2ZGWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zgwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zgwA01
3PCOA 3L1AA 1GGMA 4E51A 4M7AF 4M75E 3RKYA 1H4SA 1E22A 3V7CA 3JCMc 3JB9G 3A74A 1J5WA 4M77D 5LJ3d 2DTHA 2FYKA 2E3CA 3JCMQ 1KMMA 1WYDA 4WJ3M 5I21A 1E1OA 3DSQA 2Q7EA 4F7UE 3VQWA 3ERRA 3HY1A 4C8QA 4RCBA 5C52B 3RESA 1WNLA 1HK9A 4J6XA 5GMKj 3QO7A 3ICAA 4XQ3A 1D3BB 3R07A 4C8QC 4PJOB 4M7DF 4HWRA 1B70A 4TWAA 4K88A 5GMKl 3JCMW 4TTVA 1NJ1A 3M4GA 3OD1A 2DU7A 1BIBA 1I4K1 4M75F 4WF2A 3JB9D 1NJ6A 3LSQA 4TQFA 3P8YA 2ZR2A 4PJOG 5GANg 3HXWA 4H2YA 2YLBA 5C53B 1B8AA 2RHQA 2ARTA 4P73A 4YRKA 4F7UF 3A31A 1M8VA 3V8KA 5GAN4 2ZZEA 5GAN2 2IY5B 2DQ3A 4P3PA 2DTOA 4P73C 2I2LA 4P72A 2DJZA 2PMFA 1B7YB 5K1XA 4P72C 5LJ5f 5GAOq 1H4VB 1X54A 1D3BA 4PG3A 4TVAB 4PJOA 3HFNA 4XU3A 1QE0A 3RL6A 1L0WA 4TVWA 1HC7A 3JCMe 4PJOC 3HXXA 4WJ4A 3A32A 3FIFA 2E5AA 3JCMX 2Q5IA 4V2SA 1LOJA 3L4GB 4M78B 2IY5A 5LJ3g 1EOVA 4YRMA 4RDXA 4UP7A 1YCYA 3TUPA 3RKXA 12ASA 5GANd 2I4OA 3NELA 2I4NA 1G5HA 5GMKe 2XTIA 1M5Q1 4M78G 4H02A 2K57A 4H2SA 5LJ3f 5GAMg 4M77E 3UGQA 4HWTA 3CMQA 3RGLA 4TVAA 3I7FA 4H2WA 5GAOp 1NYQA 4TQDA 4CH3A 4RQEA 1N9RA 4P75A 3TEGA 3BJUA 1NJ5A 5GAMf 2C8MA 2ZTGA 3W3SA 4RCCA 1BBWA 4YROA 5GANh 3LSSA 3PGGA 3BDUA 4Y91A 4CS3A 4MMLA 4P75C 1H4TA 4P71A 4M78D 4YYEA 3L4GA 3JCMb 1G51A 4M78A 4XTWA 4C92B 5E3IA 3FB9A 4YRNA 4RQFA 4M77F 2DEQA 4BW9A 2JN0A 4H2UA 3V8LA 4NL2A 1I8FA 4XU1A 3LC0A 4XTZA 3JCMJ 1YFSA 3HTZA 4C92G 3SWNA 1B34B 3RACA 5LJ5e 4ZTZB 1QF6A 3NENA 3P8TA 2ZIMA 3SWNC 4C8QD 5GAN7 1KOGA 4O2DA 3V7RA 3JCMV 2ZINA 3IKMB 3TEHB 1EVKA 2CJAA 4YDQA 3L2ZA 2ARUA 4H2TA 2Q7GA 2XGTA 1KQ1A 4NL3A 2DTIA 4M7DB 11ASA 5GAMd 4NCXA 4YRFA 4YRSA 5GMKi 2ZT6A 3IG2A 4M75B 4YRGA 2EJ9A 4C92A 2EAYA 5LJ3h 2RB6A 1N9SA 1Z7MA 1EFWA 2YLCA 4C92C 4F7UB 1YGBA 4M7AA 5LJ3e 2FB7A 4JRIA 1B34A 1X56A 3M4PA 5GAN5 4CS2A 3NEMA 4TVYA 1KQ2A 1JBMA 5GAMh 2DZ9A 1NJ2A 5GANf 4M7AC 4DQ2A 1NYRA 5CAIA 1ASYA 2QTXA 3TEHA 2DU5A 4J15A 4KQEA 2P5IA 4QVDA 4UP8A 3JCMd 4BWAA 2HNIA 4PJOD 4J6WA 5LJ5j 5GAN8 4M7DA 2EL9A 4HWPA 4YCVA 4XTXA 3E9HA 1E24A 1ADYA 2ZZFA 4P3OA 3QHSA 5DY9A 4M75A 3REXA 3VQXA 3BFMA 4M7DC 1SETA 1NNHA 4CH6A 4M75C 4Q6GA 4OP0A 4M78E 4F7UA 1EIYA 1HTTA 4P74A 4CH4A 2DXTA 3VQVA 4YRLA 4ZTUB 2ODRC 1I5LA 4P74C 1B76A 3HXVA 3IALA 3A7AA 4JUVA 1EVLA 4J6YA 4OLFA 3SWNB 3QTCA 4HWSA 5LJ3j 2DQ0A 2J3LA 2VXEA 4C8QE 2I4MA 3A7UA 2ARSA 3G1ZA 2P0LA 2QHVA 4M78F 2AMCB 1X2GA 3QO5A 3FJPA 1ADJA 3RKWA 1USYC 2AKWA 4MMKA 3KFUA 1HXDA 4H2XB 5GAMj 2ZNJA 2RHSB 3A5ZA 4XTUA 5ELNA 1E1TA 4H2VA 5GANe 4UPAA 2QHUA 3MEYA 2I4LA 4C8QF 3REUA 4NOYA 4YPFA 4LNSA 4M7AB 4J5YA 3JCMg 3V8JA 3QUIA 4EO4A 4P3NA 5HGQA 1C0AA 1ASZA 4XTYA 3VBBA 4A53A 3VU3C 2E10A 2QHTA 3IKLA 3PZCA 2CGHA 3EFRA 4UP9A 4M7AG 4KR3A 2AMCA 2E64A 3RUXA 3HFOA 1SERA 4K86A 3JCMf 3JB9F 1SESA 4Q15A 4PHCA 4PJOE 2YHTA 1WQWA 4HA8A 4JRKA 4CH5A 4H2XA 1WU7A 1H641 4QVCA 2ALYA 2RHSA 3HFVA 2DKGA 1BBUA 4ZIBA 4C92D 1Z7NA 3HRKA 3P8VA 4DPGA 2RD1A 4M77A 3MF2A 1N9WA 2PMEA 4M7DG 2ZGWA 3HY0A 5C51B 3HSBA 4YRTA 4M7AD 4M75G 3HFZA 3INZA 1KMNA 1YFRA 1NJ8A 4M77C 5GAN3 1EIYB 4KR2A 4G85A 1MGQA 4YP0A 4YRQA 1X55A 4EMKB 1JJCB 4PJOF 5ELOA 1G5IA 1EQRA 2ZXFA 2E65A 4EMHA 2EWNA 4X9DA 4F7UG 5GANj 1LYLA 2G4CA 4HVCA 1WQ7A 3MF1A 5F5WA 4EMGA 4YRRA 2ZZGA 3BW1A 5GAMe 1Y96A 1LNXA 2VXFA 1YB3A 1RIQA 4M7DD 1VQZA 3HXUA 4WI1A 4RMFA 2CJ9A 2ZCEA 2DXUA 2ZT7A 3EFSA 3QNEA 3HXYA 4YRCA 4M75D 5LJ5g 2VC8A 1U1SA 3SB2A 1ATIA 4XU0A 5GAOm 1U1TA 2AKWB 3QO3A 2E41A 4L87A 2Q5HA 1WPYA 2RA2A 4PNOA 2ODRD 1IL2A 3JB9J 5K1PA 3JB9H 4EX5A 3JCMh 2DDZA 3RIRA 3RF1A 3NETA 4EMKA 1JJCA 4YRJA 2CJBA 2EJGA 4A54A 5GAN6 1SRYA 2ZNIA 4N0AA 5GAOr 3QO8A 4HWOA 1FYFA 3A7RA 4EMKC 4YREA 3HXZA 3A5YA 4XTVA 3BY7A 3WQZA 3VQYA 4XU2A 4X9CA 4N0AC 4X5OA 1LJOA 3UFGA 3V7SA 1USYA 3UGTA 3QSUA 5GMKh 3GIBA 2DVEA 2C7IA 2QHSA 4XEOA 3UH0A 1PYSB 3JB9I 1X2HA 4YCUA 3PCOB 3JCMP 4JLIA 1B7YA 1WLEA 3AHUA 1YFTA 2ALYB 4AH6A 2Q7HA 4C92E 4G84A 1W66A 3HRIA 3RERA 5GAOl 4K87A 4YRIA 2ZR3A 3E9IA 5LJ5d 4M77B 2ZIOA 2ZT5A 4C8QB 4M7AE 5GMKm 2Y90A 3HFZB 2CIMA 1I81A 4M77G 2EJFA 2RM4A 1TH7A 5GAOn 4C8QG 1B70B 2J3MA 2DZCA 5KNNA 1X01A 1H4QA 1BIAA 4HT9A 4YCWA 4XEMA 4C92F 4CS4A 4YRPA 5LJ5h 2E1HA 1PYSA 4P71C 1JRIA 1Y96B 4HT8A 4M7DE 3M4QA 2RHQB 4M78C 2ZT8A
chains in the Genus database with same CATH superfamily
3L1AA 1X6OA 5FU6B 2Z0WA 4EIKA 1VQPA 2QQRA 3V7CA 4L5GA 1VQMA 1QMCA 2CSIA 4F14A 4D8DA 2ED0A 4A4KA 2DTHA 2FYKA 4WJ3M 1YN8A 3DSQA 1W6XA 3VQWA 3HY1A 4C8QA 4RCBA 2HSPA 4Y28E 5C52B 3L2VA 1WNLA 1BCOA 4N4HA 1OI1A 2RHXA 1D3BB 3MP1A 2IG0A 2FPFA 4K88A 5AT1B 1NJ1A 4M75F 4PLLA 1M3BA 1FMWA 1JXOA 5I22A 3HXWA 4H2YA 2X51A 1VQ8Q 1B8AA 3LYIA 2WSFE 4EDUA 1D1AA 1QLYA 2ARTA 4P73A 2VASA 2G6FX 4F7UF 3CCMA 1VQOT 1M8VA 2RJFA 1NZ9A 4RTVA 1CKAA 2HAXA 2EQKA 4N4IA 2DTOA 5FU6C 1E6GA 1WHHA 3QYHB 2DJZA 3I56Q 1VQ5Q 1VQNT 1B7YB 1QCNA 1BI3A 5C0MA 5K1XA 1GBRA 5A2QE 1RAEB 4P72C 4LVKA 2VGMA 4QT7A 4PG3A 5GAOq 1X54A 1J3TA 3HRUA 2OTJA 4ELYC 2FZKB 3M0QA 2J6KA 1QCFA 1TOVA 2DJQA 3G71T 1M2VB 1KQSP 3ULRB 3HXXA 2JM9A 2RF0A 4GLKA 1Y71A 2KYBA 1SPKA 4JPBW 1K9MU 1O75A 1OZ3A 2K3YA 3CPFA 1D0YA 1M4ZA 1ZLMA 4M78B 1B7TA 3J81E 2QGGA 4XK8E 3OY9A 3BDLA 1QW1A 1YI2T 2ESWA 3ZBDA 3MP6A 4E7JA 3M9QA 1M90C 2K57A 4H2SA 3C94A 3QXEB 3UGQA 3MO8A 4FCYA 3CBOA 2CSQA 3I7FA 1KHCA 3OYNA 2LP5A 8ATCB 1NYQA 2JT4A 3SEMA 1N9RA 2QEXQ 1IRXA 2RHZA 4RCCA 4YROA 2KY9A 3CMAT 3MCAB 1RUWA 3BDUA 4CS3A 1SF9A 3JAME 4M78D 3L4GA 2H8HA 1BYMA 2GFAA 5CKFA 4C92B 2HKNA 4RQFA 2KAFA 4M77F 1KSWA 4BW9A 4TVRA 4H2UA 4NL2A 1YFSA 4DBHA 3A8MB 1EIFA 2LNHB 1QF6A 3CCUA 3M53A 2FRWA 2KE9A 2X35A 3JCMV 2LJ1A 3L2ZA 2YUQA 1JJ2A 5IXBA 1KQ1A 4HCCA 2DTIA 4M7DB 2ABLA 2KT1A 2DYBA 2V8IA 2EVRA 4Z02A 1LPLA 2ZT6A 4KBMB 2K6DA 2QK0A 2ZPEB 4IUPA 4KUDK 2YRVA 2EAYA 2RB6A 4MDXA 1N9SA 3CCRT 2NS6A 1EFWA 1WGSA 2XDPA 2ECZA 1S72Q 1JO8A 2HZYA 4C92C 2DM1A 1NEGA 3OW2S 4AG1C 1SG5A 2FB7A 4L59A 1NEBA 1X56A 4LNPA 1YJWT 3CC4T 1S1NA 3EAEA 1K8AC 3E9GA 3MJXA 3R6NA 2DA9A 3F70A 4DQ2A 2GF7A 3TSZA 3LLRA 3PMTA 2QTXA 2DU5A 2L3SA 1Q82C 4QQGA 4QVDA 4UP8A 1VQLQ 1VQPQ 3VYGA 5CIUA 2CP7A 4MZPA 1IXDA 1VQMQ 1M3AA 2EL9A 4HWPA 4YCVA 2LRQA 1ADYA 3OYYA 2FPEA 4M75A 1MV3A 3REXA 5KYYB 4OGCA 1TG0A 4M7DC 3CCVQ 3PE0A 4Q6GA 4M78E 4F7UA 2WSCE 3C12A 2PVGB 1PNJA 2QA4T 1T0JA 1HTTA 4CH4A 1EIYA 1GL5A 2CREA 3PIOA 5FRMA 3EG9B 3TEEA 1YIJT 3OYBA 3CCSA 2CZ0B 4YRLA 2E3HA 2DL5A 2OAWA 2YSQA 4X1VA 4OLFA 3SWNB 3QTCA 3CCMQ 3EFOB 4C0ZA 5CQXA 9ATCB 2DQ0A 4BI8B 4ZN3A 1G8XA 2AT1B 2CP3A 2VVKA 4CRIA 2XU8A 2P0LA 1BBZA 2QHVA 2DK3A 2AMCB 2CT3A 1ADJA 2FPDA 1QWEA 3RKWA 4ZGDB 2CYZB 5EG2A 5GAMj 2C0OA 5D6XA 2RHSB 2KYMA 2OTJQ 2COYA 4J8OA 1OOTA 3DLMA 1BK2A 4H2VA 2QHUA 1V29B 2LJ0A 2XI9A 2QG9B 3VV0A 2LQKA 1PKSA 3GNFB 2DMOA 2V8JA 4PK4A 5J39A 2BUDA 4KH1B 3J80E 3QUIA 4EO4A 4B6MA 1VYTA 2MWPA 4XTYA 1ASZA 2RQWA 3PZCA 3VS5A 2CGHA 1KQSS 4UC4A 4ATOA 3HFOA 4FW1A 3WVEB 4B9WA 2JW4A 2KXCA 4A4GA 4BE2A 2PVOB 2YHTA 2QGFB 4QVCA 2ALYA 3CCJA 2NYSA 2COZA 1BBUA 4ZIBA 3J7AF 1Z7NA 4RTXA 4M77A 2YWWA 4M7DG 1NBEB 1W2BP 3HY0A 1YJNT 3G6EQ 5FWCA 1ZUKA 2XHCA 1YWPA 5D6WA 1MGQA 4PJOF 1OQKA 3EGXA 3HP9A 1EQRA 1C0MA 4J7FA 2G4CA 1ZBXA 1WQ7A 3MF1A 4HVCA 3NHNA 4EMGA 2NUTA 1RL2A 3EH1A 4LE9A 2L0AA 5CR2A 1Y96A 2VXFA 2XG8D 1VQZA 4R0KA 3EFSA 3CCUQ 3TU4K 4OMLA 2DD4A 1SRLA 1U1TA 1TXQA 2AKWB 2D0NA 4C5GA 4L87A 4HT4A 4PNOA 1IL2A 3JB9J 5DLQE 4OB3B 1OX8A 3JCMh 4IKFA 3RIRA 2P84A 4EMKA 2ZPHB 4YRJA 2SEMA 3LGFA 3X24B 5HKCA 1IGUA 2ZNIA 5GAOr 4ELZC 3GOXA 3A7RA 2FG0A 3HXZA 3OYIA 3I55T 3A5YA 3NTKA 1FWZA 1M90R 4Z89A 3OBYA 1KK7A 1K9AA 3OYMA 5M9OA 3UF4A 4FT4A 2O9VA 2DVEA 2QHSA 4XEOA 3UH0A 2KRNA 1VIFA 3T9NA 2LT4A 1VUBA 2DETA 3JCMP 1GRIA 3AHUA 1PSFA 2R5AA 2O2OA 1U06A 3RERA 5GAOl 4YRIA 3E9IA 5LJ5d 2ZIOA 3WXMB 2P4RA 4C8QB 1UJ0A 5GMKm 2EW3A 5D7UA 1AWWA 3L2QA 2HSEB 3FEOA 1I81A 5A0GA 5CKHA 3MEVA 4A4HA 2J3MA 2CZ6B 4LD9K 1U8RA 5KNNA 3CCSQ 1YFNA 4KGXB 4BY6B 1V76A 1H4QA 4YCWA 1WXUA 2DX1A 5HCKA 4YRPA 2YRCA 4HVUA 4E2FB 1VQOA 4E51A 4M7AF 1Y07A 2JTMA 1LVKA 3A74A 1J5WA 4KRTA 2VGNA 1K9MC 2DO3A 5I21A 2GFUA 4DOWA 1E1OA 2Q7EA 2BE7D 1E7OA 2EGCA 1V1CA 5A0LA 2MMPA 1UGSB 3RESA 1HK9A 2C0TA 2FZCB 3R07A 2DIGA 2FRYA 4C8QC 4HWRA 1MMNA 2CZ7B 1B70A 1TTHB 3ASKA 3G71A 3C4SA 3M4GA 1K8AR 2IIMA 3QWYA 4IIMA 4E7IA 3A1PA 4WF2A 1DJ7B 5KE3A 1NJ6A 3A8OB 4CC2A 4PJOG 2A7YA 2ZR2A 2YLBA 5C53B 1Q82R 2E3IA 4YRKA 2LQWA 4CC3A 1N27A 3V8KA 1NLOC 1AD5A 4P3PA 1HJDA 3KUFA 4P73C 2I2LA 3TREA 4JLGA 3M0SA 3EGDA 2GQVA 2RJCA 4KGVB 5LJ5f 3CCJQ 1BCMA 1T3SA 4PJOA 2KGTA 3CQTA 1X43A 1QVGP 2H3JA 4TVWA 2HCKA 3SFMA 2MYSA 1HC7A 3JCMe 1MMAA 2XD0A 2RH2A 3CMAA 2KVQG 3MPUB 4OMPA 2KK4A 3ER0A 3L4GB 2IY5A 4YRMA 1EOVA 2FVUA 1W2BS 2DBMA 1H3ZA 4FIBA 4UP7A 3I9QA 4PLIA 3VRYA 2D8JA 3NELA 3OBWA 4II1A 1UGRB 2PTKA 4F17A 2J06A 2RQVA 3OYEA 1X69A 2K2VA 4LVIA 4H2WA 3PMIA 2K5IA 4XAXB 3P8HA 2B8AA 5GAOp 4E7KA 4JS5A 4CH3A 2EIFA 2K2MA 4ZTFA 2DIQA 3H41A 2MWOA 3BJUA 4QW2A 