1CQ9A 2DURA 5KXBA 1LODA 1C4RA 2VXRA 2DWRA 1OKQA 2GNBA 1WLWA 5T5PA 2VUAA 4YZ1A 3IKWA 4ISQA 4C1XA 2UURA 2A6ZA 2D3SA 1CN1A 2FHRA 3B00A 4XDQA 4Q2FA 3ZSLA 4YM3A 4PCRA 5GZGA 1HLCA 3NV3A 5JOXA 2PHTA 1Y7BA 1LHUA 1EPWA 2PHUA 3AYEA 1JBCA 1FYUA 2EXIA 2AENA 1ULGA 4M3CE 1FAYA 1YRZA 2UWBA 1HDKA 1F9KA 3HMYA 3QCWA 4LBNA 3ILFA 3B9CA 1QNWA 3GNEA 4CZSA 4BMEA 5KXDA 5E88A 3MEPA 4FPKA 3ZXEA 1MVEA 1W6PA 3WLUA 1WW6A 5IUQA 3VKLA 1BJQA 5GZEA 1UKGA 1GZWB 4Y20A 4YM2A 4GWNA 3SNMA 3WDTA 3KQRA 1DQ6A 4Y24A 4Q1RA 5CAZA 5IK8A 1DIWA 3A0NA 3USUB 1DGLA 2EF6A 2DUPA 2ENRA 1VLNA 3RQ0A 2D6OX 4UW6A 3WOGA 1FX5A 2AUYA 1WLCA 4U36A 4LBJA 1LOGA 4FOWA 2A6VA 4BLIA 4BOWA 1YYNA 3MW4A 4AGGA 1R1ZA 3LSDA 3AXEA 1RITA 4Q8KA 3WNXA 3BODA 5JLVA 1LHOA 2ZMLA 4Y1VA 1G9FA 1IS4A 5JMCA 3ASIA 2CYFA 4FPHA 4XMAA 4LBQD 1FNZA 2D7FA 2EXHA 1S0DA 3NV1A 5JOZA 1GYKA 1MR5A 1W6NB 2VU9A 2WT2A 3ZSKA 3JUUA 1IKQA 1W6OB 2BQPA 1H9PA 2ES3A 3HR9A 2PHFA 4YM1A 1S0JA 4YGBA 2WNEA 2WT1A 2YROA 5EXOA 1GSLA 2GN7A 2ZHMA 3ZSJA 1Q56A 3R4SA 3WUCA 3SH4A 3UL2A 3O0VA 4R9DA 3T1MA 5T5OA 2ZGMA 2D44A 4FQZA 2VW1A 1UZYA 4YZ4A 1MACA 1WLDA 2ZBJA 4Y26A 1Q8PA 5GM0A 3ZXLA 3O0XA 1ULEA 2ZGSA 2DU1A 3OY8A 3FLTA 4DQAA 3PVEA 1LOAA 3V0BB 2FMDA 1OFSA 3IMNA 3POWA 5EYXA 1S0CA 3UJQA 1MVQA 4LBQA 3DUIA 4XJZA 3HN1A 3B69A 2D6LX 4FPLA 4Y22B 1H9WA 1JHNA 4YZ5A 2NP0A 2WQZC 2GMPA 1QDCA 4DRRA 1H30A 3BOPA 1SLLA 1S0GA 1YO8A 3ILRA 3WDWA 2VW0A 4Y1XA 2DVBA 5DUXA 2C5DA 3TB0A 5IT6A 2D6MA 2ZACA 4FQ4A 4M3CF 1LOBA 1MS1A 2OUHA 4SLIA 2VW2A 4XMIA 4AWDA 4DPNA 3SH5A 3WHTA 3M1HA 1BXHA 4XYXA 5AVAA 4CTEA 3H0OA 1DYKA 3I8TA 5T55A 1DLLA 1PZ7A 1W6PB 2NN8A 1GZCA 3APBA 4GXLA 1ENSA 1S0BA 4XBLA 1LHNA 1WW4A 3UJOA 5DUWA 1OQ1A 1J1TA 4D69A 2ZGKA 1C1FA 2YZ4A 2UWAA 2JKBA 2A71A 1GV9A 3VKNA 2JE7A 3AZVA 4PBPA 2D6PA 1FV3A 1APNA 1AXYA 2SBAA 4BQ1A 2E7QA 4W65A 2ZHNA 4XJAA 1QMJA 4FPOB 5H9SA 5T52A 2A3WA 2Q5TA 1KDMA 1QKQA 3D6EA 2V5YA 3JU9A 4Q27A 4XJ8A 3AK0A 4Y22A 5FREA 3N3HA 3AJYA 1Z0HA 1MZ5A 2ZABA 4FOVA 3AP6A 2ZHKA 1N47A 2CWMA 1ULFA 1FNYA 4Y1UA 1GKBA 1URXA 2YMZA 1Q8OA 4XTMA 2YY1A 4YZ3A 5LK5A 2WJSA 4YW5A 1LHWA 4XHBA 3FFZA 3AXDA 3POYA 1F5FA 3W59A 4P14A 1C57A 5DUVA 2AH2A 1GNHA
chains in the Genus database with same CATH superfamily
2DCYA 3KB5A 4HN0A 5LEJA 1F31A 1PM7A 1W6OA 1QOOA 3ZYJB 3RZKA 2WSUA 4CPBD 2ZGPA 3I3BA 4EE2A 5IHRA 4LKEA 1VBA1 1A3KA 1AR71 1XNCA 4BIFA 1ENRA 4RGKA 4GB32 2HWE3 3FBYA 4XUTA 5FZBA 5J7MA 1C1LA 4GWJA 5FMCA 2B7YA 4CSWA 1W6MA 5FYIA 5FMOL 2BJSA 2W39A 1PVC1 1DLCA 2JE8A 2ZX4A 4XE9A 4LBMA 4NIGA 5C8CC 1QU0A 4MGSA 1TMF3 1H2NA 1LB2A 1UF2C 4BU2A 4YPJA 2WLQA 3UK9A 1UXXX 2WR9A 3AJZA 2P17A 5CA6A 3I2JA 1GWKA 4Q5OA 3VUOA 2CDPA 1W99A 3MUY1 4IE5A 4K3UA 1F4HA 1STMA 1IG3A 1LENA 5FZFA 1AVBA 4M01A 4YRDA 3H8XA 5F32A 2JENA 2RV9A 5FZHA 5HV0A 4RA0A 5IK5A 1KS5A 1POV3 4YZ2A 4I02A 2VXJA 3WF1A 1FPN2 2ZKLA 1DQ1A 3NAPC 3MF9A 1ZRDA 4D7SA 4P9IA 1DYPA 1JZ2A 4FFIA 4QQLA 2F4LA 3A7QA 3N9QA 4IE0A 3J7NA 4PJYA 4QB2A 4IEOA 5FPLA 1UOFA 4UW4A 3RZMA 2OPKA 3RZHA 1WCDJ 4B3NA 4AE2A 5FWEA 3WDVA 3ELNA 5IWFA 1HX6A 1W8OA 2PAMA 2DYCA 1JYWA 1RJ8A 1QJY3 4QT6A 1RL3A 3N9PA 1V6KA 3MICA 3GZEA 4RS5B 3VD5A 4O61A 5I8SA 4LT5A 1V6MA 2VNVA 4MUVA 1VMJA 4NOTA 4A6SA 5BV6A 2DUOA 5F3CA 2WO2A 3ES1A 5J09A 1FPN1 1R081 4KWJA 1RUC1 3OGGA 1QF3A 2C6SA 5A70A 5IFTA 1LECA 3WCRA 4WM8C 1UU6A 1UZ0A 2ARBA 1H2KA 2XJRA 4YGDA 2KXLA 1YI7A 1RUJ2 2JJ6A 4P9YA 1N3OA 2HBTA 2HKXA 3AMQA 5L7OA 1WW7A 3NNJA 3RS6A 4B7EA 1S4CA 4RQPC 4QPGB 4R4XA 3F95A 1UXZA 2JKXA 1YFYA 4PI0A 4CU7A 2QJVA 2VOVA 3B01A 4XQWA 4ZKTB 4TXWA 4XW3A 4JKMA 5ERLA 4NWWA 4XAEA 1LU2A 4OI4A 3VZMA 2MEV2 4GB31 3ZX7A 2L9LA 1POV1 4OMCA 3ES4A 2GMMA 4GH4C 4HK9A 2R041 3U75A 1WLTA 3I2GA 5GKAC 4L9BA 1OA4A 1VP6A 1Y4WA 2IFWA 3RI9A 4XDOA 2ZOEB 4QGLA 3H1YA 3WNPA 1OF4A 4BLJA 2PTMA 4CEYA 2LS6A 2GALA 5AC93 3U0ZA 3J8F1 3AMPA 1KFUL 2PAKA 2RM22 4JHTA 1AF9A 1OFNA 2ZAHA 3IT8A 3RPQA 1VBE3 1ZNPA 4JV4A 5K0UC 3FHQA 4QX2A 5LA0A 4FTSA 2GSYA 1XSQA 3D0SA 3TN93 3THTA 3MPPG 5JXGA 1D2QA 1RINA 3M3EA 4JQTA 1QDOA 1AYN2 2VQ0A 1X50A 4J1XA 4XHXA 1J83A 3WDXA 2W87A 1QOTA 1AR83 5FPZA 1AJOA 3UETA 5CFDB 5DMYA 1UY0A 3KHBA 1AYN3 5FDBA 4LOTA 1OXCA 4C1WA 3FL7A 1J1LA 4AVSA 5FLIA 5A3LA 3ITQA 5FYTA 1VPHA 1N3PA 2FCTA 3OGRA 3POEA 3CJIB 5A3OA 2XWJB 4MSVA 3WW4A 4COUA 5JOWA 1OA3A 1SQ4A 1TE1B 3BPSA 3M3IA 2FD8A 1UY3A 4N53A 4XFIA 2VULA 1S1AA 4Q0UA 4M3CA 4DUVA 3NAPA 1JW6A 5A7WB 3P6BA 3T0AA 1AR62 1BHGA 1C28A 1D4M3 2ZZJA 3I2IA 3PVNA 1AXKA 1TME1 2GC1A 3I3QA 4Z82A 2E7AA 4Z8BA 5JIUA 5KXEA 3V0AA 4QX1A 2RR11 3ZIWA 2D43A 4XIOA 3NKGA 4R9BA 5ABJA 5HV4A 