2ZGWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zgwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zgwA01
4J6YA 4YRKA 2DEQA 4RCBA 4OLFA 3QHSA 5GANg 3FB9A 5GMKl 1EIYB 2E65A 4M75D 1B8AA 3VU3C 5ELNA 4XTWA 1WPYA 4N0AC 1EIYA 3LC0A 4H2XB 4P3OA 1SERA 5GAN8 4TVYA 2P5IA 3JCMc 5ELOA 1YFSA 4Y91A 4M7DF 4M7DC 1H4TA 2IY5B 1NYRA 5GAN6 5GMKj 1J5WA 3SWNA 4WF2A 4YRSA 1I81A 3PGGA 3VQYA 5KNNA 4X9CA 4TVWA 2RB6A 1NJ5A 5LJ5g 1LNXA 4HT8A 4A53A 4M75F 4M75C 3IKMB 3SWNC 5LJ5j 5GAN5 5GAOm 1HXDA 3VQWA 4ZTZB 1MGQA 4XTVA 4H02A 4M78G 1NJ8A 4EO4A 2QHVA 1KOGA 1B70A 4TVAB 3HY1A 1JJCA 4M7AA 4ZTUB 4NL3A 3SB2A 2ODRC 3P8YA 1E1OA 2ZZEA 4G85A 4TVAA 4CH3A 3EFSA 2XGTA 4XEOA 3RUXA 1B7YA 2DKGA 5GAMf 4XU2A 4RCCA 3BW1A 5LJ5d 3NETA 4PHCA 4K86A 4XTUA 1EOVA 2YHTA 1X56A 1KQ1A 3QO3A 2G4CA 4C92D 4M7DE 3FIFA 3P8VA 3UH0A 2DDZA 5GAN3 5GAMg 2K57A 1RIQA 5GMKm 4P75A 1W66A 1NJ6A 3TUPA 1WNLA 4CH5A 4YCUA 1WYDA 2ZNIA 2ALYB 2RHSA 4PNOA 2C8MA 4EMKA 4M75E 4M7AG 4YRLA 2AMCA 5DY9A 4PJOD 2CIMA 1QF6A 1USYC 4C92F 4C92C 4UP7A 4NOYA 4KR2A 2CJBA 5GAOp 4JRKA 1WLEA 1X01A 4HVCA 3INZA 4H2VA 4C8QD 2J3MA 3FJPA 5GAMd 2ZCEA 1U1TA 3HRKA 4Q15A 3HTZA 4YRCA 1ASYA 3BFMA 5GMKe 1N9SA 3I7FA 4HA8A 1H4VB 4PG3A 4YRRA 1BIAA 1H4QA 4NL2A 2DU5A 1PYSA 3JCMV 4M77D 1NYQA 4PJOF 4PJOC 1BBWA 1FYFA 4N0AA 3QNEA 2Q7EA 2ZZFA 4YP0A 3OD1A 2AKWA 1U1SA 4M7DA 5GMKh 4J15A 4XU3A 4HWRA 4K87A 4UP9A 1ASZA 3L4GA 4HWPA 4C8QF 4C8QC 4QVCA 5F5WA 3L1AA 3IKLA 5GMKi 2P0LA 3VBBA 2VXFA 3NEMA 1HK9A 3QTCA 2ZINA 5GANj 3IALA 4P73A 5LJ3e 3SWNB 3LSSA 1WQWA 3JB9J 4M77F 4M77C 4M75A 5LJ5h 1G51A 4XEMA 3WQZA 3HFZA 4EX5A 3UFGA 4F7UF 1X55A 1N9RA 3A5YA 1NJ1A 2EJ9A 4C92E 2ARSA 2C7IA 4YRMA 4P73C 3HXXA 2DVEA 4K88A 5LJ3h 1WQ7A 1EFWA 4XU1A 2ARUA 5GANd 5GAN2 2EWNA 4XTXA 3RKYA 1TH7A 1B70B 1LJOA 3V7CA 1JJCB 4M7AB 3UGQA 4RDXA 5C53B 4HWOA 5I21A 3A7UA 4P71C 4M7DG 1L0WA 4CS3A 1BIBA 5LJ3f 1EVLA 3NENA 3MEYA 3HXWA 1B7YB 3JCMX 4PJOE 3V8KA 1EVKA 4YRGA 3JCMW 5CAIA 4MMLA 2E1HA 3JCMe 2ARTA 1SESA 3EFRA 1X54A 4C8QE 4HWTA 4J5YA 2ZTGA 4M75G 4XTYA 3G1ZA 2E64A 4TWAA 1HC7A 3JB9H 5GAOq 1YFTA 4EMGA 3BDUA 3A7RA 2E41A 2Q7HA 2Q5HA 3A74A 3QUIA 4YPFA 4M77E 3JCMh 12ASA 4F7UE 4RQFA 1ADJA 1USYA 2ZIOA 3JB9G 4C92A 2RHSB 3P8TA 5GAMj 5E3IA 4EMKB 2EJGA 2XTIA 2AMCB 4UPAA 3MF2A 1H641 2CJAA 3JCMf 4BWAA 2CGHA 2I4MA 4CH6A 3ERRA 3A7AA 4YRIA 3BJUA 5GAN4 3RF1A 3A31A 4YCWA 4LNSA 1B34A 2QHUA 4KR3A 1N9WA 3HFOA 3QO5A 4PJOB 5GANe 3NELA 3M4PA 4MMKA 4YRQA 3QO8A 4CS2A 4PJOA 2ZT6A 5K1PA 2ZT5A 3DSQA 4J6XA 3PCOA 4YRTA 1PYSB 4C8QB 2VC8A 5C51B 1SETA 4WI1A 2ZZGA 2RHQA 4C8QA 4RMFA 3JCMb 1Y96A 3RIRA 1KQ2A 1LOJA 3M4GA 1B76A 2DJZA 4WJ3M 5GANh 2AKWB 2ZR2A 2DTHA 4M7DB 1KMNA 4E51A 2ZNJA 2VXEA 3KFUA 3ICAA 4M77B 3QSUA 2PMFA 3L4GB 5C52B 2ZXFA 4C92G 3R07A 5LJ5e 5GAN7 4ZIBA 1ADYA 4M77A 2DQ3A 4JRIA 1HTTA 2I4OA 2QHSA 3HXZA 4M78D 3HRIA 4P74C 1VQZA 1KMMA 4F7UA 4HWSA 4YRPA 1IL2A 3HY0A 3RL6A 2YLCA 4NCXA 3TEHA 3V7SA 1NJ2A 4M75B 1M5Q1 4QVDA 4P72A 3HFNA 2Q7GA 3HFZB 4BW9A 2DU7A 1YB3A 1YGBA 4WJ4A 4PJOG 4JLIA 2DTOA 3E9IA 5HGQA 2FB7A 4EMHA 4G84A 2E5AA 3A32A 4P71A 2ZR3A 4YYEA 2DXUA 4P72C 4A54A 4M78F 4M78C 3JB9I 2I4LA 4H2SA 5LJ5f 4C8QG 5GAOr 4DPGA 3VQXA 4O2DA 4X5OA 4H2XA 1E24A 3LSQA 2DZ9A 2ODRD 1JBMA 11ASA 2IY5A 2E10A 3QO7A 3RGLA 3E9HA 4CH4A 5GAMe 5K1XA 1X2GA 1X2HA 4M77G 3JB9D 1Z7MA 3MF1A 4YRNA 4F7UG 4P3NA 2PMEA 3V8JA 4KQEA 1LYLA 4H2UA 4M7AD 2DTIA 3RESA 1WU7A 4L87A 3RACA 2QHTA 1E1TA 3RKXA 5LJ3g 5GAMh 5GAOn 4XQ3A 2E3CA 4X9DA 1JRIA 3JCMJ 4YCVA 4YDQA 2J3LA 1GGMA 5LJ3j 3GIBA 3JB9F 2HNIA 4C92B 3V7RA 4P3PA 3JCMP 4XTZA 4H2YA 1BBUA 1EQRA 1QE0A 4M7AF 4M7AC 2EL9A 3JCMQ 1YFRA 2ZT8A 4M78E 3HSBA 4JUVA 3RERA 4TQFA 4AH6A 4DQ2A 1B34B 3HXUA 4V2SA 2RA2A 2FYKA 1SRYA 1G5IA 5LJ3d 4Q6GA 1C0AA 4TQDA 3RKWA 2DXTA 2EJFA 3PCOB 1I5LA 2DQ0A 2QTXA 1NNHA 1I8FA 3UGTA 1G5HA 4XU0A 2ZIMA 3JCMg 1YCYA 2I4NA 2RHQB 4TTVA 5GAOl 2ZT7A 4YRFA 1Y96B 3HXVA 3VQVA 2ALYA 3W3SA 3IG2A 4P74A 4P75C 3TEGA 4YROA 4HT9A 3CMQA 3M4QA 2Q5IA 2RD1A 3REXA 2I2LA 2EAYA 2RM4A 4OP0A 4EMKC 4RQEA 4F7UB 4YREA 3BY7A 2DZCA 4YRJA 1E22A 3TEHB 3PZCA 4J6WA 4UP8A 3L2ZA 3AHUA 2ZGWA 2Y90A 5GANf 1ATIA 1H4SA 3A5ZA 3HXYA 3V8LA 1D3BB 4M78B 1I4K1 4M7DD 3HFVA 3JCMd 1Z7NA 4M7AE 2JN0A 2YLBA 1D3BA 4M78A 2CJ9A 4H2TA 4H2WA 3REUA 4CS4A 1M8VA
chains in the Genus database with same CATH superfamily
1PHTA 4J6YA 4LNPA 1VUBA 5GANg 1B8AA 2CP7A 3MJXA 3LH5A 1LCKA 4JDSA 2JUFA 4N0AC 5I2SA 2B8AA 1OX8A 1SERA 5GAN8 4LD6A 2FRWA 4M7DC 1NYRA 2E5QA 1RAFB 1EZZB 1W6XA 5GMKj 1J5WA 3I56Q 1I81A 2A28A 5KNNA 3X26B 4QQGA 2F2XA 2JMAA 3G7ZA 3GF5A 1D0XA 2NUTA 1UECA 2COYA 1UHFA 1K0SA 2RQVA 2RB6A 2M9UA 2HQHA 3EHRA 4A53A 2KR3A 2ATCB 3OYYA 1VYUA 1YN8A 5A0GA 1HXDA 4J9EA 1NBEB 3CD6Q 1B70A 3VUZA 4KGVB 5I22A 4ZTUB 4NL3A 3L2RA 4J7FA 2MYSA 2VKNA 3HRTA 4X1VA 1TSFA 4N4GA 4TVAA 1WHKA 1N27A 5KE3A 1IHWA 1LVKA 2JVVA 3RUXA 2KYMA 1MV3A 1T0JA 4RCCA 3BW1A 1I1JA 5LJ5d 4DBFA 5IH2A 3CMAQ 1UGVA 1O75A 2GBQA 2KEAA 3RNJA 4K86A 1D1BA 3MP6A 3LYIA 2P4TA 1KQ1A 2VGNA 3QO3A 1UGQB 2LJ1A 2L0AA 1RAEB 2AHJB 1K8AR 2NUPB 5GAMg 2KGTA 1EFNA 2M02A 1NLPC 1RIQA 1G3YA 1C1AA 1MHNA 3QIIA 4P75A 3PMTA 1WNLA 2K6DA 1OPLA 4C0FA 3LW5E 2ALYB 1XQHA 2X3XD 3NTIA 1GBRA 4M75E 3GP8A 4M7AG 1VA7A 2VB6A 1QVPA 3NGPA 3HRSA 4ZGJB 4UP7A 3H0FA 2CS7A 2NWMA 3SHWA 1OULA 2DJQA 2RQWA 1QVFS 1W70A 1X01A 2KAFA 3INZA 4N4HA 3CCQA 4H2VA 2RQRA 3HTZA 3VUBA 1ASYA 2RI3A 3CC7Q 3I7FA 2M0YA 3SFMA 3CCQT 3PTAA 2CT4A 5FU7B 4NL2A 1H4QA 4YTLA 2LQNA 4C0ZA 2EVRA 3QWYA 2ZPEB 3U23A 5CKDA 2FVUA 2GTOA 1PWTA 4N0AA 2QGGA 2CH4W 4YP0A 1KD1U 4M7DA 3S3NA 1YBYA 2LCSA 1H8KA 4K87A 3L4GA 3UPUA 1PD0A 4C8QC 1M2OA 2SEMA 1ZBJA 3VBBA 2JTEA 2VXFA 4O5VA 3UA6A 5IHNA 2ZINA 2VYTA 2X35A 5LJ3e 3SWNB 1UDLA 2QQSA 2MMPA 1WQWA 1E6GA 3M0UA 5LJ5h 4A4KA 2GNCA 3HFZA 1ZUKA 4F7UF 2XDDA 2K2VA 2JS0A 3EFOA 4C92E 2C7IA 4F16A 4P73C 2FHDA 2DIGA 4K88A 1Y0MA 3L2VA 4LDVA 5GANd 3VS7A 2OJ2A 1I0CA 3A98A 4C0DB 1KQSP 3EHQA 3UGQA 3A7UA 3X28B 4QKUA 4CS3A 2EQIA 3NENA 1NLOC 2RJCA 1G83A 2MPXC 1KQSA 2IPOB 4PJOE 1HD3A 4EDUA 2EQMA 3JCMW 1FMWA 4MMLA 1G3WA 2DE0X 3VRYA 3I55A 3TU4K 3LX7A 2QASA 1SESA 1X54A 1X6GA 2KQWA 3I55T 4XTYA 3G1ZA 2DNUA 5GAOq 3A7RA 1UEBA 3OW2P 2D8JA 1BB9A 1D0ZA 3MO8A 6AT1B 2Q5HA 2FL7A 3G6EQ 1YJWA 2PTKA 1N6AA 4RQFA 2JM8A 3ULRB 3EG9B 1NPRA 3OW2A 3GOXA 4MZMA 1YJWT 4EMKB 2J6FA 1ZUYA 1WI7A 1Y7XA 2AMCB 2CJAA 2JTMA 3CCLA 4BWAA 4DBQA 1M90U 4CH6A 3A7AA 1QW1A 4RUGA 1JJ2P 4FW2A 3H6ZA 2X9HA 2KYBA 3FRNA 3CCLT 2QHUA 2W10A 2O9SA 3PIOA 3QO5A 1X69A 2EYXA 1YITQ 1NJIU 3P8DA 1JJ2A 5CO7A 4J6XA 1E7OA 1PYSB 2RK1A 2YXYA 2MWPA 2F2VA 1JO8A 2RHQA 2ZZGA 2W0ZA 4C8QA 5KYXA 1GFCA 1Y96A 2DJZA 5GANh 1KMNA 1OX9A 3KFUA 4M77B 1EIFA 3R07A 5LJ5e 1KHCA 4LXCA 1CSKA 4FYYB 3HXZA 2RF0A 1FMVA 4M78D 1NEBA 4P74C 2DL7A 2EPDA 3F70A 3MEVA 3PVLA 5FU6C 4DEXA 1TG0A 1IB8A 3TEHA 4M75B 1RL2A 1TUGB 3CCJQ 3REAB 1OPKA 1WGSA 1YB3A 2MIOA 2GQIA 2D0QB 5J26A 1O9SA 1WDXA 4B9WA 1VQ6A 3L2UA 4G84A 3CCEA 4J9IA 5FU7C 4A4HA 1KD1C 2ZR3A 4P72C 4MDXA 4A54A 4M78F 2CP6A 2CH4A 3NHNA 3CCET 2KXCA 2YRDA 5IT9E 2WACA 2RK2A 3MHXA 1E24A 3ER0A 1R0BG 3LSQA 2K5FA 1JBMA 2E10A 3CMEA 1M4ZA 5K1XA 2A36A 4M77G 4JZ4A 3META 3JB9D 4TVRA 4BACA 1Z7MA 1PKSA 3CMET 1RUWA 2KK4A 2EYZA 2DRMA 1K9MR 1VQKA 2H8HA 4P5NA 3RESA 4ME7A 1AD5A 2DFUA 1VQKT 5D6YA 4IURA 3RKXA 5LJ3g 5GAMh 3CCVA 1VQLQ 1MUZA 5GAOn 2J05A 2E3CA 4QQ6A 3M54A 2J3LA 1GGMA 3CCVT 3REBB 5LJ3j 3GIBA 2EKOA 4ZTJA 1MMGA 1KSWA 3JB9F 2HNIA 2RN8A 4C92B 4Z89A 1T0HA 4LN2A 3JCMP 2YWWA 4C0DC 4AMCA 1M27C 1IREB 5KYUB 3CCRQ 3CCUQ 1YFRA 3M0SA 4TQFA 1RAGB 4ZTFA 2A0FB 4AH6A 2AT1B 2GF7A 4B6MA 3UF4A 3HXUA 3TEEA 2COZA 1B3QA 1EX4A 4C5EA 4RTZA 2YRVA 4X34A 2M0OA 2LC4A 1SPKA 4TQDA 4FU6A 2D8HA 2EGCA 3RKWA 2HCKA 9ATCB 4KT0E 2NUPA 3EGDB 2QTXA 2HL3A 4FYVB 2XICA 3M9QA 1G5HA 4XU0A 4LDWA 3CEYA 2C0IA 2ROTA 4KULA 4YRFA 1VIEA 1GXIE 2ALYA 4II1A 3W3SA 8ATCB 4P74A 2L5QA 1WX6A 3M4QA 3M56A 1M90C 3RMQA 3VS2A 5CIUA 5IXFA 4BDYA 1PSEA 3REXA 2RM4A 4EMKC 4DOWA 3HL8A 3OYJA 2XD0A 3ZFJA 1NJIC 3FDRA 3E9FA 2ZGWA 2Y90A 2K2MA 5CKEA 3OYAA 3S3OA 1H4SA 3HXYA 4M7DD 3JCMd 4M7AE 2YLBA 2ESWA 3MPUB 4KUIA 1K76A 4RTWA 1YJ9T 1AT1B 2BTTA 2AIRB 4N4IA 2OI3A 2NYSA 2KI7A 2RJDA 2I0NA 4E7KA 4RCBA 1TUDA 3FB9A 5GMKl 2CDTA 3PE0A 1WHGA 3TCJA 5ELNA 4ESRA 1GBQA 2XU8A 2E3HA 2CKKA 2R5MA 4BE1A 1QCNA 1EIYA 2YUNA 3LC0A 4H2XB 4P3OA 1SEMA 1UHCA 5I11A 2DD5A 4M7DF 2RPNA 4J9GA 4OMQA 2K3XA 2X4WA 3SWNA 1D1CA 4HVVA 4AFZC 3CCMQ 2KSSA 3CXCP 2EYWA 2CZ7B 3I9QA 5L8RE 1Y71A 4OGEA 5LJ5g 1WLPB 1KC8U 3QYHB 3CXCA 4M75C 3IQLA 2JOYA 5LJ5j 5GAN5 1QVGS 1NZ9A 4XTVA 2OAUA 1NJ8A 4H02A 1Z9QA 4GBQA 5KYNA 2GFUA 1FX7A 1PG5B 4OMLA 3MQZA 1E1OA 4LVIA 4CH3A 2XGTA 1ZSZB 4XEOA 2LQKA 3OYCA 1PRMC 3OYHA 4XU2A 1X6BA 3A8MB 2O2OA 5IAYA 2DILA 3NETA 1ABQA 2EQUA 5L23A 4ANJA 5HY6A 3CCSA 3EG1A 2IIMA 1X56A 2QA4Q 3M5AA 2CP0A 2XIDA 1BCMA 1WHJA 3FIFA 3CCST 1VQ8A 3P8VA 2K57A 2NLUA 1VQ8T 1VQ4Q 1G8XA 5GMKm 5A0DA 3OBWA 2HQEA 1NJ6A 5IN1A 