2ZGWA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with adenosine and biotin, mutations r48a and k111a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zgwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zgwA01
3MEYA 2QHVA 5GAOn 1B34B 2RHQB 4PJOD 4C8QC 4P73A 4M75E 1WLEA 4C8QB 4TVAB 3E9IA 4WJ3M 3JCMX 4P3PA 1W66A 2YHTA 4M77E 3NELA 4XTWA 1J5WA 2ALYA 2DQ0A 2ZZGA 3HFZA 4M75A 4C92A 4G84A 4C92F 4M77G 3TUPA 3SB2A 4M7DG 5LJ5e 3A74A 1E22A 4E51A 4H2TA 2ARSA 3LC0A 5GMKh 1JJCB 4UP7A 4P75A 3QO7A 4F7UA 2VXEA 2EAYA 2I4NA 4J6WA 3A5YA 4V2SA 1ASYA 1YFSA 3GIBA 2ZR2A 4K87A 4JLIA 1H4QA 1Y96A 1N9SA 1KMMA 4WI1A 4KR2A 1C0AA 12ASA 5ELOA 4P75C 2J3LA 3HY1A 2E10A 1KOGA 4P3NA 4MMKA 5CAIA 5GANd 2Q7EA 4RCBA 2ZCEA 3TEHB 4HVCA 1TH7A 2EWNA 1JJCA 3CMQA 2E41A 3HFNA 3QHSA 1E1OA 1LOJA 3HXYA 2DTHA 2ZXFA 4TVAA 2ZZFA 4QVDA 1H4TA 2ZT8A 3V7RA 5LJ3j 4M78E 4CS3A 1Y96B 3RKYA 2EJGA 1WPYA 2RD1A 2XTIA 3JCMJ 5GAN3 2QTXA 5LJ3g 2ZNJA 4P73C 5GAN2 3V8JA 5GANf 5K1XA 4M7DE 4RQEA 3HFVA 3JCMg 4Q15A 3V8KA 1HK9A 2E65A 5GAMe 3VQYA 3JB9F 1SETA 1HXDA 4YDQA 3HXWA 2RA2A 1E1TA 5GAOq 2ZR3A 3A32A 3MF2A 3HXXA 1WYDA 2AMCB 4TTVA 3JB9G 4M78D 3VQVA 5DY9A 4J5YA 4ZTUB 3JB9I 1B70A 4BW9A 2I4OA 1X01A 4JRIA 3V8LA 4XQ3A 1M8VA 1Z7NA 4BWAA 1I4K1 2Q5HA 4HWSA 4NOYA 4H2XB 1G5IA 4YRFA 1EQRA 4KQEA 4EX5A 3UGTA 4TQFA 4P72A 4EMKC 3JCMV 3LSSA 2AKWB 4C92G 5LJ3e 4M75G 4XEMA 4M7DF 1SRYA 3TEGA 3W3SA 2AMCA 5I21A 1D3BA 2VC8A 2ALYB 4P3OA 4YRGA 4M75F 1B70B 5GAMg 4M75C 4G85A 1EVKA 3HFZB 2E5AA 1YB3A 3M4GA 4UP8A 5GAMj 1LYLA 4TVYA 1NJ5A 2C8MA 4M7DA 4YROA 3VU3C 4M77D 5GAOp 3E9HA 3QO8A 4M7AF 1HC7A 5K1PA 2RHSB 4XTVA 3RGLA 5GAN5 4YRKA 2ZT5A 4M7AG 2CJ9A 1YFRA 2YLCA 5GAMh 4XU3A 4PJOA 3RKWA 3PGGA 2QHTA 5GMKl 1NJ8A 1U1TA 2QHUA 4CH4A 2ZT7A 1KQ1A 4XTYA 4M78C 4M77B 4A53A 5C53B 4TQDA 3TEHA 5GAN4 2DTOA 2I2LA 4HWRA 3NETA 5GAMd 1B76A 3JCMd 3RKXA 3JCMb 1L0WA 1EIYA 2FYKA 4UPAA 1B7YA 3SWNA 3HXZA 4CH5A 4WJ4A 1H4SA 1MGQA 4M78G 4X5OA 2EL9A 4DQ2A 4ZIBA 1U1SA 3HTZA 3QO5A 1HTTA 5GAN6 2ZIOA 5GAOm 1X55A 4M78F 4L87A 5E3IA 3A7RA 2JN0A 1X54A 1ATIA 2DU5A 3M4QA 1SERA 4XU0A 1EIYB 5GANg 1YGBA 4AH6A 3REXA 1NYQA 3INZA 2CIMA 4M77C 4M78B 3SWNB 1USYC 1LNXA 2RB6A 3RUXA 3I7FA 2ZINA 4YRSA 4YPFA 4YRIA 4YRMA 5GMKe 3JB9H 4EMKB 2DXTA 4PJOB 3UFGA 3P8TA 2ODRC 2ARTA 3EFSA 5F5WA 4XTZA 5LJ5f 1N9RA 5GMKi 1LJOA 1YFTA 4P74C 4YRQA 3HFOA 1JBMA 4TWAA 5LJ3h 2DZ9A 4C92C 4XU1A 5C51B 4M78A 1QE0A 2IY5A 4DPGA 1D3BB 3M4PA 1M5Q1 4M7AD 1EOVA 4HWOA 2DJZA 4RCCA 3WQZA 4OLFA 3JCMP 2DEQA 4OP0A 4CS4A 3L1AA 4EMGA 3SWNC 1YCYA 5GAMf 1KMNA 1B8AA 3FB9A 1I5LA 5LJ3d 3P8VA 3QUIA 3JCMQ 3IKMB 1BIAA 3VQWA 2E64A 1ADYA 1NYRA 3HY0A 2P5IA 4H2YA 4M7AE 5GAOr 4NL3A 3PCOA 4K86A 2DXUA 3KFUA 1ADJA 4HT9A 5GAN8 4N0AC 4PJOC 1ASZA 4X9DA 4C8QE 4QVCA 2DDZA 4K88A 4XU2A 1KQ2A 5GANe 1WQ7A 4Y91A 4XEOA 3LSQA 3QO3A 4PNOA 3VQXA 4P71A 4YRNA 4X9CA 2I4MA 1N9WA 2C7IA 4F7UB 4YRRA 3JCMh 2Q7GA 1QF6A 3JB9D 3RACA 5GAN7 1WQWA 3PCOB 5GANj 3BW1A 4F7UF 3HXUA 1BIBA 4M7AA 2PMEA 3RERA 3HXVA 1WU7A 5HGQA 5LJ5d 2E3CA 3IG2A 4H2VA 4HT8A 3HSBA 4M75D 4TVWA 4XTXA 1PYSB 2DZCA 3HRIA 3P8YA 1G5HA 2ARUA 2DU7A 4CH3A 2QHSA 2VXFA 4YRPA 1H641 2DQ3A 1X2HA 2RM4A 5LJ5h 3JCMf 4YCVA 2DVEA 4EMKA 4A54A 3VBBA 4NCXA 3IALA 4M7DC 1NJ6A 1GGMA 4M7DB 4WF2A 4YRCA 4F7UE 2CJBA 1NNHA 4EO4A 4N0AA 2CGHA 2RHSA 3DSQA 1IL2A 4P74A 3HRKA 11ASA 4RMFA 5LJ5j 3V7SA 4LNSA 1EFWA 3RESA 3NENA 4C92E 3UH0A 3A31A 4C8QG 3BJUA 4HWPA 4M7AB 4M77A 2J3MA 3A7AA 4HWTA 4RQFA 3R07A 1I8FA 4H2XA 3QNEA 3V7CA 1SESA 3QSUA 1PYSA 3RIRA 2AKWA 3G1ZA 3IKLA 1Z7MA 4H02A 2K57A 4YCUA 1I81A 2FB7A 4JUVA 4PJOF 5GMKm 2ZT6A 4M77F 3L4GB 5GMKj 4ZTZB 2XGTA 3JCMc 4PHCA 4CH6A 4PG3A 1X56A 3FIFA 4YRLA 4C8QD 3PZCA 3A5ZA 4PJOG 3ICAA 2Q5IA 4F7UG 1NJ2A 1B34A 4H2SA 2RHQA 4KR3A 4P72C 2EJFA 3JB9J 3BY7A 1JRIA 2ODRD 4C8QA 2E1HA 4JRKA 4J15A 4P71C 3UGQA 5GAOl 5LJ3f 2G4CA 4M7DD 2I4LA 1FYFA 3JCMe 4Q6GA 1BBWA 3RF1A 1USYA 4YRTA 4O2DA 3RL6A 4H2WA 3L4GA 3REUA 1BBUA 2ZTGA 4PJOE 2ZGWA 4M75B 4C92D 3ERRA 5KNNA 4C92B 3MF1A 2P0LA 1E24A 3A7UA 1G51A 2ZNIA 2EJ9A 5GANh 4CS2A 4M7AC 3NEMA 2DTIA 3EFRA 4YYEA 3BFMA 1H4VB 3FJPA 4MMLA 1VQZA 4YREA 2PMFA 4YCWA 4EMHA 4HA8A 3BDUA 4YRJA 1EVLA 2ZIMA 4NL2A 4J6XA 4XTUA 2ZZEA 1X2GA 2CJAA 5C52B 3AHUA 1NJ1A 2IY5B 4J6YA 2Y90A 2YLBA 5ELNA 1WNLA 5LJ5g 3JCMW 1B7YB 2Q7HA 2DKGA 4H2UA 3L2ZA 4YP0A 2HNIA 3QTCA 4C8QF 1RIQA 4RDXA 4UP9A 3OD1A
chains in the Genus database with same CATH superfamily
2QHVA 1X6GA 5GAOn 2BE9B 1B34B 3M0UA 1UGSB 2DF6A 4HT4A 4P73A 2HBPA 2JS2A 1M2VA 4C8QB 4TVAB 4WJ3M 3QDFA 1MUZA 2F5TX 1NEBA 3L2RA 4BI3A 3EGXB 4IUUA 1C6VX 1KD1U 3NELA 1HYOA 2FL7A 2OTJQ 2DQ0A 3HFZA 3M0SA 2RNAA 4M77G 4M7DG 5LJ5e 1AWWA 2LNVA 1QVGA 4UP7A 2DJQA 3ASKA 1UFFA 4P75A 2JUFA 3QO7A 2JM8A 1SEMA 4FYWB 1MMGA 2AHJB 2FPEA 4V2SA 2HZYA 3CCQA 5FRMA 3GLXA 2LX9A 2ROTA 3RMSA 4JLIA 1Y96A 2JVVA 1AEYA 1MHNA 12ASA 5ELOA 1SKUB 2RQTA 1V76A 1LVKA 1VQKT 2KAFA 2EKHA 1D0YA 1Z9ZA 1TH7A 2E6ZA 3P8BB 8AT1B 5CCAA 3HXYA 1LOJA 2DTHA 1I0CA 2A28A 1KC8C 2HL5C 1RL2A 6AT1B 2H3JA 2EJGA 2XTIA 2RD1A 3QPHA 2DE0X 1MMDA 5GAN3 3OSSC 1PHTA 4BB7A 1VQPT 1VQ5A 3V8JA 3I55A 5K1XA 1OULA 4RQEA 3G1JA 2YUOA 2A36A 2A7YA 3UA6A 1ZQ1A 1HK9A 2RI2A 5HY6A 1SETA 1O9SA 4IUQA 5FW9A 1UHFA 1NBEB 1GRIA 1KHIA 2RA2A 2PTKA 1WYDA 2P0KA 2PNIA 3OYKA 3JB9G 1RLPC 4ELYC 3M0RA 4D8KA 3J80E 1RAIB 3CBMA 1QQJA 3VKIA 1VYTA 5IH2A 2FRWA 4H2XB 1KG1A 1G5IA 1H3ZA 3GOXA 3CMEQ 1QVGP 2PU9B 4AFQC 1I07A 1UECA 4OMFB 4M7DF 1SRYA 3TEGA 2AMCA 5I21A 4PKCC 2C06A 3A8OB 4YRGA 2DEUA 1W2BA 4F16A 1B70B 4M75C 2CP5A 4LE9A 2R58A 2DFUA 4KUIA 2KVQG 2RK2A 1K4US 2LMJA 4UP8A 2V1RA 4CI0C 5GAMj 4TVYA 3ZFJA 3SHWA 2F2XA 5KYYB 4M7DA 3CCMQ 3G6ET 2FRYA 2EYQA 2Z0WA 2HL3A 4M7AF 1HC7A 1ZA1B 2RHSB 1YJNQ 4XTVA 3EFOA 3HRSA 4J83A 3HRTA 1CKAA 2W0ZA 1FXXA 4YRKA 2EGCA 4AMCA 2CJ9A 2DLPA 2XHCA 2YRVA 2LVMA 4PJOA 4PLIA 3E9GA 1K0SA 3PGGA 5GMKl 1U1TA 4M77B 3TEHA 2LTOA 2DTOA 2DAQA 2EQKA 2DRMA 2RI5A 1IREB 1SRMA 3H0FA 4PJJA 1TG0A 1QVPA 4F17A 1YJNA 4R0KA 1WHLA 2HSPA 5J26A 3MKDA 2M16A 1L0WA 1BI0A 3OQ5A 3QKJA 1B7YA 4AFUC 1SG5A 3C95A 3NGPA 5FRNA 2HSEB 3HTZA 2ZPHB 5GAOm 1JB0E 1QLYA 5E3IA 3JSCA 4FYYB 2DU5A 1PC0A 2RQVA 2KMTA 2DILA 2QYZA 4M77C 4IIOA 4YRSA 1WI7A 2ZINA 1MMAA 4YRIA 5GMKe 2DXTA 1TUDA 2OTJA 3UFGA 2EGEA 1WJSA 2VASA 4D6WA 1PD0A 1E7OA 3C12A 4LVKA 1WHMA 2BIVA 1S72A 4OMNA 1N9RA 3PVQA 1GCPA 4X34A 1A0NB 2RH2A 4MZTA 1W2BS 2DZ9A 1W70A 3UPUA 2RMOA 1D3BB 1M5Q1 2QEXA 4M7AD 3M9QA 1PSEA 1VQPA 1EOVA 4HWOA 1VQ5Q 2MYSA 1PKSA 2KYMA 2HEQA 1VYUA 1QVGS 3WQZA 2L3SA 4OLFA 1TOVA 3JCMP 1VQNT 2EW3A 3L1AA 1Q81C 2BE7D 1J3TA 1KMNA 1VQMQ 1I5LA 3P8VA 2ECZA 3JCMQ 4FU6A 1BIAA 3VQWA 2HKNA 3OBWA 4J9GA 2E64A 1G3TA 5I11A 3CPWA 1YP5A 3RMQA 1SF9A 4EDUA 4M7AE 3CC7T 4J8OA 2K9GA 3FEOA 1BK2A 2RO0A 1BI1A 2DXUA 2LCSA 5KH6A 3PCOA 2COWA 1ASZA 4QVCA 2DDZA 2KEAA 3VS6A 5KYXA 3A1PA 4FW1A 1R0BG 2LQWA 3EG0A 2QQAA 1GCQC 3RBBB 3J7AF 3VQXA 2CT4A 4YRNA 3QYHB 2KYBA 3SFMA 1N9WA 2DO3A 1Q7YC 4LDWA 1RAAB 3JCMh 2DL7A 3TCJA 2ABLA 1WQWA 3CQTA 3X24B 4J9DA 4C5EA 5GANj 3HXUA 2DXBA 3RERA 3HXVA 4R56A 4HT8A 5I2MA 1NLPC 4HVWA 1YCSB 3CBPA 3G4SQ 5FLXE 3FC3A 4BE2A 3HRIA 2ARUA 1WA7A 4CH3A 1VA7A 2VXFA 1JO8A 4J9CA 4FCYA 2RM4A 3JCMf 1YI2A 4VUBA 3VBBA 2OI3A 2FO0A 1KSWA 2F69A 2J7IA 4OMPA 1BKBA 3VS0A 3LX7A 2V26A 3IALA 5KYUA 4M7DC 1NJ6A 2JM9A 1NNHA 5FWCA 4N0AA 3GP8A 3DSQA 2EYYA 2LDMA 4P74A 4FIBA 3T9NA 1VQ9A 1M9SA 3OYYA 3CCJQ 1FMWA 3V7SA 4OMMA 4LNSA 1VQ9T 2O4XB 2G3RA 2RHIA 1TWBA 3BJUA 4LVIA 2E6NA 3DKMA 4M7AB 2J3MA 3A5ZB 1C1AA 1HD3A 1I8FA 1UTIA 4C0DC 4C0DB 3QSUA 1PYSA 3G4SA 3GBQA 4PLLA 4BE0A 2JT4A 3CCLA 3OMCA 5HKCA 2K57A 2NUTB 3EGDA 3UF4A 2ZT6A 1ABQA 5IXBA 2VKNA 2KI7A 3JCMc 2XGTA 2NUPB 1OX8A 3PZCA 2EYWA 2GTOA 1VQLT 4AT1B 5KE3A 2WACA 2E70A 4QKUA 4KR3A 2ZPEB 2EJFA 1VQ8A 2FZCB 2L3RA 2NYSA 1JRIA 2ODRD 1OEBA 1M2VB 4C8QA 4JRKA 4J15A 4LD6A 1FYFA 5DLOA 4E7IA 2L89A 4PJLA 1PM3A 1YJ9A 1USYA 3MP1A 2EBPA 4MDXA 2HD0A 1ZUYA 4K11A 4BI4A 3M4YA 4JJCA 1VQKA 5KYNA 2LJ1A 1HJDA 3LWIA 1YWPA 2ZTGA 4PJOE 5KNNA 2X9HA 3MF1A 1IZ6A 3JV3A 2MWOA 2JMAA 3NEMA 2KXCA 3HP9A 2ATCB 4MMLA 4YREA 1UE9A 3LYIA 2QA4Q 1VQOT 4YRJA 3M57A 3SEMA 1EVLA 2ZIMA 2M51A 4NL2A 5CKHA 4N4IA 3QG1A 4RKUE 2KR3A 1EFNA 2IY5B 2PVDB 1QWFA 4ORZA 2C0OA 4A4KA 1WNLA 2PUKB 1PSFA 4H2UA 4OMQA 4OB3B 3L2ZA 3OS2A 1PRMC 