2ZTGA 4ZNXA 3PT9A 5GANh 3LSSA 2GGRA 3UDCA 3PGGA 2NLUA 4Y91A 1WDXA 1OU8A 4YYEA 3JCMb 2IPOB 4XTWA 1GXIE 5E3IA 4RTUA 5FWBA 2DEQA 2GTOA 4RKUE 2JN0A 4ME7A 4FYXB 4XTZA 2DYIA 3FRNA 3JCMJ 2L3QA 3MEAA 1YJWA 3RACA 3CC4A 1XTDA 2V1QA 3C0CA 3H0IA 3M0TA 5IN1A 3O5ZA 4KT0E 3LWIA 2M1HA 3V7RA 1WYXA 3FJ5A 2ZINA 2DXBA 2J6FA 5FU7B 4YDQA 2CJAA 3FC3A 4BI3A 4M4ZA 4H2TA 2OTLT 3CBPA 2A0FB 2DL4A 4YRSA 1FYNA 4RTTA 3IG2A 3EG3A 4M75B 3RBBB 1NM7A 1Z7MA 4PJJA 1M30A 1Q95G 2QA4A 5KH6A 1UTIA 4F7UB 4AFUC 1WJRA 2V8KA 4M7AA 4AFSC 2X4YA 5LJ3e 1YIJA 1B34A 5GAN5 1HYOA 3NEMA 4TVYA 4CS2A 1QVFP 5GAMh 2RQTA 4MZMA 2Y4XA 1NYRA 2HKQB 5GJWB 2AHJB 2JZ2A 5CK9A 5CAIA 1VQOQ 6AT1B 3NMZC 3JCMd 2HNIA 4BE0A 3ZL7C 4BDYA 1Q81C 1QQJA 4XTXA 5FU7C 4JRPA 2RMOA 2KT8A 4P3OA 1VQNQ 1TSFA 2L5QA 5IXFA 3MEWA 3M55A 1W4SA 3HL8A 1VQ4T 2RO0A 1SETA 4BUGA 1KHIA 4M75C 3G4ST 4LDXA 1IHWA 4OP0A 1AOJA 1G3WA 1UHFA 4P74A 3OMCA 3G71Q 2DXTA 1G5VA 2ODRC 1I5LA 1RLPC 2CKKA 5KYUA 3A7AA 4JUVA 4J6YA 2MIOA 3RMQA 4HWSA 3NGPA 3M58A 5LJ3j 4OVAA 3Q1JA 3CXCP 2PNIA 3QWXX 2VXEA 2I4MA 3G1ZA 1R77A 4X34A 1YI2Q 2JNGA 4M78F 5IAYA 2A8EA 1YITA 2E5QA 2R57A 3LH5A 3OW2A 1A0NB 2CP6A 4IUQA 3VS0A 2ED1A 3M54A 3OS5A 3I35A 2ZNJA 4A63B 1WA7A 3WVDB 3R6OA 1TU0B 2L89A 2EBPA 1SHGA 3A8GB 1E1TA 4FSXA 2AIRB 5GANe 1YJNA 3X26B 3CMAQ 4YPFA 3EH2A 2PUOB 2K3BA 4OB0B 3JCMg 3V8JA 2K5LA 4F04B 1YHQT 1QVGS 3TSWA 1KC8U 2RK2A 3EGXB 1MUZA 2X4WA 3VBBA 4A53A 2EYYA 2QHTA 1K9MR 3VUZA 3NPFA 1KD1C 1X6BA 4UP9A 2FO0A 1QP2A 1M27C 2NUTB 4K86A 1PWTA 3JCMf 3JB9F 1U5SA 4PHCA 1PCXA 1WQWA 1X2KA 2J05A 2EYZA 4HA8A 4JRKA 3X25B 4CH5A 2QXFA 3HFVA 1UGQB 1E6HA 2YT6A 4C92D 3HRKA 2C06A 3A8LB 1K73C 4E7SA 4EPCA 3MF2A 1N9WA 2PMEA 2QTVA 2EQJA 2I0NA 2PZ1A 4M75G 3HFZA 1KMNA 2EQIA 4M77C 4KR2A 3S6WA 5HK0A 2W10A 3SDZA 4YP0A 4YRQA 1X55A 4EMKB 5ELOA 2M0YA 3CCRQ 1G5IA 1IO6A 1WFWA 1AHJB 2M9UA 4EMHA 1KFZA 4F7UG 5GANj 4JZ3A 3ZFJA 3I55A 5F5WA 2MPXC 2ZZGA 3BW1A 5GAMe 1YJWQ 4DBRA 1PG5B 1LNXA 2BZXA 3CC4Q 4M7DD 4WI1A 4RMFA 3CPWP 2ZCEA 2DXUA 2WACA 1I1JA 1UGVA 4JDSA 4YRCA 2RQRA 2VC8A 1NPRA 1B07A 4XU0A 3PFSA 2L3RA 1AWXA 2B86A 1YCSB 3DB4A 2MCNA 1K0SA 1JJCA 1KQSA 1ZA1B 2CJBA 1FMKA 2EJGA 1VQ7T 4O5VA 2O9SA 4EMKC 2QA4Q 2ZAEA 4YREA 2COWA 1X75C 3BY7A 4IURA 1BI0A 1YIJQ 1JXMA 3UWNA 5FLXE 3L2UA 1MHNA 1R0CB 3UGTA 2YRDA 4J9HA 3UA6A 1Q7YU 2KSSA 3I5RA 3NTHA 2QQAA 2LJ3A 3GPLA 3AT1B 2RNAA 4Q5WA 1N8RU 1X2HA 5I2SA 2VV5A 4AFZC 4JLIA 1B7YA 2ZZDA 1YFTA 2Q7HA 1QVFS 4C92E 5IHNA 4G84A 1W66A 3HRIA 2LC4A 2QQBA 2P0QA 2ENMA 4OMOA 2FL7A 3QG1A 2CUDA 5I11A 1P92A 1UB4A 2X9HA 2G3RA 2KROA 4D6WA 1M1FA 1U3OA 2CIMA 2D9TA 3TVTA 3VS3A 2KR3A 1Q81U 1WLPB 4M77G 1NJIU 2JJ9A 2YUNA 1XJWB 5GAOn 1B70B 1AZGB 3HRTA 4CC4B 2HBWA 1BIAA 4XEMA 4D8KA 2L3PA 4CS4A 2E1HA 1ZQ1A 1YITT 4HT8A 4M7DE 3M4QA 1GGMA 1H4SA 2XMFA 4RG8A 1E22A 2ZPFB 3JB9G 1OZ2A 2KI7A 2DPPB 4FT2A 2E3CA 4OF1A 2RK1A 1WYDA 3CCET 3EGDB 5HK3A 1GFDA 2IVWA 3HKSA 4J6XA 5GMKj 3VS2A 3CXCS 1UG1A 3ICAA 5I2MA 1WJSA 2ZPBB 4LN2A 1ZUUA 2XICA 4PJOB 4TWAA 1BI2A 3OD1A 1YJNQ 2RI2A 1BIBA 3CMEA 2CDTA 3VYHB 4TQFA 3P8YA 2K9GA 2GQIA 5GANg 3EGUA 5CKBA 2LT1A 2VYTA 5DM7R 2RHQA 2RHUA 3A31A 5L8RE 1RADB 3CCLT 1Q81R 2IY5B 5GAN2 1AZEA 3QKJA 2MAMA 1Q86U 1VQ9T 2JOYA 4A4FA 4BE1A 1ZX6A 1MV0B 3CCQT 4LDWA 2PMFA 3NTIA 4LUEA 2BKDN 3QIIA 4PL6A 1X2QA 2RN8A 3LH0A 2XIDA 1H4VB 2GCXA 3RR6A 1RABB 3D7SB 1KD1U 3CD6T 3UATA 3HFNA 4XU3A 1KIKA 2HL5C 4HCBA 1L0WA 4FYYB 4J9EA 3PIPA 4B9XA 1LCKA 2D1XA 4PJOC 2PVDB 5EC7A 4WJ4A 4LDYA 3CC7T 3FIFA 2E5AA 1TUDA 2Q5IA 3PVLA 4C0GA 1YBYA 5CKEA 1LOJA 1K73U 3PVQA 4ORZA 5CO7A 1ABOA 2PQWA 1IREB 3M56A 3QZ5B 1G2BA 1G83A 3I55Q 4RDXA 1PD0A 1VQ6T 1YCYA 12ASA 1JU5C 2I4NA 1G5HA 2JTEA 2XTIA 1M5Q1 4ZGEB 4H02A 4FSSA 1WHJA 5GAMg 1TS9A 3CMQA 1FMVA 4MDWA 4TVAA 1UE9A 1VOMA 2EGEA 1UJYA 1GBQA 1XOVA 4J9CA 4J9BA 4C0DC 1C6VX 1IB8A 2GNCA 4FYWB 4P75A 2A3LA 3TEGA 2OTLA 2PUKB 5GAMf 3CPWS 4FW2A 3W3SA 1BBWA 1O9SA 4MMLA 1H4TA 1XNIA 1KD1R 4JZ4A 5D6YA 1SHFA 3V8LA 4XU1A 2XDDA 3LC0A 1AWJA 2H3EB 2CUBA 1VQKT 2K4YA 3SWNA 1B34B 3G1JA 2O31A 3NENA 4LVMA 4C5EA 4DBFA 3G7ZA 1K73R 3OMGA 3RMSA 4C8QD 3SD4A 1KOGA 1ZHIA 1AEYA 3IKMB 2K5FA 3I56A 2EYQA 2CP5A 2CT4A 2DD5A 3E19A 2VKNA 2Q7GA 5KYXA 3QPHA 4NL3A 11ASA 3OYFA 4NCXA 5GMKi 1SSHA 4L6V5 1W2BA 2KBTA 4PKCC 4QKUA 2DAQA 5CCAA 5LJ3h 3OYGA 1VQ4A 3G4SA 4WCIA 5HY6A 2AZVA 2F5KA 2A28A 3A98A 1IGQA 2DLPA 1YGBA 2LDMA 4PJNA 4DOVA 1JQQA 3M4PA 3M59A 4BDZA 4CC7A 1JBMA 1KQ2A 2AK5A 3M4YA 1H8KA 2DZ9A 1R8OB 3GNGA 1NJ2A 2LCLA 4M7AC 1VIEA 2BZYA 4J9IA 2DILA 1I5OB 3LWHA 1NYFA 3TEHA 3E1SA 1ACMB 4BWAA 4IUTA 4PFZA 3CC2T 3OS0A 1KC8C 1UDLA 1E24A 2ZZFA 3QHSA 1PRLC 1UHCA 2NWMA 1NLPC 3VQXA 2JS2A 4BI4A 1I0CA 3CMET 1PHTA 4CH6A 4E7LA 4OMFB 1FX7A 3OYJA 1OYXA 4HVWA 4C0FA 2DF6A 4GBQA 3VQVA 3JSCA 1OU9A 4ZTUB 4P74C 1B76A 1QVPA 3HXVA 3IALA 2LMJA 2M16A 3OS1A 1EVLA 1YHQA 4IUUA 1WHKA 3MP8A 2O01E 1C1AA 2AKLA 2V1RA 2F69A 1WHMA 4PFOA 2O4XA 2YXYA 4C8QE 3A7UA 2DL3A 4KUIA 2M0OA 2QDYB 3ME9A 1X2GA 3QO5A 3FJPA 1OV3A 5AYFA 4DBQA 2LVMA 2MOXA 1USYC 2AKWA 3PNWC 2ZPIB 1HXDA 2L2PA 2MF2A 2EYXA 1GCPA 2XK0A 3X20B 3H9NA 3A5ZA 1NE8A 4PFPA 4XTUA 1RLQC 5ELNA 4J83A 2A08A 2ZCFB 3M57A 1VYVA 3MEYA 5KYWA 4ZN1A 1T3LA 1NYGA 3UT1A 4NOYA 4OMNA 1AWOA 3REUA 1OX9A 2F1LA 1SKUB 1PSEA 1YJ9T 4J5YA 5HGQA 1C0AA 3VU3C 1WXBA 2BZ8A 4M7AG 4KR3A 1MMDA 2K3XA 1RAIB 1SESA 4OB1B 1GCQA 4DEXA 2QAZA 3LX7A 2RJDA 3FDRA 4H2XA 1I07A 1YNZA 1WU7A 1H641 1VQLA 1JJ2P 2DKGA 3LGLA 4HCKA 3S3OA 1T0HA 1RAHB 2K79A 2CP2A 1WI7A 1WXTA 2SRCA 2RD1A 4BACA 2D0QB 1Q7YC 1G3TA 1UGPB 2ZGWA 2HQEA 2RHYA 2OTLQ 3CCVA 5C51B 3HSBA 2JUFA 4YRTA 1N8RC 1EIYB 3INZA 1YFRA 1NJ8A 4C5HA 4G85A 3KFVA 1VQ8T 1AVZC 1M1KU 3ZEHA 5KE2A 1JJCB 2OAUA 2DE0X 4LD6A 1VQ7A 1ZUYA 4RTWA 2ZXFA 2EWNA 2OI3A 4X9DA 1LYLA 2HQHA 3EHRA 2L8DA 2WSEE 2LQNA 4YRRA 1WIEA 1QWFA 4KGZB 3I56T 1VQ5T 1RIQA 1AT1B 3GF5A 2CJ9A 3O8VA 1NJIC 2QASA 3HXYA 1ZA2B 4M75D 1MNEA 1PRMC 1U1SA 1ATIA 1RAAB 5GAOm 3QO3A 2LQ8A 2LTOA 1X27A 1WPYA 1Z9ZA 2ODRD 1QVGA 1D1BA 2BIVA 5K1PA 2DDZA 3HTRA 3RF1A 2MI6A 3QBYA 1EX4A 1HSQA 1K76A 2KQWA 1BI1A 1G3SA 5GAN6 1VQ4Q 1SRYA 2VB6A 4N0AA 3G4SQ 4HWOA 3JRZA 2M51A 1IHVA 3FLGA 3VQYA 2EKOA 4X9CA 5IHIA 2NUPA 4RUGA 1LJOA 3UFGA 2LNVA 2LX7A 1USYA 3QSUA 5LL6S 5GMKh 1M1KR 2EQMA 3OSVA 3GIBA 2HMAA 2C7IA 1W1FA 1WHLA 3QYGB 5FW9A 3OA6A 3JB9I 4RG2A 3E2UA 4YCUA 3OSSC 1KG1A 2ALYB 4AH6A 2QEXT 1WJQA 2LCCA 1W70A 1M9SA 4K87A 3X28B 2GBQA 4JS4A 3CCEA 1PC0A 4M77B 1TWBA 1Q86C 2Y90A 4ZGJB 2KNBB 2W0ZA 2PU9B 3G6EA 2R5MA 1ZSZA 1RAFB 3META 1QKWA 2RM4A 4AMCA 1NPPA 2DZCA 1UUEA 4C92F 3VUBA 1Y0MA 4LDUA 5LJ5h 2KEAA 4K11A 1PYSA 1WZOA 1YHQQ 4P71C 1JRIA 4RTZA 1Y96B 2RHQB 4M78C 4BB7A 3CCLA 2ZT8A 3PCOA 1D0XA 7AT1B 4M75E 3RKYA 3LW5E 4E7ZA 1PM3A 1YP5A 1Z9QA 3JCMc 1VQ9A 2E12A 4JJDA 1HD3A 4M77D 5LJ3d 3JCMQ 3CCQA 1KMMA 5J3BA 4F7UE 3ERRA 2CS7A 3UA7A 3DLLA 2KRMA 2E4HA 3QO7A 3CD6A 1EFNA 2MK5A 4XQ3A 1S72T 2CH4W 5FRNA 3VRZA 4M7DF 4KULA 3HPWA 2QQ9A 1RACB 5GMKl 3JCMW 4TTVA 1F1BB 3KBGA 2DU7A 4IIOA 3OYHA 1I4K1 2FZGB 4VUBA 2HBPA 3JB9D 3REBB 3CC7A 2C0IA 3LSQA 3MQZA 3HRSA 2DVJA 1QVFA 3QDFA 1K1ZA 2GTJA 5GAN4 2ZZEA 1KC8R 1OULA 3OYAA 1H3HA 1VQLT 1VQPT 2DQ3A 8AT1B 1VQ6A 2DRKA 2J7IA 1TUGB 1VQMT 1NG2A 3VS6A 4P72A 2VWFA 2NUZA 2AKKA 2O88A 3CCVT 1UECA 1MNDA 1D3BA 3H6ZA 4TVAB 3P8BB 3GBQA 3MKDA 3PTAA 1UFFA 1QE0A 3TCJA 2VUBA 2X4XA 3RL6A 2JMCA 4JJCA 4J9FA 4R56A 2XKOC 1D0ZA 1OPKA 2E6NA 3A32A 3EHQA 1JJ2S 3JCMX 1XQHA 2KMTA 4V2SA 4J9GA 1Y57A 4N4GA 1VQ7Q 3EG2A 3CCMT 5LJ3g 2CZ1B 2CP0A 4LVJA 5A0DA 1VQKA 1ARKA 3TUPA 3RKXA 5GANd 2I4OA 5GMKe 5CQYA 3CXCA 2OJ2A 4M78G 5ECAA 4WTOB 1MMGA 5LJ3f 4M77E 4HWTA 3RGLA 2RI5A 2ZPGB 2OTJT 4TQDA 4RTYA 1X6GA 2HDAA 2F2WA 2D6FA 4RQEA 1CSKA 1FXXA 3URGA 2XDBA 3QZ9B 1M2VA 3BE3A 4ZTJA 5KCOA 1NJ5A 2C8MA 2RPNA 5KYXB 2OX7A 2X3XD 5KYNA 1SSFA 4QVZA 1RAGB 4P75C 1RI9A 1ABQA 4P71A 1KJWA 2HD0A 3M0PA 4KH0B 2EPDA 1H92A 4M78A 1G51A 3C95A 5DLOA 3FB9A 4YRNA 2RQUA 3QJ6A 4GLMA 4C5IA 2Y4YA 4J9DA 4CI0C 1I8FA 3H0FA 5J26A 2DL7A 2ATCB 3OQ5A 3HTZA 2P0PA 4C92G 1CKBA 2F2XA 5LJ5e 4ZTZB 5CVIA 3P8TA 2ZIMA 3MEUA 1N5ZA 1YITQ 3SWNC 2QYZA 4IUVA 5GAN7 1Q7YR 1YWOA 1OEBA 4O2DA 4GY5A 3TEHB 1EVKA 1WX6A 2ARUA 3VJPA 1N8RR 2P0KA 3CC2A 2XGTA 3L2WA 3G6ET 3L42A 5GAMd 4YRFA 3CCEQ 4YRGA 2EJ9A 4C92A 2RHIA 2DERA 1JB0E 2BE9B 5GJVB 1QP3A 5IH2A 4O6JA 2YLCA 1M90U 2KDSA 3L2RA 2DFUA 3IQLA 2LZ6B 4JRIA 1NJIR 2R58A 1IZ6A 2V26A 2FEIA 1M2OA 4J7IA 5GANf 3CCUT 1D09B 2HQXA 1ASYA 3CPWA 3OYCA 3GLXA 3CCLQ 4J15A 1K0XA 4KQEA 4LVLA 2P5IA 3H0HA 4C0DB 4PJOD 4QQDA 4J6WA 5LJ5j 1UEBA 1VQ9Q 2O4XB 5GAN8 3OS2A 1EZZB 4M7DA 4NS5A 3S3NA 3E9HA 2RI3A 3CCQQ 5DY9A 1OPLA 3BFMA 4LXCA 4R55A 4AFQC 4JJBA 4PJLA 2P4TA 1NNHA 3CD6Q 1K4US 4FM4B 3A5ZB 1M1GA 1B3QA 2JXBA 2X3WD 3UPUA 3TQ7P 5KYWB 3CC7Q 3CBMA 1YJ9A 2K7AA 4YTLA 2E70A 3VS7A 3I5SA 1VYUA 3KXTA 1Y7XA 3H8ZA 3M5AA 4Y92A 2J3LA 2X4JA 3EG0A 4DEYA 4OMMA 2ARSA 1VQ6Q 1M1KC 5CKDA 4QQ6A 3M0UA 1Q86R 1VA7A 5KYYA 2EQUA 3E9FA 2YUPA 4MMKA 3KFUA 