3VD9A 1SFPA 1ZRIA 2ZXQA 4CRQA 4QKBA 4MG2A 4NPRA 5FBJA 3H1WA 3VD7A 3WCSA 2XVLA 1ZRFA 4PDWC 2Y6FA 2XJTA 4AQ6A 3IBMA 4RFRB 2JDKA 2C9AA 1DGWA 1KJLA 3ACFA 4NHXA 3AC0A 3NAPB 1TMF1 2BWAA 1YQ5A 1GNZA 3U1XA 2BERA 2VAUA 2WS92 3MW3A 2GNMA 2IXIA 4QPWA 2VZUA 5DZFA 1R1A1 2P34A 2V4AA 4LBLA 4FXKB 5CFCB 2YV8A 4NIIA 2IXLA 1VMFA 4XJWA 4ZU4A 3VHNA 1UYXA 4OZOA 2VD7A 3S0MA 2Z42A 3AKQA 1RTVA 1UYPA 3WDUA 3V0BA 1W3VA 3Q8AA 3O1PA 2WFF3 3OD0A 1RMU1 2FCUA 3VZOA 1S0FA 4BM8A 3N35A 1G9AA 3J7HA 5FYUA 3INAA 4NE9A 3FHAA 2QKDA 4Y1ZA 4CCLA 1VB2A 2PHLA 5T3NA 1MS9A 2RDQA 1SCRA 2EAAA 3A22A 3VBUB 1R1A2 3ZYHA 4EV0A 5CZKA 3ZFFB 1S55A 1DBNA 1HRV3 2VZVA 2GH2A 4NPLA 4Q8LA 3DGTA 1RUH1 2BOJA 2NMNA 4H7MA 4XJUA 4LULA 3SH3A 1LGCA 3TEYA 4JVAA 1VB4A 4QM9A 1SLBA 5H9QA 3EYPA 2K0GA 3LA7A 5LW9A 1NXD1 1G9DA 3MGUA 1N3QA 3NQHA 3IAPA 2K46A 3GZTB 4BE3A 2Y6GA 1IS6A 4OUMA 1PVC2 3IM0A 3HWJA 2W68A 2CNAA 1ND3A 4LKFA 4N90A 3FLRA 2I07B 3O14A 4N43B 4FSJA 1AXZA 2GZWA 3K75B 4HETA 3WW2A 2EXKA 4IEWA 4DY3A 4GH4B 2QQLA 3VB9A 4AI8A 1R091 1H1AA 2YHJA 1HJGA 2YG0A 1Z78A 4IV3B 4WM7C 4XUOA 2QQIA 4QXBA 2WS91 1RUC3 1UAIA 1XXNA 4E4HA 1F2NA 1W6QA 2DTWA 3DKQA 5DZGA 3I3MA 4NRMA 1VAKA 4MGQA 3NKTA 3FJSA 4XAAA 3AZWA 3ILNA 1HRI3 2RJKA 1W2OA 5LA2A 5C5TA 2ADDA 4CU8A 5FXZA 2W1SA 3N4MA 2DCJA 2VG9A 5F9TA 1V9U3 3NNMA 3TWIA 1OUSA 1KJRA 1NA1C 4XABA 1F35A 3O5SA 4GD4A 5B4XA 2AACA 5JVVA 2A7AA 1ZBA2 2R30A 1SBDA 2AREA 4ARXA 4BK4A 3J8F3 1SFYA 1TZOA 2BNMA 1JZ3A 3RWNA 4L97A 1SMVA 4TWTA 4DNYA 1YFUA 1JTZX 4K20A 2RM21 1RUH3 4AGRA 1ZBA1 4P9XA 4YM0A 3KV6A 4OI0A 4QDQA 5ANQA 3LCPA 5KXCA 4YG0A 3I49A 3FX3A 5GLVA 4WVVA 5A6ZA 3LE0A 1UIJA 1OURA 4CP9B 4R9AA 1CJPA 3M2MA 3JBG2 1NAEA 1WBFA 4K1YA 3IIIA 2VVEA 2EALA 3J4UH 5E16A 3O1RA 1HJFA 2EIGA 3FHIB 3K4ZA 2BYVE 2PHWA 4LUMA 5EYYA 1SACA 4L2NA 2CDOA 4D6RA 1MS8A 5M0TA 4LLOA 3Q9OA 3W5NA 4PIXA 4E2SA 3TEZA 3RFRA 4EWEA 4UFMA 1BYHA 1J3PA 4YARA 4MHRA 3T1LA 2WFPA 3WW1A 4JGYB 5FUPA 3AZXA 4LO5B 4E2QA 3PHMA 1BK0A 3L2HA 1LODA 4ONUA 5TSWA 3THCA 1OKQA 1WLWA 5F5CA 4I3GA 4JZRA 2HLEA 2VUAA 5T5PA 1GZTA 5FZ4A 3IKWA 4GIQA 3KVAA 4GQ7A 4F7ZA 1CN1A 4QMAA 5FPAA 3B00A 1XE7A 3CMGA 4A3XA 2EIDA 1OQEA 4Q2FA 4EQVA 3VBOA 1GFF2 2R073 4PCRA 4NWVA 3IIAA 3NV3A 4HG6B 1JYNA 1HXS1 1K12A 2PHTA 3H50A 4UFJA 1JBCA 5FPBA 1HB1A 3MPBA 4QB1A 1ULGA 2BRTA 2D5FA 1YRZA 2UWBA 1HDKA 1HRI2 3G7DA 1SHWB 1W06A 3QCWA 3LPFA 3B9CA 1OPOA 5FK7A 5KXDA 5E88A 5FAXA 3NO8A 5ACA1 4C90A 4OLLA 5DABA 3MFAA 4P08A 1WW6A 5CFCC 3VKLA 4MHUA 5GZEA 3R6SA 1ASJ2 2Y8KA 4YM2A 4GWNA 3SNMA 3KQRA 1CAUB 3KHCA 2QZ3A 2XLAA 4CXYA 2W2IA 4QXKA 1KGYA 4A2UA 5IVEA 1JOBA 1PMJX 1VLNA 2D6OX 1US2A 2J1RA 4FXGB 4QPGC 2AUYA 4RR3C 1HV0A 3RQ0A 5DAXA 4LBJA 4ZS2A 2OKXA 4CEYB 2XBO3 3LZZA 2A6VA 4DMIA 3U11A 3MW4A 4CCCA 1R64A 1R1ZA 1RITA 1RUF2 2OS2A 3WNXA 1O7FA 4WM8A 4H3WA 2VMIA 1LHOA 2HWF2 1PO23 3HQUA 3MV11 1UU4A 2GAUA 4LE4A 4XFGA 1E5SA 4Y1VA 2W0XA 3ZDSA 1MEC3 2DFCA 1FMD2 5F8PA 2VR4A 4QGMA 1VBA3 2D7FA 4FFGA 3PNAA 3URFA 1AR93 2WT2A 1NLQA 2Y26A 2BGPA 2Y60A 4X8NA 3BI3A 2VZPA 2TNFA 1W6OB 2BQPA 1ZBE1 2ES3A 5ANNA 4D6SA 2Q4SA 1AYM3 4Z2AA 1H2LA 1AR91 4QB6A 1O6UA 4S2GA 5C4WA 3WSOA 1ZZCA 1BBT3 3SH4A 3HPNA 3O0VA 5DQ0A 1B35C 2HEYF 4Z1VA 3S5AA 4M0NA 4OVEA 2BVVA 2X29A 4FQZA 5FFOC 3GBGA 1MACA 3ZN4A 1U5ZA 2BTVC 1OLRA 2ZBJA 4Y26A 3RNSA 3ZN6B 5GM0A 4KGQA 3O0XA 4PHZA 5JI9A 5CVRA 3ZM8A 2UYBA 4QKDA 3BB6A 3KGZA 1LOAA 3V0BB 2GU9A 4B4RA 3DV8A 5F1RA 5CISA 3TEXA 2RVAA 3RJRA 4LHLA 4Q4X2 1S0CA 4Y3OA 3VBHB 3UJQA 2WZR2 1MVQA 5LBEA 2HWD2 3DUIA 3WINE 3HIFA 2ET7A 5J3UA 4Y22B 1H9WA 4OFGA 1K5JA 3E97A 2NP0A 4MXWA 2R042 5A7OA 3MLKA 4NIDA 5C70A 4TLFA 1NYWA 4Y1XA 1D7PM 2WO1A 2G19A 2Y6LA 3FE5A 5FQ0B 3EBRA 1R1A3 4N7UA 5IW0A 4XMIA 4AWDA 1CZSA 3ZYFA 3SEPA 3SH5A 1RUG1 3WNMA 1EV12 3G6JB 4DPNA 5ABJB 3W5MA 5AVAA 1YCIA 3I8TA 1UPIA 2HWD1 1W6PB 1ENSA 1S0BA 1WW4A 2J1UA 5J96B 5DUWA 5JZGB 5DDJ2 1YQ2A 2DBNA 3IAQA 4BWOA 2YZ4A 3ZPOA 2JE7A 1APNA 2R6QA 1ODNA 2E7QA 5F6LB 5I8YA 5L9VA 4P02B 4AEDC 4GH4A 5GALA 1KDMA 3D6EA 2XWBB 4B8EA 3H8RA 2W1UA 1IPJA 3AK0A 3VDDB 3WP4A 3FBMA 1Z0HA 2ZABA 1R082 3U4SA 1UU5A 2HBUA 1QJU3 3GCXA 3WR0A 3AKRA 3ME2A 4QHOA 1RUJ1 4A7YA 5D2AA 4H14A 1QXJA 4Q0QA 5JI7A 2YMZA 1Q8OA 4LKDA 2JWPA 2G9FA 2YY1A 4GJZA 4IESA 3VBSB 3GGLA 2WJSA 3HN3A 3I2HA 4XHBA 4CEWB 3POYA 3AXDA 1HN0A 3KV5A 5JPMB 1EAH2 2VMFA 1K45A 3S5QA 1PGW1 2PHDA 2Q1ZB 1GOHA 5LATA 1X8EA 1YFWA 2YB7A 4HL0A 1U5YA 4Q4Y2 3ZFFC 4D7TA 4CUCA 2XMLA 4JRLA 1D0GA 5CKNA 3BIWE 3MIHA 1X9PA 2XJVA 3AP9A 2VZQA 3J26N 2DFBA 2IZWA 4NAOA 4XDPA 2FBEA 2HEWF 2R49A 4IE7A 1RUH2 3MW2A 4QXCA 4JC1A 