3NTKA 1QP2A 2DPPB 4LVMA 4UC4A 4UP9A 4EPCA 4A4GA 2RHQB 4PJOD 4M75E 1WLEA 1V1CA 1TSFA 2L5QA 3JCMX 2YUNA 1YJWA 3RNJA 1UUEA 5LL6S 2FPFA 3QWYA 3CCUQ 4XTWA 5ECAA 1J5WA 1G8XA 2DBKA 5J3BA 2NS6A 3TVTA 4FSSA 3SDZA 2LQKA 2LJ3A 1WJRA 1M90U 4XAXB 1XJWB 3C0CA 3OYFA 2X3WD 3I56A 4LDXA 4B9WA 3SB2A 2YXYA 4PFOA 3OYCA 3VS2A 3OYGA 1VQLQ 2ROLA 1YNZA 2XKOC 4F7UA 3EGXA 4J6WA 3A5YA 5DLQE 5KYWB 3TSZA 4HCKA 2QAZA 4K87A 2COYA 2YT6A 1N9SA 1RACB 1QP3A 3NHNA 4ESRA 2E12A 2KY9A 2QASA 1CSKA 1SHFA 2KT8A 2Q7EA 2O01E 4QW2A 1M1KR 4RCBA 2ZCEA 4HVCA 2EWNA 1JJCA 3CMAQ 2KK4A 1UG1A 3CMQA 1YIJQ 1H92A 4TVAA 2ZZFA 3VS3A 2EVRA 4QVDA 4JJDA 4IIMA 2K2VA 2QA4T 2ZT8A 1GL5A 5LJ3j 1Y07A 3CCET 1Y96B 3RKYA 3PVLA 1K73U 4CC4B 4JLGA 2QA4A 2QTXA 1ZSGA 2XDDA 3CCJT 5GAN2 2XDBA 4F04B 1BI3A 1JXMA 1KFZA 2A37A 2HDAA 4Q15A 2EYXA 1MMNA 2DIGA 5FU6C 2E65A 2LQ8A 5FU6B 3HXWA 4E7JA 1E1TA 2L2PA 1S72Q 3VUZA 2RK1A 3JRZA 5GJWB 1VIEA 2BTTA 3OS5A 2J6OA 5DY9A 4ZTUB 2PZ1A 3L2VA 1B70A 2I4OA 1VQLA 3KUFA 4JRQA 4XQ3A 1G5VA 1M8MA 1Q7YU 1JJ2P 3HKSA 3PIPA 2LJ0A 1I4K1 3CC4A 4NOYA 2DL3A 3CCRT 1EQRA 3WVDB 4EX5A 3UGTA 2RPNA 4P72A 4EMKC 1IRXA 4TQFA 3JCMV 3LSSA 1OQKA 2AKWB 2I0NA 4A4EA 4M75G 4J9HA 2ZZDA 3KXTA 2L0AA 4AFSC 2MIOA 4AG1C 2XG8D 3VYHB 4N4GA 2VC8A 3E19A 2ALYB 3MO8A 1OOTA 3A8MB 3DLMA 4Z88A 2CZ7B 1M1FA 4G85A 1EVKA 4CRIA 3P8DA 3HRUA 3M4GA 5CVIA 1U3OA 4KBMB 1NJ5A 1OPLA 3MEAA 4Z02A 2VYTA 4M77D 3E9HA 4KH0B 2RQRA 5K1PA 2YRDA 3RGLA 1PNJA 3PMTA 2DIQA 2JTEA 1ARKA 3QZ5B 1S1NA 3VS1A 2YLCA 5GAMh 4J9FA 5CQYA 1FX7A 2E3HA 2KNBB 2ZT7A 1GCQA 4XTYA 4M78C 2VV5A 3RR6A 4OGEA 4HWRA 1VQOQ 1G83A 3O8VA 3CCLQ 1DJ7B 1QCFA 4O6JA 5M9OA 4KRTA 2HKQB 1VQ7A 2CUBA 1IXDA 3HTRA 1BB9A 2DL4A 2F1LA 3HHTB 1IGUA 2V8JA 5C0MA 4CH5A 3EG2A 4WJ4A 1H4SA 1MGQA 1JJ2A 4X5OA 1WHJA 3M58A 3SD4A 4ELZC 2CZ6B 4BDYA 2VUBA 4FW2A 4LDYA 2ZIOA 2K6DA 2H8HA 2MAMA 1VQ9Q 1Y57A 3A98A 1X54A 2DD4A 3EFOB 3PNWC 4PJNA 1MNEA 2W10A 4M78B 1USYC 3A8GB 2RB6A 1K73C 1E6HA 2JJ9A 4YRMA 3G71A 2IPOB 4PJOB 3P8TA 2R5AA 2RF0A 3MEWA 2VWFA 4AG2C 2LNHB 2CYZB 3PTAA 1YFTA 4TWAA 2GQIA 1NYGA 3CCEA 4LXCA 3S3MA 1QE0A 1Q82U 2IY5A 2EKOA 2M02A 3CCJA 2RJFA 4WTOB 1TUCA 2DNUA 4RTWA 3PIOA 4RCCA 2KDSA 1G3YA 2CSIA 2YSQA 4AFZC 5L23A 3VRZA 5GAMf 3C94A 3EH2A 4JZ4A 3FB9A 1QKXA 5LJ3d 3QUIA 2H3EB 2MCNA 2F5KA 2FG0A 2L3PA 3CCST 2D1XA 1M90C 2M0OA 3HY0A 1B3QA 2XD0A 1X2QA 5GAOr 2MI6A 2YUQA 2SRCA 1H3HA 2EGAA 4N0AC 4X9DA 4C8QE 1IHVA 2PUOB 1AHJB 4K88A 3EH1A 5GANe 3WVEB 1O75A 3REAB 1WQ7A 3CCLT 1D09B 2CT3A 3TQ7P 4PNOA 3CC7Q 2K5LA 4QVZA 3G6EQ 4P71A 2CS7A 2CUDA 4X9CA 2C7IA 5IHIA 4F7UB 4GLMA 2BZYA 3QYGB 1NM7A 2XICA 4IURA 4YRRA 2O4XA 5GAN7 3EHQA 4B9XA 1ACMB 1D0XA 4C0FA 1BIBA 2K79A 3H0IA 1VQ8T 2PMEA 3G7ZA 1WZOA 1OU8A 5LJ5d 2E3CA 4H2VA 2KROA 3CCEQ 1Q81R 1PYSB 5I22A 1G3WA 1VQNA 1OZ2A 3MP8A 2IG0A 3CBOA 1G5HA 4BACA 2EPDA 2QHSA 1FYNA 3MP6A 2CDTA 3EGDB 4KGXB 4LNPA 5LJ5h 4DEYA 4E7KA 3CMAT 3OBYA 4YCVA 4EMKA 3R6OA 4DBRA 1UJYA 4KH1B 3A8LB 1VQOA 2ZPBB 3CXCA 1RI0A 1GGMA 5KYYA 4M7DB 2QG9B 3REBB 4F7UE 2P0PA 2RI3A 2EQUA 1RAEB 2RHSA 2FHDA 2XK0A 11ASA 2QGGA 2VVKA 2C0IA 1VQPQ 1U5SA 1EFWA 1WIEA 4C92E 1WXUA 4C8QG 4E7LA 2VGMA 4E6RA 1BYMA 2GBQA 3E9FA 1W4SA 2OTJT 4CC7A 1SESA 1RAGB 3RIRA 2AKWA 3G1ZA 1NZ9A 4IUVA 3NMZC 3JAME 1KC8R 4RTVA 2QQBA 5GMKm 4M77F 3VS7A 3L4GB 3UATA 3TEEA 4CH6A 1X56A 2CP2A 2FPDA 3FIFA 3H0HA 5A0LA 1T3SA 3A5ZA 4PJOG 2ZPFB 1N5ZA 4F7UG 2X4XA 1OX9A 4L6V5 1W6XA 2E1HA 2KRNA 3P8HA 4P71C 2I4LA 4Q6GA 3E2UA 1BBWA 2NWMA 3J81E 2AT1B 2NUTA 4O2DA 3RL6A 2EQIA 2BUDA 2JTMA 3CCMT 1BBUA 1EZZB 2ZGWA 3I5SA 4C92D 1Q82C 1UDLA 4HVVA 2P0LA 3H41A 2D9TA 2ZNIA 5GANh 4RTXA 4CS2A 2DTIA 1M1KC 2E4HA 2KE9A 2O2OA 2PMFA 2BZ8A 1G3SA 1D1CA 4EMHA 3BDUA 2AKLA 2KSSA 4XTUA 1WJQA 5C52B 3FRNA 3PFSA 1KIKA 2Y90A 2YLBA 3I56Q 1SSHA 2K3BA 2IVWA 1VOMA 4Z89A 3CCRQ 1TS9A 2LCLA 1K9MC 4C8QF 4RDXA 3TUPA 1BCMA 2DMOA 5EG2A 1IB8A 2OTLQ 3IQLA 4QQDA 3E9IA 1QVFP 2YHTA 1W66A 3CCQQ 1AVZC 2K3YA 4C0ZA 3MQZA 2J6KA 3I55Q 2ALYA 4NS5A 3CCRA 1E6GA 4C92A 1K9MR 1AD5A 3CMEA 1YI2T 4YTLA 4C92F 2ZPIB 1K0XA 1D1AA 1OU9A 4HCZA 3A74A 4E51A 2B8AA 4E2FB 2ARSA 3LC0A 1JJCB 3CMAA 3CCUA 4XK8E 2DL5A 2GGRA 1B07A 2YDLA 2LCCA 1ASYA 3QDRB 2XU8A 1YJWQ 3UWNA 1WHHA 2CZ0B 2ZR2A 2JOYA 4WI1A 1C0AA 2P84A 2B86A 4PJMA 4P75C 1M3AA 1M3CA 1KOGA 2FEIA 4P3NA 3L2UA 3QIIA 5CAIA 2DX1A 2FZGB 3H8ZA 5FU7B 4RUGA 3NTHA 3EG3A 3QHSA 3HFNA 5FROA 3U23A 3OW2P 1C0MA 3M56A 3G4ST 3V7RA 4M78E 1WX6A 2CP7A 3JCMJ 2KQWA 3CEYA 2ZNJA 4P73C 4IUPA 4A4FA 4E47A 4M7DE 3HFVA 3JCMg 1JU5C 2CH4W 2AZSA 3V8KA 5GAMe 5CR2A 3VQYA 3JB9F 1ZUUA 1HXDA 1NJIR 2X51A 5KCHA 4YDQA 5AT1B 1K9MU 3A32A 3UA7A 2E3IA 3MF2A 3HXXA 2LC4A 4M78D 1PRLC 1Q86C 1OZ3A 1OPKA 4BW9A 4GBQA 1LPLA 5EC7A 4BUGA 3V8LA 1ZX6A 3OYLA 1NE8A 3LW5E 4RTZA 2XDPA 4FYVB 4HWSA 2V8IA 4YRFA 4KQEA 3QXEB 4ZN1A 3OYDA 2XMFA 1NJIC 2KRSA 4XEMA 1WLPB 2IIMA 5A0DA 4JS5A 1WHGA 3AT1B 1BBZA 1FMVA 2V8KA 3FJ5A 4M75F 5GAMg 1M27C 1YB3A 1LYLA 4ZGEB 2ZPGB 1MV0B 5IN1A 2C8MA 4HVUA 3OYJA 1M4ZA 4YROA 1VQ6Q 5GAOp 3QO8A 3X25B 3LGLA 5GAN5 1SSFA 2QDYB 2OAUA 3QJ6A 1VQ8Q 4MZPA 7AT1B 3OYMA 2ZT5A 4MDWA 4M7AG 3BDLA 4DA4A 1EX4A 1QCOA 2YWWA 3QBYA 2O31A 3DLLA 3RKWA 2QHTA 1NJ8A 2CH4A 3OYHA 2OTLT 4A53A 4BD3A 4TQDA 4J7FA 1JEGA 1KHCA 4F14A 1OYXA 1UGRB 3NETA 5GAMd 1KQSA 1B76A 1ZSZA 4GY5A 2DXCA 3S3OA 3LLRA 4UPAA 1EIFA 1SRLA 3HXZA 4LVLA 1D0ZA 5HK3A 3FDRA 2A0FB 1JXOA 3ZBDA 4JRPA 1QVFA 1Q7YR 2EL9A 4A63B 4DQ2A 4PK4A 3QO5A 1HTTA 2JW4A 3CCUT 1K9AA 1X55A 4RTUA 4L87A 1RUWA 1VQMA 2R5MA 3M4QA 1ZBXA 3CCVT 1N8RC 1EIYB 5GANg 3ZL7C 4B6MA 1VUBA 4AH6A 1PD1A 1NYQA 3INZA 3LGFA 1QKWA 3EGUA 3SWNB 1W1FA 1LNXA 3RUXA 1W2BP 1VQ5T 4YPFA 4ME7A 1WXBA 2GQVA 3JB9H 2GFAA 4EMKB 2KT1A 1JQQA 3VJPA 4LUEA 2ODRC 4HXJA 3URGA 3E1SA 2J06A 3EFSA 4XTZA 5LJ5f 5I2SA 1LJOA 4YRQA 3HFOA 3CD6A 2ED1A 5LJ3h 1T0HA 5IAYA 5C51B 4OMLA 4J9BA 4M78A 5A2QE 1NEGA 2X4JA 4Y28E 2DJZA 1M2OA 3MEUA 4OP0A 3R6NA 4EMGA 2M1HA 3SWNC 2K7AA 2HQHA 3CPWS 1I1JA 1B8AA 3IKMB 1U8RA 2A3LA 3EG9B 1YITA 3OYIA 1U06A 2P5IA 3ULRB 2VB6A 3X20B 1X2KA 4NL3A 1GFDA 3THKA 4K86A 3KFUA 5CKDA 1ZBJA 5GAN8 4PJOC 2GF7A 4XU2A 1M1GA 3G71T 1KQ2A 5CIUA 4Y91A 4XEOA 4HCCA 2QQRA 3TREA 4JZ3A 1TTHB 2DETA 1WXTA 3LWHA 1RI9A 3X26B 1WFWA 1VQ4T 3L42A 2K5IA 2R57A 2VGNA 2JTFA 4N4HA 3ZEHA 2Q7GA 2ED0A 1QF6A 3OYEA 3JB9D 4X1VA 1YHQT 2AK5A 1QVFS 2G6FX 3OSVA 3OY9A 1N8RU 4OVAA 2EQJA 2BKDN 2LQNA 1YJNT 3M0PA 2DYIA 5HGQA 4JJNK 3HSBA 4M75D 2QQSA 1AOJA 4TVWA 5AYFA 1UEBA 3P8YA 1Y0MA 1KQSP 1YWOA 3S6WA 3CCMA 2DU7A 4KUDK 2DQ3A 4O5VA 4JDSA 2DVEA 3VS4A 1IO6A 4A54A 4FL6A 1VQ7T 1Q82R 2PQWA 4DOWA 4NCXA 1QMCA 3GNGA 1M3BA 5IHKA 3CCSA 1ZA2B 4WF2A 3CC2Q 2CJBA 1GFCA 2BZXA 3CC4T 1IL2A 3HRKA 2O9VA 5FWBA 3PT9A 3I9QA 1N6AA 1V29B 3RESA 2GFUA 2K2MA 2HQXA 2RHUA 1UGVA 2MOXA 1S72T 4DBQA 2HCKA 4HWPA 3A7AA 4HWTA 2GTJA 1VQMT 3R07A 1YN8A 3NTIA 4H2XA 1Y7XA 3V7CA 1R77A 2MF2A 1Z7MA 3F70A 4YCUA 3CMET 3LH0A 4PJOF 1X6OA 3D7SB 2ZCFB 1R0CB 2COZA 4YRLA 2CP0A 2ZAEA 3FLGA 4P5NA 1AT1B 3CCVQ 3VV0A 1YIJT 1NJIU 2X3XD 1B34A 1NYFA 4ZGJB 2QI2A 4P72C 3JB9J 3TU4K 3BY7A 1YIJA 1Q81U 1P92A 1CKBA 4L5GA 2LP5A 5GAOl 2DVJA 2G4CA 1YI2Q 3JCMe 4BE1A 3RF1A 3NPFA 1G2BA 2QXFA 3OA6A 2DM1A 1T3LA 3I5RA 4H2WA 1Q86U 3L4GA 2SEMA 1M30A 2F2WA 4C92B 1G51A 3QJYA 1IGQA 2EJ9A 4M7AC 5D6XA 2K3XA 3BFMA 3DB3A 3FJPA 1H4VB 2C0TA 2LZ6B 1AZGB 4YCWA 4HA8A 3EAEA 1D1BA 4TVRA 4J6XA 2ZZEA 3MCAB 2NLUA 4FSXA 3KBGA 4HKEA 5KCOA 3AHUA 5J39A 1NJ1A 2K4YA 4J6YA 4JS4A 2O88A 1UJ0A 1MV3A 3JCMW 2CP6A 1VYVA 1B7YB 3UDCA 1OV3A 2Q7HA 1K8AU 2E5KA 4M4ZA 1TUGB 3G6EA 4YP0A 1X27A 2WSEE 3QTCA 1VQ6A 5IHNA 3OB9A 4R55A 1N27A 2CZ1B 2WSFE 2HMAA 2Y4YA 3MEYA 2XI9A 1UHCA 1F1BB 4C8QC 2JS0A 2MK5A 2AIRB 2QEXT 4P3PA 1AZEA 1ZHIA 4M77E 2RHXA 4KT0E 1X75C 2JXBA 2ZZGA 4M75A 3M5AA 4RG8A 4G84A 2A08A 2M9UA 4CC2A 1E22A 4H2TA 1Q86R 1UGQB 1NG2A 1QWEA 5GMKh 3H9NA 2YUPA 4ZTFA 3O5ZA 2VXEA 1X69A 2EAYA 2QEXQ 3CC7A 2I4NA 2X4WA 1YFSA 4IUTA 3GIBA 3M53A 1H4QA 4FT4A 1KMMA 4KR2A 2L8DA 1VQKQ 2J3LA 3HY1A 2E10A 4OMOA 1ZLMA 4MMKA 1LCKA 5GANd 2J6FA 1NPRA 3VYGA 3TEHB 1FMKA 1Y71A 2X4YA 2E41A 2LRQA 1E1OA 2ZXFA 5HCKA 1H4TA 2V1QA 4BY6B 3CXCP 1FWZA 2DYBA 4CS3A 4RTYA 4E7HA 3N5BB 1WPYA 5IXFA 4LDVA 5LJ3g 1Q95G 2AZVA 5GANf 2DRKA 4DBHA 2JZ2A 1AWXA 2RHZA 2E5QA 2HBWA 4PL6A 4RTTA 3UT1A 2GNCA 4ZTJA 5GAOq 2ZR3A 3VS5A 1VQ4Q 4LVJA 3ME9A 3OYNA 2AMCB 4TTVA 