3G1JA 3EG9A 4YCUA 1RI0A 4NS5A 3QPHA 1YJNA 4EMKA 1X27A 2AMCA 1UGSB 5DY9A 1YJNT 1VQPQ 1VQNA 1UUEA 3H8ZA 4BD3A 4C92C 2OAWA 4NOYA 3X24B 5GAOp 1I07A 4R55A 1D1AA 1VQNT 4C8QD 3CPWS 2J3MA 2ZCEA 3HRKA 3CC2A 1RABB 1M2VB 2AKKA 1VQ5T 3A5ZB 1T3SA 2ZPBB 5KCOA 4HA8A 1WYXA 2KT8A 1RAHB 1H4VB 4PG3A 4YRRA 3CC2T 2DU5A 2HAXA 1PYSA 2ECZA 3JCMV 2DXCA 3G4SQ 3CQTA 4PJOC 4PLLA 3OYLA 4GLMA 3OD1A 2ZPGB 1U1SA 3HRUA 3E19A 4XU3A 2P0QA 4E7HA 2E70A 1BU1A 1X43A 4C8QF 4QVCA 5CK9A 3L1AA 1VQ7A 2JNGA 5GANj 5GJVB 2KRMA 4GY5A 5FWCA 1VQ7T 2LT4A 2CSIA 1IGQA 4M75A 5D6WA 2YUQA 3MP1A 3WQZA 4EX5A 3UFGA 2KVQG 1OV3A 2DX1A 3A5YA 3A8OB 4YRMA 1GCPA 4IUPA 3HXXA 1YHQQ 2LQWA 5DLOA 4O6JA 3N5BB 5LJ3h 1WQ7A 3RBBB 1EFWA 4XU1A 2LZ6B 4HCBA 2E4HA 1SG5A 5GAN2 2CSQA 4XTXA 1WXUA 3TQ7P 2Y4YA 1LJOA 1JJCB 4M7AB 1RAAB 4BUGA 3GNGA 3OMGA 5C53B 4LUEA 5J39A 3QG1A 2FZKB 1L0WA 1D09B 4FW1A 1BIBA 4D8DA 1YI2Q 1EVLA 1B7YB 4Z88A 3JCMX 2PQWA 3V8KA 1M3AA 3EGXB 1EVKA 4YRGA 4LVLA 3JCMe 2G6FX 3RR6A 1GL5A 1KC8C 3EGUA 2JW4A 2EIFA 4HWTA 4J5YA 2ZTGA 3EG0A 1H92A 3OS1A 4F04B 1TXQA 2E64A 4TWAA 3OS2A 2X3WD 1YFTA 4EMGA 3GBQA 4OMMA 3A74A 4YPFA 4M77E 1QQJA 3H9NA 3A8LB 1PCXA 2AK5A 3EH1A 1IHVA 5IHIA 1ABOA 4C0GA 4C92A 5CKFA 2ENMA 5GAMj 4J8OA 2EJGA 4M4ZA 2ZAEA 1VQOA 1XJWB 1KD1R 4UPAA 1VQ9Q 1H641 3MKDA 4ELZC 2A8EA 4BDZA 2NS6A 1VQOT 3ERRA 1S72A 3RF1A 2XHCA 2E6NA 1N9WA 3HFOA 4JJCA 1S72T 3NELA 3M4PA 3C4SA 3CBPA 1YFNA 4BI4A 1VQMQ 4YRQA 1R0CB 1ZX6A 4PJOA 3H0IA 3DSQA 1SRMA 3EGDA 3A8HB 2J6KA 1PNJA 2VC8A 4D6WA 2DYIA 1RLQC 2LX7A 1U8RA 1SETA 2BE7D 2QQBA 4MZTA 1FWZA 1NYFA 4RMFA 3JCMb 2K7AA 2LX9A 3CBMA 2AKWB 2ZR2A 3O8VA 2DM1A 2HDAA 4HKEA 4JJBA 3ICAA 4CC3A 2PMFA 1W2BP 2DO3A 2ZXFA 1WJRA 3OYKA 4ELYC 4KGXB 2RQTA 2DQ3A 1HTTA 4B9XA 2I4OA 1G2BA 2JT4A 1W2BA 5IXBA 1RLPC 2BZ8A 3RL6A 1U5SA 3JV3A 3JRZA 3PFSA 3V7SA 3QYGB 4AFSC 3HFNA 2Q7GA 2HKQB 4BY6B 1TS9A 3PNWC 2MCNA 1YGBA 3RDVA 2RHUA 2M1HA 3SDZA 5HGQA 2FB7A 4EMHA 3NTHA 2LJ0A 1QCFA 3A32A 1R77A 5CQXA 2OTJA 1YWPA 1OOTA 4AFUC 2RJEA 1XTDA 3MEWA 4DPGA 2FZCB 2OTJT 3TSWA 3VQXA 1U3OA 4H2XA 3VS4A 5KYWB 1SRLA 2LP5A 2ODRD 2DD4A 3TSZA 2CREA 1N8RR 5CVIA 11ASA 3QO7A 4BB7A 1CKAA 3CC4Q 1X2HA 4Y92A 1OU8A 2QEXA 4BI8B 4RTYA 3MF1A 2JXBA 2FPFA 3QZ9B 4F7UG 4P3NA 2PMEA 2D0NA 4KQEA 3OYNA 3G71Q 3HTRA 1M90R 1LYLA 4CC4B 2QEXT 2EGEA 4CC2A 2ABLA 3FEOA 2GCXA 4QW2A 1NJIR 1SF9A 1E1TA 5FLXE 2BUDA 2D1XA 2DXBA 5C0MA 4YDQA 1Q82U 1RAIB 5A2QE 2OTLQ 3VS6A 3V7RA 4E2FB 2MI6A 2VUBA 4XTZA 1KG1A 1N8RU 1UE9A 1YIJA 4M7AC 5C6SA 2E5KA 5D6XA 4JUVA 2CZ6B 1YIJT 1TUCA 2DEUA 2B86A 1XOVA 2BE9B 1QCOA 4DQ2A 1B34B 1M1GA 1M1FA 4V2SA 2MF2A 2FYKA 1SRYA 1G5IA 1KQSS 1K0XA 4Q6GA 2MK5A 2LCLA 2DRKA 4E47A 3UA7A 2EJFA 1B07A 3S6WA 3ME9A 1NNHA 1I8FA 3UGTA 5GJWB 4RG2A 4JJNK 2QAZA 3JCMg 2I4NA 1BI1A 4TTVA 5GAOl 2ZT7A 3GLXA 4IUTA 3HXVA 3VQVA 4OB0B 4HT4A 5HKCA 2G3RA 4KGZB 3C0CA 3TEGA 1WHLA 1F1BB 1M1KU 2J6OA 3Q1JA 1AZEA 2DBKA 2ZPFB 3QDRB 5FROA 2RD1A 2I2LA 3OW2S 2EAYA 4OP0A 3HHTB 4BE2A 3BY7A 3HP9A 4PJMA 4J6WA 1M2VA 3AHUA 4RMOA 3A5ZA 3V8LA 3VKIA 4M78B 1I4K1 3HFVA 1Z7NA 2LRQA 3NMZC 2RH2A 1OZ2A 3GPLA 1D3BA 3ZEHA 2JTFA 2CJ9A 4H2TA 2DL3A 1ZUUA 1M8VA 1JJ2S 4YRKA 2DEQA 4OLFA 2QGFB 2RMOA 4M75D 3VU3C 1I5OB 3NPFA 2WSFE 4XK8E 4XTWA 1WPYA 5CKBA 3CBOA 1V1CA 4TVYA 2P5IA 3JCMc 2VWFA 3DB3A 1H4TA 1UFFA 1Q86U 4JJDA 2E6ZA 1H3HA 2HSEB 3BDLA 3PGGA 2RHIA 4PFOA 3R6NA 3OYIA 3QZ5B 2AZVA 3I56A 4DBRA 1K1ZA 2DAQA 4TVWA 1VOMA 3I56T 4HT8A 4J9CA 3KXTA 4M75F 4OMPA 2QQRA 3SWNC 2ZCFB 3OQ5A 5GAOm 2ED0A 4RTUA 4BY6C 4M78G 1K73U 2QHVA 1KOGA 4TVAB 3HY1A 1WHMA 1JJCA 4M7AA 2PVGB 3SB2A 2ODRC 3CD6A 2CUDA 1OI1A 4J7IA 4G85A 4FT4A 3DKMA 1RADB 1ZA1B 1G5VA 4ZN1A 1MMAA 3CD6T 4FCYA 1B7YA 2K9GA 1X2QA 3EGXA 4Z02A 3DB4A 4LUDA 5EG2A 2LMJA 2LJ3A 4PHCA 2HSPA 1EOVA 3LGLA 3CMAA 1JB0E 1BK2A 3OA6A 1WJSA 2G4CA 4C92D 1AWXA 3R6OA 4L6V5 4ZGEB 1C6VX 2VGMA 3UH0A 3CMAT 2V1QA 4ZGDB 5GAN3 1AWOA 1SSFA 2DETA 3QKJA 3AT1B 1Q82C 4CRIA 2KT1A 4IIOA 1W66A 3TUPA 4LVMA 4PFZA 1LPLA 1WXBA 2EYQA 4PNOA 2C8MA 1JU5C 1N8RC 1BCOA 3SEMA 4YRLA 3OYEA 5KYYB 4PJOD 2QG9B 2CIMA 1USYC 2JZ2A 4C92F 1PD1A 4IUVA 1VQ9T 1MNEA 4KR2A 3CCQQ 2CJBA 4JRKA 1WLEA 4K11A 2QQ9A 3X25B 2DBMA 2HL5C 3I5RA 1IZ6A 5GMKe 2X4XA 3L2QA 2QYZA 2CP3A 3MEUA 3M4YA 3CC7A 1YJ9A 4J9HA 4E7LA 1BI0A 1KC8R 2FO0A 3EH2A 1Q81U 3CC7T 1NYQA 1TTHB 4PJOF 1BBWA 2Q7EA 3QNEA 1BYMA 2ZZFA 4FL6A 2EW3A 2AKWA 4J15A 1M1KC 3BE3A 1ASZA 4HWPA 8AT1B 2RI2A 3IKLA 3VRZA 4Z8AA 2LNHB 4BE0A 5HK3A 2CT3A 2KY9A 2R57A 4M77C 1QP3A 2PU9B 2FZGB 3LLRA 2KDSA 2YDLA 1X55A 5M9OA 4RG8A 1NJ1A 2EJ9A 3VYHB 2YSQA 2QTVA 1ACMB 5FWBA 5AYFA 1UG1A 3HPWA 3J81E 5KH6A 4LDUA 3OYMA 1NM7A 1PM3A 4OMNA 1HSQA 3RKYA 1TH7A 2DMOA 1UGRB 1SHGA 4HWOA 3WVDB 4QVZA 4M7DG 2RHZA 5LJ3f 5KYWA 1Q86C 1WZOA 3S3MA 1TWBA 2HKNA 3I55Q 3DLLA 5D7UA 3VS3A 2M51A 2CZ0B 2H3JA 2DERA 3EFRA 2FG0A 3G71T 2V8KA 5HK0A 4PJJA 3PIPA 1HC7A 3JB9H 4KH1B 2XMFA 1K73C 3QWXX 2Q7HA 1KJWA 1ZLMA 1YJWQ 3QUIA 1GCQC 4VUBA 2VV5A 3JCMh 2XDBA 12ASA 4F7UE 5HCKA 2KMTA 3CXCS 3G6EA 1ADJA 1USYA 2ZIOA 2RHSB 3P8TA 2K3BA 2XTIA 3G6ET 3CCLQ 2HZYA 3MF2A 2DK3A 2HEQA 1G3SA 2CGHA 1ZA2B 1P92A 4BI3A 3BJUA 4YCWA 1B34A 4KR3A 1WJQA 2XI9A 4J83A 1VQ5A 4MMKA 1ARKA 4IKFA 4CS2A 2DL5A 1YITA 3SD4A 2ZT6A 2SRCA 5K1PA 2WSCE 4Y28E 4C8QB 1VYVA 1QKWA 1YITT 5C51B 2LVMA 3FC3A 4JLGA 2R5AA 3RIRA 1KQ2A 1LOJA 1WXTA 3M4GA 1B76A 1M8MA 2DTHA 4E51A 2ZNJA 1AVZC 5C52B 4HCZA 2PZ1A 3MEAA 1ADYA 4M77A 3TVTA 2FRYA 4DA4A 1VQZA 1KMMA 1VYTA 2P4RA 2DYBA 3HY0A 1IL2A 2YLCA 1AHJB 1T3LA 1NJ2A 1M5Q1 2COWA 1SKUB 3OMCA 3OYDA 3CCJA 2QQAA 1Q81C 1VQ6Q 4WJ4A 1IRXA 3A8GB 4KRTA 3C12A 3OSVA 3CCEQ 4OMFB 2KRSA 2V26A 3CCJT 2L3RA 3OYBA 2E5AA 2GQVA 2C0OA 2BIVA 1Q7YU 4A4FA 3JB9I 3KBGA 4XAXB 3QDFA 2I4LA 1AWJA 5LJ5f 2L89A 4C8QG 4H2SA 2EBPA 2DVJA 5GAOr 2RQUA 2ED1A 3CMEQ 2HD0A 2Z0WA 1UJYA 3RGLA 3E9HA 1X2GA 4RTXA 4YRNA 1M3CA 4HXJA 3V8JA 1VQKQ 1QLYA 1WHHA 4H2UA 4LD9K 1B7TA 4M7AD 5FRMA 3LWIA 1GCQA 2XDPA 1WU7A 3CCVQ 4E7ZA 3JSCA 3RACA 1AEYA 2QK0A 2QHTA 4X9DA 1JRIA 3JCMJ 1VQLA 1QVFP 3UWNA 4OB3B 1DJ7B 1OZ3A 1VQLT 4LDYA 2V8IA 1QVFA 4H2YA 3LWHA 3PT9A 4OB1B 4M7AF 2EL9A 2YUOA 3JCMQ 1Q95G 2WSEE 4KBMB 2ZT8A 1G3TA 4M78E 3O5ZA 1CKBA 4C5GA 3RERA 3A1PA 3CCRA 3CCUA 5EC7A 5KYUA 2DL4A 2K4YA 4IIMA 3CCRT 3CCUT 1C0AA 1SSHA 2ZPHB 1ZSZC 4AFQC 1R8OB 3PCOB 3FJ5A 1I5LA 2DQ0A 2DL8A 1OQKA 4FYWB 1BI2A 3E2UA 2QDYB 2EGAA 2JMCA 1OYXA 5FU6B 1YCSB 3IG2A 1FYNA 1M9SA 4PJNA 4FYXB 3UDCA 4YROA 3CMQA 2CZ1B 5KYYA 2CP2A 4DEYA 4PKCC 2D9TA 4F7UB 2PNIA 4YREA 3OY9A 4L59A 4YRJA 3C95A 1YJ9Q 1E22A 2L3SA 1W1FA 5GANf 3DLMA 2QDLA 1K8AU 1WFWA 5KE2A 4JRPA 2O31A 4Q5WA 2O4XB 1BI3A 4WTOB 1IO6A 3H41A 1MMDA 3JAME 2PVOB 2EQJA 2RI5A 4J9FA 1AZGB 4H2WA 4CS4A 5LL6S 4R56A 3M0TA 3QHSA 3NFCA 1EIYB 3M58A 3M57A 3I35A 2E65A 2K79A 2LNVA 1Q82R 4E6RA 1YP5A 1ZBXA 5ELOA 1OEBA 1YFSA 4Y91A 2IY5B 5GAN6 4PJLA 2OX7A 4WF2A 4YRSA 3VQYA 3URGA 2DIQA 2HQXA 2F69A 4X9CA 2DF6A 3CCMA 4AG2C 1KHIA 1NJ5A 2P0KA 1LNXA 1W2BS 3CCMT 1V76A 2FPEA 3H0HA 3OB9A 3IKMB 1PSFA 3OS0A 3VQWA 4ZTZB 2J7IA 2O01E 2X4YA 1MGQA 1Q7YC 7AT1B 2JS2A 4EO4A 2V8JA 4OB2B 4DBHA 1FMKA 3P8YA 2ZZEA 2M16A 1M30A 3EFSA 2L3PA 1JXMA 1X6OA 2DKGA 3VJPA 5GAMf 3OS5A 1M1KR 2YRCA 1KFZA 1ZSZA 4EPCA 2XG8D 4JZ3A 3CCSQ 2MWOA 1K9AA 1Z9ZA 1NE8A 4XTUA 3OSSC 4JS5A 3P8BB 2HMAA 1QWFA 2YHTA 4GLKA 1VQ8Q 1ZQ1A 1TU0B 3ZL7C 4M7DE 1NPPA 4RTTA 4LE9A 2QA4A 2DDZA 1YNZA 2QA4T 4UC4A 2A3LA 4D8KA 1VQ4A 4CH5A 1QP2A 1X2KA 3E1SA 1YJNQ 1WYDA 2ZNIA 3M0PA 4IUUA 4A4EA 1IXDA 2RHSA 3L42A 3T9NA 1ZSGA 1VQ4T 1M3BA 2A08A 2E12A 1VQNQ 1QF6A 2KXDA 1VQ5Q 1NYGA 3M55A 1ZHIA 4HVUA 1VQPA 4HCCA 3CC2Q 1Y07A 4MZPA 3VV0A 2F5KA 4HVCA 4JPBW 1Q86R 3FJPA 5GAMd 4Q15A 1U1TA 1VQPT 4YRCA 3BFMA 1N5ZA 1N9SA 3ASKA 1PRLC 3M0QA 4HVWA 1BIAA 1PKTA 2PVDB 4M77D 2E3IA 5ECAA 1FYFA 2DA9A 4FT2A 2GGRA 3G4SA 1AWWA 1K73R 2D6FA 5GMKh 4PFPA 4HWRA 4ZN3A 4UP9A 3MP8A 2X4JA 3G4ST 1VQ7Q 2NUZA 5F5WA 3OYGA 5GMKi 3C94A 2P0LA 1D0YA 3NEMA 3QTCA 1HK9A 5CKHA 3IALA 1TOVA 2KRNA 2L2PA 4P73A 4LVJA 2XK0A 3LSSA 2V1RA 2P0PA 3JB9J 1K8AC 3QJ6A 4M77F 4FM4B 2NUTB 1G51A 4XEMA 2F5TX 2FEIA 1N9RA 1JXOA 3PVQA 2ARSA 2ROLA 2GTJA 4OGCA 5A0LA 2DVEA 2QXFA 3QJYA 1VQ6T 3EG3A 1YHQA 3RMSA 2ARUA 3QXEB 2EWNA 1X75C 4FSXA 1B70B 2A7YA 3D7SB 3EAEA 3V7CA 1YHQT 2DPPB 4RDXA 2C0TA 4QQDA 4DOVA 1VIFA 5I21A 1SHFA 4A63B 1KIKA 4P71C 4OMOA 2X51A 3MEYA 3WVEB 3HXWA 4L5GA 1YI2A 2AZSA 2L3QA 3X20B 5CAIA 2E1HA 1YI2T 1NEGA 2F2WA 2ARTA 1XNIA 4C8QE 1QWEA 4M75G 4MDWA 1MNDA 3BDUA 2E41A 4E7JA 2CP5A 4AG1C 2MAMA 2RNAA 3FLGA 3UT1A 4J9BA 4FIBA 2AKLA 2YT6A 4QT7A 1Q81R 5KCHA 3JB9G 1UJ0A 1VQOQ 5E3IA 1WA7A 2HBPA 3LGFA 2YUPA 1S72Q 3JCMf 3HKSA 4C5IA 2I4MA 4PK4A 5CCAA 5CR2A 1VQ9A 4YRIA 4LDXA 5GAN4 1K9MU 1GRIA 3ZBDA 3A31A 4LNSA 1BBZA 1WIEA 3LH0A 4PJOB 5GANe 3J80E 4OVAA 3VYGA 5FW9A 3UATA 3QO8A 4ZNXA 2EKHA 2ZT5A 3PCOA 4YRTA 1VQMA 1IGUA 3VS5A 3M59A 3PMIA 4WI1A 2LQ8A 1VQMT 1FXXA 2BKDN 2VASA 2F1LA 4WJ3M 2Y4XA 1AOJA 4M7DB 4PLIA 2VXEA 3QSUA 3L4GB 2LTOA 4C92G 5GAN7 4ZIBA 4E7SA 3MCAB 4JRIA 1QVGP 2L8DA 2BZXA 2CYZB 2QHSA 2PUKB 3HRIA 2KE9A 4F7UA 4HWSA 1U06A 4YRPA 4NCXA 3TREA 1RACB 3OYFA 5IHKA 1Y57A 4RTVA 4IUQA 4ATOA 1QVGA 4QVDA 4P72A 3HFZB 1J3TA 4FSSA 4BW9A 2DU7A 2C06A 2HBWA 4KUDK 1S1NA 3OBYA 1QMCA 3KFVA 3EFOB 2O4XA 5DLQE 2XKOC 1JQQA 1KK7A 4PJOG 4JLIA 1UTIA 2DTOA 3E9IA 2OTJQ 2LT1A 4P71A 4YYEA 2DXUA 1QKXA 2JJ9A 4M78C 1GFDA 1W4SA 3THKA 4A4GA 4O2DA 4X5OA 1UB4A 2DZ9A 2IY5A 1NG2A 1BKBA 2QEXQ 4CH4A 5GAMe 4LVKA 1RI9A 3CC4A 2RHYA 3CC4T 2J06A 4J9DA 2O9VA 3L2WA 3G71A 2BZYA 1E6HA 2A37A 2QI2A 2DTIA 4L87A 4ORZA 1JEGA 2KNBB 2O88A 4XQ3A 1H3ZA 4AT1B 3E9GA 4YCVA 3M53A 4OF1A 5I2MA 2K5LA 3NTKA 1HJDA 5AT1B 3EG2A 3CPWP 2K5IA 2IG0A 5DM7R 1UGPB 4EIKA 2OTLA 2EFIA 1YIJQ 4P3PA 1BBUA 2JM9A 1EQRA 3CPWA 1QE0A 2VVKA 2OTLT 3P8HA 4C5HA 1MMNA 4E7IA 1HYOA 3HSBA 1YWOA 3J7AF 2RO0A 4CI0C 5J3BA 2RA2A 1MV0B 5LJ3d 2ZPIB 3WXMB 3I5SA 2DXTA 4F14A 4JRQA 1OU9A 5FRNA 2KROA 2P84A 2K3YA 2ZIMA 5CQYA 1YCYA 2RHQB 2DLPA 2RJFA 5KYXB 1Y96B 4HCKA 3KUFA 4KH0B 4F17A 1Q7YR 4P75C 2KBTA 4HT9A 2FPDA 2Q5IA 2CUBA 1PC0A 4PL6A 1K9MC 4RQEA 2EQKA 4RKUE 2R58A 2PUOB 4CC7A 2MOXA 2DZCA 3VS1A 2H3EB 1A0NB 2RHXA 3TEHB 3CPFA 1K4US 3PZCA 4UP8A 3L2ZA 1ATIA 2EYYA 3QBYA 4R0KA 1D3BB 2IVWA 1C0MA 3M0RA 3VS0A 2GFAA 2LDMA 2JN0A 4WCIA 4M78A 3GNFB 1V29B 3REUA 2LCCA 4JS4A 2ZZDA
chains in the Genus database with same CATH topology
4J6YA 1VUBA 5GANg 1B8AA 4JDSA 2JUFA 4N0AC 5I2SA 2B8AA 1SERA 5GAN8 4LD6A 4M7DC 1NYRA 2E5QA 5GMKj 1J5WA 1I81A 5KNNA 3X26B 4QQGA 3G7ZA 3GF5A 2RB6A 2M9UA 4A53A 3OYYA 5A0GA 1HXDA 1B70A 3VUZA 4ZTUB 4NL3A 3L2RA 4J7FA 3HRTA 4N4GA 4TVAA 1N27A 5KE3A 2JVVA 3RUXA 4RCCA 3BW1A 5LJ5d 1O75A 4K86A 3MP6A 3LYIA 2P4TA 1KQ1A 2VGNA 3QO3A 1UGQB 2AHJB 5GAMg 1RIQA 1G3YA 1MHNA 3QIIA 4P75A 3PMTA 1WNLA 4C0FA 3LW5E 2ALYB 1XQHA 3NTIA 4M75E 3GP8A 4M7AG 1QVPA 3HRSA 4ZGJB 4UP7A 2CS7A 1QVFS 1X01A 2KAFA 3INZA 4N4HA 3CCQA 4H2VA 3HTZA 3VUBA 1ASYA 2RI3A 3I7FA 3SFMA 3CCQT 3PTAA 5FU7B 4NL2A 1H4QA 4YTLA 4C0ZA 2ZPEB 5CKDA 2FVUA 4N0AA 4YP0A 1KD1U 4M7DA 3S3NA 1YBYA 4K87A 3L4GA 3UPUA 4C8QC 3VBBA 2VXFA 4O5VA 2ZINA 2VYTA 2X35A 5LJ3e 3SWNB 2QQSA 2MMPA 1WQWA 5LJ5h 4A4KA 3HFZA 4F7UF 2XDDA 2K2VA 4C92E 2C7IA 4P73C 2FHDA 2DIGA 4K88A 3L2VA 4LDVA 5GANd 4C0DB 3UGQA 3A7UA 3X28B 4CS3A 3NENA 2RJCA 1KQSA 4PJOE 4EDUA 2EQMA 3JCMW 4MMLA 1G3WA 3I55A 3TU4K 3LX7A 1SESA 1X54A 2KQWA 3I55T 4XTYA 3G1ZA 5GAOq 3A7RA 1UEBA 3MO8A 2Q5HA 2FL7A 1YJWA 1N6AA 4RQFA 1NPRA 3OW2A 3GOXA 4MZMA 1YJWT 4EMKB 1Y7XA 2AMCB 2CJAA 2JTMA 3CCLA 4BWAA 1M90U 4CH6A 3A7AA 1QW1A 3H6ZA 3FRNA 3CCLT 2QHUA 3PIOA 3QO5A 1NJIU 3P8DA 1JJ2A 5CO7A 4J6XA 1PYSB 2RK1A 2MWPA 2ZZGA 2RHQA 4C8QA 1Y96A 2DJZA 5GANh 1KMNA 3KFUA 4M77B 1EIFA 3R07A 5LJ5e 1KHCA 3HXZA 4M78D 4P74C 3F70A 3MEVA 5FU6C 3TEHA 4M75B 1RL2A 1WGSA 1YB3A 2D0QB 5J26A 1O9SA 4B9WA 1VQ6A 3L2UA 4G84A 3CCEA 5FU7C 4A4HA 1KD1C 2ZR3A 4P72C 4MDXA 4A54A 4M78F 3CCET 5IT9E 2WACA 2RK2A 3MHXA 1E24A 3ER0A 3LSQA 2K5FA 1JBMA 2E10A 3CMEA 1M4ZA 5K1XA 4M77G 3META 3JB9D 4TVRA 4BACA 1Z7MA 3CMET 2KK4A 1VQKA 4P5NA 3RESA 4ME7A 1VQKT 5D6YA 4IURA 3RKXA 5LJ3g 5GAMh 3CCVA 5GAOn 2E3CA 4QQ6A 3M54A 2J3LA 1GGMA 3CCVT 5LJ3j 3GIBA 2EKOA 4ZTJA 3JB9F 2HNIA 4C92B 3JCMP 4C0DC 1IREB 1YFRA 4TQFA 4ZTFA 4AH6A 2GF7A 3HXUA 3TEEA 4C5EA 2YRVA 4X34A 2M0OA 2LC4A 4TQDA 4FU6A 3RKWA 4KT0E 2QTXA 2XICA 3M9QA 1G5HA 4XU0A 4LDWA 3CEYA 4KULA 4YRFA 1VIEA 1GXIE 2ALYA 4II1A 3W3SA 4P74A 2L5QA 3M4QA 3M56A 1M90C 3RMQA 5CIUA 4BDYA 1PSEA 3REXA 2RM4A 4EMKC 4DOWA 3HL8A 3OYJA 2XD0A 3ZFJA 1NJIC 3FDRA 3E9FA 2ZGWA 2Y90A 5CKEA 3OYAA 3S3OA 1H4SA 3HXYA 4M7DD 3JCMd 4M7AE 2YLBA 4KUIA 1YJ9T 4N4IA 2RJDA 4E7KA 4RCBA 3FB9A 5GMKl 3TCJA 5ELNA 2XU8A 2CKKA 2R5MA 4BE1A 1EIYA 3LC0A 4H2XB 4P3OA 2DD5A 4M7DF 2K3XA 2X4WA 3SWNA 2KSSA 2CZ7B 5L8RE 1Y71A 4OGEA 5LJ5g 1KC8U 3QYHB 3CXCA 4M75C 2JOYA 5LJ5j 5GAN5 1QVGS 1NZ9A 4XTVA 2OAUA 1NJ8A 4H02A 2GFUA 1FX7A 3MQZA 1E1OA 4LVIA 4CH3A 2XGTA 4XEOA 2LQKA 3OYCA 3OYHA 4XU2A 3A8MB 5IAYA 3NETA 2EQUA 5HY6A 3CCSA 1X56A 3M5AA 2XIDA 3FIFA 1VQ8A 3CCST 3P8VA 2K57A 2NLUA 1VQ8T 5GMKm 5A0DA 3OBWA 2HQEA 1NJ6A 5IN1A 4YCUA 1RI0A 4NS5A 3QPHA 1YJNA 4EMKA 2AMCA 1UGSB 5DY9A 1YJNT 1VQNA 4BD3A 3H8ZA 4C92C 4NOYA 3X24B 5GAOp 4R55A 1VQNT 4C8QD 3CPWS 2J3MA 2ZCEA 3HRKA 3CC2A 1VQ5T 3A5ZB 2ZPBB 5KCOA 4HA8A 1H4VB 4PG3A 4YRRA 3CC2T 2DU5A 2HAXA 1PYSA 3JCMV 2DXCA 4PJOC 4PLLA 3OYLA 3OD1A 2ZPGB 1U1SA 3HRUA 3E19A 4XU3A 2P0QA 4E7HA 2E70A 4C8QF 4QVCA 5CK9A 3L1AA 1VQ7A 2JNGA 5GANj 4GY5A 1VQ7T 2LT4A 4M75A 5D6WA 3MP1A 3WQZA 4EX5A 3UFGA 2KVQG 3A5YA 3A8OB 4YRMA 4IUPA 3HXXA 5DLOA 4O6JA 3N5BB 5LJ3h 1WQ7A 1EFWA 4XU1A 4HCBA 5GAN2 4XTXA 2Y4YA 1LJOA 1JJCB 4M7AB 4BUGA 3GNGA 3OMGA 5C53B 5J39A 3QG1A 1L0WA 1BIBA 1EVLA 1B7YB 3JCMX 2PQWA 3V8KA 1EVKA 4YRGA 4LVLA 3JCMe 1KC8C 4HWTA 2EIFA 4J5YA 2ZTGA 3OS1A 2E64A 4TWAA 3OS2A 1YFTA 4EMGA 3A74A 4YPFA 4M77E 3A8LB 4C0GA 4C92A 5CKFA 5GAMj 4J8OA 2EJGA 1VQOA 4UPAA 1H641 4ELZC 2A8EA 4BDZA 2NS6A 1VQOT 3ERRA 1S72A 3RF1A 2XHCA 2E6NA 1N9WA 3HFOA 1S72T 3NELA 3M4PA 3C4SA 3CBPA 4YRQA 4BI4A 4PJOA 3DSQA 3A8HB 2VC8A 4D6WA 1U8RA 1SETA 2QQBA 4MZTA 1FWZA 4RMFA 3JCMb 2LX9A 3CBMA 2AKWB 2ZR2A 3O8VA 4HKEA 3ICAA 2PMFA 2DO3A 2ZXFA 1WJRA 3OYKA 4ELYC 2DQ3A 1HTTA 4B9XA 2I4OA 1W2BA 3RL6A 3JRZA 3PFSA 3V7SA 3QYGB 3HFNA 2Q7GA 4BY6B 3PNWC 1YGBA 2RHUA 2M1HA 3SDZA 5HGQA 2FB7A 4EMHA 3NTHA 3A32A 5CQXA 2OTJA 2RJEA 1XTDA 3MEWA 4DPGA 2OTJT 3VQXA 4H2XA 2ODRD 2DD4A 5CVIA 11ASA 3QO7A 4BB7A 1X2HA 2QEXA 4BI8B 3MF1A 3QZ9B 4F7UG 4P3NA 2PMEA 4KQEA 3OYNA 1LYLA 2QEXT 3FEOA 2GCXA 4QW2A 1E1TA 5FLXE 2BUDA 2DXBA 5C0MA 4YDQA 1Q82U 5A2QE 3V7RA 2MI6A 2VUBA 4XTZA 1KG1A 1N8RU 1YIJA 4M7AC 5C6SA 5D6XA 4JUVA 2CZ6B 1YIJT 1XOVA 4DQ2A 1B34B 1M1GA 1M1FA 4V2SA 2MF2A 2FYKA 1SRYA 1G5IA 1KQSS 4Q6GA 2LCLA 4E47A 2EJFA 3S6WA 3ME9A 1NNHA 1I8FA 3UGTA 4RG2A 4JJNK 3JCMg 2I4NA 1BI1A 4TTVA 5GAOl 2ZT7A 3GLXA 4IUTA 3HXVA 3VQVA 4OB0B 4HT4A 5HKCA 2G3RA 3TEGA 1M1KU 3Q1JA 2ZPFB 3QDRB 5FROA 2RD1A 2I2LA 3OW2S 2EAYA 4OP0A 3HHTB 4BE2A 3BY7A 3HP9A 4J6WA 3AHUA 4RMOA 3A5ZA 3V8LA 3VKIA 4M78B 1I4K1 3HFVA 1Z7NA 2LRQA 2RH2A 1OZ2A 3GPLA 1D3BA 3ZEHA 2JTFA 2CJ9A 4H2TA 1M8VA 1JJ2S 4YRKA 2DEQA 4OLFA 4M75D 3VU3C 2WSFE 4XK8E 4XTWA 1WPYA 5CKBA 3CBOA 4TVYA 2P5IA 3JCMc 3DB3A 1H4TA 1Q86U 2E6ZA 3BDLA 3PGGA 2RHIA 3OYIA 3QZ5B 3I56A 2DAQA 4TVWA 3I56T 4HT8A 3KXTA 4M75F 2QQRA 3SWNC 2ZCFB 3OQ5A 5GAOm 4BY6C 4M78G 1K73U 2QHVA 1KOGA 4TVAB 3HY1A 1JJCA 4M7AA 2PVGB 3SB2A 2ODRC 3CD6A 1OI1A 4J7IA 4G85A 4FT4A 3DKMA 1G5VA 4ZN1A 3CD6T 1B7YA 4Z02A 3DB4A 5EG2A 4PHCA 1EOVA 3LGLA 3CMAA 1JB0E 3OA6A 1WJSA 2G4CA 4C92D 3R6OA 4L6V5 4ZGEB 2VGMA 3UH0A 3CMAT 4ZGDB 5GAN3 1SSFA 3QKJA 1Q82C 4CRIA 1W66A 3TUPA 4LVMA 2EYQA 4PNOA 2C8MA 1N8RC 4YRLA 3OYEA 4PJOD 2CIMA 1USYC 2JZ2A 4C92F 4IUVA 1VQ9T 4KR2A 2CJBA 4JRKA 1WLEA 2QQ9A 3X25B 1IZ6A 5GMKe 2X4XA 3L2QA 3MEUA 3M4YA 3CC7A 1YJ9A 4E7LA 1BI0A 1Q81U 3CC7T 1NYQA 4PJOF 1BBWA 2Q7EA 3QNEA 1BYMA 2ZZFA 4FL6A 2AKWA 4J15A 1M1KC 1ASZA 4HWPA 2RI2A 3IKLA 4BE0A 5HK3A 2KY9A 2R57A 4M77C 1QP3A 2PU9B 3LLRA 2KDSA 1X55A 5M9OA 4RG8A 1NJ1A 2EJ9A 3VYHB 5AYFA 3HPWA 3J81E 5KH6A 4LDUA 3OYMA 3RKYA 1TH7A 1UGRB 4HWOA 3WVDB 4QVZA 4M7DG 2RHZA 5LJ3f 1Q86C 3S3MA 3DLLA 2CZ0B 2H3JA 3EFRA 3G71T 2V8KA 5HK0A 3PIPA 1HC7A 3JB9H 1K73C 2Q7HA 3QUIA 4VUBA 2VV5A 3JCMh 2XDBA 12ASA 4F7UE 2KMTA 3CXCS 3G6EA 1ADJA 1USYA 2ZIOA 2RHSB 3P8TA 2XTIA 3G6ET 3MF2A 2DK3A 1G3SA 2CGHA 4BI3A 1P92A 3BJUA 4YCWA 1B34A 4KR3A 1WJQA 2XI9A 4J83A 1VQ5A 4MMKA 4IKFA 4CS2A 1YITA 3SD4A 2ZT6A 5K1PA 2WSCE 4Y28E 4C8QB 1YITT 5C51B 2LVMA 3FC3A 4JLGA 2R5AA 3RIRA 1KQ2A 1LOJA 3M4GA 1B76A 2DTHA 4E51A 2ZNJA 5C52B 4HCZA 3MEAA 1ADYA 4M77A 4DA4A 1VQZA 1KMMA 1IL2A 3HY0A 2YLCA 1AHJB 1NJ2A 1M5Q1 3OMCA 3OYDA 3CCJA 2QQAA 1Q81C 4WJ4A 3A8GB 3OSVA 3C12A 4OMFB 3CCJT 2L3RA 3OYBA 2E5AA 2GQVA 1Q7YU 2BIVA 4A4FA 3JB9I 3KBGA 4XAXB 2I4LA 4H2SA 5LJ5f 2L89A 4C8QG 5GAOr 2HD0A 3RGLA 3E9HA 1X2GA 4YRNA 3V8JA 4H2UA 4LD9K 4M7AD 5FRMA 3LWIA 2XDPA 1WU7A 3JSCA 3RACA 2QHTA 4X9DA 1JRIA 3JCMJ 1VQLA 3UWNA 4OB3B 1DJ7B 1OZ3A 1VQLT 4LDYA 2V8IA 1QVFA 4H2YA 3LWHA 3PT9A 4OB1B 4M7AF 2EL9A 3JCMQ 2WSEE 4KBMB 2ZT8A 1G3TA 4M78E 4C5GA 3RERA 3CCRA 3CCUA 2K4YA 3CCRT 3CCUT 1C0AA 2ZPHB 1R8OB 3PCOB 1I5LA 2DQ0A 1BI2A 2QDYB 1OYXA 5FU6B 3IG2A 1M9SA 3UDCA 4YROA 3CMQA 2CZ1B 4PKCC 2D9TA 4F7UB 4YREA 3OY9A 4L59A 4YRJA 3C95A 1E22A 5GANf 3DLMA 1K8AU 5KE2A 4JRPA 4Q5WA 2O4XB 1BI3A 3JAME 2PVOB 2EQJA 2RI5A 4H2WA 4CS4A 5LL6S 4R56A 3QHSA 3NFCA 1EIYB 3M58A 3M57A 2E65A 2LNVA 1ZBXA 5ELOA 1YFSA 4Y91A 2IY5B 5GAN6 4WF2A 4YRSA 3VQYA 3URGA 2DIQA 2HQXA 2F69A 4X9CA 3CCMA 1KHIA 1NJ5A 2P0KA 1LNXA 1W2BS 3CCMT 3OB9A 3IKMB 1PSFA 3OS0A 3VQWA 4ZTZB 2X4YA 2O01E 1Q7YC 1MGQA 4EO4A 2V8JA 4OB2B 3P8YA 2ZZEA 2M16A 3EFSA 1X6OA 2DKGA 3VJPA 5GAMf 3OS5A 4EPCA 2XG8D 2MWOA 1NE8A 4XTUA 3OSSC 4JS5A 3P8BB 2YHTA 4GLKA 1ZQ1A 4M7DE 1NPPA 2QA4A 2DDZA 2QA4T 4UC4A 2A3LA 1VQ4A 4CH5A 1QP2A 3E1SA 1WYDA 2ZNIA 4IUUA 