3HHTB 2HEQA 2KXDA 4OB2B 4OMQA 4H2XB 1D1CA 2JMAA 4E6RA 1SEMA 5L23A 2DNUA 4HKEA 1K8AU 2KRSA 2ROTA 3EG1A 4ANJA 3VKIA 3EG9A 4UPAA 2I4LA 3CCST 3VS1A 4C8QF 4AG2C 4RMOA 1Q82U 4LNSA 4M7AB 1VQ8A 1ZBJA 2QQSA 2A36A 4P3NA 3EFOA 3M0RA 1N6AA 2AZSA 3P8DA 2RJEA 2E10A 3IKLA 1TUCA 2HL3A 3EFRA 4BD3A 2BTTA 5C6SA 1VQKQ 2E64A 3RUXA 2AMCA 1SERA 4Z88A 4Q15A 1VQ5A 3CEYA 4PJOE 2JM8A 4E7HA 1ZSGA 5KCHA 4JJNK 2M02A 1RI0A 2RHSA 4OGEA 1GCQC 3OYKA 4A4EA 5FROA 3P8VA 4DPGA 1WHGA 1M8MA 2ROLA 2F2VA 1VQNA 1M3CA 2QDLA 3JV3A 3OYDA 4M7AD 2DBKA 5GAN3 2DRMA 3DKMA 2E65A 1G3YA 5KYUB 3THKA 3VS4A 4BY6C 4FYVB 4PJMA 2NUPB 1YB3A 3HXUA 2ZT7A 1PD1A 4FU6A 3QNEA 3CCJT 5LJ5g 3RNJA 3SB2A 4JRQA 1YI2A 4P5NA 3N5BB 2E41A 4HXJA 2JVVA 3QDRB 2QEXA 2Q5HA 2RA2A 3CC2Q 4DA4A 1SRMA 4HCZA 1QKXA 1BKBA 3JB9H 4EX5A 2E6ZA 3OYLA 3NETA 1BB9A 3REAB 3CMEQ 4A54A 4ESRA 3QO8A 2E5KA 1JEGA 2EFIA 1FYFA 4AT1B 4FL6A 4F16A 1ZSZB 4XTVA 3WQZA 3NFCA 4XU2A 4N0AC 4X5OA 3V7SA 2LCSA 2CH4A 2J6OA 4MZTA 2QI2A 2EYWA 3GP8A 1PYSB 4HVVA 2YUOA 5IHKA 3PCOB 1WLEA 3U23A 1BU1A 2FHDA 3OW2P 2ZR3A 2EGAA 4LUDA 3SHWA 2ZT5A 2EKHA 1QCOA 3A8HB 4M7AE 4Z8AA 3QJYA 4E47A 3HFZB 1S72A 3MHXA 1R0BG 3DB3A 3OB9A 2F5TX 2EJFA 3S3MA 1TH7A 2A37A 4C8QG 4LDVA 2DL8A 2DXCA 1X01A 1ZSZC 2LX9A 3CCRA 4HT9A 5IT9E 2DEUA 2YDLA 1YJ9Q 1PKTA 3RDVA 1GFCA 2JS0A 2D8HA 2JTFA
chains in the Genus database with same CATH topology
3L1AA 1X6OA 5FU6B 1VQPA 2QQRA 3V7CA 4L5GA 1VQMA 4A4KA 2DTHA 2FYKA 4WJ3M 3DSQA 3VQWA 3HY1A 4C8QA 4RCBA 4Y28E 5C52B 3L2VA 1WNLA 4N4HA 1OI1A 2RHXA 1D3BB 3MP1A 2IG0A 4K88A 1NJ1A 4M75F 4PLLA 3HXWA 4H2YA 1B8AA 3LYIA 2WSFE 4EDUA 2ARTA 4P73A 4F7UF 3CCMA 1VQOT 1M8VA 2RJFA 1NZ9A 2HAXA 2EQKA 4N4IA 2DTOA 5FU6C 3QYHB 2DJZA 1VQNT 1B7YB 1BI3A 5C0MA 5K1XA 5A2QE 4LVKA 4P72C 2VGMA 4PG3A 5GAOq 1X54A 3HRUA 2OTJA 4ELYC 3G71T 3HXXA 4GLKA 1Y71A 1K9MU 1O75A 1OZ3A 2K3YA 3CPFA 1M4ZA 4M78B 3J81E 4XK8E 3OY9A 3BDLA 1QW1A 1YI2T 3ZBDA 3MP6A 4E7JA 3M9QA 1M90C 2K57A 4H2SA 3C94A 3QXEB 3UGQA 3MO8A 3CBOA 3I7FA 1KHCA 3OYNA 1NYQA 1N9RA 2RHZA 4RCCA 4YROA 2KY9A 3CMAT 3MCAB 3BDUA 4CS3A 3JAME 4M78D 3L4GA 1BYMA 2GFAA 5CKFA 4C92B 4RQFA 2KAFA 4M77F 4BW9A 4TVRA 4H2UA 4NL2A 1YFSA 3A8MB 1EIFA 1QF6A 3CCUA 3M53A 2X35A 3JCMV 3L2ZA 1JJ2A 1KQ1A 4HCCA 2DTIA 4M7DB 2V8IA 4Z02A 2ZT6A 4KBMB 2ZPEB 4IUPA 4KUDK 2YRVA 2EAYA 2RB6A 4MDXA 1N9SA 3CCRT 2NS6A 1EFWA 1WGSA 2XDPA 4C92C 3OW2S 2FB7A 4L59A 1X56A 1YJWT 3CC4T 3EAEA 1K8AC 3E9GA 3F70A 4DQ2A 2GF7A 3LLRA 3PMTA 2QTXA 2DU5A 1Q82C 4QQGA 4QVDA 4UP8A 3VYGA 5CIUA 4MZPA 2EL9A 4HWPA 4YCVA 2LRQA 1ADYA 3OYYA 4M75A 3REXA 4OGCA 4M7DC 4Q6GA 4M78E 4F7UA 2WSCE 3C12A 2PVGB 2QA4T 1EIYA 1HTTA 4CH4A 3PIOA 5FRMA 3TEEA 1YIJT 3OYBA 3CCSA 2CZ0B 4YRLA 4OLFA 3SWNB 3QTCA 4C0ZA 5CQXA 2DQ0A 4BI8B 4ZN3A 4CRIA 2XU8A 2P0LA 2QHVA 2DK3A 2AMCB 1ADJA 3RKWA 4ZGDB 2CYZB 5EG2A 5GAMj 5D6XA 2RHSB 4J8OA 3DLMA 4H2VA 2QHUA 1V29B 2XI9A 3VV0A 2LQKA 3GNFB 2V8JA 5J39A 2BUDA 3J80E 3QUIA 4EO4A 2MWPA 1ASZA 4XTYA 3PZCA 2CGHA 1KQSS 4UC4A 4ATOA 3HFOA 3WVEB 4B9WA 4A4GA 4BE2A 2PVOB 2YHTA 4QVCA 2ALYA 3CCJA 1BBUA 4ZIBA 3J7AF 1Z7NA 4M77A 4M7DG 3HY0A 1YJNT 2XHCA 5D6WA 1MGQA 4PJOF 3HP9A 1EQRA 4J7FA 2G4CA 1ZBXA 1WQ7A 3MF1A 4HVCA 4EMGA 1RL2A 5CR2A 1Y96A 2VXFA 2XG8D 1VQZA 3EFSA 3TU4K 2DD4A 1U1TA 2AKWB 4C5GA 4L87A 4HT4A 4PNOA 1IL2A 3JB9J 5DLQE 4OB3B 3JCMh 4IKFA 3RIRA 4EMKA 2ZPHB 4YRJA 3LGFA 3X24B 5HKCA 2ZNIA 5GAOr 4ELZC 3GOXA 3A7RA 3HXZA 3OYIA 3I55T 3A5YA 3NTKA 1FWZA 3OBYA 3OYMA 5M9OA 4FT4A 2DVEA 2QHSA 4XEOA 3UH0A 1VIFA 3T9NA 2LT4A 1VUBA 3JCMP 3AHUA 1PSFA 2R5AA 3RERA 5GAOl 4YRIA 3E9IA 5LJ5d 2ZIOA 3WXMB 4C8QB 5GMKm 3L2QA 3FEOA 1I81A 5A0GA 5CKHA 3MEVA 4A4HA 2J3MA 2CZ6B 4LD9K 1U8RA 5KNNA 4BY6B 1H4QA 4YCWA 4YRPA 1VQOA 4E51A 4M7AF 1Y07A 2JTMA 3A74A 1J5WA 1K9MC 2VGNA 2DO3A 5I21A 2GFUA 4DOWA 1E1OA 2Q7EA 5A0LA 2MMPA 1UGSB 3RESA 1HK9A 3R07A 2DIGA 4C8QC 4HWRA 2CZ7B 1B70A 3ASKA 3G71A 3C4SA 3M4GA 4E7IA 4WF2A 1DJ7B 5KE3A 1NJ6A 3A8OB 2ZR2A 4PJOG 2A7YA 2YLBA 5C53B 4YRKA 1N27A 3V8KA 4P3PA 4P73C 3KUFA 2I2LA 3TREA 4JLGA 2GQVA 2RJCA 5LJ5f 4PJOA 2H3JA 4TVWA 3SFMA 1HC7A 3JCMe 2XD0A 2RH2A 3CMAA 2KVQG 2KK4A 3ER0A 3L4GB 2IY5A 4YRMA 1EOVA 2FVUA 1W2BS 1H3ZA 4FIBA 4UP7A 4PLIA 3NELA 3OBWA 4II1A 1UGRB 3OYEA 2K2VA 4LVIA 4H2WA 3PMIA 2K5IA 4XAXB 3P8HA 2B8AA 5GAOp 4E7KA 4JS5A 4CH3A 2EIFA 4ZTFA 2DIQA 2MWOA 3BJUA 4QW2A 2ZTGA 3PT9A 5GANh 3LSSA 3UDCA 3PGGA 2NLUA 4Y91A 4YYEA 3JCMb 4XTWA 1GXIE 5E3IA 2DEQA 4RKUE 2JN0A 4ME7A 4XTZA 3FRNA 3JCMJ 3MEAA 1YJWA 3RACA 3CC4A 1XTDA 5IN1A 4KT0E 3LWIA 2M1HA 3V7RA 2ZINA 2DXBA 5FU7B 4YDQA 2CJAA 3FC3A 4BI3A 4H2TA 2OTLT 3CBPA 4YRSA 3IG2A 4M75B 1Z7MA 2QA4A 5KH6A 4F7UB 1WJRA 2V8KA 4M7AA 2X4YA 5LJ3e 1YIJA 1B34A 5GAN5 4CS2A 3NEMA 4TVYA 5GAMh 4MZMA 2Y4XA 1NYRA 2AHJB 2JZ2A 5CK9A 5CAIA 3JCMd 2HNIA 4BE0A 4BDYA 1Q81C 5FU7C 4XTXA 4JRPA 4P3OA 2L5QA 3MEWA 3M55A 1W4SA 3HL8A 1VQ4T 2RO0A 1SETA 4BUGA 1KHIA 4M75C 3G4ST 4LDXA 4OP0A 1G3WA 4P74A 3OMCA 2DXTA 1G5VA 2ODRC 1I5LA 2CKKA 3A7AA 4JUVA 4J6YA 3RMQA 4HWSA 3M58A 5LJ3j 4OVAA 3Q1JA 2VXEA 2I4MA 3G1ZA 4X34A 2JNGA 4M78F 5IAYA 2A8EA 1YITA 2E5QA 2R57A 3OW2A 4IUQA 3M54A 3OS5A 2ZNJA 3WVDB 3R6OA 2L89A 3A8GB 1E1TA 4FSXA 5GANe 1YJNA 3X26B 4YPFA 2PUOB 4OB0B 3JCMg 3V8JA 2K5LA 1YHQT 1QVGS 1KC8U 2RK2A 2X4WA 3VBBA 4A53A 2QHTA 3VUZA 1KD1C 4UP9A 1QP2A 4K86A 3JCMf 3JB9F 4PHCA 1WQWA 4HA8A 4JRKA 3X25B 4CH5A 2QXFA 3HFVA 1UGQB 4C92D 3HRKA 2C06A 3A8LB 1K73C 4EPCA 3MF2A 1N9WA 2PMEA 2EQJA 4M75G 3HFZA 1KMNA 4M77C 4KR2A 3S6WA 5HK0A 3SDZA 4YP0A 4YRQA 1X55A 4EMKB 5ELOA 1G5IA 1AHJB 2M9UA 4EMHA 4F7UG 5GANj 3ZFJA 3I55A 5F5WA 2ZZGA 3BW1A 5GAMe 1LNXA 4M7DD 4WI1A 4RMFA 2ZCEA 2DXUA 2WACA 4JDSA 4YRCA 2VC8A 1NPRA 4XU0A 3PFSA 2L3RA 3DB4A 1JJCA 1KQSA 2CJBA 2EJGA 1VQ7T 4O5VA 4EMKC 4YREA 1X75C 3BY7A 4IURA 1BI0A 3UWNA 5FLXE 3L2UA 1MHNA 3UGTA 1Q7YU 2KSSA 3NTHA 2QQAA 3GPLA 4Q5WA 1N8RU 1X2HA 5I2SA 2VV5A 4JLIA 1B7YA 2ZZDA 1YFTA 2Q7HA 1QVFS 4C92E 4G84A 1W66A 3HRIA 2LC4A 2QQBA 2P0QA 2FL7A 3QG1A 1P92A 1UB4A 2G3RA 4D6WA 1M1FA 2CIMA 2D9TA 1Q81U 4M77G 1NJIU 5GAOn 1B70B 3HRTA 1BIAA 4XEMA 4CS4A 2E1HA 1ZQ1A 1YITT 4HT8A 4M7DE 3M4QA 1GGMA 1H4SA 1E22A 4RG8A 2ZPFB 3JB9G 1OZ2A 2DPPB 4FT2A 2E3CA 4OF1A 2RK1A 1WYDA 3CCET 5HK3A 2IVWA 3HKSA 4J6XA 5GMKj 3CXCS 3ICAA 5I2MA 1WJSA 2ZPBB 2XICA 4PJOB 4TWAA 1BI2A 3OD1A 2RI2A 1BIBA 3CMEA 3VYHB 4TQFA 3P8YA 5GANg 5CKBA 2LT1A 2VYTA 5DM7R 2RHQA 2RHUA 3A31A 5L8RE 3CCLT 2IY5B 5GAN2 3QKJA 2MAMA 1Q86U 1VQ9T 2JOYA 4A4FA 4BE1A 3CCQT 4LDWA 2PMFA 3NTIA 2BKDN 3QIIA 4PL6A 3LH0A 2XIDA 1H4VB 2GCXA 1KD1U 3CD6T 3HFNA 4XU3A 4HCBA 1L0WA 3PIPA 4B9XA 4PJOC 2PVDB 4WJ4A 4LDYA 3CC7T 3FIFA 2E5AA 2Q5IA 4C0GA 1YBYA 5CKEA 1LOJA 1K73U 5CO7A 2PQWA 1IREB 3M56A 3QZ5B 4RDXA 1VQ6T 1YCYA 12ASA 2I4NA 1G5HA 2XTIA 1M5Q1 4ZGEB 4H02A 5GAMg 3CMQA 4MDWA 4TVAA 1XOVA 4C0DC 4P75A 2A3LA 3TEGA 2OTLA 2PUKB 5GAMf 3CPWS 3W3SA 1BBWA 1O9SA 4MMLA 1H4TA 1XNIA 5D6YA 3V8LA 4XU1A 2XDDA 3LC0A 1VQKT 2K4YA 3SWNA 1B34B 3NENA 4LVMA 4C5EA 3G7ZA 3OMGA 3RMSA 4C8QD 3SD4A 1KOGA 1ZHIA 3IKMB 2K5FA 3I56A 2EYQA 2DD5A 3E19A 2Q7GA 3QPHA 4NL3A 11ASA 3OYFA 4NCXA 5GMKi 4L6V5 1W2BA 4PKCC 2DAQA 5CCAA 5LJ3h 3OYGA 1VQ4A 3G4SA 5HY6A 2F5KA 1YGBA 2LDMA 4DOVA 3M4PA 3M59A 4BDZA 1KQ2A 1JBMA 3M4YA 2DZ9A 1R8OB 3GNGA 1NJ2A 2LCLA 4M7AC 1VIEA 3LWHA 3TEHA 3E1SA 4BWAA 4IUTA 3CC2T 3OS0A 1KC8C 1E24A 2ZZFA 3QHSA 3VQXA 4BI4A 3CMET 4CH6A 4E7LA 4OMFB 1FX7A 3OYJA 1OYXA 4C0FA 3VQVA 3JSCA 4ZTUB 4P74C 1B76A 1QVPA 3HXVA 3IALA 2M16A 3OS1A 1EVLA 1YHQA 4IUUA 3MP8A 2O01E 2F69A 2O4XA 4C8QE 3A7UA 4KUIA 2M0OA 2QDYB 3ME9A 1X2GA 3QO5A 3FJPA 5AYFA 2LVMA 1USYC 2AKWA 3PNWC 2MF2A 1HXDA 2ZPIB 2XK0A 3X20B 3A5ZA 1NE8A 4XTUA 5ELNA 4J83A 2ZCFB 3M57A 3MEYA 4ZN1A 3UT1A 4NOYA 3REUA 1YJ9T 1PSEA 4J5YA 5HGQA 1C0AA 3VU3C 4M7AG 4KR3A 2K3XA 1SESA 4OB1B 3LX7A 2RJDA 3FDRA 4H2XA 1WU7A 1H641 1VQLA 2DKGA 3LGLA 3S3OA 2RD1A 4BACA 2D0QB 1Q7YC 1G3TA 1UGPB 2ZGWA 2HQEA 2RHYA 3CCVA 5C51B 3HSBA 2JUFA 4YRTA 1N8RC 1EIYB 3INZA 1YFRA 1NJ8A 4C5HA 4G85A 1VQ8T 1M1KU 3ZEHA 5KE2A 1JJCB 2OAUA 4LD6A 1VQ7A 2ZXFA 2EWNA 4X9DA 1LYLA 2L8DA 2WSEE 4YRRA 3I56T 1VQ5T 1RIQA 3GF5A 2CJ9A 3O8VA 1NJIC 3HXYA 4M75D 1U1SA 1ATIA 5GAOm 3QO3A 2LQ8A 2LTOA 1WPYA 2ODRD 1QVGA 2BIVA 5K1PA 2DDZA 3RF1A 2MI6A 3QBYA 2KQWA 1BI1A 1G3SA 5GAN6 1SRYA 4N0AA 4HWOA 3JRZA 3FLGA 3VQYA 2EKOA 4X9CA 1LJOA 3UFGA 2LNVA 1USYA 3QSUA 5LL6S 5GMKh 2EQMA 3OSVA 3GIBA 2C7IA 3QYGB 3OA6A 3JB9I 4RG2A 4YCUA 3OSSC 1KG1A 2ALYB 4AH6A 2QEXT 1WJQA 2LCCA 1M9SA 4K87A 3X28B 4JS4A 3CCEA 4M77B 1Q86C 2Y90A 4ZGJB 2PU9B 3G6EA 2R5MA 3META 2RM4A 1NPPA 2DZCA 4C92F 3VUBA 4LDUA 5LJ5h 1PYSA 4P71C 1JRIA 1Y96B 2RHQB 4M78C 3CCLA 4BB7A 2ZT8A 3PCOA 4M75E 3RKYA 3LW5E 3JCMc 1VQ9A 2E12A 4M77D 5LJ3d 3JCMQ 3CCQA 1KMMA 5J3BA 4F7UE 3ERRA 2CS7A 3DLLA 3QO7A 3CD6A 4XQ3A 1S72T 5FRNA 4M7DF 4KULA 3HPWA 2QQ9A 5GMKl 3JCMW 4TTVA 3KBGA 2DU7A 3OYHA 1I4K1 4VUBA 2HBPA 3JB9D 3CC7A 3LSQA 3MQZA 3HRSA 1QVFA 5GAN4 2ZZEA 3OYAA 1VQLT 1VQPT 2DQ3A 