1VQ7Q 2RN8A 3VQVA 3RDVA 4J5YA 3JB9I 1X01A 4JRIA 1KC8U 2RJDA 1UGPB 1M8VA 1Z7NA 4BWAA 2LT1A 1X6BA 2Q5HA 3CCVA 2FVUA 4OB0B 5FU7C 2PVGB 4C92G 5LJ3e 2JMCA 1KJWA 1T0JA 3W3SA 5D6WA 1D3BA 4P3OA 5CKBA 3GPLA 3PE0A 3HFZB 2E5AA 3CCQT 2DA9A 4FYXB 5CO7A 2OAWA 3VU3C 3KFVA 1BCOA 3OYBA 3G71Q 1ZSZB 2AKKA 3EG9A 2DD5A 2ESWA 2KBTA 2RQWA 3CXCS 4J7IA 2RQUA 2LX7A 1YFRA 2FZKB 1RADB 4XU3A 4C5HA 4RMOA 4MZMA 4CH4A 2QHUA 2D6FA 4WCIA 3CCSQ 1KQ1A 5D6YA 5C53B 1XOVA 2QTVA 5GAN4 2I2LA 1YITT 4ATOA 1YJ9T 4IKFA 3JCMd 4ZNXA 3RKXA 3JCMb 2OX7A 1EIYA 2FYKA 1SHGA 1JJ2S 2MWPA 3SWNA 4PFPA 5CK9A 4M78G 4BY6C 3QWXX 1WDXA 4ZIBA 1U1SA 2EYZA 3HPWA 5GAN6 4C0GA 4A4HA 4M78F 1YFNA 1QCNA 3A7RA 2JN0A 1ATIA 2Y4XA 1SERA 4XU0A 1RAHB 1YGBA 1MNDA 3REXA 3CC2A 2GCXA 2CIMA 3I7FA 3CC4Q 3M0TA 4BDZA 5IT9E 3CC2T 3NFCA 3S3NA 3I35A 1GBRA 4BI8B 2NUZA 2QGFB 2ARTA 2RJEA 4PFZA 5F5WA 4QQGA 2CP3A 1XTDA 3MHXA 1BU1A 5GMKi 4P74C 3PMIA 2J05A 1JBMA 1VIFA 2DL8A 4D8DA 4C92C 4XU1A 4KULA 4ZGDB 1BI2A 4DPGA 3M4PA 4C5GA 1HSQA 3OS0A 1H8KA 2P4TA 2DEQA 1Z9QA 4QQ6A 1UB4A 2RHYA 4CS4A 2P4RA 2A8EA 2D8JA 3M55A 1YCYA 4Y92A 3VRYA 3OS1A 5CQXA 2KXDA 3CPFA 1WGSA 3MJXA 1PWTA 1ADYA 1K73R 1AWOA 1NYRA 4DEXA 4E7ZA 2KRMA 4H2YA 3C4SA 2CREA 2D0NA 1IHWA 4J9EA 2HAXA 1ADJA 3HL8A 4HT9A 1WHKA 2NUPA 1XQHA 4Q5WA 5KYUB 1NPPA 1GXIE 1PKTA 3QZ9B 3LSQA 2L3QA 3QO3A 4LN2A 2I4MA 1PCXA 2PVOB 3M0QA 4JJBA 4L59A 3OYAA 2MMPA 1ZUKA 3EG1A 2RJCA 5KYWA 4J9IA 3RACA 2OJ2A 1TU0B 3PCOB 3LH5A 1TXQA 3BW1A 4F7UF 1KD1C 4M7AA 3CD6T 2K5FA 3H6ZA 1WU7A 4QT7A 4OGCA 3IG2A 3OW2S 4XTXA 2DZCA 3MEVA 2OTLA 3CD6Q 1M90R 5C6SA 2KGTA 3EHRA 5KE2A 4YRPA 1X43A 1H641 1YJ9Q 1PG5B 1QW1A 1X2HA 1YITQ 5D7UA 1B7TA 2QK0A 4ZN3A 2ENMA 4EIKA 5KYXB 2MPXC 5CKFA 2DERA 4YRCA 5CKEA 1K76A 2F2VA 4EO4A 2CGHA 1KD1R 2D0QB 3WXMB 4RMFA 5LJ5j 1K1ZA 4LDUA 1N8RR 3CPWP 2P0QA 1SPKA 1KK7A 3NENA 3GF5A 4FM4B 2EIFA 1VQ6T 3A31A 3UH0A 5HK0A 3X28B 1KQSS 3M59A 4E7SA 2JNGA 2M0YA 1YHQA 2DBMA 2CKKA 4M77A 4RQFA 4DBFA 4DOVA 1VQ4A 1RABB 9ATCB 1YHQQ 4GLKA 3QNEA 3I55T 2WSCE 2EQMA 1VQNQ 3IKLA 1RAFB 4HCBA 3OW2A 1NLOC 4H02A 1I81A 2FB7A 4JUVA 1OI1A 3ER0A 1XNIA 3GNFB 4JPBW 2LT4A 5GMKj 2QDLA 1YJWT 4ZTZB 4PHCA 4PG3A 5GJVB 3Q1JA 4C8QD 1R8OB 3ICAA 4OF1A 2Q5IA 4RG2A 1NJ2A 4H2SA 2RHQA 3META 2XIDA 1AWJA 1YBYA 1RLQC 5L8RE 4OB1B 1GBQA 4FT2A 3I56T 3UGQA 5LJ3f 2EFIA 4M7DD 1WYXA 4CC3A 4YRTA 3M54A 1K8AR 4ANJA 4KGVB 5DM7R 3REUA 2YRCA 4LD9K 2DK3A 2D8HA 4M75B 3L2WA 3ERRA 1E24A 4Z8AA 4II1A 3A7UA 2QQ9A 4YYEA 3EFRA 4KGZB 8ATCB 2HQEA 3OMGA 3L2QA 1VQZA 4C5IA 2X35A 3VUBA 4LUDA 5A0GA 1M1KU 1ABOA 1X2GA 2CJAA 1ZSZC 2O9SA 3BE3A 1I5OB 5ELNA 5LJ5g 1K8AC 3A8HB 2DKGA 3MPUB 3DB4A 2HNIA 4OB2B 3TSWA 2CSQA 1RIQA 3OD1A
chains in the Genus database with same CATH topology
2QHVA 5GAOn 1B34B 1UGSB 4HT4A 4P73A 2HBPA 4C8QB 4TVAB 4WJ3M 2F5TX 3L2RA 4BI3A 4IUUA 1KD1U 3NELA 2FL7A 2DQ0A 3HFZA 4M77G 4M7DG 5LJ5e 2LNVA 1QVGA 4UP7A 3ASKA 4P75A 2JUFA 3QO7A 2AHJB 4V2SA 5FRMA 3CCQA 3GLXA 2LX9A 3RMSA 4JLIA 1Y96A 2JVVA 1MHNA 12ASA 5ELOA 1VQKT 2KAFA 1TH7A 2E6ZA 3P8BB 5CCAA 3HXYA 1LOJA 2DTHA 1KC8C 1RL2A 2H3JA 2EJGA 2XTIA 2RD1A 3QPHA 5GAN3 3OSSC 4BB7A 1VQPT 1VQ5A 3V8JA 3I55A 5K1XA 4RQEA 2A7YA 1ZQ1A 1HK9A 2RI2A 5HY6A 1SETA 1O9SA 4IUQA 1KHIA 2RA2A 1WYDA 2P0KA 3JB9G 3OYKA 4ELYC 3J80E 3CBMA 3VKIA 4H2XB 1KG1A 1G5IA 1H3ZA 3GOXA 2PU9B 4OMFB 4M7DF 1SRYA 3TEGA 2AMCA 5I21A 4PKCC 2C06A 3A8OB 4YRGA 1W2BA 1B70B 4M75C 2R58A 4KUIA 2KVQG 2RK2A 4UP8A 4CI0C 5GAMj 4TVYA 3ZFJA 4M7DA 3G6ET 2EYQA 4M7AF 1HC7A 2RHSB 4XTVA 3HRSA 4J83A 3HRTA 1FXXA 4YRKA 2CJ9A 2XHCA 2YRVA 2LVMA 4PJOA 4PLIA 3E9GA 3PGGA 5GMKl 1U1TA 4M77B 3TEHA 2LTOA 2DTOA 2DAQA 2EQKA 2RI5A 1IREB 1QVPA 1YJNA 5J26A 2M16A 1L0WA 1BI0A 3OQ5A 3QKJA 1B7YA 3C95A 5FRNA 3HTZA 2ZPHB 5GAOm 1JB0E 5E3IA 3JSCA 2DU5A 2KMTA 4M77C 4YRSA 2ZINA 4YRIA 5GMKe 2DXTA 2OTJA 3UFGA 1WJSA 4D6WA 3C12A 4LVKA 2BIVA 1S72A 1N9RA 4X34A 2RH2A 4MZTA 1W2BS 2DZ9A 3UPUA 1D3BB 1M5Q1 2QEXA 4M7AD 3M9QA 1PSEA 1VQPA 1EOVA 4HWOA 1QVGS 3WQZA 4OLFA 3JCMP 1VQNT 3L1AA 1Q81C 1KMNA 1I5LA 3P8VA 3JCMQ 4FU6A 1BIAA 3VQWA 3OBWA 2E64A 1G3TA 3CPWA 3RMQA 4EDUA 4M7AE 3CC7T 4J8OA 3FEOA 2RO0A 1BI1A 2DXUA 5KH6A 3PCOA 1ASZA 4QVCA 2DDZA 2QQAA 3J7AF 3VQXA 4YRNA 3QYHB 3SFMA 1N9WA 2DO3A 1Q7YC 4LDWA 3JCMh 3TCJA 1WQWA 3X24B 5GANj 4C5EA 3HXUA 2DXBA 3RERA 3HXVA 4R56A 4HT8A 5I2MA 3CBPA 5FLXE 3FC3A 4BE2A 3HRIA 2ARUA 4CH3A 2VXFA 2RM4A 3JCMf 1YI2A 4VUBA 3VBBA 2F69A 1BKBA 3LX7A 3IALA 4M7DC 1NJ6A 1NNHA 4N0AA 3GP8A 3DSQA 4P74A 2LDMA 4FIBA 3T9NA 1VQ9A 1M9SA 3OYYA 3V7SA 4LNSA 1VQ9T 2O4XB 2G3RA 2RHIA 3BJUA 4LVIA 2E6NA 3DKMA 4M7AB 2J3MA 3A5ZB 1I8FA 4C0DC 4C0DB 3QSUA 1PYSA 3G4SA 4PLLA 4BE0A 3CCLA 3OMCA 5HKCA 2K57A 2ZT6A 2XGTA 3JCMc 3PZCA 1VQLT 5KE3A 2WACA 2E70A 4KR3A 2ZPEB 1VQ8A 2EJFA 2L3RA 2ODRD 1JRIA 4C8QA 4JRKA 4J15A 4LD6A 1FYFA 5DLOA 4E7IA 2L89A 1YJ9A 1USYA 3MP1A 4MDXA 2HD0A 4BI4A 3M4YA 1VQKA 3LWIA 2ZTGA 4PJOE 5KNNA 3MF1A 1IZ6A 2MWOA 3NEMA 3HP9A 4MMLA 4YREA 3LYIA 1VQOT 4YRJA 3M57A 1EVLA 2ZIMA 4NL2A 5CKHA 4N4IA 3QG1A 4RKUE 2IY5B 2PVDB 4A4KA 1WNLA 2PUKB 1PSFA 4H2UA 4OB3B 3L2ZA 3OS2A 3NTKA 1QP2A 2DPPB 4LVMA 4UP9A 4UC4A 4EPCA 4A4GA 2RHQB 4PJOD 4M75E 1WLEA 2L5QA 3JCMX 1YJWA 5LL6S 4XTWA 1J5WA 5J3BA 2NS6A 3SDZA 2LQKA 1WJRA 1M90U 4XAXB 4LDXA 3OYFA 3I56A 4B9WA 3SB2A 3OYCA 3OYGA 2XKOC 4F7UA 4J6WA 3A5YA 5DLQE 4K87A 1N9SA 1QP3A 2E12A 2KY9A 2Q7EA 2O01E 4QW2A 4RCBA 2ZCEA 4HVCA 2EWNA 1JJCA 3CMQA 2KK4A 4TVAA 2ZZFA 4QVDA 2K2VA 2QA4T 2ZT8A 5LJ3j 1Y07A 3CCET 1Y96B 3RKYA 1K73U 4JLGA 2QA4A 2QTXA 2XDDA 3CCJT 5GAN2 2XDBA 1BI3A 4Q15A 2DIGA 2E65A 2LQ8A 5FU6C 5FU6B 3HXWA 4E7JA 1E1TA 3VUZA 2RK1A 3JRZA 1VIEA 3OS5A 5DY9A 4ZTUB 3L2VA 1B70A 2I4OA 1VQLA 3KUFA 4JRQA 4XQ3A 1G5VA 1Q7YU 3HKSA 3PIPA 3CC4A 1I4K1 4NOYA 3CCRT 1EQRA 3WVDB 4EX5A 3UGTA 4TQFA 4P72A 4EMKC 3JCMV 3LSSA 2AKWB 4A4EA 4M75G 3KXTA 2ZZDA 2XG8D 3VYHB 4N4GA 2VC8A 3E19A 2ALYB 3MO8A 3A8MB 3DLMA 2CZ7B 1M1FA 4G85A 1EVKA 4CRIA 3P8DA 3HRUA 3M4GA 5CVIA 4KBMB 1NJ5A 3MEAA 4Z02A 2VYTA 4M77D 3E9HA 5K1PA 3RGLA 3PMTA 2DIQA 3QZ5B 2YLCA 5GAMh 5CQYA 1FX7A 2ZT7A 4XTYA 4M78C 2VV5A 4OGEA 4HWRA 3O8VA 1DJ7B 4O6JA 5M9OA 1VQ7A 3HHTB 2V8JA 5C0MA 4CH5A 4WJ4A 1H4SA 1MGQA 1JJ2A 4X5OA 3M58A 3SD4A 4ELZC 2CZ6B 4BDYA 2VUBA 4LDYA 2ZIOA 2MAMA 1X54A 2DD4A 3PNWC 4M78B 1USYC 3A8GB 2RB6A 1K73C 4YRMA 3G71A 4PJOB 3P8TA 2R5AA 3MEWA 2CYZB 3PTAA 1YFTA 4TWAA 3CCEA 3S3MA 1QE0A 1Q82U 2IY5A 2EKOA 3CCJA 2RJFA 3PIOA 4RCCA 2KDSA 1G3YA 5GAMf 3C94A 3FB9A 5LJ3d 3QUIA 2F5KA 3CCST 1M90C 2M0OA 3HY0A 2XD0A 5GAOr 2MI6A 4N0AC 4X9DA 4C8QE 2PUOB 1AHJB 4K88A 5GANe 3WVEB 1O75A 1WQ7A 3CCLT 4PNOA 2K5LA 4QVZA 4P71A 2CS7A 4X9CA 2C7IA 4F7UB 3QYGB 2XICA 4YRRA 4IURA 2O4XA 5GAN7 4B9XA 4C0FA 1BIBA 1VQ8T 2PMEA 3G7ZA 5LJ5d 2E3CA 4H2VA 1PYSB 1G3WA 1VQNA 1OZ2A 3MP8A 2IG0A 3CBOA 1G5HA 4BACA 2QHSA 3MP6A 5LJ5h 4E7KA 3CMAT 3OBYA 4YCVA 4EMKA 3R6OA 3A8LB 1VQOA 2ZPBB 3CXCA 1RI0A 1GGMA 4M7DB 4F7UE 2P0PA 2RI3A 2EQUA 2RHSA 2FHDA 2XK0A 11ASA 1EFWA 4C92E 4C8QG 4E7LA 2VGMA 1BYMA 3E9FA 1W4SA 2OTJT 1SESA 3RIRA 2AKWA 3G1ZA 1NZ9A 4IUVA 3JAME 2QQBA 5GMKm 4M77F 3L4GB 3TEEA 4CH6A 1X56A 3FIFA 5A0LA 3A5ZA 4PJOG 2ZPFB 4F7UG 2X4XA 3P8HA 4L6V5 2E1HA 4P71C 2I4LA 4Q6GA 1BBWA 3J81E 4O2DA 3RL6A 2BUDA 2JTMA 3CCMT 1BBUA 2ZGWA 4C92D 1Q82C 2P0LA 2D9TA 2ZNIA 5GANh 4CS2A 2DTIA 1M1KC 2PMFA 1G3SA 4EMHA 3BDUA 2KSSA 4XTUA 1WJQA 5C52B 3FRNA 3PFSA 2Y90A 2YLBA 2IVWA 2LCLA 1K9MC 4C8QF 4RDXA 3TUPA 5EG2A 4QQDA 3E9IA 1W66A 2YHTA 2K3YA 4C0ZA 3MQZA 2ALYA 4NS5A 3CCRA 4C92A 3CMEA 1YI2T 4YTLA 4C92F 2ZPIB 4HCZA 3A74A 4E51A 2B8AA 2ARSA 3LC0A 1JJCB 3CMAA 3CCUA 4XK8E 2LCCA 1ASYA 3QDRB 2XU8A 3UWNA 2CZ0B 2ZR2A 2JOYA 4WI1A 1C0AA 4P75C 1KOGA 4P3NA 3L2UA 3QIIA 5CAIA 3H8ZA 5FU7B 3NTHA 3QHSA 3HFNA 5FROA 3M56A 3G4ST 3V7RA 4M78E 3JCMJ 2KQWA 3CEYA 2ZNJA 4P73C 4IUPA 4A4FA 4E47A 4M7DE 3HFVA 3JCMg 5CR2A 3V8KA 5GAMe 3VQYA 3JB9F 1HXDA 5KCHA 4YDQA 1K9MU 3A32A 3MF2A 3HXXA 2LC4A 4M78D 1Q86C 1OZ3A 4BW9A 4BUGA 3V8LA 3OYLA 1NE8A 3LW5E 2XDPA 4HWSA 2V8IA 4YRFA 4KQEA 3QXEB 4ZN1A 3OYDA 1NJIC 4XEMA 5A0DA 4JS5A 2V8KA 4M75F 5GAMg 1YB3A 1LYLA 4ZGEB 2ZPGB 5IN1A 2C8MA 3OYJA 4YROA 1M4ZA 5GAOp 3QO8A 3X25B 3LGLA 5GAN5 1SSFA 2QDYB 2OAUA 3QJ6A 4MZPA 3OYMA 2ZT5A 4MDWA 4M7AG 3BDLA 4DA4A 3QBYA 3DLLA 3RKWA 2QHTA 1NJ8A 3OYHA 2OTLT 4A53A 4BD3A 4TQDA 4J7FA 1KHCA 1OYXA 