4A4EA 2RHSA 3L42A 3T9NA 1VQ4T 2E12A 1QF6A 3M55A 1ZHIA 1VQPA 4HCCA 1Y07A 4MZPA 3VV0A 2F5KA 4HVCA 3FJPA 5GAMd 4Q15A 1U1TA 1VQPT 4YRCA 3BFMA 1N9SA 3ASKA 1BIAA 2PVDB 4M77D 1FYFA 4FT2A 3G4SA 2D6FA 5GMKh 4HWRA 4ZN3A 4UP9A 3MP8A 2X4JA 3G4ST 5F5WA 3OYGA 5GMKi 3C94A 2P0LA 3NEMA 3QTCA 1HK9A 5CKHA 3IALA 4P73A 4LVJA 2XK0A 3LSSA 2P0PA 3JB9J 1K8AC 3QJ6A 4M77F 4FM4B 1G51A 4XEMA 2F5TX 1N9RA 2ARSA 4OGCA 5A0LA 2DVEA 2QXFA 3QJYA 1VQ6T 1YHQA 3RMSA 2ARUA 3QXEB 2EWNA 1X75C 4FSXA 1B70B 2A7YA 3EAEA 3V7CA 1YHQT 4RDXA 2DPPB 4QQDA 4DOVA 1VIFA 5I21A 4P71C 3MEYA 3WVEB 3HXWA 4L5GA 1YI2A 3X20B 5CAIA 2E1HA 1YI2T 2ARTA 1XNIA 4C8QE 4M75G 4MDWA 3BDUA 2E41A 4E7JA 2MAMA 3FLGA 3UT1A 4FIBA 5KCHA 3JB9G 5E3IA 2HBPA 3LGFA 3JCMf 3HKSA 4C5IA 2I4MA 5CCAA 5CR2A 1VQ9A 4YRIA 4LDXA 5GAN4 1K9MU 3ZBDA 3A31A 4LNSA 3LH0A 4PJOB 5GANe 3J80E 4OVAA 3VYGA 3QO8A 2ZT5A 3PCOA 4YRTA 1VQMA 3M59A 3PMIA 4WI1A 2LQ8A 1VQMT 1FXXA 2BKDN 4WJ3M 2Y4XA 4M7DB 4PLIA 2VXEA 3QSUA 3L4GB 2LTOA 4C92G 5GAN7 4ZIBA 3MCAB 4JRIA 2QHSA 2L8DA 2CYZB 2PUKB 3HRIA 4F7UA 4HWSA 4YRPA 4NCXA 3TREA 3OYFA 4IUQA 4ATOA 1QVGA 4QVDA 4P72A 3HFZB 4BW9A 2DU7A 2C06A 4KUDK 3OBYA 2O4XA 5DLQE 2XKOC 4PJOG 4JLIA 2DTOA 3E9IA 2LT1A 4P71A 4YYEA 2DXUA 4M78C 1W4SA 4A4GA 4O2DA 4X5OA 1UB4A 2DZ9A 2IY5A 1BKBA 4CH4A 5GAMe 4LVKA 3CC4A 2RHYA 3CC4T 3L2WA 3G71A 2QI2A 2DTIA 4L87A 4XQ3A 1H3ZA 3E9GA 4YCVA 3M53A 4OF1A 5I2MA 2K5LA 3NTKA 2K5IA 2IG0A 5DM7R 1UGPB 2OTLA 2EFIA 4P3PA 1BBUA 1EQRA 3CPWA 1QE0A 2OTLT 3P8HA 4C5HA 4E7IA 3HSBA 3J7AF 2RO0A 4CI0C 5J3BA 2RA2A 5LJ3d 2ZPIB 3WXMB 2DXTA 4JRQA 5FRNA 2K3YA 2ZIMA 5CQYA 1YCYA 2RHQB 2RJFA 1Y96B 3KUFA 4P75C 4HT9A 2Q5IA 4PL6A 1K9MC 4RQEA 2EQKA 4RKUE 2R58A 2PUOB 2DZCA 2RHXA 3TEHB 3CPFA 3PZCA 4UP8A 3L2ZA 1ATIA 3QBYA 1D3BB 2IVWA 2GFAA 2LDMA 2JN0A 4M78A 3GNFB 1V29B 3REUA 2LCCA 4JS4A 2ZZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  4YRK A;  2DEQ A;  4RCB A;  4OLF A;  3QHS A;  5GAN g;  3FB9 A;  5GMK l;  1EIY B;  2E65 A;  4M75 D;  1B8A A;  3VU3 C;  5ELN A;  4XTW A;  1WPY A;  4N0A C;  1EIY A;  3LC0 A;  4H2X B;  4P3O A;  1SER A;  5GAN 8;  4TVY A;  2P5I A;  3JCM c;  5ELO A;  1YFS A;  4Y91 A;  4M7D F;  4M7D C;  1H4T A;  2IY5 B;  1NYR A;  5GAN 6;  5GMK j;  1J5W A;  3SWN A;  4WF2 A;  4YRS A;  1I81 A;  3PGG A;  3VQY A;  5KNN A;  4X9C A;  4TVW A;  2RB6 A;  1NJ5 A;  5LJ5 g;  1LNX A;  4HT8 A;  4A53 A;  4M75 F;  4M75 C;  3IKM B;  3SWN C;  5LJ5 j;  5GAN 5;  5GAO m;  1HXD A;  3VQW A;  4ZTZ B;  1MGQ A;  4XTV A;  4H02 A;  4M78 G;  1NJ8 A;  4EO4 A;  2QHV A;  1KOG A;  1B70 A;  4TVA B;  3HY1 A;  1JJC A;  4M7A A;  4ZTU B;  4NL3 A;  3SB2 A;  2ODR C;  3P8Y A;  1E1O A;  2ZZE A;  4G85 A;  4TVA A;  4CH3 A;  3EFS A;  2XGT A;  4XEO A;  3RUX A;  1B7Y A;  2DKG A;  5GAM f;  4XU2 A;  4RCC A;  3BW1 A;  5LJ5 d;  3NET A;  4PHC A;  4K86 A;  4XTU A;  1EOV A;  2YHT A;  1X56 A;  1KQ1 A;  3QO3 A;  2G4C A;  4C92 D;  4M7D E;  3FIF A;  3P8V A;  3UH0 A;  2DDZ A;  5GAN 3;  5GAM g;  2K57 A;  1RIQ A;  5GMK m;  4P75 A;  1W66 A;  1NJ6 A;  3TUP A;  1WNL A;  4CH5 A;  4YCU A;  1WYD A;  2ZNI A;  2ALY B;  2RHS A;  4PNO A;  2C8M A;  4EMK A;  4M75 E;  4M7A G;  4YRL A;  2AMC A;  5DY9 A;  4PJO D;  2CIM A;  1QF6 A;  1USY C;  4C92 F;  4C92 C;  4UP7 A;  4NOY A;  4KR2 A;  2CJB A;  5GAO p;  4JRK A;  1WLE A;  1X01 A;  4HVC A;  3INZ A;  4H2V A;  4C8Q D;  2J3M A;  3FJP A;  5GAM d;  2ZCE A;  1U1T A;  3HRK A;  4Q15 A;  3HTZ A;  4YRC A;  1ASY A;  3BFM A;  5GMK e;  1N9S A;  3I7F A;  4HA8 A;  1H4V B;  4PG3 A;  4YRR A;  1BIA A;  1H4Q A;  4NL2 A;  2DU5 A;  1PYS A;  3JCM V;  4M77 D;  1NYQ A;  4PJO F;  4PJO C;  1BBW A;  1FYF A;  4N0A A;  3QNE A;  2Q7E A;  2ZZF A;  4YP0 A;  3OD1 A;  2AKW A;  1U1S A;  4M7D A;  5GMK h;  4J15 A;  4XU3 A;  4HWR A;  4K87 A;  4UP9 A;  1ASZ A;  3L4G A;  4HWP A;  4C8Q F;  4C8Q C;  4QVC A;  5F5W A;  3L1A A;  3IKL A;  5GMK i;  2P0L A;  3VBB A;  2VXF A;  3NEM A;  1HK9 A;  3QTC A;  2ZIN A;  5GAN j;  3IAL A;  4P73 A;  5LJ3 e;  3SWN B;  3LSS A;  1WQW A;  3JB9 J;  4M77 F;  4M77 C;  4M75 A;  5LJ5 h;  1G51 A;  4XEM A;  3WQZ A;  3HFZ A;  4EX5 A;  3UFG A;  4F7U F;  1X55 A;  1N9R A;  3A5Y A;  1NJ1 A;  2EJ9 A;  4C92 E;  2ARS A;  2C7I A;  4YRM A;  4P73 C;  3HXX A;  2DVE A;  4K88 A;  5LJ3 h;  1WQ7 A;  1EFW A;  4XU1 A;  2ARU A;  5GAN d;  5GAN 2;  2EWN A;  4XTX A;  3RKY A;  1TH7 A;  1B70 B;  1LJO A;  3V7C A;  1JJC B;  4M7A B;  3UGQ A;  4RDX A;  5C53 B;  4HWO A;  5I21 A;  3A7U A;  4P71 C;  4M7D G;  1L0W A;  4CS3 A;  1BIB A;  5LJ3 f;  1EVL A;  3NEN A;  3MEY A;  3HXW A;  1B7Y B;  3JCM X;  4PJO E;  3V8K A;  1EVK A;  4YRG A;  3JCM W;  5CAI A;  4MML A;  2E1H A;  3JCM e;  2ART A;  1SES A;  3EFR A;  1X54 A;  4C8Q E;  4HWT A;  4J5Y A;  2ZTG A;  4M75 G;  4XTY A;  3G1Z A;  2E64 A;  4TWA A;  1HC7 A;  3JB9 H;  5GAO q;  1YFT A;  4EMG A;  3BDU A;  3A7R A;  2E41 A;  2Q7H A;  2Q5H A;  3A74 A;  3QUI A;  4YPF A;  4M77 E;  3JCM h;  12AS A;  4F7U E;  4RQF A;  1ADJ A;  1USY A;  2ZIO A;  3JB9 G;  4C92 A;  2RHS B;  3P8T A;  5GAM j;  5E3I A;  4EMK B;  2EJG A;  2XTI A;  2AMC B;  4UPA A;  3MF2 A;  1H64 1;  2CJA A;  3JCM f;  4BWA A;  2CGH A;  2I4M A;  4CH6 A;  3ERR A;  3A7A A;  4YRI A;  3BJU A;  5GAN 4;  3RF1 A;  3A31 A;  4YCW A;  4LNS A;  1B34 A;  2QHU A;  4KR3 A;  1N9W A;  3HFO A;  3QO5 A;  4PJO B;  5GAN e;  3NEL A;  3M4P A;  4MMK A;  4YRQ A;  3QO8 A;  4CS2 A;  4PJO A;  2ZT6 A;  5K1P A;  2ZT5 A;  3DSQ A;  4J6X A;  3PCO A;  4YRT A;  1PYS B;  4C8Q B;  2VC8 A;  5C51 B;  1SET A;  4WI1 A;  2ZZG A;  2RHQ A;  4C8Q A;  4RMF A;  3JCM b;  1Y96 A;  3RIR A;  1KQ2 A;  1LOJ A;  3M4G A;  1B76 A;  2DJZ A;  4WJ3 M;  5GAN h;  2AKW B;  2ZR2 A;  2DTH A;  4M7D B;  1KMN A;  4E51 A;  2ZNJ A;  2VXE A;  3KFU A;  3ICA A;  4M77 B;  3QSU A;  2PMF A;  3L4G B;  5C52 B;  2ZXF A;  4C92 G;  3R07 A;  5LJ5 e;  5GAN 7;  4ZIB A;  1ADY A;  4M77 A;  2DQ3 A;  4JRI A;  1HTT A;  2I4O A;  2QHS A;  3HXZ A;  4M78 D;  3HRI A;  4P74 C;  1VQZ A;  1KMM A;  4F7U A;  4HWS A;  4YRP A;  1IL2 A;  3HY0 A;  3RL6 A;  2YLC A;  4NCX A;  3TEH A;  3V7S A;  1NJ2 A;  4M75 B;  1M5Q 1;  4QVD A;  4P72 A;  3HFN A;  2Q7G A;  3HFZ B;  4BW9 A;  2DU7 A;  1YB3 A;  1YGB A;  4WJ4 A;  4PJO G;  4JLI A;  2DTO A;  3E9I A;  5HGQ A;  2FB7 A;  4EMH A;  4G84 A;  2E5A A;  3A32 A;  4P71 A;  2ZR3 A;  4YYE A;  2DXU A;  4P72 C;  4A54 A;  4M78 F;  4M78 C;  3JB9 I;  2I4L A;  4H2S A;  5LJ5 f;  4C8Q G;  5GAO r;  4DPG A;  3VQX A;  4O2D A;  4X5O A;  4H2X A;  1E24 A;  3LSQ A;  2DZ9 A;  2ODR D;  1JBM A;  11AS A;  2IY5 A;  2E10 A;  3QO7 A;  3RGL A;  3E9H A;  4CH4 A;  5GAM e;  5K1X A;  1X2G A;  1X2H A;  4M77 G;  3JB9 D;  1Z7M A;  3MF1 A;  4YRN A;  4F7U G;  4P3N A;  2PME A;  3V8J A;  4KQE A;  1LYL A;  4H2U A;  4M7A D;  2DTI A;  3RES A;  1WU7 A;  4L87 A;  3RAC A;  2QHT A;  1E1T A;  3RKX A;  5LJ3 g;  5GAM h;  5GAO n;  4XQ3 A;  2E3C A;  4X9D A;  1JRI A;  3JCM J;  4YCV A;  4YDQ A;  2J3L A;  1GGM A;  5LJ3 j;  3GIB A;  3JB9 F;  2HNI A;  4C92 B;  3V7R A;  4P3P A;  3JCM P;  4XTZ A;  4H2Y A;  1BBU A;  1EQR A;  1QE0 A;  4M7A F;  4M7A C;  2EL9 A;  3JCM Q;  1YFR A;  2ZT8 A;  4M78 E;  3HSB A;  4JUV A;  3RER A;  4TQF A;  4AH6 A;  4DQ2 A;  1B34 B;  3HXU A;  4V2S A;  2RA2 A;  2FYK A;  1SRY A;  1G5I A;  5LJ3 d;  4Q6G A;  1C0A A;  4TQD A;  3RKW A;  2DXT A;  2EJF A;  3PCO B;  1I5L A;  2DQ0 A;  2QTX A;  1NNH A;  1I8F A;  3UGT A;  1G5H A;  4XU0 A;  2ZIM A;  3JCM g;  1YCY A;  2I4N A;  2RHQ B;  4TTV A;  5GAO l;  2ZT7 A;  4YRF A;  1Y96 B;  3HXV A;  3VQV A;  2ALY A;  3W3S A;  3IG2 A;  4P74 A;  4P75 C;  3TEG A;  4YRO A;  4HT9 A;  3CMQ A;  3M4Q A;  2Q5I A;  2RD1 A;  3REX A;  2I2L A;  2EAY A;  2RM4 A;  4OP0 A;  4EMK C;  4RQE A;  4F7U B;  4YRE A;  3BY7 A;  2DZC A;  4YRJ A;  1E22 A;  3TEH B;  3PZC A;  4J6W A;  4UP8 A;  3L2Z A;  3AHU A;  2ZGW A;  2Y90 A;  5GAN f;  1ATI A;  1H4S A;  3A5Z A;  3HXY A;  3V8L A;  1D3B B;  4M78 B;  1I4K 1;  4M7D D;  3HFV A;  3JCM d;  1Z7N A;  4M7A E;  2JN0 A;  2YLB A;  1D3B A;  4M78 A;  2CJ9 A;  4H2T A;  4H2W A;  3REU A;  4CS4 A;  1M8V A; 
#chains in the Genus database with same CATH topology