1VQ6A 1VQMT 4P72A 3CCVT 1D3BA 3H6ZA 4TVAB 3P8BB 3PTAA 1QE0A 3TCJA 2VUBA 2X4XA 3RL6A 4R56A 2XKOC 2E6NA 3A32A 1JJ2S 3JCMX 1XQHA 2KMTA 4V2SA 4N4GA 3CCMT 5LJ3g 2CZ1B 4LVJA 5A0DA 1VQKA 3TUPA 3RKXA 5GANd 2I4OA 5GMKe 5CQYA 3CXCA 4M78G 5LJ3f 4M77E 4HWTA 3RGLA 2RI5A 2ZPGB 2OTJT 4TQDA 4RQEA 2D6FA 1FXXA 3URGA 2XDBA 3QZ9B 4ZTJA 5KCOA 1NJ5A 2C8MA 1SSFA 4QVZA 4P75C 4P71A 2HD0A 1G51A 4M78A 3C95A 5DLOA 3FB9A 4YRNA 3QJ6A 4C5IA 2Y4YA 4CI0C 1I8FA 5J26A 3OQ5A 3HTZA 2P0PA 4C92G 5LJ5e 4ZTZB 5CVIA 3P8TA 2ZIMA 3MEUA 3SWNC 4IUVA 5GAN7 4O2DA 4GY5A 3TEHB 1EVKA 2ARUA 3VJPA 2P0KA 2XGTA 3CC2A 3L2WA 3G6ET 3L42A 5GAMd 4YRFA 4YRGA 2EJ9A 4C92A 2RHIA 1JB0E 1QP3A 4O6JA 2YLCA 1M90U 2KDSA 3L2RA 4JRIA 2R58A 1IZ6A 4J7IA 5GANf 3CCUT 2HQXA 1ASYA 3CPWA 3OYCA 3GLXA 4J15A 4KQEA 4LVLA 2P5IA 4C0DB 4PJOD 4QQDA 4J6WA 5LJ5j 1UEBA 2O4XB 5GAN8 3OS2A 4M7DA 4NS5A 3S3NA 3E9HA 2RI3A 5DY9A 3BFMA 4R55A 2P4TA 1NNHA 4FM4B 3A5ZB 1M1GA 3UPUA 3CBMA 1YJ9A 4YTLA 2E70A 3KXTA 1Y7XA 3H8ZA 3M5AA 2J3LA 2X4JA 2ARSA 1M1KC 5CKDA 4QQ6A 2EQUA 3E9FA 4MMKA 3KFUA 3HHTB 4OB2B 4H2XB 4HKEA 1K8AU 3VKIA 4UPAA 2I4LA 3CCST 4C8QF 4RMOA 1Q82U 4LNSA 4M7AB 1VQ8A 2QQSA 4P3NA 1N6AA 3P8DA 2RJEA 2E10A 3IKLA 3EFRA 4BD3A 5C6SA 2AMCA 2E64A 3RUXA 1SERA 4Q15A 1VQ5A 3CEYA 4PJOE 4E7HA 5KCHA 4JJNK 1RI0A 2RHSA 4OGEA 3OYKA 4A4EA 5FROA 3P8VA 4DPGA 1VQNA 3OYDA 4M7AD 5GAN3 3DKMA 2E65A 1G3YA 4BY6C 1YB3A 3HXUA 2ZT7A 4FU6A 3QNEA 3CCJT 5LJ5g 3SB2A 4JRQA 1YI2A 4P5NA 3N5BB 2E41A 2JVVA 3QDRB 2QEXA 2Q5HA 2RA2A 4DA4A 4HCZA 1BKBA 3JB9H 4EX5A 2E6ZA 3OYLA 3NETA 4A54A 3QO8A 2EFIA 1FYFA 4FL6A 4XTVA 3WQZA 3NFCA 4XU2A 4N0AC 4X5OA 3V7SA 4MZTA 2QI2A 3GP8A 1PYSB 3PCOB 1WLEA 2FHDA 2ZR3A 2ZT5A 3A8HB 4M7AE 3QJYA 4E47A 3HFZB 1S72A 3MHXA 3DB3A 3OB9A 2F5TX 2EJFA 3S3MA 1TH7A 4C8QG 4LDVA 2DXCA 1X01A 2LX9A 3CCRA 4HT9A 5IT9E 2JTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCO A;  3L1A A;  1GGM A;  4E51 A;  4M7A F;  4M75 E;  3RKY A;  1H4S A;  1E22 A;  3V7C A;  3JCM c;  3JB9 G;  3A74 A;  1J5W A;  4M77 D;  5LJ3 d;  2DTH A;  2FYK A;  2E3C A;  3JCM Q;  1KMM A;  1WYD A;  4WJ3 M;  5I21 A;  1E1O A;  3DSQ A;  2Q7E A;  4F7U E;  3VQW A;  3ERR A;  3HY1 A;  4C8Q A;  4RCB A;  5C52 B;  3RES A;  1WNL A;  1HK9 A;  4J6X A;  5GMK j;  3QO7 A;  3ICA A;  4XQ3 A;  1D3B B;  3R07 A;  4C8Q C;  4PJO B;  4M7D F;  4HWR A;  1B70 A;  4TWA A;  4K88 A;  5GMK l;  3JCM W;  4TTV A;  1NJ1 A;  3M4G A;  3OD1 A;  2DU7 A;  1BIB A;  1I4K 1;  4M75 F;  4WF2 A;  3JB9 D;  1NJ6 A;  3LSQ A;  4TQF A;  3P8Y A;  2ZR2 A;  4PJO G;  5GAN g;  3HXW A;  4H2Y A;  2YLB A;  5C53 B;  1B8A A;  2RHQ A;  2ART A;  4P73 A;  4YRK A;  4F7U F;  3A31 A;  1M8V A;  3V8K A;  5GAN 4;  2ZZE A;  5GAN 2;  2IY5 B;  2DQ3 A;  4P3P A;  2DTO A;  4P73 C;  2I2L A;  4P72 A;  2DJZ A;  2PMF A;  1B7Y B;  5K1X A;  4P72 C;  5LJ5 f;  5GAO q;  1H4V B;  1X54 A;  1D3B A;  4PG3 A;  4TVA B;  4PJO A;  3HFN A;  4XU3 A;  1QE0 A;  3RL6 A;  1L0W A;  4TVW A;  1HC7 A;  3JCM e;  4PJO C;  3HXX A;  4WJ4 A;  3A32 A;  3FIF A;  2E5A A;  3JCM X;  2Q5I A;  4V2S A;  1LOJ A;  3L4G B;  4M78 B;  2IY5 A;  5LJ3 g;  1EOV A;  4YRM A;  4RDX A;  4UP7 A;  1YCY A;  3TUP A;  3RKX A;  12AS A;  5GAN d;  2I4O A;  3NEL A;  2I4N A;  1G5H A;  5GMK e;  2XTI A;  1M5Q 1;  4M78 G;  4H02 A;  2K57 A;  4H2S A;  5LJ3 f;  5GAM g;  4M77 E;  3UGQ A;  4HWT A;  3CMQ A;  3RGL A;  4TVA A;  3I7F A;  4H2W A;  5GAO p;  1NYQ A;  4TQD A;  4CH3 A;  4RQE A;  1N9R A;  4P75 A;  3TEG A;  3BJU A;  1NJ5 A;  5GAM f;  2C8M A;  2ZTG A;  3W3S A;  4RCC A;  1BBW A;  4YRO A;  5GAN h;  3LSS A;  3PGG A;  3BDU A;  4Y91 A;  4CS3 A;  4MML A;  4P75 C;  1H4T A;  4P71 A;  4M78 D;  4YYE A;  3L4G A;  3JCM b;  1G51 A;  4M78 A;  4XTW A;  4C92 B;  5E3I A;  3FB9 A;  4YRN A;  4RQF A;  4M77 F;  2DEQ A;  4BW9 A;  2JN0 A;  4H2U A;  3V8L A;  4NL2 A;  1I8F A;  4XU1 A;  3LC0 A;  4XTZ A;  3JCM J;  1YFS A;  3HTZ A;  4C92 G;  3SWN A;  1B34 B;  3RAC A;  5LJ5 e;  4ZTZ B;  1QF6 A;  3NEN A;  3P8T A;  2ZIM A;  3SWN C;  4C8Q D;  5GAN 7;  1KOG A;  4O2D A;  3V7R A;  3JCM V;  2ZIN A;  3IKM B;  3TEH B;  1EVK A;  2CJA A;  4YDQ A;  3L2Z A;  2ARU A;  4H2T A;  2Q7G A;  2XGT A;  1KQ1 A;  4NL3 A;  2DTI A;  4M7D B;  11AS A;  5GAM d;  4NCX A;  4YRF A;  4YRS A;  5GMK i;  2ZT6 A;  3IG2 A;  4M75 B;  4YRG A;  2EJ9 A;  4C92 A;  2EAY A;  5LJ3 h;  2RB6 A;  1N9S A;  1Z7M A;  1EFW A;  2YLC A;  4C92 C;  4F7U B;  1YGB A;  4M7A A;  5LJ3 e;  2FB7 A;  4JRI A;  1B34 A;  1X56 A;  3M4P A;  5GAN 5;  4CS2 A;  3NEM A;  4TVY A;  1KQ2 A;  1JBM A;  5GAM h;  2DZ9 A;  1NJ2 A;  5GAN f;  4M7A C;  4DQ2 A;  1NYR A;  5CAI A;  1ASY A;  2QTX A;  3TEH A;  2DU5 A;  4J15 A;  4KQE A;  2P5I A;  4QVD A;  4UP8 A;  3JCM d;  4BWA A;  2HNI A;  4PJO D;  4J6W A;  5LJ5 j;  5GAN 8;  4M7D A;  2EL9 A;  4HWP A;  4YCV A;  4XTX A;  3E9H A;  1E24 A;  1ADY A;  2ZZF A;  4P3O A;  3QHS A;  5DY9 A;  4M75 A;  3REX A;  3VQX A;  3BFM A;  4M7D C;  1SET A;  1NNH A;  4CH6 A;  4M75 C;  4Q6G A;  4OP0 A;  4M78 E;  4F7U A;  1EIY A;  1HTT A;  4P74 A;  4CH4 A;  2DXT A;  3VQV A;  4YRL A;  4ZTU B;  2ODR C;  1I5L A;  4P74 C;  1B76 A;  3HXV A;  3IAL A;  3A7A A;  4JUV A;  1EVL A;  4J6Y A;  4OLF A;  3SWN B;  3QTC A;  4HWS A;  5LJ3 j;  2DQ0 A;  2J3L A;  2VXE A;  4C8Q E;  2I4M A;  3A7U A;  2ARS A;  3G1Z A;  2P0L A;  2QHV A;  4M78 F;  2AMC B;  1X2G A;  3QO5 A;  3FJP A;  1ADJ A;  3RKW A;  1USY C;  2AKW A;  4MMK A;  3KFU A;  1HXD A;  4H2X B;  5GAM j;  2ZNJ A;  2RHS B;  3A5Z A;  4XTU A;  5ELN A;  1E1T A;  4H2V A;  5GAN e;  4UPA A;  2QHU A;  3MEY A;  2I4L A;  4C8Q F;  3REU A;  4NOY A;  4YPF A;  4LNS A;  4M7A B;  4J5Y A;  3JCM g;  3V8J A;  3QUI A;  4EO4 A;  4P3N A;  5HGQ A;  1C0A A;  1ASZ A;  4XTY A;  3VBB A;  4A53 A;  3VU3 C;  2E10 A;  2QHT A;  3IKL A;  3PZC A;  2CGH A;  3EFR A;  4UP9 A;  4M7A G;  4KR3 A;  2AMC A;  2E64 A;  3RUX A;  3HFO A;  1SER A;  4K86 A;  3JCM f;  3JB9 F;  1SES A;  4Q15 A;  4PHC A;  4PJO E;  2YHT A;  1WQW A;  4HA8 A;  4JRK A;  4CH5 A;  4H2X A;  1WU7 A;  1H64 1;  4QVC A;  2ALY A;  2RHS A;  3HFV A;  2DKG A;  1BBU A;  4ZIB A;  4C92 D;  1Z7N A;  3HRK A;  3P8V A;  4DPG A;  2RD1 A;  4M77 A;  3MF2 A;  1N9W A;  2PME A;  4M7D G;  2ZGW A;  3HY0 A;  5C51 B;  3HSB A;  4YRT A;  4M7A D;  4M75 G;  3HFZ A;  3INZ A;  1KMN A;  1YFR A;  1NJ8 A;  4M77 C;  5GAN 3;  1EIY B;  4KR2 A;  4G85 A;  1MGQ A;  4YP0 A;  4YRQ A;  1X55 A;  4EMK B;  1JJC B;  4PJO F;  5ELO A;  1G5I A;  1EQR A;  2ZXF A;  2E65 A;  4EMH A;  2EWN A;  4X9D A;  4F7U G;  5GAN j;  1LYL A;  2G4C A;  4HVC A;  1WQ7 A;  3MF1 A;  5F5W A;  4EMG A;  4YRR A;  2ZZG A;  3BW1 A;  5GAM e;  1Y96 A;  1LNX A;  2VXF A;  1YB3 A;  1RIQ A;  4M7D D;  1VQZ A;  3HXU A;  4WI1 A;  4RMF A;  2CJ9 A;  2ZCE A;  2DXU A;  2ZT7 A;  3EFS A;  3QNE A;  3HXY A;  4YRC A;  4M75 D;  5LJ5 g;  2VC8 A;  1U1S A;  3SB2 A;  1ATI A;  4XU0 A;  5GAO m;  1U1T A;  2AKW B;  3QO3 A;  2E41 A;  4L87 A;  2Q5H A;  1WPY A;  2RA2 A;  4PNO A;  2ODR D;  1IL2 A;  3JB9 J;  5K1P A;  3JB9 H;  4EX5 A;  3JCM h;  2DDZ A;  3RIR A;  3RF1 A;  3NET A;  4EMK A;  1JJC A;  4YRJ A;  2CJB A;  2EJG A;  4A54 A;  5GAN 6;  1SRY A;  2ZNI A;  4N0A A;  5GAO r;  3QO8 A;  4HWO A;  1FYF A;  3A7R A;  4EMK C;  4YRE A;  3HXZ A;  3A5Y A;  4XTV A;  3BY7 A;  3WQZ A;  3VQY A;  4XU2 A;  4X9C A;  4N0A C;  4X5O A;  1LJO A;  3UFG A;  3V7S A;  1USY A;  3UGT A;  3QSU A;  5GMK h;  3GIB A;  2DVE A;  2C7I A;  2QHS A;  4XEO A;  3UH0 A;  1PYS B;  3JB9 I;  1X2H A;  4YCU A;  3PCO B;  3JCM P;  4JLI A;  1B7Y A;  1WLE A;  3AHU A;  1YFT A;  2ALY B;  4AH6 A;  2Q7H A;  4C92 E;  4G84 A;  1W66 A;  3HRI A;  3RER A;  5GAO l;  4K87 A;  4YRI A;  2ZR3 A;  3E9I A;  5LJ5 d;  4M77 B;  2ZIO A;  2ZT5 A;  4C8Q B;  4M7A E;  5GMK m;  2Y90 A;  3HFZ B;  2CIM A;  1I81 A;  4M77 G;  2EJF A;  2RM4 A;  1TH7 A;  5GAO n;  4C8Q G;  1B70 B;  2J3M A;  2DZC A;  5KNN A;  1X01 A;  1H4Q A;  1BIA A;  4HT9 A;  4YCW A;  4XEM A;  4C92 F;  4CS4 A;  4YRP A;  5LJ5 h;  2E1H A;  1PYS A;  4P71 C;  1JRI A;  1Y96 B;  4HT8 A;  4M7D E;  3M4Q A;  2RHQ B;  4M78 C;  2ZT8 A; 
#chains in the Genus database with same CATH topology