4XCAA 1O3SA 4QU2A 3CO2A 4OI2A 5E89A 1T6GC 3OPWA 1IHMA 4XJ9A 5FUIA 4RHV2 3AFGA 5EWSA 2WT0A 1N1SA 1UZVA 1HQWA 1OLQA 4IEYA 1TNFA 3EQEA 4CP2A 1XOYA 4IXLA 1E57A 1A8MA 3CJXA 2VMGA 3AMNA 4DXRA 1QQP2 4IDZA 3KD4A 3MZHA 1CWPA 2B8MA 4QX0A 1BBT2 5FBZA 2XQXA 1WA4A 3DPRB 2ZKNA 4CDUC 1COV2 1JUHA 1RUOA 4J1WA 3JQXA 1AYM2 3L9JT 5CG9A 1RXFA 3UGFA 4COZA 2FDGA 1J3QA 2VY0A 3OPTA 2PAEA 1UL9A 3POGA 4AQTA 5DDJ1 2CTVA 2G4IA 1TMF2 3ZR6A 1XYPA 4SBVA 5GJ6A 1S2EA 1XPWA 3OBRA 4Y4YA 2D3RA 2JEMA 4HPKB 3T0DA 1SBEA 1TNRA 2VCMA 2VC9A 4EJRA 2VOWA 4ITCA 3IWZA 4JCKA 1W2UA 1Q8QA 2R16A 2XR4A 3GZAA 5CNAA 3AFKA 4P9JA 3VKFC 4D94A 4UFHA 3RZLA 4FVVA 5FYVA 3MF6A 1DU3D 2OPWA 3AZYA 5C3SA 4Q4X1 2VTXJ 4CXWA 3DXUA 3FMGA 5C3PA 3OPZA 5L7OC 4OZXA 2ZAAA 4MZUA 1NE4A 2RDRA 1US3A 3O7OA 1OF3A 2GMEA 3AVRA 4CDXB 4XFFA 5FZ9A 3WY6A 1IGOA 3N9LA 1UY1A 1W03A 4AVCA 1AL21 4COYA 1H2MA 3M7AA 4FPFA 3ZIXA 1W39A 4QHZA 1J84A 3KMHA 3NVCA 5B4NA 4NJ4A 1HW5A 3A4UA 3BALA 5DG2A 1PMIA 3MIBA 2B4KA 1QIQA 1YHFA 2YBKA 4MXVA 4XF1A 3VGIA 3GBWA 4FBFA 5D21A 5FCCA 4MYEA 5FLHA 3LOIA 2LALA 1W8ZA 4I0BA 3SITA 2VTFA 1K5MC 3D4KA 1H8VA 2GC0A 3NWKA 2DCZA 4LK7A 5GLUA 1JS9A 1RUE2 2BWCA 4GMP0 4AEDB 3S6PA 1BVP1 2UWCA 3THPA 1SCSA 2Q0AA 5CKMA 3MUZ1 3TN91 4IV1A 3Q8EA 4XTPA 4BQ3A 4R52A 2P6HA 3TOJA 3ZKUA 1HIXA 3HAGA 1EV11 3RYRA 2WIIB 3PUIA 5DZEA 5K9YA 1OHFA 1BKZA 2EAKA 2IVJA 2F6BA 4A6OA 2VOKA 1V9U2 4K9SA 3ZXFA 5C9AC 2RE9A 2B42B 1GLHA 2B45X 5JZGC 3JZVA 3OTFA 1VBE1 3UNPA 1RUF1 5IVVA 5C71A 2W08A 2JG8A 2WWUA 3OYWA 2ZHLA 3MDPA 2JDAA 2E26A 1KFXL 1CAVB 2ZGQA 3WUDA 2ARXA 5IK4A 3HBKA 4QXHA 3RG0A 1AYM1 4FTBA 2AR6A 4GKYA 1BMV1 3NV2A 2NM1A 2HWD3 1MS0A 2XHNA 3P3NA 4FPCA 3PIJA 4MH0E 1FOD2 1RUI2 2ZGOA 5GZDA 4GAZA 2V73A 5T5JA 5LY2A 3BTYA 1KRIA 3KLSA 2HWF3 3NNFA 4IV3C 1PVXA 5KC5A 1OOPA 4DB5A 1IPKA 3CKHA 5B2GB 3BCWA 1DDLA 5HCAA 1CAUA 1Y9QA 2PYTA 4AI0A 1U12A 3CEWA 4UW3A 4G4FA 3KF5A 2VUJA 1O4YA 4GWMA 4I09A 2AZ5A 1VBB3 2A6WA 3ECQA 4E4DX 2QQKA 5FY9A 5FXXA 3EB7A 1SLIA 1JZ7A 3A21A 4BZ4A 1NLSA 3RI8A 1UX6A 1YXWA 1CAVA 3JB4C 4B1MA 5C5UA 1V6LA 1UX7A 4KU8A 2E63A 2BBVA 3KV9A 1AX1A 1QJX3 4TLGA 1SZBA 3K77A 4BHPA 5DG1A 1JHJA 2J42A 3VBOB 1CPMA 3E6DA 3MI8A 4RL7A 5FY4A 1G7YA 4YG6A 2JDYA 4DS0A 1X9TA 2CHHA 3D5OA 4Y5SA 3UYJA 1RHI1 1F8VA 1JMUB 1N1VA 1W05A 3FFQA 1DQ2A 1MZ6A 2GNDA 5FZ7A 4HZFA 1QJY2 2HH9A 4QKNA 1OKOA 1IS5A 3ZFGC 5A33B 3AYAA 2EIBA 5EJ1B 1HXS3 2GNTA 3GYDA 4HN1A 4M00A 4ORFA 5BNOC 1ULDA 4LQRA 4WVWA 2VQUA 5LASA 3VBRA 4YFWA 4CDXC 1LJ7A 4XBQA 3VN4A 3VBFC 5L9RA 2RS52 1ZRCA 2VZOA 2VVFA 5FYCA 4BK5A 3BVCA 4GALA 1OI6A 1LOFC 3H3ZA 1AR81 2HWB2 3IB3A 3L2YA 3N7KA 2HYXA 4MVTA 5SV8A 3D0JA 4QX5A 4A3ZA 2G1MA 4CDQC 1TME2 5F5QA 4F8AA 4KWUA 4YW4A 1W6NA 3HNYM 4ZU7A 1RB8G 1GOFA 3GZUC 3VBHA 4CP1A 2X53S 2KM2A 4Q4V3 3KF3A 1N1TA 3D82A 2XB6C 4META 2DVFA 3SCHA 1K5MB 2D6NA 1I1EA 2WA4A 4Q4V2 5A7PA 3TEWA 4GZ9A 1BEV1 4XFAA 2WFF2 4CDWB 4HXCA 1GWMA 1ZZ7A 2R0HA 4IEQA 3IDCB 2W92A 1CX4A 1BQPA 3OUJA 2Q8EA 3ZDVA 5C4WB 4O9EA 2PXJA 3RJ2X 1H0BA 2A6XA 4KNCA 4BMBA 3K4DA 2RS53 1GZWA 4PQQA 1ASJ1 2GDFA 4RGGA 4X8PA 2GP3A 4RQPA 1QWRA 1UN1A 5FPVA 5C9AB 2HWC3 3HBZA 2UY9A 3NJYA 4PIYA 3GHMA 3W58A 4AVVA 2ARAA 3LF7A 1JU3A 3N9NA 1DZRA 4RFT0 3GJAA 2FCVA 5BNOA 2JXAA 2TUNA 3JBG1 4XXPA 3NNGA 4DXTA 1SEFA 3LIGA 4URTA 2W46A 3LPGA 5BNNA 2JIGA 1A6CA 2TEPA 4HMZA 2XHKA 2G9ZA 2D97A 3SKJE 3BU0A 1EPZA 4BQ2A 1POV0 2QZ2A 4FPYA 4Q4W3 4N53B 1NCRB 1MEC2 3RZGA 4LEJA 1D4M2 2QQJA 4A45A 3WXPA 3ZVXA 1P8JA 3ETPA 4FO9A 3MV01 2Q30A 4I30A 3OB8A 3WF4A 4DXSA 3K48A 1VAVA 2E6VA 4URAA 4BYYA 5JOYA 4YFZA 3AL5A 3K3NA 3RMYA 4RQPB 5FZ6A 2LUWA 5FV3A 1BCXA 4O7XA 3UKNA 1ZZ8A 2Y38A 1DGWX 3OGVA 3SC7X 4ARYA 2XVGA 4UBGA 1G86A 4FFFA 5J37A 5HI0A 1A8DA 2A70A 2RS32 2ZGUA 4FAHA 3OD4A 1UZZA 3UKTA 5I93A 2JDUA 3KZ4C 1NZIA 1W28A 3E6CC 2FDKA 3LSEA 4LLFA 2Z4FA 3OY8B 4Y20B 3MLLA 3SXWA 3OSDA 4UAPA 2XKPA 5A32A 1LCLA 1YEWA 5CIRA 1CESA 3AP5A 3JQWA 2BPA2 2BVBA 5KXBA 4Q0SA 1HRV1 2CAVA 2GH8A 2DWRA 3A23A 3UGHA 3VD3A 1JH5A 3WP3A 4LE3A 4YZ1A 2VL4A 4C1XA 4CDXA 1X8MA 2ID4A 4UYBA 1XE8A 2C24A 4YM3A 4D7YA 2VMEA 4L0PA 1UYYA 2WNOA 3POBA 1AHSA 4IUGA 4NRQA 2F17A 1COV3 5JOXA 1VBC1 2WL1A 2PHUA 4QWNA 4PLNA 5BNOB 1J3RA 1FYUA 3ZMOA 1FAYA 3HMYA 1AR82 1NE6A 2HWB1 4LBNA 4J6GA 5HBAA 3W21A 3GNEA 2OQ6A 5I0DA 2C1FA 1RUE1 3JCIA 4WBBA 4XUNA 3ZXEA 3WLUA 4ET7A 1R093 1UKGA 4P9GA 3IDEA 4P14A 1GZWB 4AI2A 1JZ6A 4Z92B 4AEJA 1DQ6A 5ABJC 4Q1RA 2XBO1 4AW7A 2VQAA 5EJ3A 2PQQA 1WCQA 3A0NA 3ROUA 1DGLA 2EF6A 2A1XA 2ENRA 4O65A 1S2BA 1RUJ3 2FDIA 3D8CA 1MQTA 2ZJCA 4UW6A 2WBKA 1QXRA 4LIUA 2ARCA 