 1PHT A;  4J6Y A;  4LNP A;  1VUB A;  5GAN g;  1B8A A;  2CP7 A;  3MJX A;  3LH5 A;  1LCK A;  4JDS A;  2JUF A;  4N0A C;  5I2S A;  2B8A A;  1OX8 A;  1SER A;  5GAN 8;  4LD6 A;  2FRW A;  4M7D C;  1NYR A;  2E5Q A;  1RAF B;  1EZZ B;  1W6X A;  5GMK j;  1J5W A;  3I56 Q;  1I81 A;  2A28 A;  5KNN A;  3X26 B;  4QQG A;  2F2X A;  2JMA A;  3G7Z A;  3GF5 A;  1D0X A;  2NUT A;  1UEC A;  2COY A;  1UHF A;  1K0S A;  2RQV A;  2RB6 A;  2M9U A;  2HQH A;  3EHR A;  4A53 A;  2KR3 A;  2ATC B;  3OYY A;  1VYU A;  1YN8 A;  5A0G A;  1HXD A;  4J9E A;  1NBE B;  3CD6 Q;  1B70 A;  3VUZ A;  4KGV B;  5I22 A;  4ZTU B;  4NL3 A;  3L2R A;  4J7F A;  2MYS A;  2VKN A;  3HRT A;  4X1V A;  1TSF A;  4N4G A;  4TVA A;  1WHK A;  1N27 A;  5KE3 A;  1IHW A;  1LVK A;  2JVV A;  3RUX A;  2KYM A;  1MV3 A;  1T0J A;  4RCC A;  3BW1 A;  1I1J A;  5LJ5 d;  4DBF A;  5IH2 A;  3CMA Q;  1UGV A;  1O75 A;  2GBQ A;  2KEA A;  3RNJ A;  4K86 A;  1D1B A;  3MP6 A;  3LYI A;  2P4T A;  1KQ1 A;  2VGN A;  3QO3 A;  1UGQ B;  2LJ1 A;  2L0A A;  1RAE B;  2AHJ B;  1K8A R;  2NUP B;  5GAM g;  2KGT A;  1EFN A;  2M02 A;  1NLP C;  1RIQ A;  1G3Y A;  1C1A A;  1MHN A;  3QII A;  4P75 A;  3PMT A;  1WNL A;  2K6D A;  1OPL A;  4C0F A;  3LW5 E;  2ALY B;  1XQH A;  2X3X D;  3NTI A;  1GBR A;  4M75 E;  3GP8 A;  4M7A G;  1VA7 A;  2VB6 A;  1QVP A;  3NGP A;  3HRS A;  4ZGJ B;  4UP7 A;  3H0F A;  2CS7 A;  2NWM A;  3SHW A;  1OUL A;  2DJQ A;  2RQW A;  1QVF S;  1W70 A;  1X01 A;  2KAF A;  3INZ A;  4N4H A;  3CCQ A;  4H2V A;  2RQR A;  3HTZ A;  3VUB A;  1ASY A;  2RI3 A;  3CC7 Q;  3I7F A;  2M0Y A;  3SFM A;  3CCQ T;  3PTA A;  2CT4 A;  5FU7 B;  4NL2 A;  1H4Q A;  4YTL A;  2LQN A;  4C0Z A;  2EVR A;  3QWY A;  2ZPE B;  3U23 A;  5CKD A;  2FVU A;  2GTO A;  1PWT A;  4N0A A;  2QGG A;  2CH4 W;  4YP0 A;  1KD1 U;  4M7D A;  3S3N A;  1YBY A;  2LCS A;  1H8K A;  4K87 A;  3L4G A;  3UPU A;  1PD0 A;  4C8Q C;  1M2O A;  2SEM A;  1ZBJ A;  3VBB A;  2JTE A;  2VXF A;  4O5V A;  3UA6 A;  5IHN A;  2ZIN A;  2VYT A;  2X35 A;  5LJ3 e;  3SWN B;  1UDL A;  2QQS A;  2MMP A;  1WQW A;  1E6G A;  3M0U A;  5LJ5 h;  4A4K A;  2GNC A;  3HFZ A;  1ZUK A;  4F7U F;  2XDD A;  2K2V A;  2JS0 A;  3EFO A;  4C92 E;  2C7I A;  4F16 A;  4P73 C;  2FHD A;  2DIG A;  4K88 A;  1Y0M A;  3L2V A;  4LDV A;  5GAN d;  3VS7 A;  2OJ2 A;  1I0C A;  3A98 A;  4C0D B;  1KQS P;  3EHQ A;  3UGQ A;  3A7U A;  3X28 B;  4QKU A;  4CS3 A;  2EQI A;  3NEN A;  1NLO C;  2RJC A;  1G83 A;  2MPX C;  1KQS A;  2IPO B;  4PJO E;  1HD3 A;  4EDU A;  2EQM A;  3JCM W;  1FMW A;  4MML A;  1G3W A;  2DE0 X;  3VRY A;  3I55 A;  3TU4 K;  3LX7 A;  2QAS A;  1SES A;  1X54 A;  1X6G A;  2KQW A;  3I55 T;  4XTY A;  3G1Z A;  2DNU A;  5GAO q;  3A7R A;  1UEB A;  3OW2 P;  2D8J A;  1BB9 A;  1D0Z A;  3MO8 A;  6AT1 B;  2Q5H A;  2FL7 A;  3G6E Q;  1YJW A;  2PTK A;  1N6A A;  4RQF A;  2JM8 A;  3ULR B;  3EG9 B;  1NPR A;  3OW2 A;  3GOX A;  4MZM A;  1YJW T;  4EMK B;  2J6F A;  1ZUY A;  1WI7 A;  1Y7X A;  2AMC B;  2CJA A;  2JTM A;  3CCL A;  4BWA A;  4DBQ A;  1M90 U;  4CH6 A;  3A7A A;  1QW1 A;  4RUG A;  1JJ2 P;  4FW2 A;  3H6Z A;  2X9H A;  2KYB A;  3FRN A;  3CCL T;  2QHU A;  2W10 A;  2O9S A;  3PIO A;  3QO5 A;  1X69 A;  2EYX A;  1YIT Q;  1NJI U;  3P8D A;  1JJ2 A;  5CO7 A;  4J6X A;  1E7O A;  1PYS B;  2RK1 A;  2YXY A;  2MWP A;  2F2V A;  1JO8 A;  2RHQ A;  2ZZG A;  2W0Z A;  4C8Q A;  5KYX A;  1GFC A;  1Y96 A;  2DJZ A;  5GAN h;  1KMN A;  1OX9 A;  3KFU A;  4M77 B;  1EIF A;  3R07 A;  5LJ5 e;  1KHC A;  4LXC A;  1CSK A;  4FYY B;  3HXZ A;  2RF0 A;  1FMV A;  4M78 D;  1NEB A;  4P74 C;  2DL7 A;  2EPD A;  3F70 A;  3MEV A;  3PVL A;  5FU6 C;  4DEX A;  1TG0 A;  1IB8 A;  3TEH A;  4M75 B;  1RL2 A;  1TUG B;  3CCJ Q;  3REA B;  1OPK A;  1WGS A;  1YB3 A;  2MIO A;  2GQI A;  2D0Q B;  5J26 A;  1O9S A;  1WDX A;  4B9W A;  1VQ6 A;  3L2U A;  4G84 A;  3CCE A;  4J9I A;  5FU7 C;  4A4H A;  1KD1 C;  2ZR3 A;  4P72 C;  4MDX A;  4A54 A;  4M78 F;  2CP6 A;  2CH4 A;  3NHN A;  3CCE T;  2KXC A;  2YRD A;  5IT9 E;  2WAC A;  2RK2 A;  3MHX A;  1E24 A;  3ER0 A;  1R0B G;  3LSQ A;  2K5F A;  1JBM A;  2E10 A;  3CME A;  1M4Z A;  5K1X A;  2A36 A;  4M77 G;  4JZ4 A;  3MET A;  3JB9 D;  4TVR A;  4BAC A;  1Z7M A;  1PKS A;  3CME T;  1RUW A;  2KK4 A;  2EYZ A;  2DRM A;  1K9M R;  1VQK A;  2H8H A;  4P5N A;  3RES A;  4ME7 A;  1AD5 A;  2DFU A;  1VQK T;  5D6Y A;  4IUR A;  3RKX A;  5LJ3 g;  5GAM h;  3CCV A;  1VQL Q;  1MUZ A;  5GAO n;  2J05 A;  2E3C A;  4QQ6 A;  3M54 A;  2J3L A;  1GGM A;  3CCV T;  3REB B;  5LJ3 j;  3GIB A;  2EKO A;  4ZTJ A;  1MMG A;  1KSW A;  3JB9 F;  2HNI A;  2RN8 A;  4C92 B;  4Z89 A;  1T0H A;  4LN2 A;  3JCM P;  2YWW A;  4C0D C;  4AMC A;  1M27 C;  1IRE B;  5KYU B;  3CCR Q;  3CCU Q;  1YFR A;  3M0S A;  4TQF A;  1RAG B;  4ZTF A;  2A0F B;  4AH6 A;  2AT1 B;  2GF7 A;  4B6M A;  3UF4 A;  3HXU A;  3TEE A;  2COZ A;  1B3Q A;  1EX4 A;  4C5E A;  4RTZ A;  2YRV A;  4X34 A;  2M0O A;  2LC4 A;  1SPK A;  4TQD A;  4FU6 A;  2D8H A;  2EGC A;  3RKW A;  2HCK A;  9ATC B;  4KT0 E;  2NUP A;  3EGD B;  2QTX A;  2HL3 A;  4FYV B;  2XIC A;  3M9Q A;  1G5H A;  4XU0 A;  4LDW A;  3CEY A;  2C0I A;  2ROT A;  4KUL A;  4YRF A;  1VIE A;  1GXI E;  2ALY A;  4II1 A;  3W3S A;  8ATC B;  4P74 A;  2L5Q A;  1WX6 A;  3M4Q A;  3M56 A;  1M90 C;  3RMQ A;  3VS2 A;  5CIU A;  5IXF A;  4BDY A;  1PSE A;  3REX A;  2RM4 A;  4EMK C;  4DOW A;  3HL8 A;  3OYJ A;  2XD0 A;  3ZFJ A;  1NJI C;  3FDR A;  3E9F A;  2ZGW A;  2Y90 A;  2K2M A;  5CKE A;  3OYA A;  3S3O A;  1H4S A;  3HXY A;  4M7D D;  3JCM d;  4M7A E;  2YLB A;  2ESW A;  3MPU B;  4KUI A;  1K76 A;  4RTW A;  1YJ9 T;  1AT1 B;  2BTT A;  2AIR B;  4N4I A;  2OI3 A;  2NYS A;  2KI7 A;  2RJD A;  2I0N A;  4E7K A;  4RCB A;  1TUD A;  3FB9 A;  5GMK l;  2CDT A;  3PE0 A;  1WHG A;  3TCJ A;  5ELN A;  4ESR A;  1GBQ A;  2XU8 A;  2E3H A;  2CKK A;  2R5M A;  4BE1 A;  1QCN A;  1EIY A;  2YUN A;  3LC0 A;  4H2X B;  4P3O A;  1SEM A;  1UHC A;  5I11 A;  2DD5 A;  4M7D F;  2RPN A;  4J9G A;  4OMQ A;  2K3X A;  2X4W A;  3SWN A;  1D1C A;  4HVV A;  4AFZ C;  3CCM Q;  2KSS A;  3CXC P;  2EYW A;  2CZ7 B;  3I9Q A;  5L8R E;  1Y71 A;  4OGE A;  5LJ5 g;  1WLP B;  1KC8 U;  3QYH B;  3CXC A;  4M75 C;  3IQL A;  2JOY A;  5LJ5 j;  5GAN 5;  1QVG S;  1NZ9 A;  4XTV A;  2OAU A;  1NJ8 A;  4H02 A;  1Z9Q A;  4GBQ A;  5KYN A;  2GFU A;  1FX7 A;  1PG5 B;  4OML A;  3MQZ A;  1E1O A;  4LVI A;  4CH3 A;  2XGT A;  1ZSZ B;  4XEO A;  2LQK A;  3OYC A;  1PRM C;  3OYH A;  4XU2 A;  1X6B A;  3A8M B;  2O2O A;  5IAY A;  2DIL A;  3NET A;  1ABQ A;  2EQU A;  5L23 A;  4ANJ A;  5HY6 A;  3CCS A;  3EG1 A;  2IIM A;  1X56 A;  2QA4 Q;  3M5A A;  2CP0 A;  2XID A;  1BCM A;  1WHJ A;  3FIF A;  3CCS T;  1VQ8 A;  3P8V A;  2K57 A;  2NLU A;  1VQ8 T;  1VQ4 Q;  1G8X A;  5GMK m;  5A0D A;  3OBW A;  2HQE A;  1NJ6 A;  5IN1 A;  3G1J A;  3EG9 A;  4YCU A;  1RI0 A;  4NS5 A;  3QPH A;  1YJN A;  4EMK A;  1X27 A;  2AMC A;  1UGS B;  5DY9 A;  1YJN T;  1VQP Q;  1VQN A;  1UUE A;  3H8Z A;  4BD3 A;  4C92 C;  2OAW A;  4NOY A;  3X24 B;  5GAO p;  1I07 A;  4R55 A;  1D1A A;  1VQN T;  4C8Q D;  3CPW S;  2J3M A;  2ZCE A;  3HRK A;  3CC2 A;  1RAB B;  1M2V B;  2AKK A;  1VQ5 T;  3A5Z B;  1T3S A;  2ZPB B;  5KCO A;  4HA8 A;  1WYX A;  2KT8 A;  1RAH B;  1H4V B;  4PG3 A;  4YRR A;  3CC2 T;  2DU5 A;  2HAX A;  1PYS A;  2ECZ A;  3JCM V;  2DXC A;  3G4S Q;  3CQT A;  4PJO C;  4PLL A;  3OYL A;  4GLM A;  3OD1 A;  2ZPG B;  1U1S A;  3HRU A;  3E19 A;  4XU3 A;  2P0Q A;  4E7H A;  2E70 A;  1BU1 A;  1X43 A;  4C8Q F;  4QVC A;  5CK9 A;  3L1A A;  1VQ7 A;  2JNG A;  5GAN j;  5GJV B;  2KRM A;  4GY5 A;  5FWC A;  1VQ7 T;  2LT4 A;  2CSI A;  1IGQ A;  4M75 A;  5D6W A;  2YUQ A;  3MP1 A;  3WQZ A;  4EX5 A;  3UFG A;  2KVQ G;  1OV3 A;  2DX1 A;  3A5Y A;  3A8O B;  4YRM A;  1GCP A;  4IUP A;  3HXX A;  1YHQ Q;  2LQW A;  5DLO A;  4O6J A;  3N5B B;  5LJ3 h;  1WQ7 A;  3RBB B;  1EFW A;  4XU1 A;  2LZ6 B;  4HCB A;  2E4H A;  1SG5 A;  5GAN 2;  2CSQ A;  4XTX A;  1WXU A;  3TQ7 P;  2Y4Y A;  1LJO A;  1JJC B;  4M7A B;  1RAA B;  4BUG A;  3GNG A;  3OMG A;  5C53 B;  4LUE A;  5J39 A;  3QG1 A;  2FZK B;  1L0W A;  1D09 B;  4FW1 A;  1BIB A;  4D8D A;  1YI2 Q;  1EVL A;  1B7Y B;  4Z88 A;  3JCM X;  2PQW A;  3V8K A;  1M3A A;  3EGX B;  1EVK A;  4YRG A;  4LVL A;  3JCM e;  2G6F X;  3RR6 A;  1GL5 A;  1KC8 C;  3EGU A;  2JW4 A;  2EIF A;  4HWT A;  4J5Y A;  2ZTG A;  3EG0 A;  1H92 A;  3OS1 A;  4F04 B;  1TXQ A;  2E64 A;  4TWA A;  3OS2 A;  2X3W D;  1YFT A;  4EMG A;  3GBQ A;  4OMM A;  3A74 A;  4YPF A;  4M77 E;  1QQJ A;  3H9N A;  3A8L B;  1PCX A;  2AK5 A;  3EH1 A;  1IHV A;  5IHI A;  1ABO A;  4C0G A;  4C92 A;  5CKF A;  2ENM A;  5GAM j;  4J8O A;  2EJG A;  4M4Z A;  2ZAE A;  1VQO A;  1XJW B;  1KD1 R;  4UPA A;  1VQ9 Q;  1H64 1;  3MKD A;  4ELZ C;  2A8E A;  4BDZ A;  2NS6 A;  1VQO T;  3ERR A;  1S72 A;  3RF1 A;  2XHC A;  2E6N A;  1N9W A;  3HFO A;  4JJC A;  1S72 T;  3NEL A;  3M4P A;  3C4S A;  3CBP A;  1YFN A;  4BI4 A;  1VQM Q;  4YRQ A;  1R0C B;  1ZX6 A;  4PJO A;  3H0I A;  3DSQ A;  1SRM A;  3EGD A;  3A8H B;  2J6K A;  1PNJ A;  2VC8 A;  4D6W A;  2DYI A;  1RLQ C;  2LX7 A;  1U8R A;  1SET A;  2BE7 D;  2QQB A;  4MZT A;  1FWZ A;  1NYF A;  4RMF A;  3JCM b;  2K7A A;  2LX9 A;  3CBM A;  2AKW B;  2ZR2 A;  3O8V A;  2DM1 A;  2HDA A;  4HKE A;  4JJB A;  3ICA A;  4CC3 A;  2PMF A;  1W2B P;  2DO3 A;  2ZXF A;  1WJR A;  3OYK A;  4ELY C;  4KGX B;  2RQT A;  2DQ3 A;  1HTT A;  4B9X A;  2I4O A;  1G2B A;  2JT4 A;  1W2B A;  5IXB A;  1RLP C;  2BZ8 A;  3RL6 A;  1U5S A;  3JV3 A;  3JRZ A;  3PFS A;  3V7S A;  3QYG B;  4AFS C;  3HFN A;  2Q7G A;  