1UGRB 3NETA 5GAMd 1KQSA 1B76A 4GY5A 2DXCA 3S3OA 3LLRA 4UPAA 1EIFA 3HXZA 4LVLA 5HK3A 3FDRA 3ZBDA 4JRPA 1QVFA 2EL9A 4DQ2A 3QO5A 1HTTA 3CCUT 1X55A 4L87A 1VQMA 2R5MA 3M4QA 1ZBXA 3CCVT 1N8RC 1EIYB 5GANg 4AH6A 1VUBA 1NYQA 3INZA 3LGFA 3SWNB 1VQ5T 1LNXA 3RUXA 4YPFA 4ME7A 2GQVA 3JB9H 2GFAA 4EMKB 3VJPA 2ODRC 3URGA 3E1SA 3EFSA 4XTZA 5LJ5f 5I2SA 1LJOA 4YRQA 3HFOA 3CD6A 5LJ3h 5IAYA 5C51B 4M78A 5A2QE 2X4JA 4Y28E 2DJZA 3MEUA 4OP0A 4EMGA 2M1HA 3SWNC 3CPWS 1B8AA 3IKMB 1U8RA 2A3LA 1YITA 3OYIA 2P5IA 3X20B 4NL3A 4K86A 3KFUA 5CKDA 5GAN8 4PJOC 2GF7A 4XU2A 1M1GA 3G71T 1KQ2A 5CIUA 4Y91A 4XEOA 4HCCA 2QQRA 3TREA 3LWHA 3X26B 1VQ4T 3L42A 2K5IA 2R57A 2VGNA 2JTFA 4N4HA 3ZEHA 2Q7GA 1QF6A 3OYEA 3JB9D 1YHQT 1QVFS 3OSVA 3OY9A 1N8RU 4OVAA 2EQJA 2BKDN 1YJNT 5HGQA 4JJNK 3HSBA 4M75D 2QQSA 4TVWA 5AYFA 1UEBA 3P8YA 3CCMA 3S6WA 2DU7A 4KUDK 2DQ3A 4O5VA 4JDSA 2DVEA 4A54A 4FL6A 1VQ7T 2PQWA 4DOWA 4NCXA 3GNGA 3CCSA 4WF2A 2CJBA 3CC4T 1IL2A 3HRKA 3PT9A 1N6AA 1V29B 3RESA 2GFUA 2HQXA 2RHUA 1S72T 4HWPA 3A7AA 4HWTA 1VQMT 3R07A 3NTIA 4H2XA 1Y7XA 3V7CA 2MF2A 1Z7MA 3F70A 4YCUA 3CMET 3LH0A 4PJOF 1X6OA 2ZCFB 4YRLA 3FLGA 4P5NA 3VV0A 1YIJT 1NJIU 1B34A 4ZGJB 4P72C 2QI2A 3JB9J 3TU4K 3BY7A 1YIJA 1Q81U 1P92A 4L5GA 5GAOl 2G4CA 3JCMe 4BE1A 3RF1A 2QXFA 3OA6A 4H2WA 1Q86U 3L4GA 4C92B 1G51A 3QJYA 2EJ9A 4M7AC 5D6XA 2K3XA 3BFMA 3DB3A 3FJPA 1H4VB 4YCWA 4HA8A 3EAEA 4TVRA 4J6XA 2ZZEA 3MCAB 2NLUA 4FSXA 3KBGA 4HKEA 5KCOA 3AHUA 5J39A 1NJ1A 2K4YA 4J6YA 4JS4A 3JCMW 1B7YB 3UDCA 2Q7HA 1K8AU 3G6EA 4YP0A 2WSEE 3QTCA 1VQ6A 3OB9A 4R55A 1N27A 2CZ1B 2WSFE 2Y4YA 3MEYA 2XI9A 4C8QC 2QEXT 4P3PA 1ZHIA 4M77E 2RHXA 4KT0E 1X75C 2ZZGA 4M75A 3M5AA 4RG8A 4G84A 2M9UA 1E22A 4H2TA 1UGQB 5GMKh 4ZTFA 2VXEA 2EAYA 3CC7A 2I4NA 2X4WA 1YFSA 4IUTA 3GIBA 3M53A 1H4QA 4FT4A 1KMMA 4KR2A 2L8DA 2J3LA 3HY1A 2E10A 4MMKA 5GANd 1NPRA 3VYGA 3TEHB 1Y71A 2X4YA 2E41A 2LRQA 1E1OA 2ZXFA 1H4TA 4BY6B 1FWZA 4CS3A 4E7HA 3N5BB 1WPYA 4LDVA 5LJ3g 5GANf 2JZ2A 2RHZA 2E5QA 4PL6A 3UT1A 4ZTJA 5GAOq 2ZR3A 4LVJA 3ME9A 3OYNA 2AMCB 4TTVA 3VQVA 4J5YA 3JB9I 1X01A 4JRIA 1KC8U 2RJDA 1UGPB 1M8VA 1Z7NA 4BWAA 2LT1A 2Q5HA 3CCVA 2FVUA 4OB0B 5FU7C 2PVGB 4C92G 5LJ3e 3W3SA 5D6WA 1D3BA 4P3OA 5CKBA 3GPLA 3HFZB 2E5AA 3CCQT 5CO7A 3VU3C 3OYBA 2DD5A 3CXCS 4J7IA 1YFRA 4XU3A 4C5HA 4RMOA 4MZMA 4CH4A 2QHUA 2D6FA 1KQ1A 5D6YA 5C53B 1XOVA 5GAN4 2I2LA 1YITT 4ATOA 1YJ9T 4IKFA 3JCMd 3RKXA 3JCMb 1EIYA 2FYKA 1JJ2S 2MWPA 3SWNA 5CK9A 4M78G 4BY6C 4ZIBA 1U1SA 3HPWA 5GAN6 4C0GA 4A4HA 4M78F 3A7RA 2JN0A 1ATIA 2Y4XA 1SERA 4XU0A 1YGBA 3REXA 3CC2A 2GCXA 2CIMA 3I7FA 4BDZA 5IT9E 3CC2T 3NFCA 3S3NA 4BI8B 2ARTA 2RJEA 5F5WA 4QQGA 1XTDA 3MHXA 5GMKi 4P74C 3PMIA 1JBMA 1VIFA 4C92C 4XU1A 4KULA 4ZGDB 1BI2A 4DPGA 3M4PA 4C5GA 3OS0A 2P4TA 2DEQA 4QQ6A 1UB4A 2RHYA 4CS4A 2A8EA 3M55A 1YCYA 3OS1A 5CQXA 3CPFA 1WGSA 1ADYA 1NYRA 4H2YA 3C4SA 2HAXA 1ADJA 3HL8A 4HT9A 1XQHA 4Q5WA 1NPPA 1GXIE 3QZ9B 3LSQA 3QO3A 2I4MA 4L59A 2PVOB 3OYAA 2MMPA 2RJCA 3RACA 3PCOB 3BW1A 4F7UF 1KD1C 4M7AA 3CD6T 2K5FA 3H6ZA 1WU7A 4OGCA 3IG2A 3OW2S 4XTXA 2DZCA 3MEVA 2OTLA 5C6SA 5KE2A 4YRPA 1H641 1X2HA 1QW1A 4ZN3A 5CKFA 4YRCA 5CKEA 4EO4A 2CGHA 2D0QB 3WXMB 4RMFA 5LJ5j 4LDUA 2P0QA 3NENA 3GF5A 4FM4B 2EIFA 1VQ6T 3A31A 3UH0A 5HK0A 3X28B 1KQSS 3M59A 2JNGA 1YHQA 2CKKA 4M77A 4RQFA 4DOVA 1VQ4A 4GLKA 3QNEA 3I55T 2WSCE 2EQMA 3IKLA 4HCBA 3OW2A 4H02A 1I81A 2FB7A 4JUVA 1OI1A 3ER0A 1XNIA 3GNFB 2LT4A 5GMKj 4ZTZB 1YJWT 4PHCA 4PG3A 3Q1JA 4C8QD 1R8OB 3ICAA 4OF1A 2Q5IA 4RG2A 1NJ2A 4H2SA 2RHQA 3META 2XIDA 1YBYA 5L8RE 4OB1B 4FT2A 3I56T 3UGQA 5LJ3f 2EFIA 4M7DD 4YRTA 3M54A 3REUA 5DM7R 4LD9K 2DK3A 4M75B 3L2WA 3ERRA 1E24A 3A7UA 4II1A 2QQ9A 4YYEA 3EFRA 2HQEA 3OMGA 3L2QA 1VQZA 4C5IA 2X35A 3VUBA 5A0GA 1M1KU 1X2GA 2CJAA 5ELNA 5LJ5g 1K8AC 3A8HB 2DKGA 3DB4A 2HNIA 4OB2B 1RIQA 3OD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEY A;  2QHV A;  5GAO n;  1B34 B;  2RHQ B;  4PJO D;  4C8Q C;  4P73 A;  4M75 E;  1WLE A;  4C8Q B;  4TVA B;  3E9I A;  4WJ3 M;  3JCM X;  4P3P A;  1W66 A;  2YHT A;  4M77 E;  3NEL A;  4XTW A;  1J5W A;  2ALY A;  2DQ0 A;  2ZZG A;  3HFZ A;  4M75 A;  4C92 A;  4G84 A;  4C92 F;  4M77 G;  3TUP A;  3SB2 A;  4M7D G;  5LJ5 e;  3A74 A;  1E22 A;  4E51 A;  4H2T A;  2ARS A;  3LC0 A;  5GMK h;  1JJC B;  4UP7 A;  4P75 A;  3QO7 A;  4F7U A;  2VXE A;  2EAY A;  2I4N A;  4J6W A;  3A5Y A;  4V2S A;  1ASY A;  1YFS A;  3GIB A;  2ZR2 A;  4K87 A;  4JLI A;  1H4Q A;  1Y96 A;  1N9S A;  1KMM A;  4WI1 A;  4KR2 A;  1C0A A;  12AS A;  5ELO A;  4P75 C;  2J3L A;  3HY1 A;  2E10 A;  1KOG A;  4P3N A;  4MMK A;  5CAI A;  5GAN d;  2Q7E A;  4RCB A;  2ZCE A;  3TEH B;  4HVC A;  1TH7 A;  2EWN A;  1JJC A;  3CMQ A;  2E41 A;  3HFN A;  3QHS A;  1E1O A;  1LOJ A;  3HXY A;  2DTH A;  2ZXF A;  4TVA A;  2ZZF A;  4QVD A;  1H4T A;  2ZT8 A;  3V7R A;  5LJ3 j;  4M78 E;  4CS3 A;  1Y96 B;  3RKY A;  2EJG A;  1WPY A;  2RD1 A;  2XTI A;  3JCM J;  5GAN 3;  2QTX A;  5LJ3 g;  2ZNJ A;  4P73 C;  5GAN 2;  3V8J A;  5GAN f;  5K1X A;  4M7D E;  4RQE A;  3HFV A;  3JCM g;  4Q15 A;  3V8K A;  1HK9 A;  2E65 A;  5GAM e;  3VQY A;  3JB9 F;  1SET A;  1HXD A;  4YDQ A;  3HXW A;  2RA2 A;  1E1T A;  5GAO q;  2ZR3 A;  3A32 A;  3MF2 A;  3HXX A;  1WYD A;  2AMC B;  4TTV A;  3JB9 G;  4M78 D;  3VQV A;  5DY9 A;  4J5Y A;  4ZTU B;  3JB9 I;  1B70 A;  4BW9 A;  2I4O A;  1X01 A;  4JRI A;  3V8L A;  4XQ3 A;  1M8V A;  1Z7N A;  4BWA A;  1I4K 1;  2Q5H A;  4HWS A;  4NOY A;  4H2X B;  1G5I A;  4YRF A;  1EQR A;  4KQE A;  4EX5 A;  3UGT A;  4TQF A;  4P72 A;  4EMK C;  3JCM V;  3LSS A;  2AKW B;  4C92 G;  5LJ3 e;  4M75 G;  4XEM A;  4M7D F;  1SRY A;  3TEG A;  3W3S A;  2AMC A;  5I21 A;  1D3B A;  2VC8 A;  2ALY B;  4P3O A;  4YRG A;  4M75 F;  1B70 B;  5GAM g;  4M75 C;  4G85 A;  1EVK A;  3HFZ B;  2E5A A;  1YB3 A;  3M4G A;  4UP8 A;  5GAM j;  1LYL A;  4TVY A;  1NJ5 A;  2C8M A;  4M7D A;  4YRO A;  3VU3 C;  4M77 D;  5GAO p;  3E9H A;  3QO8 A;  4M7A F;  1HC7 A;  5K1P A;  2RHS B;  4XTV A;  3RGL A;  5GAN 5;  4YRK A;  2ZT5 A;  4M7A G;  2CJ9 A;  1YFR A;  2YLC A;  5GAM h;  4XU3 A;  4PJO A;  3RKW A;  3PGG A;  2QHT A;  5GMK l;  1NJ8 A;  1U1T A;  2QHU A;  4CH4 A;  2ZT7 A;  1KQ1 A;  4XTY A;  4M78 C;  4M77 B;  4A53 A;  5C53 B;  4TQD A;  3TEH A;  5GAN 4;  2DTO A;  2I2L A;  4HWR A;  3NET A;  5GAM d;  1B76 A;  3JCM d;  3RKX A;  3JCM b;  1L0W A;  1EIY A;  2FYK A;  4UPA A;  1B7Y A;  3SWN A;  3HXZ A;  4CH5 A;  4WJ4 A;  1H4S A;  1MGQ A;  4M78 G;  4X5O A;  2EL9 A;  4DQ2 A;  4ZIB A;  1U1S A;  3HTZ A;  3QO5 A;  1HTT A;  5GAN 6;  2ZIO A;  5GAO m;  1X55 A;  4M78 F;  4L87 A;  5E3I A;  3A7R A;  2JN0 A;  1X54 A;  1ATI A;  2DU5 A;  3M4Q A;  1SER A;  4XU0 A;  1EIY B;  5GAN g;  1YGB A;  4AH6 A;  3REX A;  1NYQ A;  3INZ A;  2CIM A;  4M77 C;  4M78 B;  3SWN B;  1USY C;  1LNX A;  2RB6 A;  3RUX A;  3I7F A;  2ZIN A;  4YRS A;  4YPF A;  4YRI A;  4YRM A;  5GMK e;  3JB9 H;  4EMK B;  2DXT A;  4PJO B;  3UFG A;  3P8T A;  2ODR C;  2ART A;  3EFS A;  5F5W A;  4XTZ A;  5LJ5 f;  1N9R A;  5GMK i;  1LJO A;  1YFT A;  4P74 C;  4YRQ A;  3HFO A;  1JBM A;  4TWA A;  5LJ3 h;  2DZ9 A;  4C92 C;  4XU1 A;  5C51 B;  4M78 A;  1QE0 A;  2IY5 A;  4DPG A;  1D3B B;  3M4P A;  1M5Q 1;  4M7A D;  1EOV A;  4HWO A;  2DJZ A;  4RCC A;  3WQZ A;  4OLF A;  3JCM P;  2DEQ A;  4OP0 A;  4CS4 A;  3L1A A;  4EMG A;  3SWN C;  1YCY A;  5GAM f;  1KMN A;  1B8A A;  3FB9 A;  1I5L A;  5LJ3 d;  3P8V A;  3QUI A;  3JCM Q;  3IKM B;  1BIA A;  3VQW A;  2E64 A;  1ADY A;  1NYR A;  3HY0 A;  2P5I A;  4H2Y A;  4M7A E;  5GAO r;  4NL3 A;  3PCO A;  4K86 A;  2DXU A;  3KFU A;  1ADJ A;  4HT9 A;  5GAN 8;  4N0A C;  4PJO C;  1ASZ A;  4X9D A;  4C8Q E;  4QVC A;  2DDZ A;  4K88 A;  4XU2 A;  1KQ2 A;  5GAN e;  1WQ7 A;  4Y91 A;  4XEO A;  3LSQ A;  3QO3 A;  4PNO A;  3VQX A;  4P71 A;  4YRN A;  4X9C A;  2I4M A;  1N9W A;  2C7I A;  4F7U B;  4YRR A;  3JCM h;  2Q7G A;  1QF6 A;  3JB9 D;  3RAC A;  5GAN 7;  1WQW A;  3PCO B;  5GAN j;  3BW1 A;  4F7U F;  3HXU A;  1BIB A;  4M7A A;  2PME A;  3RER A;  3HXV A;  1WU7 A;  5HGQ A;  5LJ5 d;  2E3C A;  3IG2 A;  4H2V A;  4HT8 A;  3HSB A;  4M75 D;  4TVW A;  4XTX A;  1PYS B;  2DZC A;  3HRI A;  3P8Y A;  1G5H A;  2ARU A;  2DU7 A;  4CH3 A;  2QHS A;  2VXF A;  4YRP A;  1H64 1;  2DQ3 A;  1X2H A;  2RM4 