1MQTC 1Q43A 3AL6A 3WP5A 2VNOA 3VL8A 2ZS6B 4NHYA 3LSDA 4Q8KA 4MADA 4CCEA 2BBAA 3ZFEA 4AI9A 1H8TC 4HKWA 1GP6A 1Z7S3 2WZEA 3LD8A 5JLVA 4JX0A 5CG8A 1G9FA 4GB33 3ASIA 4MV2A 1NKGA 2WZ8A 1RUG2 4XMAA 3WEZA 5C8CA 4QGNA 1EAH3 4HONA 3NV1A 4R4ZA 3ZXDA 2QQMA 3I59B 5FZKA 4KGGA 3ZSKA 3JUUA 4HK8A 3S30A 2D93A 4AOCA 2Y0OA 2V72A 3J8F2 1ENXA 1H9PA 3C7OA 3H42B 3DF0A 3H8UA 5G05L 4AHXA 2IXJA 3OUIA 4QKFA 4B7KA 5BNNC 3O1TA 3AMMA 2WT1A 5EXOA 1ODMA 1X82A 4QQPA 3I2OA 3R4SA 3VBRC 5T5OA 1ZBE2 2RR12 5I0RA 3B94A 4EYUA 1UZYA 1QY4A 1WLDA 4YZ4A 4IEVA 1BVVA 3T4VA 3ZXLA 4LOSA 4F3JA 1ULEA 2DU1A 3DN7A 3FLTA 5FY1A 4DQAA 3PVEA 4QQHA 2FMDA 1W2AX 4BQXA 2O8OA 1ZA7A 3POWA 4INDA 2XUEA 2ADEA 4BJ0A 3DL3A 1BMV2 2JB8A 1ND3C 1VRH2 1HB3A 5JWPA 3B69A 4EN6B 3B5LB 4LTAA 4YZ5A 1ND2B 3ETQA 5IVBA 2YPDA 1QDCA 2VZTA 2VBDA 4AI1A 3CZUA 5JIAA 1S0GA 3ILRA 4AVAA 2R043 5DUXA 3JD71 4N43A 2C5DA 4Z2WA 2D6MA 1E5HA 1HB2A 4HFSA 5LRRA 4NVPA 1MS1A 3HJRA 4KH9A 3VHRA 1PO12 3QH6A 4QAWA 4XC9A 2VZ1A 1XU2A 4N53C 3PL0A 3M1HA 1BXHA 3MBWA 3H0OA 1DYKA 5JPNB 3CQOA 2X10A 1C5HA 2NN8A 5FKCA 4GXLA 1Q5OA 4XBLA 3UJOA 1CX1A 4RR3B 1J1TA 5F5AA 2ZGKA 4WM7B 5FXWA 1C1FA 4NN0A 1GV9A 3VKNA 5IYYA 2D5HA 2D6PA 3MO4A 2SBAA 4OHXA 4AFBA 1PHMA 4W65A 5FP9A 4CDWA 1QMJA 4FPOB 1Z7S2 4RS5A 3WQBA 1U5XA 1VR3A 1QKQA 2A3WA 3JU9A 2V5YA 3LEKA 4KBZA 4Y22A 1KD7A 5LY1A 3RYPA 4LHNA 4LR4A 4C8DA 4AFDA 4FOVA 4AFCA 4BQ4A 1GNYA 2BFUL 1N47A 5EHDA 4E8DA 2RS31 1YQ6A 2RDNA 4I0WB 4QX3A 1GKBA 1PK6C 4YZ3A 1VRH1 1IPSA 2WS93 4LMFA 1HB4A 5I8TA 2XVKA 5JAXA 2BNOA 3W59A 3JXSA 5CFCA 3W9AA 4PDWA 5DUVA 2UYAA 3E6BA 1NQJA 5FZ0A 1FMD3 1GR3A 2RS13 1CAXA 4XQ4A 5C3OA 5JR7B 2YGMA 1IG0A 1L7RA 2QTWB 2V5DA 2R063 3AMHA 4ZZ8A 3WG4A 3FUQA 4YW3A 4N9IA 2HEVF 2ZTNA 3KWVA 4M0HA 2DVAA 5FTTC 2HYKA 1LULA 2IXKA 1JU4A 4COVA 1FOD3 1RUI3 1S0EA 3CU7A 4BPZA 1GZ9A 3PTYA 5CU1A 5F3GA 1EY2A 1WUVA 4YGCA 2Q8OA 3FUOA 5J98B 3VZJA 2ZEZA 3V56A 2BGCA 2E7TA 4WZFA 4OQ8A 4UFKA 3B9IA 1LR5A 1W2NA 2RMU2 4KU7A 1V9U1 4PT6A 4AFAA 2ZGTA 3AZZA 4NR1A 2ZX2A 5G04L 4NMIA 4YG3A 4D3WA 3PVOA 4XFHA 3HNMA 1RUD3 1FATA 2HWE2 3B3QE 3N7LA 4PDWB 4JGZA 2P5BA 4MX3A 2YFZA 3VBFA 1ONAA 3P5BA 5A1FA 3KSCA 2GN3A 2X09A 1PM4A 2X5IC 3J9SA 5F5IA 4QPIB 5IATA 1LRHA 2VBBA 3OEAA 3I59A 1QH6A 5KHHA 2DVDA 3RMXA 4YVSA 4BXFA 4ASLA 5AC91 4G3YC 1FXZA 1NX9A 2KD7A 2Z2SB 1C8NA 4DUWA 3GJBA 4ZXKA 1JN2P 2ZX1A 2TBVA 1O8SA 2Y64A 4AG4A 3VV1A 1W8HA 1OOPB 2YU1A 3Q8CA 2V4VA 4IE6A 5FO7B 2W91A 3M3CA 3H1MA 5FYSA 1LU1A 3WHUA 1TG7A 4CCJA 3ORJA 1XNDA 4IV1C 3WDYA 1MZFA 4M4PA 1UIKA 1ZM1A 3AYCA 2YYOA 4BQWA 2ETEA 4Y33A 5FRAA 3RVHA 5EQUA 4Q4Y3 1RXGA 1GMMA 2O1QA 1JODA 2BEOA 2MEV3 4QDRA 3PUHA 2WNVC 2WABA 3QLQA 2R0FA 2VO5A 4HT1T 3V0AB 4FP2A 4RSUA 5FZ8A 5A6XA 1UWWA 1EAH1 4S2DA 3CIHA 2JG8B 3T2TA 1LEMA 4E2GA 4CEWC 5JMOA 3NL1A 3GBFA 3UGGA 3RRDA 2PMWB 3ZXJA 4IQPA 2MEV1 3LGRA 3CDZB 1LHVA 4IV3A 5DUUA 1FV2A 1ULPA 2VBPA 4CXXA 4HVQA 5FO9B 1JYTA 2I2SA 1LTEA 3THDA 1REFA 4ZU5A 4QX8A 4KG0A 3M3OA 1RUE3 2OW4A 1W0PA 3PIGA 3N9MA 1ND3B 1NA1B 2WA3A 2LM3A 4NIAA 2ORXA 5JSOA 2AGSA 5D8AC 3V64A 1E5RA 3VLBB 2WO7A 4FTEA 4ZPIA 1DQ5A 3QACA 3UKVA 3R05A 4Q4W2 4LNVA 3KGLA 5DDJ3 4UI9L 5K4LA 4LUKA 1Y43B 3ZFGB 4NIHA 2BDRA 3PLQA 4ISRA 1YJLA 4DOUA 1HKDA 4WVMA 1HV1A 2H6BA 4YLZA 1V0AA 3TAYA 1T6BX 4P9WA 4GMP3 4LO8A 2EVXA 5LRSA 1XU1A 2VCAA 4OULA 2ZEWA 1QHDA 3U14A 3LAGA 2XLFA 3ZFEC 4Q0VA 1VALA 4DIQA 5FYYA 1PIV1 5JXIA 3VBFB 2B39A 2NZ9A 3O1UA 4CVUA 4CUGA 5FOJB 1OUXA 1W8WA 2OX0A 1A78A 2RR13 3ACIA 3HNBM 2E9QA 3AKTA 2HWC1 5LA1A 2ZA9A 3ZYBA 3GDBA 5KC6A 3N7MA 5JSRA 1PNGA 2GP5A 1U0AA 3VBSA 1OMIA 3SCGA 4MOAA 1VBC2 5KWRA 4R9CA 4K21A 5T5LA 1I6XA 4C91A 4CP0A 3T09A 4TZDA 3TBDA 2R1DA 2VQTA 3ZN6A 3BIEA 2OT7A 4AR2A 2JDHA 1NT0A 3AYDA 2J1AA 2ZGNA 2DF7A 3WNOA 5FYZA 1PVC3 3CHXA 4K6BA 5BNQA 2VH9A 4Z07A 1SDDB 3S57A 1REEA 2PLV1 4FT8A 4CDWC 2DCKA 1W6QB 2W47A 3ZN5A 1OD5A 5JCTA 2OZ6A 1PX4A 4HSLA 1EUTA 1MQTB 1UOBA 1UY2A 4RYDA 2Q8DA 1RVF3 1ST8A 2IWGB 4AQSA 3LDKA 2RDSA 1CAXB 1IZ3A 3CNAA 1JZ5A 3O1VA 2I74A 5BNPC 3E5UA 3ZYPA 3A0KA 4XPVA 3CJIA 5FZ3A 3LB9A 4NUBA 5HCBA 4D0QA 3OEBA 1ZZ6A 2BZDA 4Q4V1 3RZZA 2DCTA 4W6XA 1YI9A 5CBLA 4R8HA 4LO4B 1VBA2 3OOXA 1Y9GA 1LOCA 1XRUA 1LGBA 2YBSA 1SPPB 3IPVA 4AHYA 2BUKA 2OUJA 4AEKA 1RUG3 5KHIA 1D4M1 4GKXA 1V6NA 4HLTA 2PHXA 1S2KA 1CIWA 1UNBA 3FLPA 1D0HA 2E31A 2W95A 3U37A 2C0ZA 2JX9A 4HSJA 5BYNA 2YUEA 2W9XA 5EZWA 2NLRA 1JOJA 1B09A 5H9RA 1GQGA 4W50A 3T2PA 2A3XA 2QFEA 1EV13 1HQLA 1XQNA 5FMOS 3WZ1A 4BA6A 5IK7A 1UMIA 4Q26A 5LB6A 1AUYA 3J7LA 1NA1A 2WN2A 1DF0A 3K3OA 3DYMA 2E53A 3WG3A 4K8RB 2EXJA 3MFCA 