2HKQ B;  4BY6 B;  1TS9 A;  3PNW C;  2MCN A;  1YGB A;  3RDV A;  2RHU A;  2M1H A;  3SDZ A;  5HGQ A;  2FB7 A;  4EMH A;  3NTH A;  2LJ0 A;  1QCF A;  3A32 A;  1R77 A;  5CQX A;  2OTJ A;  1YWP A;  1OOT A;  4AFU C;  2RJE A;  1XTD A;  3MEW A;  4DPG A;  2FZC B;  2OTJ T;  3TSW A;  3VQX A;  1U3O A;  4H2X A;  3VS4 A;  5KYW B;  1SRL A;  2LP5 A;  2ODR D;  2DD4 A;  3TSZ A;  2CRE A;  1N8R R;  5CVI A;  11AS A;  3QO7 A;  4BB7 A;  1CKA A;  3CC4 Q;  1X2H A;  4Y92 A;  1OU8 A;  2QEX A;  4BI8 B;  4RTY A;  3MF1 A;  2JXB A;  2FPF A;  3QZ9 B;  4F7U G;  4P3N A;  2PME A;  2D0N A;  4KQE A;  3OYN A;  3G71 Q;  3HTR A;  1M90 R;  1LYL A;  4CC4 B;  2QEX T;  2EGE A;  4CC2 A;  2ABL A;  3FEO A;  2GCX A;  4QW2 A;  1NJI R;  1SF9 A;  1E1T A;  5FLX E;  2BUD A;  2D1X A;  2DXB A;  5C0M A;  4YDQ A;  1Q82 U;  1RAI B;  5A2Q E;  2OTL Q;  3VS6 A;  3V7R A;  4E2F B;  2MI6 A;  2VUB A;  4XTZ A;  1KG1 A;  1N8R U;  1UE9 A;  1YIJ A;  4M7A C;  5C6S A;  2E5K A;  5D6X A;  4JUV A;  2CZ6 B;  1YIJ T;  1TUC A;  2DEU A;  2B86 A;  1XOV A;  2BE9 B;  1QCO A;  4DQ2 A;  1B34 B;  1M1G A;  1M1F A;  4V2S A;  2MF2 A;  2FYK A;  1SRY A;  1G5I A;  1KQS S;  1K0X A;  4Q6G A;  2MK5 A;  2LCL A;  2DRK A;  4E47 A;  3UA7 A;  2EJF A;  1B07 A;  3S6W A;  3ME9 A;  1NNH A;  1I8F A;  3UGT A;  5GJW B;  4RG2 A;  4JJN K;  2QAZ A;  3JCM g;  2I4N A;  1BI1 A;  4TTV A;  5GAO l;  2ZT7 A;  3GLX A;  4IUT A;  3HXV A;  3VQV A;  4OB0 B;  4HT4 A;  5HKC A;  2G3R A;  4KGZ B;  3C0C A;  3TEG A;  1WHL A;  1F1B B;  1M1K U;  2J6O A;  3Q1J A;  1AZE A;  2DBK A;  2ZPF B;  3QDR B;  5FRO A;  2RD1 A;  2I2L A;  3OW2 S;  2EAY A;  4OP0 A;  3HHT B;  4BE2 A;  3BY7 A;  3HP9 A;  4PJM A;  4J6W A;  1M2V A;  3AHU A;  4RMO A;  3A5Z A;  3V8L A;  3VKI A;  4M78 B;  1I4K 1;  3HFV A;  1Z7N A;  2LRQ A;  3NMZ C;  2RH2 A;  1OZ2 A;  3GPL A;  1D3B A;  3ZEH A;  2JTF A;  2CJ9 A;  4H2T A;  2DL3 A;  1ZUU A;  1M8V A;  1JJ2 S;  4YRK A;  2DEQ A;  4OLF A;  2QGF B;  2RMO A;  4M75 D;  3VU3 C;  1I5O B;  3NPF A;  2WSF E;  4XK8 E;  4XTW A;  1WPY A;  5CKB A;  3CBO A;  1V1C A;  4TVY A;  2P5I A;  3JCM c;  2VWF A;  3DB3 A;  1H4T A;  1UFF A;  1Q86 U;  4JJD A;  2E6Z A;  1H3H A;  2HSE B;  3BDL A;  3PGG A;  2RHI A;  4PFO A;  3R6N A;  3OYI A;  3QZ5 B;  2AZV A;  3I56 A;  4DBR A;  1K1Z A;  2DAQ A;  4TVW A;  1VOM A;  3I56 T;  4HT8 A;  4J9C A;  3KXT A;  4M75 F;  4OMP A;  2QQR A;  3SWN C;  2ZCF B;  3OQ5 A;  5GAO m;  2ED0 A;  4RTU A;  4BY6 C;  4M78 G;  1K73 U;  2QHV A;  1KOG A;  4TVA B;  3HY1 A;  1WHM A;  1JJC A;  4M7A A;  2PVG B;  3SB2 A;  2ODR C;  3CD6 A;  2CUD A;  1OI1 A;  4J7I A;  4G85 A;  4FT4 A;  3DKM A;  1RAD B;  1ZA1 B;  1G5V A;  4ZN1 A;  1MMA A;  3CD6 T;  4FCY A;  1B7Y A;  2K9G A;  1X2Q A;  3EGX A;  4Z02 A;  3DB4 A;  4LUD A;  5EG2 A;  2LMJ A;  2LJ3 A;  4PHC A;  2HSP A;  1EOV A;  3LGL A;  3CMA A;  1JB0 E;  1BK2 A;  3OA6 A;  1WJS A;  2G4C A;  4C92 D;  1AWX A;  3R6O A;  4L6V 5;  4ZGE B;  1C6V X;  2VGM A;  3UH0 A;  3CMA T;  2V1Q A;  4ZGD B;  5GAN 3;  1AWO A;  1SSF A;  2DET A;  3QKJ A;  3AT1 B;  1Q82 C;  4CRI A;  2KT1 A;  4IIO A;  1W66 A;  3TUP A;  4LVM A;  4PFZ A;  1LPL A;  1WXB A;  2EYQ A;  4PNO A;  2C8M A;  1JU5 C;  1N8R C;  1BCO A;  3SEM A;  4YRL A;  3OYE A;  5KYY B;  4PJO D;  2QG9 B;  2CIM A;  1USY C;  2JZ2 A;  4C92 F;  1PD1 A;  4IUV A;  1VQ9 T;  1MNE A;  4KR2 A;  3CCQ Q;  2CJB A;  4JRK A;  1WLE A;  4K11 A;  2QQ9 A;  3X25 B;  2DBM A;  2HL5 C;  3I5R A;  1IZ6 A;  5GMK e;  2X4X A;  3L2Q A;  2QYZ A;  2CP3 A;  3MEU A;  3M4Y A;  3CC7 A;  1YJ9 A;  4J9H A;  4E7L A;  1BI0 A;  1KC8 R;  2FO0 A;  3EH2 A;  1Q81 U;  3CC7 T;  1NYQ A;  1TTH B;  4PJO F;  1BBW A;  2Q7E A;  3QNE A;  1BYM A;  2ZZF A;  4FL6 A;  2EW3 A;  2AKW A;  4J15 A;  1M1K C;  3BE3 A;  1ASZ A;  4HWP A;  8AT1 B;  2RI2 A;  3IKL A;  3VRZ A;  4Z8A A;  2LNH B;  4BE0 A;  5HK3 A;  2CT3 A;  2KY9 A;  2R57 A;  4M77 C;  1QP3 A;  2PU9 B;  2FZG B;  3LLR A;  2KDS A;  2YDL A;  1X55 A;  5M9O A;  4RG8 A;  1NJ1 A;  2EJ9 A;  3VYH B;  2YSQ A;  2QTV A;  1ACM B;  5FWB A;  5AYF A;  1UG1 A;  3HPW A;  3J81 E;  5KH6 A;  4LDU A;  3OYM A;  1NM7 A;  1PM3 A;  4OMN A;  1HSQ A;  3RKY A;  1TH7 A;  2DMO A;  1UGR B;  1SHG A;  4HWO A;  3WVD B;  4QVZ A;  4M7D G;  2RHZ A;  5LJ3 f;  5KYW A;  1Q86 C;  1WZO A;  3S3M A;  1TWB A;  2HKN A;  3I55 Q;  3DLL A;  5D7U A;  3VS3 A;  2M51 A;  2CZ0 B;  2H3J A;  2DER A;  3EFR A;  2FG0 A;  3G71 T;  2V8K A;  5HK0 A;  4PJJ A;  3PIP A;  1HC7 A;  3JB9 H;  4KH1 B;  2XMF A;  1K73 C;  3QWX X;  2Q7H A;  1KJW A;  1ZLM A;  1YJW Q;  3QUI A;  1GCQ C;  4VUB A;  2VV5 A;  3JCM h;  2XDB A;  12AS A;  4F7U E;  5HCK A;  2KMT A;  3CXC S;  3G6E A;  1ADJ A;  1USY A;  2ZIO A;  2RHS B;  3P8T A;  2K3B A;  2XTI A;  3G6E T;  3CCL Q;  2HZY A;  3MF2 A;  2DK3 A;  2HEQ A;  1G3S A;  2CGH A;  1ZA2 B;  1P92 A;  4BI3 A;  3BJU A;  4YCW A;  1B34 A;  4KR3 A;  1WJQ A;  2XI9 A;  4J83 A;  1VQ5 A;  4MMK A;  1ARK A;  4IKF A;  4CS2 A;  2DL5 A;  1YIT A;  3SD4 A;  2ZT6 A;  2SRC A;  5K1P A;  2WSC E;  4Y28 E;  4C8Q B;  1VYV A;  1QKW A;  1YIT T;  5C51 B;  2LVM A;  3FC3 A;  4JLG A;  2R5A A;  3RIR A;  1KQ2 A;  1LOJ A;  1WXT A;  3M4G A;  1B76 A;  1M8M A;  2DTH A;  4E51 A;  2ZNJ A;  1AVZ C;  5C52 B;  4HCZ A;  2PZ1 A;  3MEA A;  1ADY A;  4M77 A;  3TVT A;  2FRY A;  4DA4 A;  1VQZ A;  1KMM A;  1VYT A;  2P4R A;  2DYB A;  3HY0 A;  1IL2 A;  2YLC A;  1AHJ B;  1T3L A;  1NJ2 A;  1M5Q 1;  2COW A;  1SKU B;  3OMC A;  3OYD A;  3CCJ A;  2QQA A;  1Q81 C;  1VQ6 Q;  4WJ4 A;  1IRX A;  3A8G B;  4KRT A;  3C12 A;  3OSV A;  3CCE Q;  4OMF B;  2KRS A;  2V26 A;  3CCJ T;  2L3R A;  3OYB A;  2E5A A;  2GQV A;  2C0O A;  2BIV A;  1Q7Y U;  4A4F A;  3JB9 I;  3KBG A;  4XAX B;  3QDF A;  2I4L A;  1AWJ A;  5LJ5 f;  2L89 A;  4C8Q G;  4H2S A;  2EBP A;  2DVJ A;  5GAO r;  2RQU A;  2ED1 A;  3CME Q;  2HD0 A;  2Z0W A;  1UJY A;  3RGL A;  3E9H A;  1X2G A;  4RTX A;  4YRN A;  1M3C A;  4HXJ A;  3V8J A;  1VQK Q;  1QLY A;  1WHH A;  4H2U A;  4LD9 K;  1B7T A;  4M7A D;  5FRM A;  3LWI A;  1GCQ A;  2XDP A;  1WU7 A;  3CCV Q;  4E7Z A;  3JSC A;  3RAC A;  1AEY A;  2QK0 A;  2QHT A;  4X9D A;  1JRI A;  3JCM J;  1VQL A;  1QVF P;  3UWN A;  4OB3 B;  1DJ7 B;  1OZ3 A;  1VQL T;  4LDY A;  2V8I A;  1QVF A;  4H2Y A;  3LWH A;  3PT9 A;  4OB1 B;  4M7A F;  2EL9 A;  2YUO A;  3JCM Q;  1Q95 G;  2WSE E;  4KBM B;  2ZT8 A;  1G3T A;  4M78 E;  3O5Z A;  1CKB A;  4C5G A;  3RER A;  3A1P A;  3CCR A;  3CCU A;  5EC7 A;  5KYU A;  2DL4 A;  2K4Y A;  4IIM A;  3CCR T;  3CCU T;  1C0A A;  1SSH A;  2ZPH B;  1ZSZ C;  4AFQ C;  1R8O B;  3PCO B;  3FJ5 A;  1I5L A;  2DQ0 A;  2DL8 A;  1OQK A;  4FYW B;  1BI2 A;  3E2U A;  2QDY B;  2EGA A;  2JMC A;  1OYX A;  5FU6 B;  1YCS B;  3IG2 A;  1FYN A;  1M9S A;  4PJN A;  4FYX B;  3UDC A;  4YRO A;  3CMQ A;  2CZ1 B;  5KYY A;  2CP2 A;  4DEY A;  4PKC C;  2D9T A;  4F7U B;  2PNI A;  4YRE A;  3OY9 A;  4L59 A;  4YRJ A;  3C95 A;  1YJ9 Q;  1E22 A;  2L3S A;  1W1F A;  5GAN f;  3DLM A;  2QDL A;  1K8A U;  1WFW A;  5KE2 A;  4JRP A;  2O31 A;  4Q5W A;  2O4X B;  1BI3 A;  4WTO B;  1IO6 A;  3H41 A;  1MMD A;  3JAM E;  2PVO B;  2EQJ A;  2RI5 A;  4J9F A;  1AZG B;  4H2W A;  4CS4 A;  5LL6 S;  4R56 A;  3M0T A;  3QHS A;  3NFC A;  1EIY B;  3M58 A;  3M57 A;  3I35 A;  2E65 A;  2K79 A;  2LNV A;  1Q82 R;  4E6R A;  1YP5 A;  1ZBX A;  5ELO A;  1OEB A;  1YFS A;  4Y91 A;  2IY5 B;  5GAN 6;  4PJL A;  2OX7 A;  4WF2 A;  4YRS A;  3VQY A;  3URG A;  2DIQ A;  2HQX A;  2F69 A;  4X9C A;  2DF6 A;  3CCM A;  4AG2 C;  1KHI A;  1NJ5 A;  2P0K A;  1LNX A;  1W2B S;  3CCM T;  1V76 A;  2FPE A;  3H0H A;  3OB9 A;  3IKM B;  1PSF A;  3OS0 A;  3VQW A;  4ZTZ B;  2J7I A;  2O01 E;  2X4Y A;  1MGQ A;  1Q7Y C;  7AT1 B;  2JS2 A;  4EO4 A;  2V8J A;  4OB2 B;  4DBH A;  1FMK A;  3P8Y A;  2ZZE A;  2M16 A;  1M30 A;  3EFS A;  2L3P A;  1JXM A;  1X6O A;  2DKG A;  3VJP A;  5GAM f;  3OS5 A;  1M1K R;  2YRC A;  1KFZ A;  1ZSZ A;  4EPC A;  2XG8 D;  4JZ3 A;  3CCS Q;  2MWO A;  1K9A A;  1Z9Z A;  1NE8 A;  4XTU A;  3OSS C;  4JS5 A;  3P8B B;  2HMA A;  1QWF A;  2YHT A;  4GLK A;  1VQ8 Q;  1ZQ1 A;  1TU0 B;  3ZL7 C;  4M7D E;  1NPP A;  4RTT A;  4LE9 A;  2QA4 A;  2DDZ A;  1YNZ A;  2QA4 T;  4UC4 A;  2A3L A;  4D8K A;  1VQ4 A;  4CH5 A;  1QP2 A;  1X2K A;  3E1S A;  1YJN Q;  1WYD A;  2ZNI A;  3M0P A;  4IUU A;  4A4E A;  1IXD A;  2RHS A;  3L42 A;  3T9N A;  1ZSG A;  1VQ4 T;  1M3B A;  2A08 A;  2E12 A;  1VQN Q;  1QF6 A;  2KXD A;  1VQ5 Q;  1NYG A;  3M55 A;  1ZHI A;  4HVU A;  1VQP A;  4HCC A;  3CC2 Q;  1Y07 A;  4MZP A;  3VV0 A;  2F5K A;  4HVC A;  4JPB W;  1Q86 R;  3FJP A;  5GAM d;  4Q15 A;  1U1T A;  1VQP T;  4YRC A;  3BFM A;  1N5Z A;  1N9S A;  3ASK A;  1PRL C;  3M0Q A;  4HVW A;  1BIA A;  1PKT A;  2PVD B;  4M77 D;  2E3I A;  5ECA A;  1FYF A;  2DA9 A;  4FT2 A;  2GGR A;  3G4S A;  1AWW A;  1K73 R;  2D6F A;  5GMK h;  4PFP A;  4HWR A;  4ZN3 A;  