A;  5LJ5 h;  3JCM f;  4YCV A;  2DVE A;  4EMK A;  4A54 A;  3VBB A;  4NCX A;  3IAL A;  4M7D C;  1NJ6 A;  1GGM A;  4M7D B;  4WF2 A;  4YRC A;  4F7U E;  2CJB A;  1NNH A;  4EO4 A;  4N0A A;  2CGH A;  2RHS A;  3DSQ A;  1IL2 A;  4P74 A;  3HRK A;  11AS A;  4RMF A;  5LJ5 j;  3V7S A;  4LNS A;  1EFW A;  3RES A;  3NEN A;  4C92 E;  3UH0 A;  3A31 A;  4C8Q G;  3BJU A;  4HWP A;  4M7A B;  4M77 A;  2J3M A;  3A7A A;  4HWT A;  4RQF A;  3R07 A;  1I8F A;  4H2X A;  3QNE A;  3V7C A;  1SES A;  3QSU A;  1PYS A;  3RIR A;  2AKW A;  3G1Z A;  3IKL A;  1Z7M A;  4H02 A;  2K57 A;  4YCU A;  1I81 A;  2FB7 A;  4JUV A;  4PJO F;  5GMK m;  2ZT6 A;  4M77 F;  3L4G B;  5GMK j;  4ZTZ B;  2XGT A;  3JCM c;  4PHC A;  4CH6 A;  4PG3 A;  1X56 A;  3FIF A;  4YRL A;  4C8Q D;  3PZC A;  3A5Z A;  4PJO G;  3ICA A;  2Q5I A;  4F7U G;  1NJ2 A;  1B34 A;  4H2S A;  2RHQ A;  4KR3 A;  4P72 C;  2EJF A;  3JB9 J;  3BY7 A;  1JRI A;  2ODR D;  4C8Q A;  2E1H A;  4JRK A;  4J15 A;  4P71 C;  3UGQ A;  5GAO l;  5LJ3 f;  2G4C A;  4M7D D;  2I4L A;  1FYF A;  3JCM e;  4Q6G A;  1BBW A;  3RF1 A;  1USY A;  4YRT A;  4O2D A;  3RL6 A;  4H2W A;  3L4G A;  3REU A;  1BBU A;  2ZTG A;  4PJO E;  2ZGW A;  4M75 B;  4C92 D;  3ERR A;  5KNN A;  4C92 B;  3MF1 A;  2P0L A;  1E24 A;  3A7U A;  1G51 A;  2ZNI A;  2EJ9 A;  5GAN h;  4CS2 A;  4M7A C;  3NEM A;  2DTI A;  3EFR A;  4YYE A;  3BFM A;  1H4V B;  3FJP A;  4MML A;  1VQZ A;  4YRE A;  2PMF A;  4YCW A;  4EMH A;  4HA8 A;  3BDU A;  4YRJ A;  1EVL A;  2ZIM A;  4NL2 A;  4J6X A;  4XTU A;  2ZZE A;  1X2G A;  2CJA A;  5C52 B;  3AHU A;  1NJ1 A;  2IY5 B;  4J6Y A;  2Y90 A;  2YLB A;  5ELN A;  1WNL A;  5LJ5 g;  3JCM W;  1B7Y B;  2Q7H A;  2DKG A;  4H2U A;  3L2Z A;  4YP0 A;  2HNI A;  3QTC A;  4C8Q F;  1RIQ A;  4RDX A;  4UP9 A;  3OD1 A; 
#chains in the Genus database with same CATH topology
 2QHV A;  1X6G A;  5GAO n;  2BE9 B;  1B34 B;  3M0U A;  1UGS B;  2DF6 A;  4HT4 A;  4P73 A;  2HBP A;  2JS2 A;  1M2V A;  4C8Q B;  4TVA B;  4WJ3 M;  3QDF A;  1MUZ A;  2F5T X;  1NEB A;  3L2R A;  4BI3 A;  3EGX B;  4IUU A;  1C6V X;  1KD1 U;  3NEL A;  1HYO A;  2FL7 A;  2OTJ Q;  2DQ0 A;  3HFZ A;  3M0S A;  2RNA A;  4M77 G;  4M7D G;  5LJ5 e;  1AWW A;  2LNV A;  1QVG A;  4UP7 A;  2DJQ A;  3ASK A;  1UFF A;  4P75 A;  2JUF A;  3QO7 A;  2JM8 A;  1SEM A;  4FYW B;  1MMG A;  2AHJ B;  2FPE A;  4V2S A;  2HZY A;  3CCQ A;  5FRM A;  3GLX A;  2LX9 A;  2ROT A;  3RMS A;  4JLI A;  1Y96 A;  2JVV A;  1AEY A;  1MHN A;  12AS A;  5ELO A;  1SKU B;  2RQT A;  1V76 A;  1LVK A;  1VQK T;  2KAF A;  2EKH A;  1D0Y A;  1Z9Z A;  1TH7 A;  2E6Z A;  3P8B B;  8AT1 B;  5CCA A;  3HXY A;  1LOJ A;  2DTH A;  1I0C A;  2A28 A;  1KC8 C;  2HL5 C;  1RL2 A;  6AT1 B;  2H3J A;  2EJG A;  2XTI A;  2RD1 A;  3QPH A;  2DE0 X;  1MMD A;  5GAN 3;  3OSS C;  1PHT A;  4BB7 A;  1VQP T;  1VQ5 A;  3V8J A;  3I55 A;  5K1X A;  1OUL A;  4RQE A;  3G1J A;  2YUO A;  2A36 A;  2A7Y A;  3UA6 A;  1ZQ1 A;  1HK9 A;  2RI2 A;  5HY6 A;  1SET A;  1O9S A;  4IUQ A;  5FW9 A;  1UHF A;  1NBE B;  1GRI A;  1KHI A;  2RA2 A;  2PTK A;  1WYD A;  2P0K A;  2PNI A;  3OYK A;  3JB9 G;  1RLP C;  4ELY C;  3M0R A;  4D8K A;  3J80 E;  1RAI B;  3CBM A;  1QQJ A;  3VKI A;  1VYT A;  5IH2 A;  2FRW A;  4H2X B;  1KG1 A;  1G5I A;  1H3Z A;  3GOX A;  3CME Q;  1QVG P;  2PU9 B;  4AFQ C;  1I07 A;  1UEC A;  4OMF B;  4M7D F;  1SRY A;  3TEG A;  2AMC A;  5I21 A;  4PKC C;  2C06 A;  3A8O B;  4YRG A;  2DEU A;  1W2B A;  4F16 A;  1B70 B;  4M75 C;  2CP5 A;  4LE9 A;  2R58 A;  2DFU A;  4KUI A;  2KVQ G;  2RK2 A;  1K4U S;  2LMJ A;  4UP8 A;  2V1R A;  4CI0 C;  5GAM j;  4TVY A;  3ZFJ A;  3SHW A;  2F2X A;  5KYY B;  4M7D A;  3CCM Q;  3G6E T;  2FRY A;  2EYQ A;  2Z0W A;  2HL3 A;  4M7A F;  1HC7 A;  1ZA1 B;  2RHS B;  1YJN Q;  4XTV A;  3EFO A;  3HRS A;  4J83 A;  3HRT A;  1CKA A;  2W0Z A;  1FXX A;  4YRK A;  2EGC A;  4AMC A;  2CJ9 A;  2DLP A;  2XHC A;  2YRV A;  2LVM A;  4PJO A;  4PLI A;  3E9G A;  1K0S A;  3PGG A;  5GMK l;  1U1T A;  4M77 B;  3TEH A;  2LTO A;  2DTO A;  2DAQ A;  2EQK A;  2DRM A;  2RI5 A;  1IRE B;  1SRM A;  3H0F A;  4PJJ A;  1TG0 A;  1QVP A;  4F17 A;  1YJN A;  4R0K A;  1WHL A;  2HSP A;  5J26 A;  3MKD A;  2M16 A;  1L0W A;  1BI0 A;  3OQ5 A;  3QKJ A;  1B7Y A;  4AFU C;  1SG5 A;  3C95 A;  3NGP A;  5FRN A;  2HSE B;  3HTZ A;  2ZPH B;  5GAO m;  1JB0 E;  1QLY A;  5E3I A;  3JSC A;  4FYY B;  2DU5 A;  1PC0 A;  2RQV A;  2KMT A;  2DIL A;  2QYZ A;  4M77 C;  4IIO A;  4YRS A;  1WI7 A;  2ZIN A;  1MMA A;  4YRI A;  5GMK e;  2DXT A;  1TUD A;  2OTJ A;  3UFG A;  2EGE A;  1WJS A;  2VAS A;  4D6W A;  1PD0 A;  1E7O A;  3C12 A;  4LVK A;  1WHM A;  2BIV A;  1S72 A;  4OMN A;  1N9R A;  3PVQ A;  1GCP A;  4X34 A;  1A0N B;  2RH2 A;  4MZT A;  1W2B S;  2DZ9 A;  1W70 A;  3UPU A;  2RMO A;  1D3B B;  1M5Q 1;  2QEX A;  4M7A D;  3M9Q A;  1PSE A;  1VQP A;  1EOV A;  4HWO A;  1VQ5 Q;  2MYS A;  1PKS A;  2KYM A;  2HEQ A;  1VYU A;  1QVG S;  3WQZ A;  2L3S A;  4OLF A;  1TOV A;  3JCM P;  1VQN T;  2EW3 A;  3L1A A;  1Q81 C;  2BE7 D;  1J3T A;  1KMN A;  1VQM Q;  1I5L A;  3P8V A;  2ECZ A;  3JCM Q;  4FU6 A;  1BIA A;  3VQW A;  2HKN A;  3OBW A;  4J9G A;  2E64 A;  1G3T A;  5I11 A;  3CPW A;  1YP5 A;  3RMQ A;  1SF9 A;  4EDU A;  4M7A E;  3CC7 T;  4J8O A;  2K9G A;  3FEO A;  1BK2 A;  2RO0 A;  1BI1 A;  2DXU A;  2LCS A;  5KH6 A;  3PCO A;  2COW A;  1ASZ A;  4QVC A;  2DDZ A;  2KEA A;  3VS6 A;  5KYX A;  3A1P A;  4FW1 A;  1R0B G;  2LQW A;  3EG0 A;  2QQA A;  1GCQ C;  3RBB B;  3J7A F;  3VQX A;  2CT4 A;  4YRN A;  3QYH B;  2KYB A;  3SFM A;  1N9W A;  2DO3 A;  1Q7Y C;  4LDW A;  1RAA B;  3JCM h;  2DL7 A;  3TCJ A;  2ABL A;  1WQW A;  3CQT A;  3X24 B;  4J9D A;  4C5E A;  5GAN j;  3HXU A;  2DXB A;  3RER A;  3HXV A;  4R56 A;  4HT8 A;  5I2M A;  1NLP C;  4HVW A;  1YCS B;  3CBP A;  3G4S Q;  5FLX E;  3FC3 A;  4BE2 A;  3HRI A;  2ARU A;  1WA7 A;  4CH3 A;  1VA7 A;  2VXF A;  1JO8 A;  4J9C A;  4FCY A;  2RM4 A;  3JCM f;  1YI2 A;  4VUB A;  3VBB A;  2OI3 A;  2FO0 A;  1KSW A;  2F69 A;  2J7I A;  4OMP A;  1BKB A;  3VS0 A;  3LX7 A;  2V26 A;  3IAL A;  5KYU A;  4M7D C;  1NJ6 A;  2JM9 A;  1NNH A;  5FWC A;  4N0A A;  3GP8 A;  3DSQ A;  2EYY A;  2LDM A;  4P74 A;  4FIB A;  3T9N A;  1VQ9 A;  1M9S A;  3OYY A;  3CCJ Q;  1FMW A;  3V7S A;  4OMM A;  4LNS A;  1VQ9 T;  2O4X B;  2G3R A;  2RHI A;  1TWB A;  3BJU A;  4LVI A;  2E6N A;  3DKM A;  4M7A B;  2J3M A;  3A5Z B;  1C1A A;  1HD3 A;  1I8F A;  1UTI A;  4C0D C;  4C0D B;  3QSU A;  1PYS A;  3G4S A;  3GBQ A;  4PLL A;  4BE0 A;  2JT4 A;  3CCL A;  3OMC A;  5HKC A;  2K57 A;  2NUT B;  3EGD A;  3UF4 A;  2ZT6 A;  1ABQ A;  5IXB A;  2VKN A;  2KI7 A;  3JCM c;  2XGT A;  2NUP B;  1OX8 A;  3PZC A;  2EYW A;  2GTO A;  1VQL T;  4AT1 B;  5KE3 A;  2WAC A;  2E70 A;  4QKU A;  4KR3 A;  2ZPE B;  2EJF A;  1VQ8 A;  2FZC B;  2L3R A;  2NYS A;  1JRI A;  2ODR D;  1OEB A;  1M2V B;  4C8Q A;  4JRK A;  4J15 A;  4LD6 A;  1FYF A;  5DLO A;  4E7I A;  2L89 A;  4PJL A;  1PM3 A;  1YJ9 A;  1USY A;  3MP1 A;  2EBP A;  4MDX A;  2HD0 A;  1ZUY A;  4K11 A;  4BI4 A;  3M4Y A;  4JJC A;  1VQK A;  5KYN A;  2LJ1 A;  1HJD A;  3LWI A;  1YWP A;  2ZTG A;  4PJO E;  5KNN A;  2X9H A;  3MF1 A;  1IZ6 A;  3JV3 A;  2MWO A;  2JMA A;  3NEM A;  2KXC A;  3HP9 A;  2ATC B;  4MML A;  4YRE A;  1UE9 A;  3LYI A;  2QA4 Q;  1VQO T;  4YRJ A;  3M57 A;  3SEM A;  1EVL A;  2ZIM A;  2M51 A;  4NL2 A;  5CKH A;  4N4I A;  3QG1 A;  4RKU E;  2KR3 A;  1EFN A;  2IY5 B;  2PVD B;  1QWF A;  4ORZ A;  2C0O A;  4A4K A;  1WNL A;  2PUK B;  1PSF A;  4H2U A;  4OMQ A;  4OB3 B;  3L2Z A;  3OS2 A;  1PRM C;  3NTK A;  1QP2 A;  2DPP B;  4LVM A;  4UC4 A;  4UP9 A;  4EPC A;  4A4G A;  2RHQ B;  4PJO D;  4M75 E;  1WLE A;  1V1C A;  1TSF A;  2L5Q A;  3JCM X;  2YUN A;  1YJW A;  3RNJ A;  1UUE A;  5LL6 S;  2FPF A;  3QWY A;  3CCU Q;  4XTW A;  5ECA A;  1J5W A;  1G8X A;  2DBK A;  5J3B A;  2NS6 A;  3TVT A;  4FSS A;  3SDZ A;  2LQK A;  2LJ3 A;  1WJR A;  1M90 U;  4XAX B;  1XJW B;  3C0C A;  3OYF A;  2X3W D;  3I56 A;  4LDX A;  4B9W A;  3SB2 A;  2YXY A;  4PFO A;  3OYC A;  3VS2 A;  3OYG A;  1VQL Q;  2ROL A;  1YNZ A;  2XKO C;  4F7U A;  3EGX A;  4J6W A;  3A5Y A;  5DLQ E;  5KYW B;  3TSZ A;  4HCK A;  2QAZ A;  4K87 A;  2COY A;  2YT6 A;  1N9S A;  1RAC