 3L1A A;  1X6O A;  5FU6 B;  2Z0W A;  4EIK A;  1VQP A;  2QQR A;  3V7C A;  4L5G A;  1VQM A;  1QMC A;  2CSI A;  4F14 A;  4D8D A;  2ED0 A;  4A4K A;  2DTH A;  2FYK A;  4WJ3 M;  1YN8 A;  3DSQ A;  1W6X A;  3VQW A;  3HY1 A;  4C8Q A;  4RCB A;  2HSP A;  4Y28 E;  5C52 B;  3L2V A;  1WNL A;  1BCO A;  4N4H A;  1OI1 A;  2RHX A;  1D3B B;  3MP1 A;  2IG0 A;  2FPF A;  4K88 A;  5AT1 B;  1NJ1 A;  4M75 F;  4PLL A;  1M3B A;  1FMW A;  1JXO A;  5I22 A;  3HXW A;  4H2Y A;  2X51 A;  1VQ8 Q;  1B8A A;  3LYI A;  2WSF E;  4EDU A;  1D1A A;  1QLY A;  2ART A;  4P73 A;  2VAS A;  2G6F X;  4F7U F;  3CCM A;  1VQO T;  1M8V A;  2RJF A;  1NZ9 A;  4RTV A;  1CKA A;  2HAX A;  2EQK A;  4N4I A;  2DTO A;  5FU6 C;  1E6G A;  1WHH A;  3QYH B;  2DJZ A;  3I56 Q;  1VQ5 Q;  1VQN T;  1B7Y B;  1QCN A;  1BI3 A;  5C0M A;  5K1X A;  1GBR A;  5A2Q E;  1RAE B;  4P72 C;  4LVK A;  2VGM A;  4QT7 A;  4PG3 A;  5GAO q;  1X54 A;  1J3T A;  3HRU A;  2OTJ A;  4ELY C;  2FZK B;  3M0Q A;  2J6K A;  1QCF A;  1TOV A;  2DJQ A;  3G71 T;  1M2V B;  1KQS P;  3ULR B;  3HXX A;  2JM9 A;  2RF0 A;  4GLK A;  1Y71 A;  2KYB A;  1SPK A;  4JPB W;  1K9M U;  1O75 A;  1OZ3 A;  2K3Y A;  3CPF A;  1D0Y A;  1M4Z A;  1ZLM A;  4M78 B;  1B7T A;  3J81 E;  2QGG A;  4XK8 E;  3OY9 A;  3BDL A;  1QW1 A;  1YI2 T;  2ESW A;  3ZBD A;  3MP6 A;  4E7J A;  3M9Q A;  1M90 C;  2K57 A;  4H2S A;  3C94 A;  3QXE B;  3UGQ A;  3MO8 A;  4FCY A;  3CBO A;  2CSQ A;  3I7F A;  1KHC A;  3OYN A;  2LP5 A;  8ATC B;  1NYQ A;  2JT4 A;  3SEM A;  1N9R A;  2QEX Q;  1IRX A;  2RHZ A;  4RCC A;  4YRO A;  2KY9 A;  3CMA T;  3MCA B;  1RUW A;  3BDU A;  4CS3 A;  1SF9 A;  3JAM E;  4M78 D;  3L4G A;  2H8H A;  1BYM A;  2GFA A;  5CKF A;  4C92 B;  2HKN A;  4RQF A;  2KAF A;  4M77 F;  1KSW A;  4BW9 A;  4TVR A;  4H2U A;  4NL2 A;  1YFS A;  4DBH A;  3A8M B;  1EIF A;  2LNH B;  1QF6 A;  3CCU A;  3M53 A;  2FRW A;  2KE9 A;  2X35 A;  3JCM V;  2LJ1 A;  3L2Z A;  2YUQ A;  1JJ2 A;  5IXB A;  1KQ1 A;  4HCC A;  2DTI A;  4M7D B;  2ABL A;  2KT1 A;  2DYB A;  2V8I A;  2EVR A;  4Z02 A;  1LPL A;  2ZT6 A;  4KBM B;  2K6D A;  2QK0 A;  2ZPE B;  4IUP A;  4KUD K;  2YRV A;  2EAY A;  2RB6 A;  4MDX A;  1N9S A;  3CCR T;  2NS6 A;  1EFW A;  1WGS A;  2XDP A;  2ECZ A;  1S72 Q;  1JO8 A;  2HZY A;  4C92 C;  2DM1 A;  1NEG A;  3OW2 S;  4AG1 C;  1SG5 A;  2FB7 A;  4L59 A;  1NEB A;  1X56 A;  4LNP A;  1YJW T;  3CC4 T;  1S1N A;  3EAE A;  1K8A C;  3E9G A;  3MJX A;  3R6N A;  2DA9 A;  3F70 A;  4DQ2 A;  2GF7 A;  3TSZ A;  3LLR A;  3PMT A;  2QTX A;  2DU5 A;  2L3S A;  1Q82 C;  4QQG A;  4QVD A;  4UP8 A;  1VQL Q;  1VQP Q;  3VYG A;  5CIU A;  2CP7 A;  4MZP A;  1IXD A;  1VQM Q;  1M3A A;  2EL9 A;  4HWP A;  4YCV A;  2LRQ A;  1ADY A;  3OYY A;  2FPE A;  4M75 A;  1MV3 A;  3REX A;  5KYY B;  4OGC A;  1TG0 A;  4M7D C;  3CCV Q;  3PE0 A;  4Q6G A;  4M78 E;  4F7U A;  2WSC E;  3C12 A;  2PVG B;  1PNJ A;  2QA4 T;  1T0J A;  1HTT A;  4CH4 A;  1EIY A;  1GL5 A;  2CRE A;  3PIO A;  5FRM A;  3EG9 B;  3TEE A;  1YIJ T;  3OYB A;  3CCS A;  2CZ0 B;  4YRL A;  2E3H A;  2DL5 A;  2OAW A;  2YSQ A;  4X1V A;  4OLF A;  3SWN B;  3QTC A;  3CCM Q;  3EFO B;  4C0Z A;  5CQX A;  9ATC B;  2DQ0 A;  4BI8 B;  4ZN3 A;  1G8X A;  2AT1 B;  2CP3 A;  2VVK A;  4CRI A;  2XU8 A;  2P0L A;  1BBZ A;  2QHV A;  2DK3 A;  2AMC B;  2CT3 A;  1ADJ A;  2FPD A;  1QWE A;  3RKW A;  4ZGD B;  2CYZ B;  5EG2 A;  5GAM j;  2C0O A;  5D6X A;  2RHS B;  2KYM A;  2OTJ Q;  2COY A;  4J8O A;  1OOT A;  3DLM A;  1BK2 A;  4H2V A;  2QHU A;  1V29 B;  2LJ0 A;  2XI9 A;  2QG9 B;  3VV0 A;  2LQK A;  1PKS A;  3GNF B;  2DMO A;  2V8J A;  4PK4 A;  5J39 A;  2BUD A;  4KH1 B;  3J80 E;  3QUI A;  4EO4 A;  4B6M A;  1VYT A;  2MWP A;  4XTY A;  1ASZ A;  2RQW A;  3PZC A;  3VS5 A;  2CGH A;  1KQS S;  4UC4 A;  4ATO A;  3HFO A;  4FW1 A;  3WVE B;  4B9W A;  2JW4 A;  2KXC A;  4A4G A;  4BE2 A;  2PVO B;  2YHT A;  2QGF B;  4QVC A;  2ALY A;  3CCJ A;  2NYS A;  2COZ A;  1BBU A;  4ZIB A;  3J7A F;  1Z7N A;  4RTX A;  4M77 A;  2YWW A;  4M7D G;  1NBE B;  1W2B P;  3HY0 A;  1YJN T;  3G6E Q;  5FWC A;  1ZUK A;  2XHC A;  1YWP A;  5D6W A;  1MGQ A;  4PJO F;  1OQK A;  3EGX A;  3HP9 A;  1EQR A;  1C0M A;  4J7F A;  2G4C A;  1ZBX A;  1WQ7 A;  3MF1 A;  4HVC A;  3NHN A;  4EMG A;  2NUT A;  1RL2 A;  3EH1 A;  4LE9 A;  2L0A A;  5CR2 A;  1Y96 A;  2VXF A;  2XG8 D;  1VQZ A;  4R0K A;  3EFS A;  3CCU Q;  3TU4 K;  4OML A;  2DD4 A;  1SRL A;  1U1T A;  1TXQ A;  2AKW B;  2D0N A;  4C5G A;  4L87 A;  4HT4 A;  4PNO A;  1IL2 A;  3JB9 J;  5DLQ E;  4OB3 B;  1OX8 A;  3JCM h;  4IKF A;  3RIR A;  2P84 A;  4EMK A;  2ZPH B;  4YRJ A;  2SEM A;  3LGF A;  3X24 B;  5HKC A;  1IGU A;  2ZNI A;  5GAO r;  4ELZ C;  3GOX A;  3A7R A;  2FG0 A;  3HXZ A;  3OYI A;  3I55 T;  3A5Y A;  3NTK A;  1FWZ A;  1M90 R;  4Z89 A;  3OBY A;  1KK7 A;  1K9A A;  3OYM A;  5M9O A;  3UF4 A;  4FT4 A;  2O9V A;  2DVE A;  2QHS A;  4XEO A;  3UH0 A;  2KRN A;  1VIF A;  3T9N A;  2LT4 A;  1VUB A;  2DET A;  3JCM P;  1GRI A;  3AHU A;  1PSF A;  2R5A A;  2O2O A;  1U06 A;  3RER A;  5GAO l;  4YRI A;  3E9I A;  5LJ5 d;  2ZIO A;  3WXM B;  2P4R A;  4C8Q B;  1UJ0 A;  5GMK m;  2EW3 A;  5D7U A;  1AWW A;  3L2Q A;  2HSE B;  3FEO A;  1I81 A;  5A0G A;  5CKH A;  3MEV A;  4A4H A;  2J3M A;  2CZ6 B;  4LD9 K;  1U8R A;  5KNN A;  3CCS Q;  1YFN A;  4KGX B;  4BY6 B;  1V76 A;  1H4Q A;  4YCW A;  1WXU A;  2DX1 A;  5HCK A;  4YRP A;  2YRC A;  4HVU A;  4E2F B;  1VQO A;  4E51 A;  4M7A F;  1Y07 A;  2JTM A;  1LVK A;  3A74 A;  1J5W A;  4KRT A;  2VGN A;  1K9M C;  2DO3 A;  5I21 A;  2GFU A;  4DOW A;  1E1O A;  2Q7E A;  2BE7 D;  1E7O A;  2EGC A;  1V1C A;  5A0L A;  2MMP A;  1UGS B;  3RES A;  1HK9 A;  2C0T A;  2FZC B;  3R07 A;  2DIG A;  2FRY A;  4C8Q C;  4HWR A;  1MMN A;  2CZ7 B;  1B70 A;  1TTH B;  3ASK A;  3G71 A;  3C4S A;  3M4G A;  1K8A R;  2IIM A;  3QWY A;  4IIM A;  4E7I A;  3A1P A;  4WF2 A;  1DJ7 B;  5KE3 A;  1NJ6 A;  3A8O B;  4CC2 A;  4PJO G;  2A7Y A;  2ZR2 A;  2YLB A;  5C53 B;  1Q82 R;  2E3I A;  4YRK A;  2LQW A;  4CC3 A;  1N27 A;  3V8K A;  1NLO C;  1AD5 A;  4P3P A;  1HJD A;  3KUF A;  4P73 C;  2I2L A;  3TRE A;  4JLG A;  3M0S A;  3EGD A;  2GQV A;  2RJC A;  4KGV B;  5LJ5 f;  3CCJ Q;  1BCM A;  1T3S A;  4PJO A;  2KGT A;  3CQT A;  1X43 A;  1QVG P;  2H3J A;  4TVW A;  2HCK A;  3SFM A;  2MYS A;  1HC7 A;  3JCM e;  1MMA A;  2XD0 A;  2RH2 A;  3CMA A;  2KVQ G;  3MPU B;  4OMP A;  2KK4 A;  3ER0 A;  3L4G B;  2IY5 A;  4YRM A;  1EOV A;  2FVU A;  1W2B S;  2DBM A;  1H3Z A;  4FIB A;  4UP7 A;  3I9Q A;  4PLI A;  3VRY A;  2D8J A;  3NEL A;  3OBW A;  4II1 A;  1UGR B;  2PTK A;  4F17 A;  2J06 A;  2RQV A;  3OYE A;  1X69 A;  2K2V A;  4LVI A;  4H2W A;  3PMI A;  2K5I A;  4XAX B;  3P8H A;  2B8A A;  5GAO p;  4E7K A;  4JS5 A;  4CH3 A;  2EIF A;  2K2M A;  4ZTF A;  2DIQ A;  3H41 A;  2MWO A;  3BJU A;  4QW2 A;  2ZTG A;  4ZNX A;  3PT9 A;  5GAN h;  3LSS A;  2GGR A;  3UDC A;  3PGG A;  2NLU A;  4Y91 A;  1WDX A;  1OU8 A;  4YYE A;  3JCM b;  2IPO B;  4XTW A;  1GXI E;  5E3I A;  4RTU A;  5FWB A;  2DEQ A;  2GTO A;  4RKU E;  2JN0 A;  4ME7 A;  4FYX B;  4XTZ A;  2DYI A;  3FRN A;  3JCM J;  2L3Q A;  3MEA A;  1YJW A;  3RAC A;  3CC4 A;  1XTD A;  2V1Q A;  3C0C A;  3H0I A;  3M0T A;  5IN1 A;  3O5Z A;  4KT0 E;  3LWI A;  2M1H A;  3V7R A;  1WYX A;  3FJ5 A;  2ZIN A;  2DXB A;  2J6F A;  5FU7 B;  4YDQ A;  2CJA A;  3FC3 A;  4BI3 A;  4M4Z A;  4H2T A;  2OTL T;  3CBP A;  2A0F B;  2DL4 A;  4YRS A;  1FYN A;  4RTT A;  3IG2 A;  3EG3 A;  4M75 B;  3RBB B;  1NM7 A;  1Z7M A;  4PJJ A;  1M30 A;  1Q95 G;  2QA4 A;  5KH6 A;  1UTI A;  4F7U B;  4AFU C;  1WJR A;  2V8K A;  4M7A A;  4AFS C;  2X4Y A;  5LJ3 e;  1YIJ A;  1B34 A;  5GAN 5;  1HYO A;  3NEM A;  4TVY A;  4CS2 A;  1QVF P;  5GAM h;  2RQT A;  4MZM A;  2Y4X A;  1NYR A;  2HKQ B;  5GJW B;  2AHJ B;  2JZ2 A;  5CK9 A;  5CAI A;  1VQO Q;  6AT1 B;  3NMZ C;  3JCM d;  2HNI A;  4BE0 A;  3ZL7 C;  4BDY A;  1Q81 C;  1QQJ A;  4XTX A;  5FU7 C;  4JRP A;  2RMO A;  2KT8 A;  4P3O A;  1VQN Q;  1TSF A;  2L5Q A;  5IXF A;  3MEW A;  3M55 A;  1W4S A;  3HL8 A;  1VQ4 T;  2RO0 A;  1SET A;  4BUG A;  1KHI A;  4M75 C;  3G4S T;  4LDX A;  1IHW A;  4OP0 A;  1AOJ A;  1G3W A;  1UHF A;  4P74 A;  3OMC A;  3G71 Q;  2DXT A;  1G5V A;  2ODR C;  1I5L A;  1RLP C;  2CKK A;  5KYU A;  3A7A A;  4JUV A;  4J6Y A;  2MIO A;  3RMQ A;  4HWS A;  3NGP A;  3M58 A;  5LJ3 j;  4OVA A;  3Q1J A;  3CXC P;  2PNI A;  3QWX X;  2VXE A;  2I4M A;  3G1Z A;  1R77 A;  4X34 A;  1YI2 Q;  2JNG A;  4M78 F;  5IAY A;  2A8E A;  1YIT A;  2E5Q A;  2R57 A;  3LH5 A;  3OW2 A;  1A0N B;  2CP6 A;  4IUQ A;  3VS0 A;  2ED1 A;  3M54 A;  3OS5 A;  3I35 A;  2ZNJ A;  4A63 B;  1WA7 A;  3WVD B;  3R6O A;  1TU0 B;  2L89 A;  2EBP A;  1SHG A;  3A8G B;  1E1T A;  4FSX A;  2AIR B;  5GAN e;  1YJN A;  3X26 B;  3CMA Q;  4YPF A;  3EH2 A;  2PUO B;  2K3B A;  4OB0 B;  3JCM g;  3V8J A;  2K5L A;  4F04 B;  1YHQ T;  1QVG S;  3TSW A;  1KC8 U;  2RK2 A;  3EGX B;  1MUZ A;  2X4W A;  3VBB A;  4A53 A;  2EYY A;  2QHT A;  1K9M R;  3VUZ A;  3NPF A;  1KD1 C;  1X6B A;  4UP9 A;  2FO0 A;  1QP2 A;  1M27 C;  2NUT B;  4K86 A;  1PWT A;  3JCM f;  3JB9 F;  1U5S A;  4PHC A;  1PCX A;  1WQW A;  1X2K A;  2J05 A;  2EYZ A;  4HA8 A;  4JRK A;  3X25 B;  4CH5 A;  2QXF A;  3HFV A;  1UGQ B;  1E6H A;  2YT6 A;  4C92 D;  3HRK A;  2C06 A;  3A8L B;  1K73 C;  4E7S A;  4EPC A;  3MF2 A;  1N9W A;  2PME A;  2QTV A;  2EQJ A;  2I0N A;  2PZ1 A;  4M75 G;  3HFZ A;  1KMN A;  2EQI A;  4M77 C;  4KR2 A;  3S6W A;  5HK0 A;  2W10 A;  3SDZ A;  4YP0 A;  4YRQ A;  1X55 A;  4EMK B;  5ELO A;  2M0Y A;  3CCR Q;  1G5I A;  1IO6 A;  1WFW A;  1AHJ B;  2M9U A;  4EMH A;  1KFZ A;  4F7U G;  5GAN j;  4JZ3 A;  3ZFJ A;  3I55 A;  5F5W A;  2MPX C;  2ZZG A;  3BW1 A;  5GAM e;  1YJW Q;  4DBR A;  1PG5 B;  1LNX A;  2BZX A;  3CC4 Q;  4M7D D;  4WI1 A;  4RMF A;  3CPW P;  2ZCE A;  2DXU A;  2WAC A;  1I1J A;  1UGV A;  4JDS A;  4YRC A;  2RQR A;  2VC8 A;  1NPR A;  1B07 A;  4XU0 A;  3PFS A;  2L3R A;  1AWX A;  2B86 A;  1YCS B;  3DB4 A;  2MCN A;  1K0S A;  1JJC A;  1KQS A;  1ZA1 B;  2CJB A;  1FMK A;  2EJG A;  1VQ7 T;  4O5V A;  2O9S A;  4EMK C;  2QA4 Q;  2ZAE A;  4YRE A;  2COW A;  1X75 C;  3BY7 A;  4IUR A;  1BI0 A;  1YIJ Q;  1JXM A;  3UWN A;  5FLX E;  3L2U A;  1MHN A;  1R0C B;  3UGT A;  2YRD A;  4J9H A;  3UA6 A;  1Q7Y U;  2KSS A;  3I5R A;  3NTH A;  2QQA A;  2LJ3 A;  3GPL A;  3AT1 B;  2RNA A;  4Q5W A;  1N8R U;  1X2H A;  5I2S A;  2VV5 A;  4AFZ C;  4JLI A;  1B7Y A;  2ZZD A;  1YFT A;  2Q7H A;  1QVF S;  4C92 E;  5IHN A;  4G84 A;  1W66 A;  3HRI A;  2LC4 A;  2QQB A;  2P0Q A;  2ENM A;  4OMO A;  2FL7 A;  3QG1 A;  2CUD A;  5I11 A;  1P92 A;  1UB4 A;  2X9H A;  2G3R A;  2KRO A;  4D6W A;  1M1F A;  1U3O A;  2CIM A;  2D9T A;  3TVT A;  3VS3 A;  2KR3 A;  1Q81 U;  1WLP B;  4M77 G;  1NJI U;  2JJ9 A;  2YUN A;  1XJW B;  5GAO n;  1B70 B;  1AZG B;  3HRT A;  4CC4 B;  2HBW A;  1BIA A;  4XEM A;  4D8K A;  2L3P A;  4CS4 A;  2E1H A;  1ZQ1 A;  1YIT T;  4HT8 A;  4M7D E;  3M4Q A;  1GGM A;  1H4S A;  2XMF A;  4RG8 A;  1E22 A;  2ZPF B;  3JB9 G;  1OZ2 A;  2KI7 A;  2DPP B;  4FT2 A;  2E3C A;  4OF1 A;  2RK1 A;  1WYD A;  3CCE T;  3EGD B;  5HK3 A;  1GFD A;  2IVW A;  3HKS A;  4J6X A;  5GMK j;  3VS2 A;  3CXC S;  1UG1 A;  3ICA A;  5I2M A;  1WJS A;  2ZPB B;  4LN2 A;  1ZUU A;  2XIC A;  4PJO B;  4TWA A;  1BI2 A;  3OD1 A;  1YJN Q;  2RI2 A;  1BIB A;  3CME A;  2CDT A;  3VYH B;  4TQF A;  3P8Y A;  2K9G A;  2GQI A;  5GAN g;  3EGU A;  5CKB A;  2LT1 A;  2VYT A;  5DM7 R;  2RHQ A;  2RHU A;  3A31 A;  5L8R E;  1RAD B;  3CCL T;  1Q81 R;  2IY5 B;  5GAN 2;  1AZE A;  3QKJ A;  2MAM A;  1Q86 U;  1VQ9 T;  2JOY A;  4A4F A;  4BE1 A;  1ZX6 A;  1MV0 B;  3CCQ T;  4LDW A;  2PMF A;  3NTI A;  4LUE A;  2BKD N;  3QII A;  4PL6 A;  1X2Q A;  2RN8 A;  3LH0 A;  2XID A;  1H4V B;  2GCX A;  3RR6 A;  1RAB B;  3D7S B;  1KD1 U;  3CD6 T;  3UAT A;  3HFN A;  4XU3 A;  1KIK A;  2HL5 C;  4HCB A;  1L0W A;  4FYY B;  4J9E A;  3PIP A;  4B9X A;  1LCK A;  2D1X A;  4PJO C;  2PVD B;  5EC7 A;  4WJ4 A;  4LDY A;  3CC7 T;  3FIF A;  2E5A A;  1TUD A;  2Q5I A;  3PVL A;  4C0G A;  1YBY A;  5CKE A;  1LOJ A;  1K73 U;  3PVQ A;  4ORZ A;  5CO7 A;  1ABO A;  2PQW A;  1IRE B;  3M56 A;  3QZ5 B;  1G2B A;  1G83 A;  3I55 Q;  4RDX A;  1PD0 A;  1VQ6 T;  1YCY A;  12AS A;  1JU5 C;  2I4N A;  1G5H A;  2JTE A;  2XTI A;  1M5Q 1;  4ZGE B;  4H02 A;  4FSS A;  1WHJ A;  5GAM g;  1TS9 A;  3CMQ A;  1FMV A;  4MDW A;  4TVA A;  1UE9 A;  1VOM A;  2EGE A;  1UJY A;  1GBQ A;  1XOV A;  4J9C A;  4J9B A;  4C0D C;  1C6V X;  1IB8 A;  2GNC A;  4FYW B;  4P75 A;  2A3L A;  3TEG A;  2OTL A;  2PUK B;  5GAM f;  3CPW S;  4FW2 A;  3W3S A;  1BBW A;  1O9S A;  4MML A;  1H4T A;  1XNI A;  1KD1 R;  4JZ4 A;  5D6Y A;  1SHF A;  3V8L A;  4XU1 A;  2XDD A;  3LC0 A;  1AWJ A;  2H3E B;  2CUB A;  1VQK T;  2K4Y A;  3SWN A;  1B34 B;  3G1J A;  2O31 A;  3NEN A;  4LVM A;  4C5E A;  4DBF A;  3G7Z A;  1K73 R;  3OMG A;  3RMS A;  4C8Q D;  3SD4 A;  1KOG A;  1ZHI A;  1AEY A;  3IKM B;  2K5F A;  3I56 A;  2EYQ A;  2CP5 A;  2CT4 A;  2DD5 A;  3E19 A;  2VKN A;  2Q7G A;  5KYX A;  3QPH A;  4NL3 A;  11AS A;  3OYF A;  4NCX A;  5GMK i;  1SSH A;  4L6V 5;  1W2B A;  2KBT A;  4PKC C;  4QKU A;  2DAQ A;  5CCA A;  5LJ3 h;  3OYG A;  1VQ4 A;  3G4S A;  4WCI A;  5HY6 A;  2AZV A;  2F5K A;  2A28 A;  3A98 A;  1IGQ A;  2DLP A;  1YGB A;  2LDM A;  4PJN A;  4DOV A;  1JQQ A;  3M4P A;  3M59 A;  4BDZ A;  4CC7 A;  1JBM A;  1KQ2 A;  2AK5 A;  3M4Y A;  1H8K A;  2DZ9 A;  1R8O B;  3GNG A;  1NJ2 A;  2LCL A;  4M7A C;  1VIE A;  2BZY A;  4J9I A;  2DIL A;  1I5O B;  3LWH A;  1NYF A;  3TEH A;  3E1S A;  1ACM B;  4BWA A;  4IUT A;  4PFZ A;  3CC2 T;  3OS0 A;  1KC8 C;  1UDL A;  1E24 A;  2ZZF A;  3QHS A;  1PRL C;  1UHC A;  2NWM A;  1NLP C;  3VQX A;  2JS2 A;  4BI4 A;  1I0C A;  3CME T;  1PHT A;  4CH6 A;  4E7L A;  4OMF B;  1FX7 A;  3OYJ A;  1OYX A;  4HVW A;  4C0F A;  2DF6 A;  4GBQ A;  3VQV A;  3JSC A;  1OU9 A;  4ZTU B;  4P74 C;  1B76 A;  1QVP A;  3HXV A;  3IAL A;  2LMJ A;  2M16 A;  3OS1 A;  1EVL A;  1YHQ A;  4IUU A;  1WHK A;  3MP8 A;  2O01 E;  1C1A A;  2AKL A;  2V1R A;  2F69 A;  1WHM A;  4PFO A;  2O4X A;  2YXY A;  4C8Q E;  3A7U A;  2DL3 A;  4KUI A;  2M0O A;  2QDY B;  3ME9 A;  1X2G A;  3QO5 A;  3FJP A;  1OV3 A;  5AYF A;  4DBQ A;  2LVM A;  2MOX A;  1USY C;  2AKW A;  3PNW C;  2ZPI B;  1HXD A;  2L2P A;  2MF2 A;  2EYX A;  1GCP A;  2XK0 A;  3X20 B;  3H9N A;  3A5Z A;  1NE8 A;  4PFP A;  4XTU A;  1RLQ C;  5ELN A;  4J83 A;  2A08 A;  2ZCF B;  3M57 A;  1VYV A;  3MEY A;  5KYW A;  4ZN1 A;  1T3L A;  1NYG A;  3UT1 A;  4NOY A;  4OMN A;  1AWO A;  3REU A;  1OX9 A;  2F1L A;  1SKU B;  1PSE A;  1YJ9 T;  4J5Y A;  5HGQ A;  1C0A A;  3VU3 C;  1WXB A;  2BZ8 A;  4M7A G;  4KR3 A;  1MMD A;  2K3X A;  1RAI B;  1SES A;  4OB1 B;  1GCQ A;  4DEX A;  2QAZ A;  3LX7 A;  2RJD A;  3FDR A;  4H2X A;  1I07 A;  1YNZ A;  1WU7 A;  1H64 1;  1VQL A;  1JJ2 P;  2DKG A;  3LGL A;  4HCK A;  3S3O A;  1T0H A;  1RAH B;  2K79 A;  2CP2 A;  1WI7 A;  1WXT A;  2SRC A;  2RD1 A;  4BAC A;  2D0Q B;  1Q7Y C;  1G3T A;  1UGP B;  2ZGW A;  2HQE A;  2RHY A;  2OTL Q;  3CCV A;  5C51 B;  3HSB A;  2JUF A;  4YRT A;  1N8R C;  1EIY B;  3INZ A;  1YFR A;  1NJ8 A;  4C5H A;  4G85 A;  3KFV A;  1VQ8 T;  1AVZ C;  1M1K U;  3ZEH A;  5KE2 A;  1JJC B;  2OAU A;  2DE0 X;  4LD6 A;  1VQ7 A;  1ZUY A;  4RTW A;  2ZXF A;  2EWN A;  2OI3 A;  4X9D A;  1LYL A;  2HQH A;  3EHR A;  2L8D A;  2WSE E;  2LQN A;  4YRR A;  1WIE A;  1QWF A;  4KGZ B;  3I56 T;  1VQ5 T;  1RIQ A;  1AT1 B;  3GF5 A;  2CJ9 A;  3O8V A;  1NJI C;  2QAS A;  3HXY A;  1ZA2 B;  4M75 D;  1MNE A;  1PRM C;  1U1S A;  1ATI A;  1RAA B;  5GAO m;  3QO3 A;  2LQ8 A;  2LTO A;  1X27 A;  1WPY A;  1Z9Z A;  2ODR D;  1QVG A;  1D1B A;  2BIV A;  5K1P A;  2DDZ A;  3HTR A;  3RF1 A;  2MI6 A;  3QBY A;  1EX4 A;  1HSQ A;  1K76 A;  2KQW A;  1BI1 A;  1G3S A;  5GAN 6;  1VQ4 Q;  1SRY A;  2VB6 A;  4N0A A;  3G4S Q;  4HWO A;  3JRZ A;  2M51 A;  1IHV A;  3FLG A;  3VQY A;  2EKO A;  4X9C A;  5IHI A;  2NUP A;  4RUG A;  1LJO A;  3UFG A;  2LNV A;  2LX7 A;  1USY A;  3QSU A;  5LL6 S;  5GMK h;  1M1K R;  2EQM A;  3OSV A;  3GIB A;  2HMA A;  2C7I A;  1W1F A;  1WHL A;  3QYG B;  5FW9 A;  3OA6 A;  3JB9 I;  4RG2 A;  3E2U A;  4YCU A;  3OSS C;  1KG1 A;  2ALY B;  4AH6 A;  2QEX T;  1WJQ A;  2LCC A;  1W70 A;  1M9S A;  4K87 A;  3X28 B;  2GBQ A;  4JS4 A;  3CCE A;  1PC0 A;  4M77 B;  1TWB A;  1Q86 C;  2Y90 A;  4ZGJ B;  2KNB B;  2W0Z A;  2PU9 B;  3G6E A;  2R5M A;  1ZSZ A;  1RAF B;  3MET A;  1QKW A;  2RM4 A;  4AMC A;  1NPP A;  2DZC A;  1UUE A;  4C92 F;  3VUB A;  1Y0M A;  4LDU A;  5LJ5 h;  2KEA A;  4K11 A;  1PYS A;  1WZO A;  1YHQ Q;  4P71 C;  1JRI A;  4RTZ A;  1Y96 B;  2RHQ B;  4M78 C;  4BB7 A;  3CCL A;  2ZT8 A;  3PCO A;  1D0X A;  7AT1 B;  4M75 E;  3RKY A;  3LW5 E;  4E7Z A;  1PM3 A;  1YP5 A;  1Z9Q A;  3JCM c;  1VQ9 A;  2E12 A;  4JJD A;  1HD3 A;  4M77 D;  5LJ3 d;  3JCM Q;  3CCQ A;  1KMM A;  5J3B A;  4F7U E;  3ERR A;  2CS7 A;  3UA7 A;  3DLL A;  2KRM A;  2E4H A;  3QO7 A;  3CD6 A;  1EFN A;  2MK5 A;  4XQ3 A;  1S72 T;  2CH4 W;  5FRN A;  3VRZ A;  4M7D F;  4KUL A;  3HPW A;  2QQ9 A;  1RAC B;  5GMK l;  3JCM W;  4TTV A;  1F1B B;  3KBG A;  2DU7 A;  4IIO A;  3OYH A;  1I4K 1;  2FZG B;  4VUB A;  2HBP A;  3JB9 D;  3REB B;  3CC7 A;  2C0I A;  3LSQ A;  3MQZ A;  3HRS A;  2DVJ A;  1QVF A;  3QDF A;  1K1Z A;  2GTJ A;  5GAN 4;  2ZZE A;  1KC8 R;  1OUL A;  3OYA A;  1H3H A;  1VQL T;  1VQP T;  2DQ3 A;  8AT1 B;  1VQ6 A;  2DRK A;  2J7I A;  1TUG B;  1VQM T;  1NG2 A;  3VS6 A;  4P72 A;  2VWF A;  2NUZ A;  2AKK A;  2O88 A;  3CCV T;  1UEC A;  1MND A;  1D3B A;  3H6Z A;  4TVA B;  3P8B B;  3GBQ A;  3MKD A;  3PTA A;  1UFF A;  1QE0 A;  3TCJ A;  2VUB A;  2X4X A;  3RL6 A;  2JMC A;  4JJC A;  4J9F A;  4R56 A;  2XKO C;  1D0Z A;  1OPK A;  2E6N A;  3A32 A;  3EHQ A;  1JJ2 S;  3JCM X;  1XQH A;  2KMT A;  4V2S A;  4J9G A;  1Y57 A;  4N4G A;  1VQ7 Q;  3EG2 A;  3CCM T;  5LJ3 g;  2CZ1 B;  2CP0 A;  4LVJ A;  5A0D A;  1VQK A;  1ARK A;  3TUP A;  3RKX A;  5GAN d;  2I4O A;  5GMK e;  5CQY A;  3CXC A;  2OJ2 A;  4M78 G;  5ECA A;  4WTO B;  1MMG A;  5LJ3 f;  4M77 E;  4HWT A;  3RGL A;  2RI5 A;  2ZPG B;  2OTJ T;  4TQD A;  4RTY A;  1X6G A;  2HDA A;  2F2W A;  2D6F A;  4RQE A;  1CSK A;  1FXX A;  3URG A;  2XDB A;  3QZ9 B;  1M2V A;  3BE3 A;  4ZTJ A;  5KCO A;  1NJ5 A;  2C8M A;  2RPN A;  5KYX B;  2OX7 A;  2X3X D;  5KYN A;  1SSF A;  4QVZ A;  1RAG B;  4P75 C;  1RI9 A;  1ABQ A;  4P71 