1I5PA 4BDVB 2D3PA 3WQ7A 1R092 2ZMKA 4C0HA 3POFA 1RHI2 1PO13 1KS4A 2V09A 1QJU2 5F3IA 3FN9A 4RS5C 2JD9A 1FPN3 1SFNA 2Y6HA 1XYNA 2BW8A 4GWIA 4QHBA 5A33A 4QX7A 1D4VB 1V00A 4IETA 5E1RA 4AL9A 5FPUA 2YU2A 2Z79A 4UT5A 3AVSA 4CEYC 1TEIA 4FFHA 4XCBA 4TSVA 3EMRA 4ATEA 5IVJA 4M3CB 4UFIA 5JUVA 3AM2A 3I97A 5I0SA 2AEZA 1DG6A 3TYJA 4FOQA 4CA9A 2HWE1 2JD4A 1AX2A 1UPSA 1S0IA 1YWKA 3HQXA 3NW4A 3RDIA 4QPGA 1ASJ3 4IEZA 2PA7A 3SCFA 3O1OA 2MHFA 3WD5A 3ZFFA 1W9TA 1VE0A 5T50A 1AJKA 1RC6A 1SBFA 1RHI3 3EHKA 4LO7A 3ZOIA 1OD3A 1X36A 2ZGLA 3MHZA 3HOBA 3NRUA 1SLCA 1K42A 2QE3A 5K0UB 1JYCA 1ZBE3 3K2OA 3AX4A 2N7GA 3U4XA 2UU8A 4PLOA 5ISLA 3IN9A 3POIA 4Q1PA 2NQYA 4XFCA 1QGLA 4QDSA 3ACGA 3HD8B 5D8AB 3BUCA 1DZQA 3WNLA 4ZONA 5GLWA 1B35B 2CU5A 4Q0PA 2LTNA 4RGAA 1EUUA 1G6NA 3DCQA 5GLZA 1WCUA 3WG2A 2CL2A 1O4TA 4MXWB 1GBGA 4K40A 4N7IA 3B93A 4RHV3 2LRPA 4MGZE 3VBOC 2JG9B 1VBD2 2OVUA 3HT2A 2A5ZA 1ZX5A 1W9FA 4UXAA 4K7JA 4OHWA 1NG0A 2YDEA 4XIKA 4XXAA 3RSJA 5C9AA 1C8M1 4AK3A 2QQPA 3S7EA 3ZPYA 2VCCA 1F15A 3WNKA 5ACA3 4KI5M 5LZ6A 5A3TA 1OPMA 5D8AA 3V65A 4AQ2A 4KMQA 1CGPA 2VOXA 3KS7A 4JGZC 3USUA 3H8OA 3PU3A 3HQRA 5A3WA 2KR2A 4YSFA 2DV9A 2WC2A 1UMZA 1ZBA3 2QDNA 1LGNA 2D6KA 5K0UA 2P3IA 2QNKA 3IPVB 2VZ3A 4YW7A 1W6MB 5A6QA 2XONA 1W3XA 2A6YA 2R071 3O12A 4I3PA 4CCMA 4DINB 5HXMA 2XJUA 5J48A 2XUMA 1VIWB 3LEMA 4A7ZA 5DAWA 1WCSA 3W20A 1W0OA 1XB9A 4NHMA 4B4PA 2JDMA 1WW5A 2BP6A 2P2KA 2WKKA 3B02A 4FOYA 5FZOA 1AL23 2JE9A 4ES8A 3UT0A 1PO22 2LW8A 2XG3A 1XSRA 1DQ0A 2Z69A 2P4EA 4BIOA 2ZMNA 2X05A 2JB4A 5HXVA 2YC0A 5IVYA 2VXRA 4Q4X3 1UOGA 2GNBA 2WZR1 1OH4A 5CFDA 4YWAA 3H7JA 3BU7A 1EYBA 1HQNA 4NRPA 2PLV3 3DXTA 3ZSLA 1LNSA 3I7DA 2DDUA 2WWSA 5A1AA 3KT7A 5HCHA 2WAAA 5GZGA 1HLCA 3ABZA 4XF0A 3GM8A 4MLOA 1LHUA 2OZJA 1EPWA 2IXCA 2VZSA 4AAXA 4EWDA 5C4WC 2AENA 3NJVA 4JDNA 5JSPA 1BK1A 3ILFA 4HVRA 4CZSA 4I0AA 3U10A 1BEV3 3MEPA 1MVEA 2D40A 4K8FA 2Z5WA 5IUQA 4AVBA 2WNVB 1O3TA 3WDTA 4Y20A 5A3UA 4Y24A 1C5IA 2R072 3JBG3 5F2WA 5FY0A 3ZO0B 5EJZB 2JDNA 5IK8A 3TRSB 2WN3A 3IDAA 2WYFA 2WZR3 2DUPA 1PX3A 2BNNA 5EP9A 5FO8B 3WOGA 1FX5A 1OT5A 1WLCA 4S2HA 3R0RA 4RR3A 1ZZBA 4U36A 4N43C 3MIEA 4FOWA 4WVMB 4BOWA 3LFIA 2Q1MA 2RG4A 1QEXA 4OUSA 4MGTA 3AXEA 4E8CA 2E33A 1C8M2 3BODA 5BPXA 5KHKA 5APAA 2ZMLA 4HKOA 4DUXA 1VBD3 2XJQA 4E27A 4FPHA 2CYFA 5FYHA 1NCQB 4UWDA 1FNZA 2QCSB 2R061 3CZJA 3LA2A 2EXHA 4BXSV 2RJLA 1XNAA 1GYKA 2VU9A 2WINB 1YUDA 1W0NA 4YVWA 1WMXA 3JB8A 2VJXA 3VHPA 4HVOA 5C7GA 5A3MA 1QJZA 3C3VA 2B46X 4YGBA 3WQ0A 4TN7A 4A7KA 3K51A 2YROA 3POJA 2GN7A 4ZZ5A 1O5LA 1F4AA 1Q56A 4LORA 1UZWA 2CSGA 4EWAA 5BY5A 5K7PA 3FC0A 2ZGMA 3X29B 2WQ8A 1AR63 1Q8PA 2G9GA 1QXPA 2D98A 4I01A 2ZCWA 3SQOA 2K9ZA 3BGAA 3OY8A 5FLJA 1JYXA 4CCNA 5FIXA 1GWLA 4GJYA 5FPXA 3ALQA 1RJ7A 3IMNA 3I3EA 3KVBA 4OMDA 5C8CB 4UOJA 5DN2A 4G9SB 2IFRA 4CYDA 4LBQA 5L9BA 1PGL2 5FJKA 4JGZB 3H3LA 3HN1A 2D6LX 2JICA 2XJPA 2ZX3A 1WGPA 2W1QA 4JQRA 3KCXA 1H8TA 5FZMA 4DRRA 2FZ1A 1NQDA 3BOPA 2HWF1 1YO8A 4KQ7A 5IAXA 2XH6A 1BBT1 1HRI1 3VZNA 2VMDA 3LIHA 4FQ4A 2ZACA 4M3CF 1LOBA 4L92A 4XF9A 3SEEA 2OUHA 1RMU2 1Y9MA 1QQP3 3SHRA 4IW3A 5F3EA 3WHTA 5T55A 1WZXA 1PZ7A 1ND2A 1GZCA 4LHKA 4RHV1 1OQ1A 3LFMA 3PTRB 4C0BA 3PUQA 5DPNA 4NROA 4JGYC 2FDJA 5LWBA 3N9OA 2JKBA 3EJKA 5FY7A 3AZVA 4PBPA 5D1IA 1AXYA 3LOBA 2ZZQA 2Y6KA 3K46A 4JKLA 3OBZA 5CADA 1C8M3 4IL7A 1SDWA 1RUD1 4PIZA 4NHKA 4XJ8A 5FOBB 3OG2A 1QJEA 4E4SA 3E1F1 3N3HA 2YFUA 4HBNA 2WNUB 1MZ5A 5FZ1A 2KA3A 3DECA 4CCDA 3T2OA 3MYXA 2CWMA 2BGOA 1W9YA 4IGPA 3ZMNA 2DBIA 4Y1UA 4A4AA 4XTMA 4P9LA 5FY5A 1ZRRA 5LK5A 1UMHA 4YW5A 2CGNA 1LHWA 4AI3A 1W90A 3FFZA 1F5FA 4N9HA 4RD7A 2WYSA 3PVBB 3VL9A 1IQDC 5FP3A 1C57A 1OLMA 5AC92 2XL7A 1SLAA 5FWJA 2XL9A 3I4IA 2RS51 5FR3A 1REDA 2P6CA 5L36A 5H9PA 3OBTA 5A3NA 4LBQB 5CEHA 3GALA 3KT1A 2JDZA 3Q8BA 2FDHA 1RUC2 2RS11 2B5HA 5C33A 4H2AA 3ZXGA 5SV5A 3BN6A 3QOPA 4BQ5A 2PLV2 4DFSA 1WD4A 4OHYA 5C3QA 4XACA 3R4UA 2C9KA 2C4XA 4J25A 4PBOA 3RZJA 2A75A 2AEYA 1H4GA 1XNKA 3C7GA 3ZYRA 1W04A 3WQ1A 4LHSA 4YGEA 1UO9A 1KDKA 3ZFEB 2J22A 3WNNA 1CAWA 3OJBA 4CDQA 2Q1FA 4OQ9A 4HPKA 4MO3M 4ES9A 3FZ3A 1BEV2 2VCBA 2ZEXA 2DU0A 2X5IA 3QBQA 1DFQA 4QQOA 1PZ9A 1RUD2 4XVHA 5LCWL 1CPNA 5IAVA 2IC1A 4ZHNA 2H0VA 3NMBA 2DUQA 4QQ2A 3GF6A 3SLIA 5L73A 1CR7A 4H55A 4KBBA 3ZXKA 3DKWA 3OYWB 2RM23 4BQYA 4WVZA 3DPRA 1LEDA 1DGRN 2MPFA 1CONA 4LBKA 5IJRA 1XBFA 2W5FA 4XUQA 2BFUS 4W6YA 3C7FA 1NCQC 3IZOA 4BCUA 2CGOA 1WCKA 4YW6A 1LKNA 3E5XA 1ACCA 1VRBA 3JD73 5A7QA 4OI1A 3VDBA 3VKMA 5ACA2 1WA6X 1OBNA 4NPMA 2WQ4A 3Q8FA 4ASKA 2RHPA 2VVDA 4DO0A 2LROA 2BV4A 