B;  1QP3 A;  3NHN A;  4ESR A;  2E12 A;  2KY9 A;  2QAS A;  1CSK A;  1SHF A;  2KT8 A;  2Q7E A;  2O01 E;  4QW2 A;  1M1K R;  4RCB A;  2ZCE A;  4HVC A;  2EWN A;  1JJC A;  3CMA Q;  2KK4 A;  1UG1 A;  3CMQ A;  1YIJ Q;  1H92 A;  4TVA A;  2ZZF A;  3VS3 A;  2EVR A;  4QVD A;  4JJD A;  4IIM A;  2K2V A;  2QA4 T;  2ZT8 A;  1GL5 A;  5LJ3 j;  1Y07 A;  3CCE T;  1Y96 B;  3RKY A;  3PVL A;  1K73 U;  4CC4 B;  4JLG A;  2QA4 A;  2QTX A;  1ZSG A;  2XDD A;  3CCJ T;  5GAN 2;  2XDB A;  4F04 B;  1BI3 A;  1JXM A;  1KFZ A;  2A37 A;  2HDA A;  4Q15 A;  2EYX A;  1MMN A;  2DIG A;  5FU6 C;  2E65 A;  2LQ8 A;  5FU6 B;  3HXW A;  4E7J A;  1E1T A;  2L2P A;  1S72 Q;  3VUZ A;  2RK1 A;  3JRZ A;  5GJW B;  1VIE A;  2BTT A;  3OS5 A;  2J6O A;  5DY9 A;  4ZTU B;  2PZ1 A;  3L2V A;  1B70 A;  2I4O A;  1VQL A;  3KUF A;  4JRQ A;  4XQ3 A;  1G5V A;  1M8M A;  1Q7Y U;  1JJ2 P;  3HKS A;  3PIP A;  2LJ0 A;  1I4K 1;  3CC4 A;  4NOY A;  2DL3 A;  3CCR T;  1EQR A;  3WVD B;  4EX5 A;  3UGT A;  2RPN A;  4P72 A;  4EMK C;  1IRX A;  4TQF A;  3JCM V;  3LSS A;  1OQK A;  2AKW B;  2I0N A;  4A4E A;  4M75 G;  4J9H A;  2ZZD A;  3KXT A;  2L0A A;  4AFS C;  2MIO A;  4AG1 C;  2XG8 D;  3VYH B;  4N4G A;  2VC8 A;  3E19 A;  2ALY B;  3MO8 A;  1OOT A;  3A8M B;  3DLM A;  4Z88 A;  2CZ7 B;  1M1F A;  4G85 A;  1EVK A;  4CRI A;  3P8D A;  3HRU A;  3M4G A;  5CVI A;  1U3O A;  4KBM B;  1NJ5 A;  1OPL A;  3MEA A;  4Z02 A;  2VYT A;  4M77 D;  3E9H A;  4KH0 B;  2RQR A;  5K1P A;  2YRD A;  3RGL A;  1PNJ A;  3PMT A;  2DIQ A;  2JTE A;  1ARK A;  3QZ5 B;  1S1N A;  3VS1 A;  2YLC A;  5GAM h;  4J9F A;  5CQY A;  1FX7 A;  2E3H A;  2KNB B;  2ZT7 A;  1GCQ A;  4XTY A;  4M78 C;  2VV5 A;  3RR6 A;  4OGE A;  4HWR A;  1VQO Q;  1G83 A;  3O8V A;  3CCL Q;  1DJ7 B;  1QCF A;  4O6J A;  5M9O A;  4KRT A;  2HKQ B;  1VQ7 A;  2CUB A;  1IXD A;  3HTR A;  1BB9 A;  2DL4 A;  2F1L A;  3HHT B;  1IGU A;  2V8J A;  5C0M A;  4CH5 A;  3EG2 A;  4WJ4 A;  1H4S A;  1MGQ A;  1JJ2 A;  4X5O A;  1WHJ A;  3M58 A;  3SD4 A;  4ELZ C;  2CZ6 B;  4BDY A;  2VUB A;  4FW2 A;  4LDY A;  2ZIO A;  2K6D A;  2H8H A;  2MAM A;  1VQ9 Q;  1Y57 A;  3A98 A;  1X54 A;  2DD4 A;  3EFO B;  3PNW C;  4PJN A;  1MNE A;  2W10 A;  4M78 B;  1USY C;  3A8G B;  2RB6 A;  1K73 C;  1E6H A;  2JJ9 A;  4YRM A;  3G71 A;  2IPO B;  4PJO B;  3P8T A;  2R5A A;  2RF0 A;  3MEW A;  2VWF A;  4AG2 C;  2LNH B;  2CYZ B;  3PTA A;  1YFT A;  4TWA A;  2GQI A;  1NYG A;  3CCE A;  4LXC A;  3S3M A;  1QE0 A;  1Q82 U;  2IY5 A;  2EKO A;  2M02 A;  3CCJ A;  2RJF A;  4WTO B;  1TUC A;  2DNU A;  4RTW A;  3PIO A;  4RCC A;  2KDS A;  1G3Y A;  2CSI A;  2YSQ A;  4AFZ C;  5L23 A;  3VRZ A;  5GAM f;  3C94 A;  3EH2 A;  4JZ4 A;  3FB9 A;  1QKX A;  5LJ3 d;  3QUI A;  2H3E B;  2MCN A;  2F5K A;  2FG0 A;  2L3P A;  3CCS T;  2D1X A;  1M90 C;  2M0O A;  3HY0 A;  1B3Q A;  2XD0 A;  1X2Q A;  5GAO r;  2MI6 A;  2YUQ A;  2SRC A;  1H3H A;  2EGA A;  4N0A C;  4X9D A;  4C8Q E;  1IHV A;  2PUO B;  1AHJ B;  4K88 A;  3EH1 A;  5GAN e;  3WVE B;  1O75 A;  3REA B;  1WQ7 A;  3CCL T;  1D09 B;  2CT3 A;  3TQ7 P;  4PNO A;  3CC7 Q;  2K5L A;  4QVZ A;  3G6E Q;  4P71 A;  2CS7 A;  2CUD A;  4X9C A;  2C7I A;  5IHI A;  4F7U B;  4GLM A;  2BZY A;  3QYG B;  1NM7 A;  2XIC A;  4IUR A;  4YRR A;  2O4X A;  5GAN 7;  3EHQ A;  4B9X A;  1ACM B;  1D0X A;  4C0F A;  1BIB A;  2K79 A;  3H0I A;  1VQ8 T;  2PME A;  3G7Z A;  1WZO A;  1OU8 A;  5LJ5 d;  2E3C A;  4H2V A;  2KRO A;  3CCE Q;  1Q81 R;  1PYS B;  5I22 A;  1G3W A;  1VQN A;  1OZ2 A;  3MP8 A;  2IG0 A;  3CBO A;  1G5H A;  4BAC A;  2EPD A;  2QHS A;  1FYN A;  3MP6 A;  2CDT A;  3EGD B;  4KGX B;  4LNP A;  5LJ5 h;  4DEY A;  4E7K A;  3CMA T;  3OBY A;  4YCV A;  4EMK A;  3R6O A;  4DBR A;  1UJY A;  4KH1 B;  3A8L B;  1VQO A;  2ZPB B;  3CXC A;  1RI0 A;  1GGM A;  5KYY A;  4M7D B;  2QG9 B;  3REB B;  4F7U E;  2P0P A;  2RI3 A;  2EQU A;  1RAE B;  2RHS A;  2FHD A;  2XK0 A;  11AS A;  2QGG A;  2VVK A;  2C0I A;  1VQP Q;  1U5S A;  1EFW A;  1WIE A;  4C92 E;  1WXU A;  4C8Q G;  4E7L A;  2VGM A;  4E6R A;  1BYM A;  2GBQ A;  3E9F A;  1W4S A;  2OTJ T;  4CC7 A;  1SES A;  1RAG B;  3RIR A;  2AKW A;  3G1Z A;  1NZ9 A;  4IUV A;  3NMZ C;  3JAM E;  1KC8 R;  4RTV A;  2QQB A;  5GMK m;  4M77 F;  3VS7 A;  3L4G B;  3UAT A;  3TEE A;  4CH6 A;  1X56 A;  2CP2 A;  2FPD A;  3FIF A;  3H0H A;  5A0L A;  1T3S A;  3A5Z A;  4PJO G;  2ZPF B;  1N5Z A;  4F7U G;  2X4X A;  1OX9 A;  4L6V 5;  1W6X A;  2E1H A;  2KRN A;  3P8H A;  4P71 C;  2I4L A;  4Q6G A;  3E2U A;  1BBW A;  2NWM A;  3J81 E;  2AT1 B;  2NUT A;  4O2D A;  3RL6 A;  2EQI A;  2BUD A;  2JTM A;  3CCM T;  1BBU A;  1EZZ B;  2ZGW A;  3I5S A;  4C92 D;  1Q82 C;  1UDL A;  4HVV A;  2P0L A;  3H41 A;  2D9T A;  2ZNI A;  5GAN h;  4RTX A;  4CS2 A;  2DTI A;  1M1K C;  2E4H A;  2KE9 A;  2O2O A;  2PMF A;  2BZ8 A;  1G3S A;  1D1C A;  4EMH A;  3BDU A;  2AKL A;  2KSS A;  4XTU A;  1WJQ A;  5C52 B;  3FRN A;  3PFS A;  1KIK A;  2Y90 A;  2YLB A;  3I56 Q;  1SSH A;  2K3B A;  2IVW A;  1VOM A;  4Z89 A;  3CCR Q;  1TS9 A;  2LCL A;  1K9M C;  4C8Q F;  4RDX A;  3TUP A;  1BCM A;  2DMO A;  5EG2 A;  1IB8 A;  2OTL Q;  3IQL A;  4QQD A;  3E9I A;  1QVF P;  2YHT A;  1W66 A;  3CCQ Q;  1AVZ C;  2K3Y A;  4C0Z A;  3MQZ A;  2J6K A;  3I55 Q;  2ALY A;  4NS5 A;  3CCR A;  1E6G A;  4C92 A;  1K9M R;  1AD5 A;  3CME A;  1YI2 T;  4YTL A;  4C92 F;  2ZPI B;  1K0X A;  1D1A A;  1OU9 A;  4HCZ A;  3A74 A;  4E51 A;  2B8A A;  4E2F B;  2ARS A;  3LC0 A;  1JJC B;  3CMA A;  3CCU A;  4XK8 E;  2DL5 A;  2GGR A;  1B07 A;  2YDL A;  2LCC A;  1ASY A;  3QDR B;  2XU8 A;  1YJW Q;  3UWN A;  1WHH A;  2CZ0 B;  2ZR2 A;  2JOY A;  4WI1 A;  1C0A A;  2P84 A;  2B86 A;  4PJM A;  4P75 C;  1M3A A;  1M3C A;  1KOG A;  2FEI A;  4P3N A;  3L2U A;  3QII A;  5CAI A;  2DX1 A;  2FZG B;  3H8Z A;  5FU7 B;  4RUG A;  3NTH A;  3EG3 A;  3QHS A;  3HFN A;  5FRO A;  3U23 A;  3OW2 P;  1C0M A;  3M56 A;  3G4S T;  3V7R A;  4M78 E;  1WX6 A;  2CP7 A;  3JCM J;  2KQW A;  3CEY A;  2ZNJ A;  4P73 C;  4IUP A;  4A4F A;  4E47 A;  4M7D E;  3HFV A;  3JCM g;  1JU5 C;  2CH4 W;  2AZS A;  3V8K A;  5GAM e;  5CR2 A;  3VQY A;  3JB9 F;  1ZUU A;  1HXD A;  1NJI R;  2X51 A;  5KCH A;  4YDQ A;  5AT1 B;  1K9M U;  3A32 A;  3UA7 A;  2E3I A;  3MF2 A;  3HXX A;  2LC4 A;  4M78 D;  1PRL C;  1Q86 C;  1OZ3 A;  1OPK A;  4BW9 A;  4GBQ A;  1LPL A;  5EC7 A;  4BUG A;  3V8L A;  1ZX6 A;  3OYL A;  1NE8 A;  3LW5 E;  4RTZ A;  2XDP A;  4FYV B;  4HWS A;  2V8I A;  4YRF A;  4KQE A;  3QXE B;  4ZN1 A;  3OYD A;  2XMF A;  1NJI C;  2KRS A;  4XEM A;  1WLP B;  2IIM A;  5A0D A;  4JS5 A;  1WHG A;  3AT1 B;  1BBZ A;  1FMV A;  2V8K A;  3FJ5 A;  4M75 F;  5GAM g;  1M27 C;  1YB3 A;  1LYL A;  4ZGE B;  2ZPG B;  1MV0 B;  5IN1 A;  2C8M A;  4HVU A;  3OYJ A;  1M4Z A;  4YRO A;  1VQ6 Q;  5GAO p;  3QO8 A;  3X25 B;  3LGL A;  5GAN 5;  1SSF A;  2QDY B;  2OAU A;  3QJ6 A;  1VQ8 Q;  4MZP A;  7AT1 B;  3OYM A;  2ZT5 A;  4MDW A;  4M7A G;  3BDL A;  4DA4 A;  1EX4 A;  1QCO A;  2YWW A;  3QBY A;  2O31 A;  3DLL A;  3RKW A;  2QHT A;  1NJ8 A;  2CH4 A;  3OYH A;  2OTL T;  4A53 A;  4BD3 A;  4TQD A;  4J7F A;  1JEG A;  1KHC A;  4F14 A;  1OYX A;  1UGR B;  3NET A;  5GAM d;  1KQS A;  1B76 A;  1ZSZ A;  4GY5 A;  2DXC A;  3S3O A;  3LLR A;  4UPA A;  1EIF A;  1SRL A;  3HXZ A;  4LVL A;  1D0Z A;  5HK3 A;  3FDR A;  2A0F B;  1JXO A;  3ZBD A;  4JRP A;  1QVF A;  1Q7Y R;  2EL9 A;  4A63 B;  4DQ2 A;  4PK4 A;  3QO5 A;  1HTT A;  2JW4 A;  3CCU T;  1K9A A;  1X55 A;  4RTU A;  4L87 A;  1RUW A;  1VQM A;  2R5M A;  3M4Q A;  1ZBX A;  3CCV T;  1N8R C;  1EIY B;  5GAN g;  3ZL7 C;  4B6M A;  1VUB A;  4AH6 A;  1PD1 A;  1NYQ A;  3INZ A;  3LGF A;  1QKW A;  3EGU A;  3SWN B;  1W1F A;  1LNX A;  3RUX A;  1W2B P;  1VQ5 T;  4YPF A;  4ME7 A;  1WXB A;  2GQV A;  3JB9 H;  2GFA A;  4EMK B;  2KT1 A;  1JQQ A;  3VJP A;  4LUE A;  2ODR C;  4HXJ A;  3URG A;  3E1S A;  2J06 A;  3EFS A;  4XTZ A;  5LJ5 f;  5I2S A;  1LJO A;  4YRQ A;  3HFO A;  3CD6 A;  2ED1 A;  5LJ3 h;  1T0H A;  5IAY A;  5C51 B;  4OML A;  4J9B A;  4M78 A;  5A2Q E;  1NEG A;  2X4J A;  4Y28 E;  2DJZ A;  1M2O A;  3MEU A;  4OP0 A;  3R6N A;  4EMG A;  2M1H A;  3SWN C;  2K7A A;  2HQH A;  3CPW S;  1I1J A;  1B8A A;  3IKM B;  1U8R A;  2A3L A;  3EG9 B;  1YIT A;  3OYI A;  1U06 A;  