A;  1KJW A;  2HD0 A;  3M0P A;  4KH0 B;  2EPD A;  1H92 A;  4M78 A;  1G51 A;  3C95 A;  5DLO A;  3FB9 A;  4YRN A;  2RQU A;  3QJ6 A;  4GLM A;  4C5I A;  2Y4Y A;  4J9D A;  4CI0 C;  1I8F A;  3H0F A;  5J26 A;  2DL7 A;  2ATC B;  3OQ5 A;  3HTZ A;  2P0P A;  4C92 G;  1CKB A;  2F2X A;  5LJ5 e;  4ZTZ B;  5CVI A;  3P8T A;  2ZIM A;  3MEU A;  1N5Z A;  1YIT Q;  3SWN C;  2QYZ A;  4IUV A;  5GAN 7;  1Q7Y R;  1YWO A;  1OEB A;  4O2D A;  4GY5 A;  3TEH B;  1EVK A;  1WX6 A;  2ARU A;  3VJP A;  1N8R R;  2P0K A;  3CC2 A;  2XGT A;  3L2W A;  3G6E T;  3L42 A;  5GAM d;  4YRF A;  3CCE Q;  4YRG A;  2EJ9 A;  4C92 A;  2RHI A;  2DER A;  1JB0 E;  2BE9 B;  5GJV B;  1QP3 A;  5IH2 A;  4O6J A;  2YLC A;  1M90 U;  2KDS A;  3L2R A;  2DFU A;  3IQL A;  2LZ6 B;  4JRI A;  1NJI R;  2R58 A;  1IZ6 A;  2V26 A;  2FEI A;  1M2O A;  4J7I A;  5GAN f;  3CCU T;  1D09 B;  2HQX A;  1ASY A;  3CPW A;  3OYC A;  3GLX A;  3CCL Q;  4J15 A;  1K0X A;  4KQE A;  4LVL A;  2P5I A;  3H0H A;  4C0D B;  4PJO D;  4QQD A;  4J6W A;  5LJ5 j;  1UEB A;  1VQ9 Q;  2O4X B;  5GAN 8;  3OS2 A;  1EZZ B;  4M7D A;  4NS5 A;  3S3N A;  3E9H A;  2RI3 A;  3CCQ Q;  5DY9 A;  1OPL A;  3BFM A;  4LXC A;  4R55 A;  4AFQ C;  4JJB A;  4PJL A;  2P4T A;  1NNH A;  3CD6 Q;  1K4U S;  4FM4 B;  3A5Z B;  1M1G A;  1B3Q A;  2JXB A;  2X3W D;  3UPU A;  3TQ7 P;  5KYW B;  3CC7 Q;  3CBM A;  1YJ9 A;  2K7A A;  4YTL A;  2E70 A;  3VS7 A;  3I5S A;  1VYU A;  3KXT A;  1Y7X A;  3H8Z A;  3M5A A;  4Y92 A;  2J3L A;  2X4J A;  3EG0 A;  4DEY A;  4OMM A;  2ARS A;  1VQ6 Q;  1M1K C;  5CKD A;  4QQ6 A;  3M0U A;  1Q86 R;  1VA7 A;  5KYY A;  2EQU A;  3E9F A;  2YUP A;  4MMK A;  3KFU A;  3HHT B;  2HEQ A;  2KXD A;  4OB2 B;  4OMQ A;  4H2X B;  1D1C A;  2JMA A;  4E6R A;  1SEM A;  5L23 A;  2DNU A;  4HKE A;  1K8A U;  2KRS A;  2ROT A;  3EG1 A;  4ANJ A;  3VKI A;  3EG9 A;  4UPA A;  2I4L A;  3CCS T;  3VS1 A;  4C8Q F;  4AG2 C;  4RMO A;  1Q82 U;  4LNS A;  4M7A B;  1VQ8 A;  1ZBJ A;  2QQS A;  2A36 A;  4P3N A;  3EFO A;  3M0R A;  1N6A A;  2AZS A;  3P8D A;  2RJE A;  2E10 A;  3IKL A;  1TUC A;  2HL3 A;  3EFR A;  4BD3 A;  2BTT A;  5C6S A;  1VQK Q;  2E64 A;  3RUX A;  2AMC A;  1SER A;  4Z88 A;  4Q15 A;  1VQ5 A;  3CEY A;  4PJO E;  2JM8 A;  4E7H A;  1ZSG A;  5KCH A;  4JJN K;  2M02 A;  1RI0 A;  2RHS A;  4OGE A;  1GCQ C;  3OYK A;  4A4E A;  5FRO A;  3P8V A;  4DPG A;  1WHG A;  1M8M A;  2ROL A;  2F2V A;  1VQN A;  1M3C A;  2QDL A;  3JV3 A;  3OYD A;  4M7A D;  2DBK A;  5GAN 3;  2DRM A;  3DKM A;  2E65 A;  1G3Y A;  5KYU B;  3THK A;  3VS4 A;  4BY6 C;  4FYV B;  4PJM A;  2NUP B;  1YB3 A;  3HXU A;  2ZT7 A;  1PD1 A;  4FU6 A;  3QNE A;  3CCJ T;  5LJ5 g;  3RNJ A;  3SB2 A;  4JRQ A;  1YI2 A;  4P5N A;  3N5B B;  2E41 A;  4HXJ A;  2JVV A;  3QDR B;  2QEX A;  2Q5H A;  2RA2 A;  3CC2 Q;  4DA4 A;  1SRM A;  4HCZ A;  1QKX A;  1BKB A;  3JB9 H;  4EX5 A;  2E6Z A;  3OYL A;  3NET A;  1BB9 A;  3REA B;  3CME Q;  4A54 A;  4ESR A;  3QO8 A;  2E5K A;  1JEG A;  2EFI A;  1FYF A;  4AT1 B;  4FL6 A;  4F16 A;  1ZSZ B;  4XTV A;  3WQZ A;  3NFC A;  4XU2 A;  4N0A C;  4X5O A;  3V7S A;  2LCS A;  2CH4 A;  2J6O A;  4MZT A;  2QI2 A;  2EYW A;  3GP8 A;  1PYS B;  4HVV A;  2YUO A;  5IHK A;  3PCO B;  1WLE A;  3U23 A;  1BU1 A;  2FHD A;  3OW2 P;  2ZR3 A;  2EGA A;  4LUD A;  3SHW A;  2ZT5 A;  2EKH A;  1QCO A;  3A8H B;  4M7A E;  4Z8A A;  3QJY A;  4E47 A;  3HFZ B;  1S72 A;  3MHX A;  1R0B G;  3DB3 A;  3OB9 A;  2F5T X;  2EJF A;  3S3M A;  1TH7 A;  2A37 A;  4C8Q G;  4LDV A;  2DL8 A;  2DXC A;  1X01 A;  1ZSZ C;  2LX9 A;  3CCR A;  4HT9 A;  5IT9 E;  2DEU A;  2YDL A;  1YJ9 Q;  1PKT A;  3RDV A;  1GFC A;  2JS0 A;  2D8H A;  2JTF A; 
#chains in the Genus database with same CATH homology
 3L1A A;  1X6O A;  5FU6 B;  1VQP A;  2QQR A;  3V7C A;  4L5G A;  1VQM A;  4A4K A;  2DTH A;  2FYK A;  4WJ3 M;  3DSQ A;  3VQW A;  3HY1 A;  4C8Q A;  4RCB A;  4Y28 E;  5C52 B;  3L2V A;  1WNL A;  4N4H A;  1OI1 A;  2RHX A;  1D3B B;  3MP1 A;  2IG0 A;  4K88 A;  1NJ1 A;  4M75 F;  4PLL A;  3HXW A;  4H2Y A;  1B8A A;  3LYI A;  2WSF E;  4EDU A;  2ART A;  4P73 A;  4F7U F;  3CCM A;  1VQO T;  1M8V A;  2RJF A;  1NZ9 A;  2HAX A;  2EQK A;  4N4I A;  2DTO A;  5FU6 C;  3QYH B;  2DJZ A;  1VQN T;  1B7Y B;  1BI3 A;  5C0M A;  5K1X A;  5A2Q E;  4LVK A;  4P72 C;  2VGM A;  4PG3 A;  5GAO q;  1X54 A;  3HRU A;  2OTJ A;  4ELY C;  3G71 T;  3HXX A;  4GLK A;  1Y71 A;  1K9M U;  1O75 A;  1OZ3 A;  2K3Y A;  3CPF A;  1M4Z A;  4M78 B;  3J81 E;  4XK8 E;  3OY9 A;  3BDL A;  1QW1 A;  1YI2 T;  3ZBD A;  3MP6 A;  4E7J A;  3M9Q A;  1M90 C;  2K57 A;  4H2S A;  3C94 A;  3QXE B;  3UGQ A;  3MO8 A;  3CBO A;  3I7F A;  1KHC A;  3OYN A;  1NYQ A;  1N9R A;  2RHZ A;  4RCC A;  4YRO A;  2KY9 A;  3CMA T;  3MCA B;  3BDU A;  4CS3 A;  3JAM E;  4M78 D;  3L4G A;  1BYM A;  2GFA A;  5CKF A;  4C92 B;  4RQF A;  2KAF A;  4M77 F;  4BW9 A;  4TVR A;  4H2U A;  4NL2 A;  1YFS A;  3A8M B;  1EIF A;  1QF6 A;  3CCU A;  3M53 A;  2X35 A;  3JCM V;  3L2Z A;  1JJ2 A;  1KQ1 A;  4HCC A;  2DTI A;  4M7D B;  2V8I A;  4Z02 A;  2ZT6 A;  4KBM B;  2ZPE B;  4IUP A;  4KUD K;  2YRV A;  2EAY A;  2RB6 A;  4MDX A;  1N9S A;  3CCR T;  2NS6 A;  1EFW A;  1WGS A;  2XDP A;  4C92 C;  3OW2 S;  2FB7 A;  4L59 A;  1X56 A;  1YJW T;  3CC4 T;  3EAE A;  1K8A C;  3E9G A;  3F70 A;  4DQ2 A;  2GF7 A;  3LLR A;  3PMT A;  2QTX A;  2DU5 A;  1Q82 C;  4QQG A;  4QVD A;  4UP8 A;  3VYG A;  5CIU A;  4MZP A;  2EL9 A;  4HWP A;  4YCV A;  2LRQ A;  1ADY A;  3OYY A;  4M75 A;  3REX A;  4OGC A;  4M7D C;  4Q6G A;  4M78 E;  4F7U A;  2WSC E;  3C12 A;  2PVG B;  2QA4 T;  1EIY A;  1HTT A;  4CH4 A;  3PIO A;  5FRM A;  3TEE A;  1YIJ T;  3OYB A;  3CCS A;  2CZ0 B;  4YRL A;  4OLF A;  3SWN B;  3QTC A;  4C0Z A;  5CQX A;  2DQ0 A;  4BI8 B;  4ZN3 A;  4CRI A;  2XU8 A;  2P0L A;  2QHV A;  2DK3 A;  2AMC B;  1ADJ A;  3RKW A;  4ZGD B;  2CYZ B;  5EG2 A;  5GAM j;  5D6X A;  2RHS B;  4J8O A;  3DLM A;  4H2V A;  2QHU A;  1V29 B;  2XI9 A;  3VV0 A;  2LQK A;  3GNF B;  2V8J A;  5J39 A;  2BUD A;  3J80 E;  3QUI A;  4EO4 A;  2MWP A;  1ASZ A;  4XTY A;  3PZC A;  2CGH A;  1KQS S;  4UC4 A;  4ATO A;  3HFO A;  3WVE B;  4B9W A;  4A4G A;  4BE2 A;  2PVO B;  2YHT A;  4QVC A;  2ALY A;  3CCJ A;  1BBU A;  4ZIB A;  3J7A F;  1Z7N A;  4M77 A;  4M7D G;  3HY0 A;  1YJN T;  2XHC A;  5D6W A;  1MGQ A;  4PJO F;  3HP9 A;  1EQR A;  4J7F A;  2G4C A;  1ZBX A;  1WQ7 A;  3MF1 A;  4HVC A;  4EMG A;  1RL2 A;  5CR2 A;  1Y96 A;  2VXF A;  2XG8 D;  1VQZ A;  3EFS A;  3TU4 K;  2DD4 A;  1U1T A;  2AKW B;  4C5G A;  4L87 A;  4HT4 A;  4PNO A;  1IL2 A;  3JB9 J;  5DLQ E;  4OB3 B;  3JCM h;  4IKF A;  3RIR A;  4EMK A;  2ZPH B;  4YRJ A;  3LGF A;  3X24 B;  5HKC A;  2ZNI A;  5GAO r;  4ELZ C;  3GOX A;  3A7R A;  3HXZ A;  3OYI A;  3I55 T;  3A5Y A;  3NTK A;  1FWZ A;  3OBY A;  3OYM A;  5M9O A;  4FT4 A;  2DVE A;  2QHS A;  4XEO A;  3UH0 A;  1VIF A;  3T9N A;  2LT4 A;  1VUB A;  3JCM P;  3AHU A;  1PSF A;  2R5A A;  3RER A;  5GAO l;  4YRI A;  3E9I A;  5LJ5 d;  2ZIO A;  3WXM B;  4C8Q B;  5GMK m;  3L2Q A;  3FEO A;  1I81 A;  5A0G A;  5CKH A;  3MEV A;  4A4H A;  2J3M A;  2CZ6 B;  4LD9 K;  1U8R A;  5KNN A;  4BY6 B;  1H4Q A;  4YCW A;  4YRP A;  1VQO A;  4E51 A;  4M7A F;  1Y07 A;  2JTM A;  3A74 A;  1J5W A;  1K9M C;  2VGN A;  2DO3 A;  5I21 A;  2GFU A;  4DOW A;  1E1O A;  2Q7E A;  5A0L A;  2MMP A;  1UGS B;  3RES A;  1HK9 A;  3R07 A;  2DIG A;  4C8Q C;  4HWR A;  2CZ7 B;  1B70 A;  3ASK A;  3G71 A;  3C4S A;  3M4G A;  4E7I A;  4WF2 A;  1DJ7 B;  5KE3 A;  1NJ6 A;  3A8O B;  2ZR2 A;  4PJO G;  2A7Y A;  2YLB A;  5C53 B;  4YRK A;  1N27 A;  3V8K A;  4P3P A;  4P73 C;  3KUF A;  2I2L A;  3TRE A;  4JLG A;  2GQV A;  2RJC A;  5LJ5 f;  4PJO A;  2H3J A;  4TVW A;  3SFM A;  1HC7 A;  3JCM e;  2XD0 A;  2RH2 A;  3CMA A;  2KVQ G;  2KK4 A;  3ER0 A;  3L4G B;  2IY5 A;  4YRM A;  1EOV A;  2FVU A;  1W2B S;  1H3Z A;  4FIB A;  4UP7 A;  4PLI A;  3NEL A;  3OBW A;  4II1 A;  1UGR B;  3OYE A;  2K2V A;  4LVI A;  4H2W A;  3PMI A;  2K5I A;  4XAX B;  3P8H A;  2B8A A;  5GAO p;  4E7K A;  4JS5 A;  4CH3 A;  2EIF A;  4ZTF A;  2DIQ A;  2MWO A;  3BJU A;  4QW2 A;  2ZTG A;  3PT9 A;  5GAN h;  3LSS A;  3UDC A;  3PGG A;  2NLU A;  4Y91 A;  4YYE A;  3JCM b;  4XTW A;  1GXI E;  5E3I A;  2DEQ A;  4RKU E;  2JN0 A;  4ME7 A;  4XTZ A;  3FRN A;  3JCM J;  3MEA A;  1YJW A;  3RAC A;  3CC4 A;  1XTD A;  5IN1 A;  4KT0 E;  3LWI A;  2M1H A;  3V7R A;  2ZIN A;  2DXB A;  5FU7 B;  4YDQ A;  2CJA A;  3FC3 A;  4BI3 A;  4H2T A;  2OTL T;  3CBP A;  4YRS A;  3IG2 A;  4M75 B;  1Z7M A;  2QA4 A;  5KH6 A;  4F7U B;  1WJR A;  2V8K A;  4M7A A;  2X4Y A;  5LJ3 e;  1YIJ A;  1B34 A;  5GAN 5;  4CS2 A;  3NEM A;  4TVY A;  5GAM h;  4MZM A;  2Y4X A;  1NYR A;  2AHJ B;  2JZ2 A;  5CK9 A;  5CAI A;  3JCM d;  2HNI A;  4BE0 A;  4BDY A;  1Q81 C;  5FU7 C;  4XTX A;  4JRP A;  4P3O A;  2L5Q A;  3MEW A;  3M55 A;  1W4S A;  3HL8 