3NJXA 5FKBA 1RUF3 3UV9A 2IXHA 4OHZA 3OBAA 1PO21 3HEIA 3VD4A 1W8FA 1Q8VA 1OSGA 1IOAA 1YIFA 2R7EB 2FQPA 2RS33 2VTXA 3F2ZA 4PI2A 2XBO2 4DEVA 5GLTA 1ZVFA 3QD6A 4YVSB 1PK6B 4UF0B 4XFBA 2DTYA 1UCXA 1VAMA 1G8WA 1VJ2A 5BXXA 4QPIA 3KM5A 4AVTA 2ILMA 1ZA4A 2E51A 1L7QA 2EA7A 2Y33A 4RN5A 4CPBA 2NMOA 4W4ZA 3M3QA 3VZLA 2E32A 4JAAA 4CE8A 3S7IA 2QUOA 1RMU3 5F37A 2PQSA 3ZYGA 3PURA 4LPLA 3N7JA 1XNTA 4V1PA 3WX5A 4HANA 2QQWA 1GP4A 1PGSA 1I3HA 1ULCA 3RGBA 3VBHC 3M4FA 1DQ4A 5FMDA 1DGRA 4QU1A 2X8KA 3CBNA 1KITA 4A44A 1HN1A 2P3YA 1LOFA 4L11A 5BNPA 2J1SA 2BOIA 1WKYA 2R1BA 4PQ9A 4ATFA 1GOGA 1PMHX 4LXLA 4BH9A 2OIIA 3JD72 1PZ8A 4M4RA 5I0UA 3VDDC 4AGVA 4F83A 2XDVA 4HOOA 5BNNB 1NCRC 2QBXA 4P5YA 2JIJA 2VOTA 3PMSA 4KWKA 5I0TA 2W3JA 3U78A 5DAQA 4AYUA 1J58A 2PFWA 4E4ZA 3VBRB 4EN9B 4EN8B 1DCSA 4ZY9A 5A6YA 4TYSA 1YNAA 1FOD1 1RUI1 3IMMA 3VDCA 5BUVA 3T08A 3AP7A 2PHRA 4CUAA 4KWLA 1MS4A 2O0OA 1BZWA 3LWCA 1GQHA 1GU3A 3PUSA 4XQDA 2VNGA 2Y0IA 2VM9A 1O3RA 1MS5A 1OVPA 1YFXA 4CP9A 2C26A 5LEKA 2WSVA 1J59A 3HVDA 1CVNA 3LA3A 2IVIB 3POSA 1XYOA 1RGSA 1OVSA 3SISA 1H6XA 2K2SA 2WNUC 3H9AA 3O1MA 2XKOA 3DYPA 4IGQA 2SLIA 4QM8A 2FMYA 3R4DB 5EFUA 4FCAA 1GANA 2CWSA 3T0BA 2XLGA 3VHOA 3T2QA 1LOEA 3PMEA 4L99A 1POQA 2O14A 3ZKYA 2OXBA 4NAMA 1VBB1 2HWB3 1VBC3 5A3PA 5C6CA 1VMHA 2IUWA 3KCCA 4X6RB 4YW1A 1PK6A 1QJU1 2P3KA 4UF0A 4W6WA 2BU9A 1JYIA 1AL22 4EZ4A 3NNLA 1N1YA 2CAUA 2YPJA 2H6CA 3NV4A 1WBLA 3PU8A 1IKPA 4COWA 1O4ZA 1YJKA 3DPRC 1NY71 5FP8A 4FPJA 3WT3A 1JUIA 2VPVA 1AL0G 2CV6A 2XPJA 1LESA 2RJ2A 1H1IA 3OGJA 2NYYA 1NCRA 3PJQA 3PUAA 1SLTA 4CCKA 1CD3G 4B29A 4JDOA 1AR92 2YXSA 4PF5A 4E9KA 4AXOA 2WFF1 5DAVA 2VE1A 1G9CA 1RVF2 1NXMA 3H3UA 1AYN1 1ENQA 3OF1A 4DZGA 1MZEA 1MS3A 1OC1A 1O5UA 2QQUA 5GZCA 4OYUA 1JZ4A 2GC3A 3I3DA 4LA3A 5JZGA 2ET1A 3E5QA 5CKQA 1W8TA 1YC61 2ZGRA 4AHZA 5KHJA 3VDAA 2Q8CA 2WNUA 4KG8A 4LK6A 4ASMB 5JDBA 3USSA 5FZAA 4CDUB 1COV1 2WO3A 4LBOA 5FZDA 3LDRA 2QDRA 2VZRA 3LQCA 3ON7A 4CU6A 4UFLA 5FZOB 4DEQA 1QQP1 1QOSA 1E5IA 2H0BA 2XQRA 5AVPA 2F4PA 3P3PA 4CUBA 5C3RA 3ZXAC 4XF3A 4D8MA 3WVJA 2FZ2A 2JDPA 4YW2A 2VECA 3P1IA 1IS3A 5FYMA 1NOVA 4L8QA 5GZFA 4GA9A 1AZDA 3EO6A 5EIYB 3ZR5A 2JECA 5AFEA 1O3QA 3C2UA 4LA2A 1OLME 1K5MA 2YC4A 5E8AA 4JDMA 1HRV2 4LITA 2CY6A 3D3AA 1EP0A 1PNFA 1RIRA 2RMU3 2Y34A 1UD1A 2ORZA 1V6OA 2A3YA 3CLPA 3NJZA 1PIV3 4FPEA 4JRAA 4LJHA 4QPYA 3WF2A 1GUIA 5K8SA 2ERFA 3BOWA 2VNRA 3GXUA 4WZCA 5T54A 5A32B 3ST7A 4TTGA 3EXUA 1O8PA 1H8TB 4WV8A 2OYZA 2YC2A 5FZEA 2J7MA 3ATGA 4JHZA 3AP4A 1YLLA 2PELA 1KQRA 1TME3 1RUNA 3BTAA 3OCPA 4WM7A 4LO6B 4XUPA 1QNYA 5CB7A 3ZSMA 4PLMA 2P37A 4JTNA 4K1ZA 1OA2A 4MGKE 4DRVA 4W8JA 1XC6A 1U5IA 4Y1YA 3KCYA 1JYVA 3TNQA 3SKVA 3I2DA 2WUHA 3VKOA 1OH3A 4GULA 1WWYA 3ENRA 2XGXA 3LKJA 1FI2A 4CEWA 4AAPA 5A80A 1Q3EA 3O1SA 1IQAA 1ND2C 3C8XA 4FP3A 1UYZA 1VBE2 1XE0A 3OGSA 1WD3A 1VRH3 1MEC1 2DVGA 3MIGA 1T2XA 5FP4A 3C7EA 3N36A 1Q8SA 2AC1A 5JXHA 3GHNA 5J36A 2QQNA 4IV1B 5HCFA 1M4WA 1AX0A 1H4HA 1OQDA 1PGW2 4U2AA 5KHGA 5KR7A 1PO11 2MNGA 4XOGA 2CGPA 3QH7A 1V6JA 1WMDA 2WDBA 3GCWA 2Y6JA 5DXDA 2QVSB 3B7MA 4AEDA 5A1LA 4JTOA 4JKKA 3KQ4B 3NSTA 4N8MA 4NO4A 4UW5A 3BKZA 3SMHA 1GICA 4YVWB 2VMCA 1AR72 4V2VA 1V6IA 1DHKB 2R32A 4XETA 5F2SA 1D2SA 2AYHA 3PDQA 1VBD1 5LBBA 2R062 4CCOA 2P3JA 2EIEA 3WF0A 1JXNA 2RS12 2QQOA 1G9BA 2B9VA 1O91A 2WRAA 4FPGA 3WG1A 2W94A 4FI9A 1NLRA 4XZPA 5DAPA 4IE4A 4OUEA 3O0WA 2ATFA 3HT1A 3AKSA 5AFBA 1UKRA 1ALYA 1JZ8A 1F5JA 3I2KA 4DXZA 1KXGA 4YYOA 4MGIE 1V70A 2VUCA 4B4QA 3T3YA 4XILA 3TN92 1ZREA 2WNVA 5C8WA 2W52A 4OCTA 3C7HA 3ZFGA 1AR61 1YQCA 1UY4A 3J7MA 1TQ5A 2NPIA 3AB0A 1CQ9A 2DURA 3WF3A 2J1TA 3WV6A 1UW8A 1NZCA 1C4RA 5LA9A 5I91A 4LIVA 1I9RA 3ZSEA 4ISQA 2UURA 3DEMA 2A6ZA 2D3SA 2FHRA 4IGOA 4JGYA 4MGYE 1GQPA 5IVFA 4XDQA 3RWKX 4DY5A 4IERA 5JR2A 1QJY1 4A42A 5CYYA 1KEXA 2OQ7A 5FZIA 3LEGA 1Y7BA 5F39A 5LBCA 3K4AA 5KBFA 3AYEA 2EXIA 5FZGA 1NUKA 4M3CE 5A7NA 4PF1A 4P5HA 4AEMA 3ACHA 1F9KA 1CZTA 1QNWA 2P1BA 4BMEA 4CU9A 4HKLA 4CDUA 3DYOA 5L7OB 4FPKA 1W6PA 4AFMA 1YQ8A 1BJQA 3M8LA 3CJIC 5EPAA 1FMD1 1XNBA 5IVCA 1RYYA 3MIFA 1H1MA 5CAZA 4ZXEA 1CAWB 1ZYBA 4CDQB 1M06G 1DIWA 4XBNA 1W9WA 3USUB 1QJX1 4O9GA 2WZPP 3I54A 5FK8A 4KL1A 2X5IB 1C3HA 2JG9C 5FUNA 1WMFA 1LOGA 1WMEA 4IEPA 1W2TA 1PIV2 5EV7A 5FP7A 3VBUA 4BLIA 1YYNA 1W8NA 1JI6A 4AGGA 1PGL1 4LKSA 1XJAA 3I2FA 2WAOA 1L3JA 2JG9A 5BNPB 3ZYIB 2O8QA 2ZEYA 1IS4A 5JMCA 3MIDA 4LBQD 1I5ZA 2XJSA 1S0DA 5JOZA 5FZCA 1GP5A 1MR5A 1W6NB 3BTXA 2ZX0A 3VBSC 4AHWA 4OHVA 1IKQA 1NY72 3KT4A 3LEIA 4X6QB 3HR9A 2PHFA 4YM1A 5FMBA 1S0JA 2W1WA 2WNEA 3BTZA 