2P5I A;  3ULR B;  2VB6 A;  3X20 B;  1X2K A;  4NL3 A;  1GFD A;  3THK A;  4K86 A;  3KFU A;  5CKD A;  1ZBJ A;  5GAN 8;  4PJO C;  2GF7 A;  4XU2 A;  1M1G A;  3G71 T;  1KQ2 A;  5CIU A;  4Y91 A;  4XEO A;  4HCC A;  2QQR A;  3TRE A;  4JZ3 A;  1TTH B;  2DET A;  1WXT A;  3LWH A;  1RI9 A;  3X26 B;  1WFW A;  1VQ4 T;  3L42 A;  2K5I A;  2R57 A;  2VGN A;  2JTF A;  4N4H A;  3ZEH A;  2Q7G A;  2ED0 A;  1QF6 A;  3OYE A;  3JB9 D;  4X1V A;  1YHQ T;  2AK5 A;  1QVF S;  2G6F X;  3OSV A;  3OY9 A;  1N8R U;  4OVA A;  2EQJ A;  2BKD N;  2LQN A;  1YJN T;  3M0P A;  2DYI A;  5HGQ A;  4JJN K;  3HSB A;  4M75 D;  2QQS A;  1AOJ A;  4TVW A;  5AYF A;  1UEB A;  3P8Y A;  1Y0M A;  1KQS P;  1YWO A;  3S6W A;  3CCM A;  2DU7 A;  4KUD K;  2DQ3 A;  4O5V A;  4JDS A;  2DVE A;  3VS4 A;  1IO6 A;  4A54 A;  4FL6 A;  1VQ7 T;  1Q82 R;  2PQW A;  4DOW A;  4NCX A;  1QMC A;  3GNG A;  1M3B A;  5IHK A;  3CCS A;  1ZA2 B;  4WF2 A;  3CC2 Q;  2CJB A;  1GFC A;  2BZX A;  3CC4 T;  1IL2 A;  3HRK A;  2O9V A;  5FWB A;  3PT9 A;  3I9Q A;  1N6A A;  1V29 B;  3RES A;  2GFU A;  2K2M A;  2HQX A;  2RHU A;  1UGV A;  2MOX A;  1S72 T;  4DBQ A;  2HCK A;  4HWP A;  3A7A A;  4HWT A;  2GTJ A;  1VQM T;  3R07 A;  1YN8 A;  3NTI A;  4H2X A;  1Y7X A;  3V7C A;  1R77 A;  2MF2 A;  1Z7M A;  3F70 A;  4YCU A;  3CME T;  3LH0 A;  4PJO F;  1X6O A;  3D7S B;  2ZCF B;  1R0C B;  2COZ A;  4YRL A;  2CP0 A;  2ZAE A;  3FLG A;  4P5N A;  1AT1 B;  3CCV Q;  3VV0 A;  1YIJ T;  1NJI U;  2X3X D;  1B34 A;  1NYF A;  4ZGJ B;  2QI2 A;  4P72 C;  3JB9 J;  3TU4 K;  3BY7 A;  1YIJ A;  1Q81 U;  1P92 A;  1CKB A;  4L5G A;  2LP5 A;  5GAO l;  2DVJ A;  2G4C A;  1YI2 Q;  3JCM e;  4BE1 A;  3RF1 A;  3NPF A;  1G2B A;  2QXF A;  3OA6 A;  2DM1 A;  1T3L A;  3I5R A;  4H2W A;  1Q86 U;  3L4G A;  2SEM A;  1M30 A;  2F2W A;  4C92 B;  1G51 A;  3QJY A;  1IGQ A;  2EJ9 A;  4M7A C;  5D6X A;  2K3X A;  3BFM A;  3DB3 A;  3FJP A;  1H4V B;  2C0T A;  2LZ6 B;  1AZG B;  4YCW A;  4HA8 A;  3EAE A;  1D1B A;  4TVR A;  4J6X A;  2ZZE A;  3MCA B;  2NLU A;  4FSX A;  3KBG A;  4HKE A;  5KCO A;  3AHU A;  5J39 A;  1NJ1 A;  2K4Y A;  4J6Y A;  4JS4 A;  2O88 A;  1UJ0 A;  1MV3 A;  3JCM W;  2CP6 A;  1VYV A;  1B7Y B;  3UDC A;  1OV3 A;  2Q7H A;  1K8A U;  2E5K A;  4M4Z A;  1TUG B;  3G6E A;  4YP0 A;  1X27 A;  2WSE E;  3QTC A;  1VQ6 A;  5IHN A;  3OB9 A;  4R55 A;  1N27 A;  2CZ1 B;  2WSF E;  2HMA A;  2Y4Y A;  3MEY A;  2XI9 A;  1UHC A;  1F1B B;  4C8Q C;  2JS0 A;  2MK5 A;  2AIR B;  2QEX T;  4P3P A;  1AZE A;  1ZHI A;  4M77 E;  2RHX A;  4KT0 E;  1X75 C;  2JXB A;  2ZZG A;  4M75 A;  3M5A A;  4RG8 A;  4G84 A;  2A08 A;  2M9U A;  4CC2 A;  1E22 A;  4H2T A;  1Q86 R;  1UGQ B;  1NG2 A;  1QWE A;  5GMK h;  3H9N A;  2YUP A;  4ZTF A;  3O5Z A;  2VXE A;  1X69 A;  2EAY A;  2QEX Q;  3CC7 A;  2I4N A;  2X4W A;  1YFS A;  4IUT A;  3GIB A;  3M53 A;  1H4Q A;  4FT4 A;  1KMM A;  4KR2 A;  2L8D A;  1VQK Q;  2J3L A;  3HY1 A;  2E10 A;  4OMO A;  1ZLM A;  4MMK A;  1LCK A;  5GAN d;  2J6F A;  1NPR A;  3VYG A;  3TEH B;  1FMK A;  1Y71 A;  2X4Y A;  2E41 A;  2LRQ A;  1E1O A;  2ZXF A;  5HCK A;  1H4T A;  2V1Q A;  4BY6 B;  3CXC P;  1FWZ A;  2DYB A;  4CS3 A;  4RTY A;  4E7H A;  3N5B B;  1WPY A;  5IXF A;  4LDV A;  5LJ3 g;  1Q95 G;  2AZV A;  5GAN f;  2DRK A;  4DBH A;  2JZ2 A;  1AWX A;  2RHZ A;  2E5Q A;  2HBW A;  4PL6 A;  4RTT A;  3UT1 A;  2GNC A;  4ZTJ A;  5GAO q;  2ZR3 A;  3VS5 A;  1VQ4 Q;  4LVJ A;  3ME9 A;  3OYN A;  2AMC B;  4TTV A;  1VQ7 Q;  2RN8 A;  3VQV A;  3RDV A;  4J5Y A;  3JB9 I;  1X01 A;  4JRI A;  1KC8 U;  2RJD A;  1UGP B;  1M8V A;  1Z7N A;  4BWA A;  2LT1 A;  1X6B A;  2Q5H A;  3CCV A;  2FVU A;  4OB0 B;  5FU7 C;  2PVG B;  4C92 G;  5LJ3 e;  2JMC A;  1KJW A;  1T0J A;  3W3S A;  5D6W A;  1D3B A;  4P3O A;  5CKB A;  3GPL A;  3PE0 A;  3HFZ B;  2E5A A;  3CCQ T;  2DA9 A;  4FYX B;  5CO7 A;  2OAW A;  3VU3 C;  3KFV A;  1BCO A;  3OYB A;  3G71 Q;  1ZSZ B;  2AKK A;  3EG9 A;  2DD5 A;  2ESW A;  2KBT A;  2RQW A;  3CXC S;  4J7I A;  2RQU A;  2LX7 A;  1YFR A;  2FZK B;  1RAD B;  4XU3 A;  4C5H A;  4RMO A;  4MZM A;  4CH4 A;  2QHU A;  2D6F A;  4WCI A;  3CCS Q;  1KQ1 A;  5D6Y A;  5C53 B;  1XOV A;  2QTV A;  5GAN 4;  2I2L A;  1YIT T;  4ATO A;  1YJ9 T;  4IKF A;  3JCM d;  4ZNX A;  3RKX A;  3JCM b;  2OX7 A;  1EIY A;  2FYK A;  1SHG A;  1JJ2 S;  2MWP A;  3SWN A;  4PFP A;  5CK9 A;  4M78 G;  4BY6 C;  3QWX X;  1WDX A;  4ZIB A;  1U1S A;  2EYZ A;  3HPW A;  5GAN 6;  4C0G A;  4A4H A;  4M78 F;  1YFN A;  1QCN A;  3A7R A;  2JN0 A;  1ATI A;  2Y4X A;  1SER A;  4XU0 A;  1RAH B;  1YGB A;  1MND A;  3REX A;  3CC2 A;  2GCX A;  2CIM A;  3I7F A;  3CC4 Q;  3M0T A;  4BDZ A;  5IT9 E;  3CC2 T;  3NFC A;  3S3N A;  3I35 A;  1GBR A;  4BI8 B;  2NUZ A;  2QGF B;  2ART A;  2RJE A;  4PFZ A;  5F5W A;  4QQG A;  2CP3 A;  1XTD A;  3MHX A;  1BU1 A;  5GMK i;  4P74 C;  3PMI A;  2J05 A;  1JBM A;  1VIF A;  2DL8 A;  4D8D A;  4C92 C;  4XU1 A;  4KUL A;  4ZGD B;  1BI2 A;  4DPG A;  3M4P A;  4C5G A;  1HSQ A;  3OS0 A;  1H8K A;  2P4T A;  2DEQ A;  1Z9Q A;  4QQ6 A;  1UB4 A;  2RHY A;  4CS4 A;  2P4R A;  2A8E A;  2D8J A;  3M55 A;  1YCY A;  4Y92 A;  3VRY A;  3OS1 A;  5CQX A;  2KXD A;  3CPF A;  1WGS A;  3MJX A;  1PWT A;  1ADY A;  1K73 R;  1AWO A;  1NYR A;  4DEX A;  4E7Z A;  2KRM A;  4H2Y A;  3C4S A;  2CRE A;  2D0N A;  1IHW A;  4J9E A;  2HAX A;  1ADJ A;  3HL8 A;  4HT9 A;  1WHK A;  2NUP A;  1XQH A;  4Q5W A;  5KYU B;  1NPP A;  1GXI E;  1PKT A;  3QZ9 B;  3LSQ A;  2L3Q A;  3QO3 A;  4LN2 A;  2I4M A;  1PCX A;  2PVO B;  3M0Q A;  4JJB A;  4L59 A;  3OYA A;  2MMP A;  1ZUK A;  3EG1 A;  2RJC A;  5KYW A;  4J9I A;  3RAC A;  2OJ2 A;  1TU0 B;  3PCO B;  3LH5 A;  1TXQ A;  3BW1 A;  4F7U F;  1KD1 C;  4M7A A;  3CD6 T;  2K5F A;  3H6Z A;  1WU7 A;  4QT7 A;  4OGC A;  3IG2 A;  3OW2 S;  4XTX A;  2DZC A;  3MEV A;  2OTL A;  3CD6 Q;  1M90 R;  5C6S A;  2KGT A;  3EHR A;  5KE2 A;  4YRP A;  1X43 A;  1H64 1;  1YJ9 Q;  1PG5 B;  1QW1 A;  1X2H A;  1YIT Q;  5D7U A;  1B7T A;  2QK0 A;  4ZN3 A;  2ENM A;  4EIK A;  5KYX B;  2MPX C;  5CKF A;  2DER A;  4YRC A;  5CKE A;  1K76 A;  2F2V A;  4EO4 A;  2CGH A;  1KD1 R;  2D0Q B;  3WXM B;  4RMF A;  5LJ5 j;  1K1Z A;  4LDU A;  1N8R R;  3CPW P;  2P0Q A;  1SPK A;  1KK7 A;  3NEN A;  3GF5 A;  4FM4 B;  2EIF A;  1VQ6 T;  3A31 A;  3UH0 A;  5HK0 A;  3X28 B;  1KQS S;  3M59 A;  4E7S A;  2JNG A;  2M0Y A;  1YHQ A;  2DBM A;  2CKK A;  4M77 A;  4RQF A;  4DBF A;  4DOV A;  1VQ4 A;  1RAB B;  9ATC B;  1YHQ Q;  4GLK A;  3QNE A;  3I55 T;  2WSC E;  2EQM A;  1VQN Q;  3IKL A;  1RAF B;  4HCB A;  3OW2 A;  1NLO C;  4H02 A;  1I81 A;  2FB7 A;  4JUV A;  1OI1 A;  3ER0 A;  1XNI A;  3GNF B;  4JPB W;  2LT4 A;  5GMK j;  2QDL A;  1YJW T;  4ZTZ B;  4PHC A;  4PG3 A;  5GJV B;  3Q1J A;  4C8Q D;  1R8O B;  3ICA A;  4OF1 A;  2Q5I A;  4RG2 A;  1NJ2 A;  4H2S A;  2RHQ A;  3MET A;  2XID A;  1AWJ A;  1YBY A;  1RLQ C;  5L8R E;  4OB1 B;  1GBQ A;  4FT2 A;  3I56 T;  3UGQ A;  5LJ3 f;  2EFI A;  4M7D D;  1WYX A;  4CC3 A;  4YRT A;  3M54 A;  1K8A R;  4ANJ A;  4KGV B;  5DM7 R;  3REU A;  2YRC A;  4LD9 K;  2DK3 A;  2D8H A;  4M75 B;  3L2W A;  3ERR A;  1E24 A;  4Z8A A;  4II1 A;  3A7U A;  2QQ9 A;  4YYE A;  3EFR A;  4KGZ B;  8ATC B;  2HQE A;  3OMG A;  3L2Q A;  1VQZ A;  4C5I A;  2X35 A;  3VUB A;  4LUD A;  5A0G A;  1M1K U;  1ABO A;  1X2G A;  2CJA A;  1ZSZ C;  2O9S A;  3BE3 A;  1I5O B;  5ELN A;  5LJ5 g;  1K8A C;  3A8H B;  2DKG A;  3MPU B;  3DB4 A;  2HNI A;  4OB2 B;  3TSW A;  2CSQ A;  1RIQ A;  3OD1 A; 
#chains in the Genus database with same CATH homology