4UP9 A;  3MP8 A;  2X4J A;  3G4S T;  1VQ7 Q;  2NUZ A;  5F5W A;  3OYG A;  5GMK i;  3C94 A;  2P0L A;  1D0Y A;  3NEM A;  3QTC A;  1HK9 A;  5CKH A;  3IAL A;  1TOV A;  2KRN A;  2L2P A;  4P73 A;  4LVJ A;  2XK0 A;  3LSS A;  2V1R A;  2P0P A;  3JB9 J;  1K8A C;  3QJ6 A;  4M77 F;  4FM4 B;  2NUT B;  1G51 A;  4XEM A;  2F5T X;  2FEI A;  1N9R A;  1JXO A;  3PVQ A;  2ARS A;  2ROL A;  2GTJ A;  4OGC A;  5A0L A;  2DVE A;  2QXF A;  3QJY A;  1VQ6 T;  3EG3 A;  1YHQ A;  3RMS A;  2ARU A;  3QXE B;  2EWN A;  1X75 C;  4FSX A;  1B70 B;  2A7Y A;  3D7S B;  3EAE A;  3V7C A;  1YHQ T;  2DPP B;  4RDX A;  2C0T A;  4QQD A;  4DOV A;  1VIF A;  5I21 A;  1SHF A;  4A63 B;  1KIK A;  4P71 C;  4OMO A;  2X51 A;  3MEY A;  3WVE B;  3HXW A;  4L5G A;  1YI2 A;  2AZS A;  2L3Q A;  3X20 B;  5CAI A;  2E1H A;  1YI2 T;  1NEG A;  2F2W A;  2ART A;  1XNI A;  4C8Q E;  1QWE A;  4M75 G;  4MDW A;  1MND A;  3BDU A;  2E41 A;  4E7J A;  2CP5 A;  4AG1 C;  2MAM A;  2RNA A;  3FLG A;  3UT1 A;  4J9B A;  4FIB A;  2AKL A;  2YT6 A;  4QT7 A;  1Q81 R;  5KCH A;  3JB9 G;  1UJ0 A;  1VQO Q;  5E3I A;  1WA7 A;  2HBP A;  3LGF A;  2YUP A;  1S72 Q;  3JCM f;  3HKS A;  4C5I A;  2I4M A;  4PK4 A;  5CCA A;  5CR2 A;  1VQ9 A;  4YRI A;  4LDX A;  5GAN 4;  1K9M U;  1GRI A;  3ZBD A;  3A31 A;  4LNS A;  1BBZ A;  1WIE A;  3LH0 A;  4PJO B;  5GAN e;  3J80 E;  4OVA A;  3VYG A;  5FW9 A;  3UAT A;  3QO8 A;  4ZNX A;  2EKH A;  2ZT5 A;  3PCO A;  4YRT A;  1VQM A;  1IGU A;  3VS5 A;  3M59 A;  3PMI A;  4WI1 A;  2LQ8 A;  1VQM T;  1FXX A;  2BKD N;  2VAS A;  2F1L A;  4WJ3 M;  2Y4X A;  1AOJ A;  4M7D B;  4PLI A;  2VXE A;  3QSU A;  3L4G B;  2LTO A;  4C92 G;  5GAN 7;  4ZIB A;  4E7S A;  3MCA B;  4JRI A;  1QVG P;  2L8D A;  2BZX A;  2CYZ B;  2QHS A;  2PUK B;  3HRI A;  2KE9 A;  4F7U A;  4HWS A;  1U06 A;  4YRP A;  4NCX A;  3TRE A;  1RAC B;  3OYF A;  5IHK A;  1Y57 A;  4RTV A;  4IUQ A;  4ATO A;  1QVG A;  4QVD A;  4P72 A;  3HFZ B;  1J3T A;  4FSS A;  4BW9 A;  2DU7 A;  2C06 A;  2HBW A;  4KUD K;  1S1N A;  3OBY A;  1QMC A;  3KFV A;  3EFO B;  2O4X A;  5DLQ E;  2XKO C;  1JQQ A;  1KK7 A;  4PJO G;  4JLI A;  1UTI A;  2DTO A;  3E9I A;  2OTJ Q;  2LT1 A;  4P71 A;  4YYE A;  2DXU A;  1QKX A;  2JJ9 A;  4M78 C;  1GFD A;  1W4S A;  3THK A;  4A4G A;  4O2D A;  4X5O A;  1UB4 A;  2DZ9 A;  2IY5 A;  1NG2 A;  1BKB A;  2QEX Q;  4CH4 A;  5GAM e;  4LVK A;  1RI9 A;  3CC4 A;  2RHY A;  3CC4 T;  2J06 A;  4J9D A;  2O9V A;  3L2W A;  3G71 A;  2BZY A;  1E6H A;  2A37 A;  2QI2 A;  2DTI A;  4L87 A;  4ORZ A;  1JEG A;  2KNB B;  2O88 A;  4XQ3 A;  1H3Z A;  4AT1 B;  3E9G A;  4YCV A;  3M53 A;  4OF1 A;  5I2M A;  2K5L A;  3NTK A;  1HJD A;  5AT1 B;  3EG2 A;  3CPW P;  2K5I A;  2IG0 A;  5DM7 R;  1UGP B;  4EIK A;  2OTL A;  2EFI A;  1YIJ Q;  4P3P A;  1BBU A;  2JM9 A;  1EQR A;  3CPW A;  1QE0 A;  2VVK A;  2OTL T;  3P8H A;  4C5H A;  1MMN A;  4E7I A;  1HYO A;  3HSB A;  1YWO A;  3J7A F;  2RO0 A;  4CI0 C;  5J3B A;  2RA2 A;  1MV0 B;  5LJ3 d;  2ZPI B;  3WXM B;  3I5S A;  2DXT A;  4F14 A;  4JRQ A;  1OU9 A;  5FRN A;  2KRO A;  2P84 A;  2K3Y A;  2ZIM A;  5CQY A;  1YCY A;  2RHQ B;  2DLP A;  2RJF A;  5KYX B;  1Y96 B;  4HCK A;  3KUF A;  4KH0 B;  4F17 A;  1Q7Y R;  4P75 C;  2KBT A;  4HT9 A;  2FPD A;  2Q5I A;  2CUB A;  1PC0 A;  4PL6 A;  1K9M C;  4RQE A;  2EQK A;  4RKU E;  2R58 A;  2PUO B;  4CC7 A;  2MOX A;  2DZC A;  3VS1 A;  2H3E B;  1A0N B;  2RHX A;  3TEH B;  3CPF A;  1K4U S;  3PZC A;  4UP8 A;  3L2Z A;  1ATI A;  2EYY A;  3QBY A;  4R0K A;  1D3B B;  2IVW A;  1C0M A;  3M0R A;  3VS0 A;  2GFA A;  2LDM A;  2JN0 A;  4WCI A;  4M78 A;  3GNF B;  1V29 B;  3REU A;  2LCC A;  4JS4 A;  2ZZD A; 
#chains in the Genus database with same CATH homology
 4J6Y A;  1VUB A;  5GAN g;  1B8A A;  4JDS A;  2JUF A;  4N0A C;  5I2S A;  2B8A A;  1SER A;  5GAN 8;  4LD6 A;  4M7D C;  1NYR A;  2E5Q A;  5GMK j;  1J5W A;  1I81 A;  5KNN A;  3X26 B;  4QQG A;  3G7Z A;  3GF5 A;  2RB6 A;  2M9U A;  4A53 A;  3OYY A;  5A0G A;  1HXD A;  1B70 A;  3VUZ A;  4ZTU B;  4NL3 A;  3L2R A;  4J7F A;  3HRT A;  4N4G A;  4TVA A;  1N27 A;  5KE3 A;  2JVV A;  3RUX A;  4RCC A;  3BW1 A;  5LJ5 d;  1O75 A;  4K86 A;  3MP6 A;  3LYI A;  2P4T A;  1KQ1 A;  2VGN A;  3QO3 A;  1UGQ B;  2AHJ B;  5GAM g;  1RIQ A;  1G3Y A;  1MHN A;  3QII A;  4P75 A;  3PMT A;  1WNL A;  4C0F A;  3LW5 E;  2ALY B;  1XQH A;  3NTI A;  4M75 E;  3GP8 A;  4M7A G;  1QVP A;  3HRS A;  4ZGJ B;  4UP7 A;  2CS7 A;  1QVF S;  1X01 A;  2KAF A;  3INZ A;  4N4H A;  3CCQ A;  4H2V A;  3HTZ A;  3VUB A;  1ASY A;  2RI3 A;  3I7F A;  3SFM A;  3CCQ T;  3PTA A;  5FU7 B;  4NL2 A;  1H4Q A;  4YTL A;  4C0Z A;  2ZPE B;  5CKD A;  2FVU A;  4N0A A;  4YP0 A;  1KD1 U;  4M7D A;  3S3N A;  1YBY A;  4K87 A;  3L4G A;  3UPU A;  4C8Q C;  3VBB A;  2VXF A;  4O5V A;  2ZIN A;  2VYT A;  2X35 A;  5LJ3 e;  3SWN B;  2QQS A;  2MMP A;  1WQW A;  5LJ5 h;  4A4K A;  3HFZ A;  4F7U F;  2XDD A;  2K2V A;  4C92 E;  2C7I A;  4P73 C;  2FHD A;  2DIG A;  4K88 A;  3L2V A;  4LDV A;  5GAN d;  4C0D B;  3UGQ A;  3A7U A;  3X28 B;  4CS3 A;  3NEN A;  2RJC A;  1KQS A;  4PJO E;  4EDU A;  2EQM A;  3JCM W;  4MML A;  1G3W A;  3I55 A;  3TU4 K;  3LX7 A;  1SES A;  1X54 A;  2KQW A;  3I55 T;  4XTY A;  3G1Z A;  5GAO q;  3A7R A;  1UEB A;  3MO8 A;  2Q5H A;  2FL7 A;  1YJW A;  1N6A A;  4RQF A;  1NPR A;  3OW2 A;  3GOX A;  4MZM A;  1YJW T;  4EMK B;  1Y7X A;  2AMC B;  2CJA A;  2JTM A;  3CCL A;  4BWA A;  1M90 U;  4CH6 A;  3A7A A;  1QW1 A;  3H6Z A;  3FRN A;  3CCL T;  2QHU A;  3PIO A;  3QO5 A;  1NJI U;  3P8D A;  1JJ2 A;  5CO7 A;  4J6X A;  1PYS B;  2RK1 A;  2MWP A;  2ZZG A;  2RHQ A;  4C8Q A;  1Y96 A;  2DJZ A;  5GAN h;  1KMN A;  3KFU A;  4M77 B;  1EIF A;  3R07 A;  5LJ5 e;  1KHC A;  3HXZ A;  4M78 D;  4P74 C;  3F70 A;  3MEV A;  5FU6 C;  3TEH A;  4M75 B;  1RL2 A;  1WGS A;  1YB3 A;  2D0Q B;  5J26 A;  1O9S A;  4B9W A;  1VQ6 A;  3L2U A;  4G84 A;  3CCE A;  5FU7 C;  4A4H A;  1KD1 C;  2ZR3 A;  4P72 C;  4MDX A;  4A54 A;  4M78 F;  3CCE T;  5IT9 E;  2WAC A;  2RK2 A;  3MHX A;  1E24 A;  3ER0 A;  3LSQ A;  2K5F A;  1JBM A;  2E10 A;  3CME A;  1M4Z A;  5K1X A;  4M77 G;  3MET A;  3JB9 D;  4TVR A;  4BAC A;  1Z7M A;  3CME T;  2KK4 A;  1VQK A;  4P5N A;  3RES A;  4ME7 A;  1VQK T;  5D6Y A;  4IUR A;  3RKX A;  5LJ3 g;  5GAM h;  3CCV A;  5GAO n;  2E3C A;  4QQ6 A;  3M54 A;  2J3L A;  1GGM A;  3CCV T;  5LJ3 j;  3GIB A;  2EKO A;  4ZTJ A;  3JB9 F;  2HNI A;  4C92 B;  3JCM P;  4C0D C;  1IRE B;  1YFR A;  4TQF A;  4ZTF A;  4AH6 A;  2GF7 A;  3HXU A;  3TEE A;  4C5E A;  2YRV A;  4X34 A;  2M0O A;  2LC4 A;  4TQD A;  4FU6 A;  3RKW A;  4KT0 E;  2QTX A;  2XIC A;  3M9Q A;  1G5H A;  4XU0 A;  4LDW A;  3CEY A;  4KUL A;  4YRF A;  1VIE A;  1GXI E;  2ALY A;  4II1 A;  3W3S A;  4P74 A;  2L5Q A;  3M4Q A;  3M56 A;  1M90 C;  3RMQ A;  5CIU A;  4BDY A;  1PSE A;  3REX A;  2RM4 A;  4EMK C;  4DOW A;  3HL8 A;  3OYJ A;  2XD0 A;  3ZFJ A;  1NJI C;  3FDR A;  3E9F A;  2ZGW A;  2Y90 A;  5CKE A;  3OYA A;  3S3O A;  1H4S A;  3HXY A;  4M7D D;  3JCM d;  4M7A E;  2YLB A;  4KUI A;  1YJ9 T;  4N4I A;  2RJD A;  4E7K A;  4RCB A;  3FB9 A;  5GMK l;  3TCJ A;  5ELN A;  2XU8 A;  2CKK A;  2R5M A;  4BE1 A;  1EIY A;  3LC0 A;  4H2X B;  4P3O A;  2DD5 A;  4M7D F;  2K3X A;  2X4W A;  3SWN A;  2KSS A;  2CZ7 B;  5L8R E;  1Y71 A;  4OGE A;  5LJ5 g;  1KC8 U;  3QYH B;  3CXC A;  4M75 C;  2JOY A;  5LJ5 j;  5GAN 5;  1QVG S;  1NZ9 A;  4XTV A;  2OAU A;  1NJ8 A;  4H02 A;  2GFU A;  1FX7 A;  3MQZ A;  1E1O A;  4LVI A;  4CH3 A;  2XGT A;  4XEO A;  2LQK A;  3OYC A;  3OYH A;  4XU2 A;  3A8M B;  5IAY A;  3NET A;  2EQU A;  5HY6 A;  3CCS A;  1X56 A;  3M5A A;  2XID A;  3FIF A;  1VQ8 A;  3CCS T;  3P8V A;  2K57 A;  2NLU A;  1VQ8 T;  5GMK m;  5A0D A;  3OBW A;  2HQE A;  1NJ6 A;  5IN1 A;  4YCU A;  1RI0 A;  4NS5 A;  3QPH A;  1YJN A;  4EMK A;  2AMC A;  1UGS B;  5DY9 A;  1YJN T;  1VQN A;  4BD3 A;  3H8Z A;  4C92 C;  4NOY A;  3X24 B;  5GAO p;  4R55 A;  1VQN T;  4C8Q D;  3CPW S;  2J3M A;  2ZCE A;  3HRK A;  3CC2 A;  1VQ5 T;  3A5Z B;  2ZPB B;  5KCO A;  4HA8 A;  1H4V B;  4PG3 A;  4YRR A;  3CC2 T;  2DU5 A;  2HAX A;  1PYS A;  3JCM V;  2DXC A;  4PJO C;  4PLL A;  3OYL A;  3OD1 A;  2ZPG B;  1U1S A;  3HRU A;  3E19 A;  4XU3 A;  2P0Q A;  4E7H A;  2E70 A;  4C8Q F;  4QVC A;  5CK9 A;  3L1A A;  1VQ7 A;  2JNG A;  5GAN j;  4GY5 A;  1VQ7 T;  2LT4 A;  4M75 A;  5D6W A;  3MP1 A;  3WQZ A;  4EX5 A;  3UFG A;  2KVQ G;  3A5Y A;  3A8O B;  4YRM A;  4IUP A;  3HXX A;  5DLO A;  4O6J A;  3N5B B;  5LJ3 h;  1WQ7 A;  1EFW A;  4XU1 A;  4HCB A;  5GAN 2;  4XTX A;  2Y4Y A;  1LJO A;  1JJC B;  4M7A B;  4BUG A;  3GNG A;  3OMG A;  5C53 B;  5J39 A;  3QG1 A;  1L0W A;  1BIB A;  1EVL A;  1B7Y B;  3JCM X;  2PQW A;  3V8K A;  1EVK A;  4YRG A;  4LVL A;  3JCM e;  1KC8 C;  4HWT A;  2EIF A;  4J5Y A;  2ZTG A;  3OS1 A;  2E64 A;  4TWA A;  3OS2 A;  1YFT A;  4EMG A;  3A74 