4QPIC 4S2FA 1HXS2 2PN5A 2XOMA 1GSLA 1R083 5FZLA 1X7NA 2ZHMA 1X33A 2I45A 3ZSJA 4EZHA 4Y5Z0 3WUCA 3UL2A 4R9DA 3T1MA 3H7YA 3T30A 4V2WA 4EROA 3BPZA 2XXZA 1SG3A 2D44A 2VW1A 1ULOA 4B1LA 1Z7S1 1OOPC 4IEXA 3WW3A 2ZGSA 2FDFA 5FY8A 4XEZA 1YIPA 2HJIA 1OFSA 3PJYA 1JOPA 1QJX2 4GMP1 1NCQA 5EYXA 3VBUC 4BISA 3AKPA 5FXVA 3RYKA 4FAGA 3ACLA 4A41A 5A7WA 1DZTA 4XJZA 3U07A 5L19A 4WM8B 2B9UA 2J1EA 4FPLA 4Q4Y1 2GC2A 1JHNA 2VGDA 2UY8A 3VDDA 2OA2A 2WQZC 1FT9A 3WP6A 1K3IA 2GMPA 4XF4A 5IFPA 4NHLA 1H30A 5J1XA 1SLLA 2JG8C 2VW0A 2DVBA 2EICA 2YGLA 4Y4RA 1CJDA 1RVF1 5FYBA 3TB0A 5IT6A 4YNIA 1H6YA 4ZS3A 1Y3TA 3OUHA 4SLIA 5A7SA 2VW2A 1O59A 1ZZ9A 5FJHA 5HPOA 3KV4A 3MLJA 3T4HB 3TNPB 1W8UA 4XYXA 4H7LA 4IEUA 5E6HA 2VUDA 4CTEA 1DLLA 5F7UA 4XURA 4YVWC 5LBFA 2WWJA 2YBPA 3APBA 5FQ0A 1UQXA 3WDWA 5LK7B 1LHNA 4D69A 4P00B 4D6QA 2WLPA 1DYOA 2UWAA 2A71A 4I2OA 4UBHA 5CFDC 1FV3A 1AR73 4BQ1A 4Q4W1 3CF6E 4XJAA 2ZHNA 2RMU1 1MPXA 1W9SA 3BYWA 2Q5TA 5H9SA 1CZVA 5T52A 4Q27A 4AF9A 3FWEA 1QH7A 1SPPA 5FREA 3ZLIA 3AJYA 1DP0A 3LDBA 1BLZA 1TVGA 2ZHKA 3AP6A 4Q29A 1QJFA 1ULFA 4Y5TA 4EN7B 4YVSC 1B35A 1FNYA 1L7LA 4EN0A 1URXA 3IDBB 2QQVA 3CL1A 4BB3A 4QD2A 5JXJA 1LAJA 4AZZA 3UESA 1CIYA 3M70A 2A73B 2HWC2 5F6KA 2J1VA 4XZUG 1VBB2 3VZKA 2ZPXA 1A34A 1UOJA 2VMHA 2AH2A 1GNHA
chains in the Genus database with same CATH topology
2DCYA 3KB5A 4HN0A 5LEJA 1F31A 1PM7A 1W6OA 1QOOA 3ZYJB 2WSUA 2ZGPA 1VBA1 1A3KA 1AR71 1XNCA 4BIFA 1ENRA 4GB32 2HWE3 3FBYA 5J7MA 1C1LA 2B7YA 1W6MA 5FMOL 2W39A 1PVC1 2ZX4A 4XE9A 4LBMA 5C8CC 1QU0A 1LB2A 1TMF3 1H2NA 1UF2C 2WLQA 3UK9A 3AJZA 2P17A 5CA6A 3VUOA 4K3UA 1LENA 1AVBA 4M01A 4YRDA 2JENA 4RA0A 5IK5A 1KS5A 1POV3 4YZ2A 4I02A 1FPN2 2ZKLA 1DQ1A 3NAPC 3MF9A 1ZRDA 4D7SA 4P9IA 1DYPA 4QQLA 4PJYA 4IEOA 4UW4A 2OPKA 1WCDJ 4B3NA 4AE2A 3WDVA 3ELNA 1HX6A 2PAMA 2DYCA 1RJ8A 1QJY3 4QT6A 1RL3A 4RS5B 1V6KA 3MICA 5I8SA 4LT5A 1V6MA 4NOTA 4MUVA 5BV6A 2DUOA 3ES1A 5J09A 1FPN1 1R081 4KWJA 1RUC1 3OGGA 1QF3A 1LECA 3WCRA 4WM8C 1UU6A 2ARBA 1H2KA 2XJRA 4YGDA 2KXLA 1YI7A 1RUJ2 2JJ6A 4P9YA 1N3OA 2HKXA 3AMQA 5L7OA 1WW7A 3RS6A 4B7EA 4RQPC 4QPGB 4R4XA 1YFYA 2QJVA 2VOVA 3B01A 4XQWA 4ZKTB 4XW3A 4NWWA 1LU2A 4OI4A 3VZMA 2MEV2 4GB31 3ZX7A 1POV1 3ES4A 2GMMA 4GH4C 4HK9A 2R041 1WLTA 5GKAC 4L9BA 1OA4A 1VP6A 2IFWA 3RI9A 2ZOEB 4QGLA 3H1YA 4BLJA 2PTMA 4CEYA 2GALA 5AC93 3U0ZA 3J8F1 3AMPA 1KFUL 2PAKA 2RM22 1AF9A 1OFNA 2ZAHA 3IT8A 3RPQA 1VBE3 1ZNPA 4JV4A 5K0UC 4FTSA 2GSYA 3D0SA 3TN93 3THTA 3MPPG 1D2QA 1RINA 3M3EA 1QDOA 1AYN2 2VQ0A 1X50A 4J1XA 4XHXA 3WDXA 1QOTA 1AR83 5FPZA 1AJOA 5CFDB 5FDBA 1AYN3 4C1WA 1J1LA 4AVSA 5FLIA 5A3LA 1N3PA 3WW4A 3CJIB 4COUA 2XWJB 4MSVA 5JOWA 1OA3A 1SQ4A 1TE1B 3M3IA 4N53A 4XFIA 2VULA 1S1AA 4Q0UA 4M3CA 3NAPA 1JW6A 1AR62 1D4M3 1C28A 3PVNA 2ZZJA 1AXKA 1TME1 2GC1A 4Z82A 2E7AA 4Z8BA 5JIUA 5KXEA 3V0AA 2RR11 3ZIWA 2D43A 4XIOA 3NKGA 4R9BA 5ABJA 4CRQA 4NPRA 3WCSA 3H1WA 2XVLA 1ZRFA 4PDWC 2XJTA 4AQ6A 3IBMA 2C9AA 1DGWA 1KJLA 3NAPB 1TMF1 2BWAA 1GNZA 2WS92 3MW3A 2GNMA 2IXIA 5DZFA 1R1A1 2P34A 4LBLA 4FXKB 5CFCB 2YV8A 2IXLA 4XJWA 4ZU4A 3VHNA 3S0MA 2Z42A 3AKQA 1RTVA 3WDUA 3V0BA 2WFF3 3OD0A 1RMU1 3VZOA 1S0FA 4BM8A 3N35A 1G9AA 3INAA 2QKDA 4Y1ZA 1VB2A 2PHLA 5T3NA 1MS9A 1SCRA 2EAAA 3VBUB 4EV0A 1R1A2 3ZFFB 1S55A 1DBNA 1HRV3 2GH2A 4Q8LA 3DGTA 1RUH1 2NMNA 4H7MA 4XJUA 3SH3A 4LULA 1LGCA 4JVAA 1VB4A 4QM9A 1SLBA 5H9QA 2K0GA 3LA7A 1NXD1 1G9DA 3MGUA 1N3QA 3GZTB 4BE3A 1IS6A 4OUMA 1PVC2 3IM0A 3HWJA 2W68A 2CNAA 1ND3A 4N90A 3FLRA 2I07B 3O14A 4N43B 4FSJA 1AXZA 2GZWA 4HETA 3WW2A 2EXKA 4IEWA 4DY3A 4GH4B 4AI8A 1R091 1H1AA 2YHJA 4WM7C 1Z78A 4IV3B 2WS91 1RUC3 1UAIA 1XXNA 1F2NA 1W6QA 2DTWA 5DZGA 1VAKA 3NKTA 3FJSA 3AZWA 3ILNA 1HRI3 2RJKA 3N4MA 2DCJA 2VG9A 5F9TA 1V9U3 3TWIA 1KJRA 1NA1C 3O5SA 5JVVA 2A7AA 1ZBA2 2R30A 1SBDA 2AREA 3J8F3 1SFYA 2BNMA 3RWNA 4L97A 1SMVA 4TWTA 4DNYA 1YFUA 1JTZX 4K20A 2RM21 1RUH3 4AGRA 1ZBA1 4P9XA 4YM0A 4OI0A 3LCPA 5KXCA 4YG0A 3FX3A 5GLVA 4WVVA 1UIJA 4R9AA 1CJPA 3M2MA 3JBG2 1WBFA 4K1YA 2VVEA 2EALA 3J4UH 5E16A 2EIGA 3FHIB 4LUMA 2BYVE 2PHWA 5EYYA 1SACA 4L2NA 1MS8A 4LLOA 3Q9OA 4PIXA 4E2SA 4EWEA 1BYHA 1J3PA 4YARA 3T1LA 2WFPA 3WW1A 4JGYB 4E2QA 3AZXA 4LO5B 3PHMA 3L2HA 1LODA 4ONUA 5TSWA 1OKQA 1WLWA 4I3GA 5T5PA 2VUAA 3IKWA 4GIQA 4GQ7A 4F7ZA 1CN1A 4QMAA 3B00A 1XE7A 4A3XA 1OQEA 4Q2FA 3VBOA 1GFF2 2R073 4PCRA 4NWVA 3IIAA 3NV3A 1HXS1 2PHTA 3H50A 1JBCA 3MPBA 1ULGA 2D5FA 1YRZA 2UWBA 1HDKA 1HRI2 3G7DA 3QCWA 3B9CA 1OPOA 5KXDA 5E88A 5FAXA 3NO8A 5ACA1 4C90A 4OLLA 3MFAA 1WW6A 5CFCC 3VKLA 5GZEA 3R6SA 1ASJ2 4YM2A 4GWNA 