A;  1VQ4 T;  2RO0 A;  1SET A;  4BUG A;  1KHI A;  4M75 C;  3G4S T;  4LDX A;  4OP0 A;  1G3W A;  4P74 A;  3OMC A;  2DXT A;  1G5V A;  2ODR C;  1I5L A;  2CKK A;  3A7A A;  4JUV A;  4J6Y A;  3RMQ A;  4HWS A;  3M58 A;  5LJ3 j;  4OVA A;  3Q1J A;  2VXE A;  2I4M A;  3G1Z A;  4X34 A;  2JNG A;  4M78 F;  5IAY A;  2A8E A;  1YIT A;  2E5Q A;  2R57 A;  3OW2 A;  4IUQ A;  3M54 A;  3OS5 A;  2ZNJ A;  3WVD B;  3R6O A;  2L89 A;  3A8G B;  1E1T A;  4FSX A;  5GAN e;  1YJN A;  3X26 B;  4YPF A;  2PUO B;  4OB0 B;  3JCM g;  3V8J A;  2K5L A;  1YHQ T;  1QVG S;  1KC8 U;  2RK2 A;  2X4W A;  3VBB A;  4A53 A;  2QHT A;  3VUZ A;  1KD1 C;  4UP9 A;  1QP2 A;  4K86 A;  3JCM f;  3JB9 F;  4PHC A;  1WQW A;  4HA8 A;  4JRK A;  3X25 B;  4CH5 A;  2QXF A;  3HFV A;  1UGQ B;  4C92 D;  3HRK A;  2C06 A;  3A8L B;  1K73 C;  4EPC A;  3MF2 A;  1N9W A;  2PME A;  2EQJ A;  4M75 G;  3HFZ A;  1KMN A;  4M77 C;  4KR2 A;  3S6W A;  5HK0 A;  3SDZ A;  4YP0 A;  4YRQ A;  1X55 A;  4EMK B;  5ELO A;  1G5I A;  1AHJ B;  2M9U A;  4EMH A;  4F7U G;  5GAN j;  3ZFJ A;  3I55 A;  5F5W A;  2ZZG A;  3BW1 A;  5GAM e;  1LNX A;  4M7D D;  4WI1 A;  4RMF A;  2ZCE A;  2DXU A;  2WAC A;  4JDS A;  4YRC A;  2VC8 A;  1NPR A;  4XU0 A;  3PFS A;  2L3R A;  3DB4 A;  1JJC A;  1KQS A;  2CJB A;  2EJG A;  1VQ7 T;  4O5V A;  4EMK C;  4YRE A;  1X75 C;  3BY7 A;  4IUR A;  1BI0 A;  3UWN A;  5FLX E;  3L2U A;  1MHN A;  3UGT A;  1Q7Y U;  2KSS A;  3NTH A;  2QQA A;  3GPL A;  4Q5W A;  1N8R U;  1X2H A;  5I2S A;  2VV5 A;  4JLI A;  1B7Y A;  2ZZD A;  1YFT A;  2Q7H A;  1QVF S;  4C92 E;  4G84 A;  1W66 A;  3HRI A;  2LC4 A;  2QQB A;  2P0Q A;  2FL7 A;  3QG1 A;  1P92 A;  1UB4 A;  2G3R A;  4D6W A;  1M1F A;  2CIM A;  2D9T A;  1Q81 U;  4M77 G;  1NJI U;  5GAO n;  1B70 B;  3HRT A;  1BIA A;  4XEM A;  4CS4 A;  2E1H A;  1ZQ1 A;  1YIT T;  4HT8 A;  4M7D E;  3M4Q A;  1GGM A;  1H4S A;  1E22 A;  4RG8 A;  2ZPF B;  3JB9 G;  1OZ2 A;  2DPP B;  4FT2 A;  2E3C A;  4OF1 A;  2RK1 A;  1WYD A;  3CCE T;  5HK3 A;  2IVW A;  3HKS A;  4J6X A;  5GMK j;  3CXC S;  3ICA A;  5I2M A;  1WJS A;  2ZPB B;  2XIC A;  4PJO B;  4TWA A;  1BI2 A;  3OD1 A;  2RI2 A;  1BIB A;  3CME A;  3VYH B;  4TQF A;  3P8Y A;  5GAN g;  5CKB A;  2LT1 A;  2VYT A;  5DM7 R;  2RHQ A;  2RHU A;  3A31 A;  5L8R E;  3CCL T;  2IY5 B;  5GAN 2;  3QKJ A;  2MAM A;  1Q86 U;  1VQ9 T;  2JOY A;  4A4F A;  4BE1 A;  3CCQ T;  4LDW A;  2PMF A;  3NTI A;  2BKD N;  3QII A;  4PL6 A;  3LH0 A;  2XID A;  1H4V B;  2GCX A;  1KD1 U;  3CD6 T;  3HFN A;  4XU3 A;  4HCB A;  1L0W A;  3PIP A;  4B9X A;  4PJO C;  2PVD B;  4WJ4 A;  4LDY A;  3CC7 T;  3FIF A;  2E5A A;  2Q5I A;  4C0G A;  1YBY A;  5CKE A;  1LOJ A;  1K73 U;  5CO7 A;  2PQW A;  1IRE B;  3M56 A;  3QZ5 B;  4RDX A;  1VQ6 T;  1YCY A;  12AS A;  2I4N A;  1G5H A;  2XTI A;  1M5Q 1;  4ZGE B;  4H02 A;  5GAM g;  3CMQ A;  4MDW A;  4TVA A;  1XOV A;  4C0D C;  4P75 A;  2A3L A;  3TEG A;  2OTL A;  2PUK B;  5GAM f;  3CPW S;  3W3S A;  1BBW A;  1O9S A;  4MML A;  1H4T A;  1XNI A;  5D6Y A;  3V8L A;  4XU1 A;  2XDD A;  3LC0 A;  1VQK T;  2K4Y A;  3SWN A;  1B34 B;  3NEN A;  4LVM A;  4C5E A;  3G7Z A;  3OMG A;  3RMS A;  4C8Q D;  3SD4 A;  1KOG A;  1ZHI A;  3IKM B;  2K5F A;  3I56 A;  2EYQ A;  2DD5 A;  3E19 A;  2Q7G A;  3QPH A;  4NL3 A;  11AS A;  3OYF A;  4NCX A;  5GMK i;  4L6V 5;  1W2B A;  4PKC C;  2DAQ A;  5CCA A;  5LJ3 h;  3OYG A;  1VQ4 A;  3G4S A;  5HY6 A;  2F5K A;  1YGB A;  2LDM A;  4DOV A;  3M4P A;  3M59 A;  4BDZ A;  1KQ2 A;  1JBM A;  3M4Y A;  2DZ9 A;  1R8O B;  3GNG A;  1NJ2 A;  2LCL A;  4M7A C;  1VIE A;  3LWH A;  3TEH A;  3E1S A;  4BWA A;  4IUT A;  3CC2 T;  3OS0 A;  1KC8 C;  1E24 A;  2ZZF A;  3QHS A;  3VQX A;  4BI4 A;  3CME T;  4CH6 A;  4E7L A;  4OMF B;  1FX7 A;  3OYJ A;  1OYX A;  4C0F A;  3VQV A;  3JSC A;  4ZTU B;  4P74 C;  1B76 A;  1QVP A;  3HXV A;  3IAL A;  2M16 A;  3OS1 A;  1EVL A;  1YHQ A;  4IUU A;  3MP8 A;  2O01 E;  2F69 A;  2O4X A;  4C8Q E;  3A7U A;  4KUI A;  2M0O A;  2QDY B;  3ME9 A;  1X2G A;  3QO5 A;  3FJP A;  5AYF A;  2LVM A;  1USY C;  2AKW A;  3PNW C;  2MF2 A;  1HXD A;  2ZPI B;  2XK0 A;  3X20 B;  3A5Z A;  1NE8 A;  4XTU A;  5ELN A;  4J83 A;  2ZCF B;  3M57 A;  3MEY A;  4ZN1 A;  3UT1 A;  4NOY A;  3REU A;  1YJ9 T;  1PSE A;  4J5Y A;  5HGQ A;  1C0A A;  3VU3 C;  4M7A G;  4KR3 A;  2K3X A;  1SES A;  4OB1 B;  3LX7 A;  2RJD A;  3FDR A;  4H2X A;  1WU7 A;  1H64 1;  1VQL A;  2DKG A;  3LGL A;  3S3O A;  2RD1 A;  4BAC A;  2D0Q B;  1Q7Y C;  1G3T A;  1UGP B;  2ZGW A;  2HQE A;  2RHY A;  3CCV A;  5C51 B;  3HSB A;  2JUF A;  4YRT A;  1N8R C;  1EIY B;  3INZ A;  1YFR A;  1NJ8 A;  4C5H A;  4G85 A;  1VQ8 T;  1M1K U;  3ZEH A;  5KE2 A;  1JJC B;  2OAU A;  4LD6 A;  1VQ7 A;  2ZXF A;  2EWN A;  4X9D A;  1LYL A;  2L8D A;  2WSE E;  4YRR A;  3I56 T;  1VQ5 T;  1RIQ A;  3GF5 A;  2CJ9 A;  3O8V A;  1NJI C;  3HXY A;  4M75 D;  1U1S A;  1ATI A;  5GAO m;  3QO3 A;  2LQ8 A;  2LTO A;  1WPY A;  2ODR D;  1QVG A;  2BIV A;  5K1P A;  2DDZ A;  3RF1 A;  2MI6 A;  3QBY A;  2KQW A;  1BI1 A;  1G3S A;  5GAN 6;  1SRY A;  4N0A A;  4HWO A;  3JRZ A;  3FLG A;  3VQY A;  2EKO A;  4X9C A;  1LJO A;  3UFG A;  2LNV A;  1USY A;  3QSU A;  5LL6 S;  5GMK h;  2EQM A;  3OSV A;  3GIB A;  2C7I A;  3QYG B;  3OA6 A;  3JB9 I;  4RG2 A;  4YCU A;  3OSS C;  1KG1 A;  2ALY B;  4AH6 A;  2QEX T;  1WJQ A;  2LCC A;  1M9S A;  4K87 A;  3X28 B;  4JS4 A;  3CCE A;  4M77 B;  1Q86 C;  2Y90 A;  4ZGJ B;  2PU9 B;  3G6E A;  2R5M A;  3MET A;  2RM4 A;  1NPP A;  2DZC A;  4C92 F;  3VUB A;  4LDU A;  5LJ5 h;  1PYS A;  4P71 C;  1JRI A;  1Y96 B;  2RHQ B;  4M78 C;  3CCL A;  4BB7 A;  2ZT8 A;  3PCO A;  4M75 E;  3RKY A;  3LW5 E;  3JCM c;  1VQ9 A;  2E12 A;  4M77 D;  5LJ3 d;  3JCM Q;  3CCQ A;  1KMM A;  5J3B A;  4F7U E;  3ERR A;  2CS7 A;  3DLL A;  3QO7 A;  3CD6 A;  4XQ3 A;  1S72 T;  5FRN A;  4M7D F;  4KUL A;  3HPW A;  2QQ9 A;  5GMK l;  3JCM W;  4TTV A;  3KBG A;  2DU7 A;  3OYH A;  1I4K 1;  4VUB A;  2HBP A;  3JB9 D;  3CC7 A;  3LSQ A;  3MQZ A;  3HRS A;  1QVF A;  5GAN 4;  2ZZE A;  3OYA A;  1VQL T;  1VQP T;  2DQ3 A;  1VQ6 A;  1VQM T;  4P72 A;  3CCV T;  1D3B A;  3H6Z A;  4TVA B;  3P8B B;  3PTA A;  1QE0 A;  3TCJ A;  2VUB A;  2X4X A;  3RL6 A;  4R56 A;  2XKO C;  2E6N A;  3A32 A;  1JJ2 S;  3JCM X;  1XQH A;  2KMT A;  4V2S A;  4N4G A;  3CCM T;  5LJ3 g;  2CZ1 B;  4LVJ A;  5A0D A;  1VQK A;  3TUP A;  3RKX A;  5GAN d;  2I4O A;  5GMK e;  5CQY A;  3CXC A;  4M78 G;  5LJ3 f;  4M77 E;  4HWT A;  3RGL A;  2RI5 A;  2ZPG B;  2OTJ T;  4TQD A;  4RQE A;  2D6F A;  1FXX A;  3URG A;  2XDB A;  3QZ9 B;  4ZTJ A;  5KCO A;  1NJ5 A;  2C8M A;  1SSF A;  4QVZ A;  4P75 C;  4P71 A;  2HD0 A;  1G51 A;  4M78 A;  3C95 A;  5DLO A;  3FB9 A;  4YRN A;  3QJ6 A;  4C5I A;  2Y4Y A;  4CI0 C;  1I8F A;  5J26 A;  3OQ5 A;  3HTZ A;  2P0P A;  4C92 G;  5LJ5 e;  4ZTZ B;  5CVI A;  3P8T A;  2ZIM A;  3MEU A;  3SWN C;  4IUV A;  5GAN 7;  4O2D A;  4GY5 A;  3TEH B;  1EVK A;  2ARU A;  3VJP A;  2P0K A;  2XGT A;  3CC2 A;  3L2W A;  3G6E T;  3L42 A;  5GAM d;  4YRF A;  4YRG A;  2EJ9 A;  4C92 A;  2RHI A;  1JB0 E;  1QP3 A;  4O6J A;  2YLC A;  1M90 U;  2KDS A;  3L2R A;  4JRI A;  2R58 A;  1IZ6 A;  4J7I A;  5GAN f;  3CCU T;  2HQX A;  1ASY A;  3CPW A;  3OYC A;  3GLX A;  4J15 A;  4KQE A;  4LVL A;  2P5I A;  4C0D B;  4PJO D;  4QQD A;  4J6W A;  5LJ5 j;  1UEB A;  2O4X B;  5GAN 8;  3OS2 A;  4M7D A;  4NS5 A;  3S3N A;  3E9H A;  2RI3 A;  5DY9 A;  3BFM A;  4R55 A;  2P4T A;  1NNH A;  4FM4 B;  3A5Z B;  1M1G A;  3UPU A;  3CBM A;  1YJ9 A;  4YTL A;  2E70 A;  3KXT A;  1Y7X A;  3H8Z A;  3M5A A;  2J3L A;  2X4J A;  2ARS A;  1M1K C;  5CKD A;  4QQ6 A;  2EQU A;  3E9F A;  4MMK A;  3KFU A;  3HHT B;  4OB2 B;  4H2X B;  4HKE A;  1K8A U;  3VKI A;  4UPA A;  2I4L A;  3CCS T;  4C8Q F;  4RMO A;  1Q82 U;  4LNS A;  4M7A B;  1VQ8 A;  2QQS A;  4P3N A;  1N6A A;  3P8D A;  2RJE A;  2E10 A;  3IKL A;  3EFR A;  4BD3 A;  5C6S A;  2AMC A;  2E64 A;  3RUX A;  1SER A;  4Q15 A;  1VQ5 A;  3CEY A;  4PJO E;  4E7H A;  5KCH A;  4JJN K;  1RI0 A;  2RHS A;  4OGE A;  3OYK A;  4A4E A;  5FRO A;  3P8V A;  4DPG A;  1VQN A;  3OYD A;  4M7A D;  5GAN 3;  3DKM A;  2E65 A;  1G3Y A;  4BY6 C;  1YB3 A;  3HXU A;  2ZT7 A;  4FU6 A;  3QNE A;  3CCJ T;  5LJ5 g;  3SB2 A;  4JRQ A;  1YI2 A;  4P5N A;  3N5B B;  2E41 A;  2JVV A;  3QDR B;  2QEX A;  2Q5H A;  2RA2 A;  4DA4 A;  4HCZ A;  1BKB A;  3JB9 H;  4EX5 A;  2E6Z A;  3OYL A;  3NET A;  4A54 A;  3QO8 A;  2EFI A;  1FYF A;  4FL6 A;  4XTV A;  3WQZ A;  3NFC A;  4XU2 A;  4N0A C;  4X5O A;  3V7S A;  4MZT A;  2QI2 A;  3GP8 A;  1PYS B;  3PCO B;  1WLE A;  2FHD A;  2ZR3 A;  2ZT5 A;  3A8H B;  4M7A E;  3QJY A;  4E47 A;  3HFZ B;  1S72 A;  3MHX A;  3DB3 A;  3OB9 A;  2F5T X;  2EJF A;  3S3M A;  1TH7 A;  4C8Q G;  4LDV A;  2DXC A;  1X01 A;  2LX9 A;  3CCR A;  4HT9 A;  5IT9 E;  2JTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...