A;  4YPF A;  4M77 E;  3A8L B;  4C0G A;  4C92 A;  5CKF A;  5GAM j;  4J8O A;  2EJG A;  1VQO A;  4UPA A;  1H64 1;  4ELZ C;  2A8E A;  4BDZ A;  2NS6 A;  1VQO T;  3ERR A;  1S72 A;  3RF1 A;  2XHC A;  2E6N A;  1N9W A;  3HFO A;  1S72 T;  3NEL A;  3M4P A;  3C4S A;  3CBP A;  4YRQ A;  4BI4 A;  4PJO A;  3DSQ A;  3A8H B;  2VC8 A;  4D6W A;  1U8R A;  1SET A;  2QQB A;  4MZT A;  1FWZ A;  4RMF A;  3JCM b;  2LX9 A;  3CBM A;  2AKW B;  2ZR2 A;  3O8V A;  4HKE A;  3ICA A;  2PMF A;  2DO3 A;  2ZXF A;  1WJR A;  3OYK A;  4ELY C;  2DQ3 A;  1HTT A;  4B9X A;  2I4O A;  1W2B A;  3RL6 A;  3JRZ A;  3PFS A;  3V7S A;  3QYG B;  3HFN A;  2Q7G A;  4BY6 B;  3PNW C;  1YGB A;  2RHU A;  2M1H A;  3SDZ A;  5HGQ A;  2FB7 A;  4EMH A;  3NTH A;  3A32 A;  5CQX A;  2OTJ A;  2RJE A;  1XTD A;  3MEW A;  4DPG A;  2OTJ T;  3VQX A;  4H2X A;  2ODR D;  2DD4 A;  5CVI A;  11AS A;  3QO7 A;  4BB7 A;  1X2H A;  2QEX A;  4BI8 B;  3MF1 A;  3QZ9 B;  4F7U G;  4P3N A;  2PME A;  4KQE A;  3OYN A;  1LYL A;  2QEX T;  3FEO A;  2GCX A;  4QW2 A;  1E1T A;  5FLX E;  2BUD A;  2DXB A;  5C0M A;  4YDQ A;  1Q82 U;  5A2Q E;  3V7R A;  2MI6 A;  2VUB A;  4XTZ A;  1KG1 A;  1N8R U;  1YIJ A;  4M7A C;  5C6S A;  5D6X A;  4JUV A;  2CZ6 B;  1YIJ T;  1XOV A;  4DQ2 A;  1B34 B;  1M1G A;  1M1F A;  4V2S A;  2MF2 A;  2FYK A;  1SRY A;  1G5I A;  1KQS S;  4Q6G A;  2LCL A;  4E47 A;  2EJF A;  3S6W A;  3ME9 A;  1NNH A;  1I8F A;  3UGT A;  4RG2 A;  4JJN K;  3JCM g;  2I4N A;  1BI1 A;  4TTV A;  5GAO l;  2ZT7 A;  3GLX A;  4IUT A;  3HXV A;  3VQV A;  4OB0 B;  4HT4 A;  5HKC A;  2G3R A;  3TEG A;  1M1K U;  3Q1J A;  2ZPF B;  3QDR B;  5FRO A;  2RD1 A;  2I2L A;  3OW2 S;  2EAY A;  4OP0 A;  3HHT B;  4BE2 A;  3BY7 A;  3HP9 A;  4J6W A;  3AHU A;  4RMO A;  3A5Z A;  3V8L A;  3VKI A;  4M78 B;  1I4K 1;  3HFV A;  1Z7N A;  2LRQ A;  2RH2 A;  1OZ2 A;  3GPL A;  1D3B A;  3ZEH A;  2JTF A;  2CJ9 A;  4H2T A;  1M8V A;  1JJ2 S;  4YRK A;  2DEQ A;  4OLF A;  4M75 D;  3VU3 C;  2WSF E;  4XK8 E;  4XTW A;  1WPY A;  5CKB A;  3CBO A;  4TVY A;  2P5I A;  3JCM c;  3DB3 A;  1H4T A;  1Q86 U;  2E6Z A;  3BDL A;  3PGG A;  2RHI A;  3OYI A;  3QZ5 B;  3I56 A;  2DAQ A;  4TVW A;  3I56 T;  4HT8 A;  3KXT A;  4M75 F;  2QQR A;  3SWN C;  2ZCF B;  3OQ5 A;  5GAO m;  4BY6 C;  4M78 G;  1K73 U;  2QHV A;  1KOG A;  4TVA B;  3HY1 A;  1JJC A;  4M7A A;  2PVG B;  3SB2 A;  2ODR C;  3CD6 A;  1OI1 A;  4J7I A;  4G85 A;  4FT4 A;  3DKM A;  1G5V A;  4ZN1 A;  3CD6 T;  1B7Y A;  4Z02 A;  3DB4 A;  5EG2 A;  4PHC A;  1EOV A;  3LGL A;  3CMA A;  1JB0 E;  3OA6 A;  1WJS A;  2G4C A;  4C92 D;  3R6O A;  4L6V 5;  4ZGE B;  2VGM A;  3UH0 A;  3CMA T;  4ZGD B;  5GAN 3;  1SSF A;  3QKJ A;  1Q82 C;  4CRI A;  1W66 A;  3TUP A;  4LVM A;  2EYQ A;  4PNO A;  2C8M A;  1N8R C;  4YRL A;  3OYE A;  4PJO D;  2CIM A;  1USY C;  2JZ2 A;  4C92 F;  4IUV A;  1VQ9 T;  4KR2 A;  2CJB A;  4JRK A;  1WLE A;  2QQ9 A;  3X25 B;  1IZ6 A;  5GMK e;  2X4X A;  3L2Q A;  3MEU A;  3M4Y A;  3CC7 A;  1YJ9 A;  4E7L A;  1BI0 A;  1Q81 U;  3CC7 T;  1NYQ A;  4PJO F;  1BBW A;  2Q7E A;  3QNE A;  1BYM A;  2ZZF A;  4FL6 A;  2AKW A;  4J15 A;  1M1K C;  1ASZ A;  4HWP A;  2RI2 A;  3IKL A;  4BE0 A;  5HK3 A;  2KY9 A;  2R57 A;  4M77 C;  1QP3 A;  2PU9 B;  3LLR A;  2KDS A;  1X55 A;  5M9O A;  4RG8 A;  1NJ1 A;  2EJ9 A;  3VYH B;  5AYF A;  3HPW A;  3J81 E;  5KH6 A;  4LDU A;  3OYM A;  3RKY A;  1TH7 A;  1UGR B;  4HWO A;  3WVD B;  4QVZ A;  4M7D G;  2RHZ A;  5LJ3 f;  1Q86 C;  3S3M A;  3DLL A;  2CZ0 B;  2H3J A;  3EFR A;  3G71 T;  2V8K A;  5HK0 A;  3PIP A;  1HC7 A;  3JB9 H;  1K73 C;  2Q7H A;  3QUI A;  4VUB A;  2VV5 A;  3JCM h;  2XDB A;  12AS A;  4F7U E;  2KMT A;  3CXC S;  3G6E A;  1ADJ A;  1USY A;  2ZIO A;  2RHS B;  3P8T A;  2XTI A;  3G6E T;  3MF2 A;  2DK3 A;  1G3S A;  2CGH A;  4BI3 A;  1P92 A;  3BJU A;  4YCW A;  1B34 A;  4KR3 A;  1WJQ A;  2XI9 A;  4J83 A;  1VQ5 A;  4MMK A;  4IKF A;  4CS2 A;  1YIT A;  3SD4 A;  2ZT6 A;  5K1P A;  2WSC E;  4Y28 E;  4C8Q B;  1YIT T;  5C51 B;  2LVM A;  3FC3 A;  4JLG A;  2R5A A;  3RIR A;  1KQ2 A;  1LOJ A;  3M4G A;  1B76 A;  2DTH A;  4E51 A;  2ZNJ A;  5C52 B;  4HCZ A;  3MEA A;  1ADY A;  4M77 A;  4DA4 A;  1VQZ A;  1KMM A;  1IL2 A;  3HY0 A;  2YLC A;  1AHJ B;  1NJ2 A;  1M5Q 1;  3OMC A;  3OYD A;  3CCJ A;  2QQA A;  1Q81 C;  4WJ4 A;  3A8G B;  3OSV A;  3C12 A;  4OMF B;  3CCJ T;  2L3R A;  3OYB A;  2E5A A;  2GQV A;  1Q7Y U;  2BIV A;  4A4F A;  3JB9 I;  3KBG A;  4XAX B;  2I4L A;  4H2S A;  5LJ5 f;  2L89 A;  4C8Q G;  5GAO r;  2HD0 A;  3RGL A;  3E9H A;  1X2G A;  4YRN A;  3V8J A;  4H2U A;  4LD9 K;  4M7A D;  5FRM A;  3LWI A;  2XDP A;  1WU7 A;  3JSC A;  3RAC A;  2QHT A;  4X9D A;  1JRI A;  3JCM J;  1VQL A;  3UWN A;  4OB3 B;  1DJ7 B;  1OZ3 A;  1VQL T;  4LDY A;  2V8I A;  1QVF A;  4H2Y A;  3LWH A;  3PT9 A;  4OB1 B;  4M7A F;  2EL9 A;  3JCM Q;  2WSE E;  4KBM B;  2ZT8 A;  1G3T A;  4M78 E;  4C5G A;  3RER A;  3CCR A;  3CCU A;  2K4Y A;  3CCR T;  3CCU T;  1C0A A;  2ZPH B;  1R8O B;  3PCO B;  1I5L A;  2DQ0 A;  1BI2 A;  2QDY B;  1OYX A;  5FU6 B;  3IG2 A;  1M9S A;  3UDC A;  4YRO A;  3CMQ A;  2CZ1 B;  4PKC C;  2D9T A;  4F7U B;  4YRE A;  3OY9 A;  4L59 A;  4YRJ A;  3C95 A;  1E22 A;  5GAN f;  3DLM A;  1K8A U;  5KE2 A;  4JRP A;  4Q5W A;  2O4X B;  1BI3 A;  3JAM E;  2PVO B;  2EQJ A;  2RI5 A;  4H2W A;  4CS4 A;  5LL6 S;  4R56 A;  3QHS A;  3NFC A;  1EIY B;  3M58 A;  3M57 A;  2E65 A;  2LNV A;  1ZBX A;  5ELO A;  1YFS A;  4Y91 A;  2IY5 B;  5GAN 6;  4WF2 A;  4YRS A;  3VQY A;  3URG A;  2DIQ A;  2HQX A;  2F69 A;  4X9C A;  3CCM A;  1KHI A;  1NJ5 A;  2P0K A;  1LNX A;  1W2B S;  3CCM T;  3OB9 A;  3IKM B;  1PSF A;  3OS0 A;  3VQW A;  4ZTZ B;  2X4Y A;  2O01 E;  1Q7Y C;  1MGQ A;  4EO4 A;  2V8J A;  4OB2 B;  3P8Y A;  2ZZE A;  2M16 A;  3EFS A;  1X6O A;  2DKG A;  3VJP A;  5GAM f;  3OS5 A;  4EPC A;  2XG8 D;  2MWO A;  1NE8 A;  4XTU A;  3OSS C;  4JS5 A;  3P8B B;  2YHT A;  4GLK A;  1ZQ1 A;  4M7D E;  1NPP A;  2QA4 A;  2DDZ A;  2QA4 T;  4UC4 A;  2A3L A;  1VQ4 A;  4CH5 A;  1QP2 A;  3E1S A;  1WYD A;  2ZNI A;  4IUU A;  4A4E A;  2RHS A;  3L42 A;  3T9N A;  1VQ4 T;  2E12 A;  1QF6 A;  3M55 A;  1ZHI A;  1VQP A;  4HCC A;  1Y07 A;  4MZP A;  3VV0 A;  2F5K A;  4HVC A;  3FJP A;  5GAM d;  4Q15 A;  1U1T A;  1VQP T;  4YRC A;  3BFM A;  1N9S A;  3ASK A;  1BIA A;  2PVD B;  4M77 D;  1FYF A;  4FT2 A;  3G4S A;  2D6F A;  5GMK h;  4HWR A;  4ZN3 A;  4UP9 A;  3MP8 A;  2X4J A;  3G4S T;  5F5W A;  3OYG A;  5GMK i;  3C94 A;  2P0L A;  3NEM A;  3QTC A;  1HK9 A;  5CKH A;  3IAL A;  4P73 A;  4LVJ A;  2XK0 A;  3LSS A;  2P0P A;  3JB9 J;  1K8A C;  3QJ6 A;  4M77 F;  4FM4 B;  1G51 A;  4XEM A;  2F5T X;  1N9R A;  2ARS A;  4OGC A;  5A0L A;  2DVE A;  2QXF A;  3QJY A;  1VQ6 T;  1YHQ A;  3RMS A;  2ARU A;  3QXE B;  2EWN A;  1X75 C;  4FSX A;  1B70 B;  2A7Y A;  3EAE A;  3V7C A;  1YHQ T;  4RDX A;  2DPP B;  4QQD A;  4DOV A;  1VIF A;  5I21 A;  4P71 C;  3MEY A;  3WVE B;  3HXW A;  4L5G A;  1YI2 A;  3X20 B;  5CAI A;  2E1H A;  1YI2 T;  2ART A;  1XNI A;  4C8Q E;  4M75 G;  4MDW A;  3BDU A;  2E41 A;  4E7J A;  2MAM A;  3FLG A;  3UT1 A;  4FIB A;  5KCH A;  3JB9 G;  5E3I A;  2HBP A;  3LGF A;  3JCM f;  3HKS A;  4C5I A;  2I4M A;  5CCA A;  5CR2 A;  1VQ9 A;  4YRI A;  4LDX A;  5GAN 4;  1K9M U;  3ZBD A;  3A31 A;  4LNS A;  3LH0 A;  4PJO B;  5GAN e;  3J80 E;  4OVA A;  3VYG A;  3QO8 A;  2ZT5 A;  3PCO A;  4YRT A;  1VQM A;  3M59 A;  3PMI A;  4WI1 A;  2LQ8 A;  1VQM T;  1FXX A;  2BKD N;  4WJ3 M;  2Y4X A;  4M7D B;  4PLI A;  2VXE A;  3QSU A;  3L4G B;  2LTO A;  4C92 G;  5GAN 7;  4ZIB A;  3MCA B;  4JRI A;  2QHS A;  2L8D A;  2CYZ B;  2PUK B;  3HRI A;  4F7U A;  4HWS A;  4YRP A;  4NCX A;  3TRE A;  3OYF A;  4IUQ A;  4ATO A;  1QVG A;  4QVD A;  4P72 A;  3HFZ B;  4BW9 A;  2DU7 A;  2C06 A;  4KUD K;  3OBY A;  2O4X A;  5DLQ E;  2XKO C;  4PJO G;  4JLI A;  2DTO A;  3E9I A;  2LT1 A;  4P71 A;  4YYE A;  2DXU A;  4M78 C;  1W4S A;  4A4G A;  4O2D A;  4X5O A;  1UB4 A;  2DZ9 A;  2IY5 A;  1BKB A;  4CH4 A;  5GAM e;  4LVK A;  3CC4 A;  2RHY A;  3CC4 T;  3L2W A;  3G71 A;  2QI2 A;  2DTI A;  4L87 A;  4XQ3 A;  1H3Z A;  3E9G A;  4YCV A;  3M53 A;  4OF1 A;  5I2M A;  2K5L A;  3NTK A;  2K5I A;  2IG0 A;  5DM7 R;  1UGP B;  2OTL A;  2EFI A;  4P3P A;  1BBU A;  1EQR A;  3CPW A;  1QE0 A;  2OTL T;  3P8H A;  4C5H A;  4E7I A;  3HSB A;  3J7A F;  2RO0 A;  4CI0 C;  5J3B A;  2RA2 A;  5LJ3 d;  2ZPI B;  3WXM B;  2DXT A;  4JRQ A;  5FRN A;  2K3Y A;  2ZIM A;  5CQY A;  1YCY A;  2RHQ B;  2RJF A;  1Y96 B;  3KUF A;  4P75 C;  4HT9 A;  2Q5I A;  4PL6 A;  1K9M C;  4RQE A;  2EQK A;  4RKU E;  2R58 A;  2PUO B;  2DZC A;  2RHX A;  3TEH B;  3CPF A;  3PZC A;  4UP8 A;  3L2Z A;  1ATI A;  3QBY A;  1D3B B;  2IVW A;  2GFA A;  2LDM A;  2JN0 A;  4M78 A;  3GNF B;  1V29 B;  3REU A;  2LCC A;  4JS4 A;  2ZZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...