3SNMA 3KQRA 1CAUB 2QZ3A 2XLAA 4QXKA 4A2UA 1VLNA 4RR3C 2D6OX 4FXGB 4QPGC 3RQ0A 2AUYA 1HV0A 4LBJA 4DMIA 4CEYB 2XBO3 3LZZA 2A6VA 3U11A 3MW4A 1R1ZA 1RITA 1RUF2 3WNXA 1O7FA 4WM8A 4H3WA 2VMIA 1LHOA 2HWF2 1PO23 4XFGA 1UU4A 2GAUA 4LE4A 4Y1VA 2W0XA 3ZDSA 1MEC3 2DFCA 1FMD2 4QGMA 1VBA3 2D7FA 3PNAA 3URFA 1AR93 2WT2A 2Y26A 4X8NA 2TNFA 1W6OB 2BQPA 1ZBE1 2ES3A 2Q4SA 1AYM3 1H2LA 1AR91 4S2GA 5C4WA 1ZZCA 1BBT3 3SH4A 3O0VA 1B35C 2HEYF 4Z1VA 4M0NA 4OVEA 2BVVA 2X29A 4FQZA 5FFOC 3GBGA 1MACA 3ZN4A 1U5ZA 2BTVC 1OLRA 2ZBJA 4Y26A 3RNSA 3ZN6B 5GM0A 4KGQA 3O0XA 5JI9A 5CVRA 2UYBA 3BB6A 3KGZA 1LOAA 3V0BB 2GU9A 4B4RA 3DV8A 5F1RA 3RJRA 4LHLA 4Q4X2 1S0CA 3VBHB 3WINE 3UJQA 2WZR2 1MVQA 2HWD2 3DUIA 3HIFA 2ET7A 5J3UA 4Y22B 1H9WA 4OFGA 2NP0A 3E97A 4MXWA 2R042 3MLKA 4TLFA 1NYWA 4Y1XA 3FE5A 5FQ0B 3EBRA 1R1A3 4N7UA 4XMIA 4AWDA 4DPNA 3SH5A 1RUG1 1EV12 3G6JB 5ABJB 5AVAA 1YCIA 3I8TA 1UPIA 2HWD1 1W6PB 1ENSA 1S0BA 1WW4A 5J96B 5JZGB 5DUWA 5DDJ2 4BWOA 2YZ4A 2JE7A 1APNA 2R6QA 2E7QA 5F6LB 5I8YA 4AEDC 4GH4A 5GALA 1KDMA 3D6EA 2XWBB 4B8EA 3VDDB 1IPJA 3AK0A 3WP4A 3FBMA 1Z0HA 2ZABA 1R082 1UU5A 1QJU3 3WR0A 3AKRA 3ME2A 4A7YA 1RUJ1 4H14A 1QXJA 4Q0QA 5JI7A 2YMZA 1Q8OA 2YY1A 2G9FA 3VBSB 4IESA 2WJSA 4XHBA 4CEWB 3POYA 3AXDA 5JPMB 1EAH2 1PGW1 2PHDA 2Q1ZB 3ZFFC 1X8EA 1YFWA 4HL0A 4Q4Y2 1U5YA 4D7TA 4JRLA 1D0GA 3BIWE 3MIHA 2XJVA 3AP9A 3J26N 2DFBA 2IZWA 2FBEA 2HEWF 2R49A 1RUH2 3MW2A 4JC1A 1O3SA 4QU2A 3CO2A 4OI2A 5E89A 1T6GC 1IHMA 4XJ9A 4RHV2 3AFGA 5EWSA 2WT0A 1N1SA 1HQWA 1OLQA 4IEYA 1TNFA 3EQEA 4CP2A 4IXLA 1E57A 1A8MA 3CJXA 2VMGA 3AMNA 1QQP2 3KD4A 3MZHA 2B8MA 1BBT2 5FBZA 3DPRB 1WA4A 4CDUC 2ZKNA 1COV2 1JUHA 1RUOA 4J1WA 3JQXA 1AYM2 3L9JT 5CG9A 4COZA 1J3QA 2VY0A 2PAEA 1UL9A 4AQTA 5DDJ1 2CTVA 2G4IA 1TMF2 1XYPA 4SBVA 5GJ6A 3OBRA 4Y4YA 2D3RA 2JEMA 4HPKB 1SBEA 1TNRA 4EJRA 2VOWA 4ITCA 3IWZA 4JCKA 1W2UA 1Q8QA 2R16A 3GZAA 5CNAA 3VKFC 3AFKA 4P9JA 4D94A 4FVVA 3MF6A 1DU3D 3AZYA 4Q4X1 3FMGA 5L7OC 3OPZA 4OZXA 2ZAAA 4MZUA 1NE4A 3O7OA 4CDXB 2GMEA 4XFFA 3WY6A 1IGOA 1AL21 4COYA 1H2MA 3M7AA 4FPFA 3ZIXA 1W39A 3KMHA 3NVCA 1HW5A 3A4UA 3BALA 5DG2A 1PMIA 3MIBA 1YHFA 4MXVA 4XF1A 3VGIA 4FBFA 3GBWA 5FCCA 4MYEA 5FLHA 3LOIA 2LALA 4I0BA 3SITA 1K5MC 3D4KA 1H8VA 2GC0A 3NWKA 2DCZA 5GLUA 1RUE2 2BWCA 4GMP0 4AEDB 3S6PA 1BVP1 2UWCA 3THPA 1SCSA 2Q0AA 3TN91 4IV1A 4XTPA 4R52A 3TOJA 1HIXA 3HAGA 1EV11 3RYRA 2WIIB 5DZEA 5K9YA 1OHFA 1BKZA 2EAKA 2F6BA 2VOKA 1V9U2 4K9SA 3ZXFA 5C9AC 2RE9A 2B42B 1GLHA 2B45X 5JZGC 3JZVA 3OTFA 1VBE1 1RUF1 2W08A 2JG8A 3OYWA 2ZHLA 3MDPA 1KFXL 1CAVB 2ZGQA 3WUDA 2ARXA 5IK4A 3RG0A 1AYM1 4FTBA 2AR6A 4GKYA 1BMV1 3NV2A 2NM1A 2HWD3 1MS0A 3P3NA 4FPCA 4MH0E 5GZDA 1FOD2 1RUI2 2ZGOA 5T5JA 2V73A 1KRIA 3KLSA 2HWF3 4IV3C 1PVXA 5KC5A 1OOPA 4DB5A 1IPKA 5B2GB 3BCWA 1DDLA 5HCAA 1CAUA 1Y9QA 2PYTA 4AI0A 1U12A 3CEWA 4UW3A 4G4FA 2VUJA 1O4YA 4GWMA 4I09A 2AZ5A 1VBB3 2A6WA 3ECQA 4E4DX 1SLIA 4BZ4A 1NLSA 3RI8A 1UX6A 1YXWA 1CAVA 3JB4C 1V6LA 4KU8A 2E63A 2BBVA 1AX1A 1QJX3 4BHPA 5DG1A 3VBOB 1CPMA 3E6DA 3MI8A 4RL7A 1G7YA 4YG6A 4DS0A 3D5OA 1RHI1 1F8VA 1N1VA 3FFQA 1DQ2A 1MZ6A 2GNDA 3ZFGC 4HZFA 1QJY2 1IS5A 5A33B 3AYAA 1HXS3 2GNTA 3GYDA 4HN1A 4M00A 4ORFA 5BNOC 1ULDA 4WVWA 3VBRA 4YFWA 4CDXC 1LJ7A 4XBQA 3VN4A 3VBFC 2RS52 1ZRCA 2VVFA 4GALA 1OI6A 1LOFC 3H3ZA 1AR81 2HWB2 3L2YA 3N7KA 4MVTA 5SV8A 3D0JA 4QX5A 4CDQC 1TME2 5F5QA 4F8AA 4YW4A 1W6NA 4ZU7A 1RB8G 3GZUC 3VBHA 4CP1A 2X53S 2KM2A 4Q4V3 1N1TA 3D82A 2XB6C 4META 2DVFA 3SCHA 1K5MB 2D6NA 1I1EA 2WA4A 4Q4V2 1BEV1 4XFAA 2WFF2 4CDWB 1ZZ7A 2R0HA 4IEQA 3IDCB 1CX4A 1BQPA 5C4WB 4O9EA 3RJ2X 1H0BA 2A6XA 4KNCA 4BMBA 2RS53 1GZWA 4X8PA 1ASJ1 2GDFA 4RGGA 4RQPA 1QWRA 1UN1A 5C9AB 2HWC3 3HBZA 2UY9A 4PIYA 3GHMA 3W58A 4AVVA 1DZRA 4RFT0 5BNOA 2JXAA 2TUNA 3JBG1 4XXPA 1SEFA 4URTA 5BNNA 2TEPA 1A6CA 4HMZA 2XHKA 2D97A 1EPZA 1POV0 2QZ2A 4FPYA 4Q4W3 4N53B 1NCRB 1MEC2 4LEJA 1D4M2 3WXPA 3ZVXA 4I30A 4FO9A 2Q30A 3K48A 1VAVA 2E6VA 4BYYA 5JOYA 4YFZA 3RMYA 4RQPB 2LUWA 1BCXA 3UKNA 1ZZ8A 2Y38A 1DGWX 2XVGA 4UBGA 1G86A 5J37A 5HI0A 1A8DA 2A70A 2RS32 2ZGUA 4FAHA 3OD4A 1UZZA 3UKTA 5I93A 3KZ4C 3E6CC 3LSEA 4LLFA 3OY8B 4Y20B 3MLLA 3SXWA 2XKPA 5A32A 1LCLA 5CIRA 1CESA 3AP5A 3JQWA 2BPA2 2BVBA 5KXBA 4Q0SA 1HRV1 2CAVA 2GH8A 2DWRA 1JH5A 3WP3A 4LE3A 4YZ1A 4C1XA 4CDXA 1X8MA 1XE8A 4YM3A 4D7YA 1AHSA 1COV3 5JOXA 1VBC1 2WL1A 2PHUA 4PLNA 5BNOB 1J3RA 1FYUA 3ZMOA 1FAYA 3HMYA 1AR82 1NE6A 2HWB1 4LBNA 4J6GA 5HBAA 3GNEA 2C1FA 1RUE1 3JCIA 4WBBA 3ZXEA 3WLUA 1R093 1UKGA 4P9GA 3IDEA 4AI2A 1GZWB 4Z92B 4AEJA 1DQ6A 5ABJC 4Q1RA 2XBO1 4AW7A 2VQAA 5EJ3A