 2QHV A;  5GAO n;  1B34 B;  1UGS B;  4HT4 A;  4P73 A;  2HBP A;  4C8Q B;  4TVA B;  4WJ3 M;  2F5T X;  3L2R A;  4BI3 A;  4IUU A;  1KD1 U;  3NEL A;  2FL7 A;  2DQ0 A;  3HFZ A;  4M77 G;  4M7D G;  5LJ5 e;  2LNV A;  1QVG A;  4UP7 A;  3ASK A;  4P75 A;  2JUF A;  3QO7 A;  2AHJ B;  4V2S A;  5FRM A;  3CCQ A;  3GLX A;  2LX9 A;  3RMS A;  4JLI A;  1Y96 A;  2JVV A;  1MHN A;  12AS A;  5ELO A;  1VQK T;  2KAF A;  1TH7 A;  2E6Z A;  3P8B B;  5CCA A;  3HXY A;  1LOJ A;  2DTH A;  1KC8 C;  1RL2 A;  2H3J A;  2EJG A;  2XTI A;  2RD1 A;  3QPH A;  5GAN 3;  3OSS C;  4BB7 A;  1VQP T;  1VQ5 A;  3V8J A;  3I55 A;  5K1X A;  4RQE A;  2A7Y A;  1ZQ1 A;  1HK9 A;  2RI2 A;  5HY6 A;  1SET A;  1O9S A;  4IUQ A;  1KHI A;  2RA2 A;  1WYD A;  2P0K A;  3JB9 G;  3OYK A;  4ELY C;  3J80 E;  3CBM A;  3VKI A;  4H2X B;  1KG1 A;  1G5I A;  1H3Z A;  3GOX A;  2PU9 B;  4OMF B;  4M7D F;  1SRY A;  3TEG A;  2AMC A;  5I21 A;  4PKC C;  2C06 A;  3A8O B;  4YRG A;  1W2B A;  1B70 B;  4M75 C;  2R58 A;  4KUI A;  2KVQ G;  2RK2 A;  4UP8 A;  4CI0 C;  5GAM j;  4TVY A;  3ZFJ A;  4M7D A;  3G6E T;  2EYQ A;  4M7A F;  1HC7 A;  2RHS B;  4XTV A;  3HRS A;  4J83 A;  3HRT A;  1FXX A;  4YRK A;  2CJ9 A;  2XHC A;  2YRV A;  2LVM A;  4PJO A;  4PLI A;  3E9G A;  3PGG A;  5GMK l;  1U1T A;  4M77 B;  3TEH A;  2LTO A;  2DTO A;  2DAQ A;  2EQK A;  2RI5 A;  1IRE B;  1QVP A;  1YJN A;  5J26 A;  2M16 A;  1L0W A;  1BI0 A;  3OQ5 A;  3QKJ A;  1B7Y A;  3C95 A;  5FRN A;  3HTZ A;  2ZPH B;  5GAO m;  1JB0 E;  5E3I A;  3JSC A;  2DU5 A;  2KMT A;  4M77 C;  4YRS A;  2ZIN A;  4YRI A;  5GMK e;  2DXT A;  2OTJ A;  3UFG A;  1WJS A;  4D6W A;  3C12 A;  4LVK A;  2BIV A;  1S72 A;  1N9R A;  4X34 A;  2RH2 A;  4MZT A;  1W2B S;  2DZ9 A;  3UPU A;  1D3B B;  1M5Q 1;  2QEX A;  4M7A D;  3M9Q A;  1PSE A;  1VQP A;  1EOV A;  4HWO A;  1QVG S;  3WQZ A;  4OLF A;  3JCM P;  1VQN T;  3L1A A;  1Q81 C;  1KMN A;  1I5L A;  3P8V A;  3JCM Q;  4FU6 A;  1BIA A;  3VQW A;  3OBW A;  2E64 A;  1G3T A;  3CPW A;  3RMQ A;  4EDU A;  4M7A E;  3CC7 T;  4J8O A;  3FEO A;  2RO0 A;  1BI1 A;  2DXU A;  5KH6 A;  3PCO A;  1ASZ A;  4QVC A;  2DDZ A;  2QQA A;  3J7A F;  3VQX A;  4YRN A;  3QYH B;  3SFM A;  1N9W A;  2DO3 A;  1Q7Y C;  4LDW A;  3JCM h;  3TCJ A;  1WQW A;  3X24 B;  5GAN j;  4C5E A;  3HXU A;  2DXB A;  3RER A;  3HXV A;  4R56 A;  4HT8 A;  5I2M A;  3CBP A;  5FLX E;  3FC3 A;  4BE2 A;  3HRI A;  2ARU A;  4CH3 A;  2VXF A;  2RM4 A;  3JCM f;  1YI2 A;  4VUB A;  3VBB A;  2F69 A;  1BKB A;  3LX7 A;  3IAL A;  4M7D C;  1NJ6 A;  1NNH A;  4N0A A;  3GP8 A;  3DSQ A;  4P74 A;  2LDM A;  4FIB A;  3T9N A;  1VQ9 A;  1M9S A;  3OYY A;  3V7S A;  4LNS A;  1VQ9 T;  2O4X B;  2G3R A;  2RHI A;  3BJU A;  4LVI A;  2E6N A;  3DKM A;  4M7A B;  2J3M A;  3A5Z B;  1I8F A;  4C0D C;  4C0D B;  3QSU A;  1PYS A;  3G4S A;  4PLL A;  4BE0 A;  3CCL A;  3OMC A;  5HKC A;  2K57 A;  2ZT6 A;  2XGT A;  3JCM c;  3PZC A;  1VQL T;  5KE3 A;  2WAC A;  2E70 A;  4KR3 A;  2ZPE B;  1VQ8 A;  2EJF A;  2L3R A;  2ODR D;  1JRI A;  4C8Q A;  4JRK A;  4J15 A;  4LD6 A;  1FYF A;  5DLO A;  4E7I A;  2L89 A;  1YJ9 A;  1USY A;  3MP1 A;  4MDX A;  2HD0 A;  4BI4 A;  3M4Y A;  1VQK A;  3LWI A;  2ZTG A;  4PJO E;  5KNN A;  3MF1 A;  1IZ6 A;  2MWO A;  3NEM A;  3HP9 A;  4MML A;  4YRE A;  3LYI A;  1VQO T;  4YRJ A;  3M57 A;  1EVL A;  2ZIM A;  4NL2 A;  5CKH A;  4N4I A;  3QG1 A;  4RKU E;  2IY5 B;  2PVD B;  4A4K A;  1WNL A;  2PUK B;  1PSF A;  4H2U A;  4OB3 B;  3L2Z A;  3OS2 A;  3NTK A;  1QP2 A;  2DPP B;  4LVM A;  4UP9 A;  4UC4 A;  4EPC A;  4A4G A;  2RHQ B;  4PJO D;  4M75 E;  1WLE A;  2L5Q A;  3JCM X;  1YJW A;  5LL6 S;  4XTW A;  1J5W A;  5J3B A;  2NS6 A;  3SDZ A;  2LQK A;  1WJR A;  1M90 U;  4XAX B;  4LDX A;  3OYF A;  3I56 A;  4B9W A;  3SB2 A;  3OYC A;  3OYG A;  2XKO C;  4F7U A;  4J6W A;  3A5Y A;  5DLQ E;  4K87 A;  1N9S A;  1QP3 A;  2E12 A;  2KY9 A;  2Q7E A;  2O01 E;  4QW2 A;  4RCB A;  2ZCE A;  4HVC A;  2EWN A;  1JJC A;  3CMQ A;  2KK4 A;  4TVA A;  2ZZF A;  4QVD A;  2K2V A;  2QA4 T;  2ZT8 A;  5LJ3 j;  1Y07 A;  3CCE T;  1Y96 B;  3RKY A;  1K73 U;  4JLG A;  2QA4 A;  2QTX A;  2XDD A;  3CCJ T;  5GAN 2;  2XDB A;  1BI3 A;  4Q15 A;  2DIG A;  2E65 A;  2LQ8 A;  5FU6 C;  5FU6 B;  3HXW A;  4E7J A;  1E1T A;  3VUZ A;  2RK1 A;  3JRZ A;  1VIE A;  3OS5 A;  5DY9 A;  4ZTU B;  3L2V A;  1B70 A;  2I4O A;  1VQL A;  3KUF A;  4JRQ A;  4XQ3 A;  1G5V A;  1Q7Y U;  3HKS A;  3PIP A;  3CC4 A;  1I4K 1;  4NOY A;  3CCR T;  1EQR A;  3WVD B;  4EX5 A;  3UGT A;  4TQF A;  4P72 A;  4EMK C;  3JCM V;  3LSS A;  2AKW B;  4A4E A;  4M75 G;  3KXT A;  2ZZD A;  2XG8 D;  3VYH B;  4N4G A;  2VC8 A;  3E19 A;  2ALY B;  3MO8 A;  3A8M B;  3DLM A;  2CZ7 B;  1M1F A;  4G85 A;  1EVK A;  4CRI A;  3P8D A;  3HRU A;  3M4G A;  5CVI A;  4KBM B;  1NJ5 A;  3MEA A;  4Z02 A;  2VYT A;  4M77 D;  3E9H A;  5K1P A;  3RGL A;  3PMT A;  2DIQ A;  3QZ5 B;  2YLC A;  5GAM h;  5CQY A;  1FX7 A;  2ZT7 A;  4XTY A;  4M78 C;  2VV5 A;  4OGE A;  4HWR A;  3O8V A;  1DJ7 B;  4O6J A;  5M9O A;  1VQ7 A;  3HHT B;  2V8J A;  5C0M A;  4CH5 A;  4WJ4 A;  1H4S A;  1MGQ A;  1JJ2 A;  4X5O A;  3M58 A;  3SD4 A;  4ELZ C;  2CZ6 B;  4BDY A;  2VUB A;  4LDY A;  2ZIO A;  2MAM A;  1X54 A;  2DD4 A;  3PNW C;  4M78 B;  1USY C;  3A8G B;  2RB6 A;  1K73 C;  4YRM A;  3G71 A;  4PJO B;  3P8T A;  2R5A A;  3MEW A;  2CYZ B;  3PTA A;  1YFT A;  4TWA A;  3CCE A;  3S3M A;  1QE0 A;  1Q82 U;  2IY5 A;  2EKO A;  3CCJ A;  2RJF A;  3PIO A;  4RCC A;  2KDS A;  1G3Y A;  5GAM f;  3C94 A;  3FB9 A;  5LJ3 d;  3QUI A;  2F5K A;  3CCS T;  1M90 C;  2M0O A;  3HY0 A;  2XD0 A;  5GAO r;  2MI6 A;  4N0A C;  4X9D A;  4C8Q E;  2PUO B;  1AHJ B;  4K88 A;  5GAN e;  3WVE B;  1O75 A;  1WQ7 A;  3CCL T;  4PNO A;  2K5L A;  4QVZ A;  4P71 A;  2CS7 A;  4X9C A;  2C7I A;  4F7U B;  3QYG B;  2XIC A;  4YRR A;  4IUR A;  2O4X A;  5GAN 7;  4B9X A;  4C0F A;  1BIB A;  1VQ8 T;  2PME A;  3G7Z A;  5LJ5 d;  2E3C A;  4H2V A;  1PYS B;  1G3W A;  1VQN A;  1OZ2 A;  3MP8 A;  2IG0 A;  3CBO A;  1G5H A;  4BAC A;  2QHS A;  3MP6 A;  5LJ5 h;  4E7K A;  3CMA T;  3OBY A;  4YCV A;  4EMK A;  3R6O A;  3A8L B;  1VQO A;  2ZPB B;  3CXC A;  1RI0 A;  1GGM A;  4M7D B;  4F7U E;  2P0P A;  2RI3 A;  2EQU A;  2RHS A;  2FHD A;  2XK0 A;  11AS A;  1EFW A;  4C92 E;  4C8Q G;  4E7L A;  2VGM A;  1BYM A;  3E9F A;  1W4S A;  2OTJ T;  1SES A;  3RIR A;  2AKW A;  3G1Z A;  1NZ9 A;  4IUV A;  3JAM E;  2QQB A;  5GMK m;  4M77 F;  3L4G B;  3TEE A;  4CH6 A;  1X56 A;  3FIF A;  5A0L A;  3A5Z A;  4PJO G;  2ZPF B;  4F7U G;  2X4X A;  3P8H A;  4L6V 5;  2E1H A;  4P71 C;  2I4L A;  4Q6G A;  1BBW A;  3J81 E;  4O2D A;  3RL6 A;  2BUD A;  2JTM A;  3CCM T;  1BBU A;  2ZGW A;  4C92 D;  1Q82 C;  2P0L A;  2D9T A;  2ZNI A;  5GAN h;  4CS2 A;  2DTI A;  1M1K C;  2PMF A;  1G3S A;  4EMH A;  3BDU A;  2KSS A;  4XTU A;  1WJQ A;  5C52 B;  3FRN A;  3PFS A;  2Y90 A;  2YLB A;  2IVW A;  2LCL A;  1K9M C;  4C8Q F;  4RDX A;  3TUP A;  5EG2 A;  4QQD A;  3E9I A;  1W66 A;  2YHT A;  2K3Y A;  4C0Z A;  3MQZ A;  2ALY A;  4NS5 A;  3CCR A;  4C92 A;  3CME A;  1YI2 T;  4YTL A;  4C92 F;  2ZPI B;  4HCZ A;  3A74 A;  4E51 A;  2B8A A;  2ARS A;  3LC0 A;  1JJC B;  3CMA A;  3CCU A;  4XK8 E;  2LCC A;  1ASY A;  3QDR B;  2XU8 A;  3UWN A;  2CZ0 B;  2ZR2 A;  2JOY A;  4WI1 A;  1C0A A;  4P75 C;  1KOG A;  4P3N A;  3L2U A;  3QII A;  5CAI A;  3H8Z A;  5FU7 B;  3NTH A;  3QHS A;  3HFN A;  5FRO A;  3M56 A;  3G4S T;  3V7R A;  4M78 E;  3JCM J;  2KQW A;  3CEY A;  2ZNJ A;  4P73 C;  4IUP A;  4A4F A;  4E47 A;  4M7D E;  3HFV A;  3JCM g;  5CR2 A;  3V8K A;  5GAM e;  3VQY A;  3JB9 F;  1HXD A;  5KCH A;  4YDQ A;  1K9M U;  3A32 A;  3MF2 A;  3HXX A;  2LC4 A;  4M78 D;  1Q86 C;  1OZ3 A;  4BW9 A;  4BUG A;  3V8L A;  3OYL A;  1NE8 A;  3LW5 E;  2XDP A;  4HWS A;  2V8I A;  4YRF A;  4KQE A;  3QXE B;  4ZN1 A;  3OYD A;  1NJI C;  4XEM A;  5A0D A;  4JS5 A;  2V8K A;  4M75 F;  5GAM g;  1YB3 A;  1LYL A;  4ZGE B;  2ZPG B;  5IN1 A;  2C8M A;  3OYJ A;  4YRO A;  1M4Z A;  5GAO p;  3QO8 A;  3X25 B;  3LGL A;  5GAN 5;  1SSF A;  2QDY B;  2OAU A;  3QJ6 A;  4MZP A;  3OYM A;  2ZT5 A;  4MDW A;  4M7A G;  3BDL A;  4DA4 A;  3QBY A;  3DLL A;  3RKW A;  2QHT A;  1NJ8 A;  3OYH A;  2OTL T;  4A53 A;  4BD3 A;  4TQD A;  4J7F A;  1KHC A;  1OYX A;  1UGR B;  3NET A;  5GAM d;  1KQS A;  1B76 A;  4GY5 A;  2DXC A;  3S3O A;  3LLR A;  4UPA A;  1EIF A;  3HXZ A;  4LVL A;  5HK3 A;  3FDR A;  3ZBD A;  4JRP A;  1QVF A;  2EL9 A;  4DQ2 A;  3QO5 A;  1HTT A;  3CCU T;  1X55 A;  4L87 A;  1VQM A;  2R5M A;  3M4Q A;  1ZBX A;  3CCV T;  1N8R C;  1EIY B;  5GAN g;  4AH6 A;  1VUB A;  1NYQ A;  3INZ A;  3LGF A;  3SWN B;  1VQ5 T;  1LNX A;  3RUX A;  4YPF A;  4ME7 A;  2GQV A;  3JB9 H;  2GFA A;  4EMK B;  3VJP A;  2ODR C;  3URG A;  3E1S A;  3EFS A;  4XTZ A;  5LJ5 f;  5I2S A;  1LJO A;  4YRQ A;  3HFO A;  3CD6 A;  5LJ3 h;  5IAY A;  5C51 B;  4M78 A;  5A2Q E;  2X4J A;  4Y28 E;  2DJZ A;  3MEU A;  4OP0 A;  4EMG A;  2M1H A;  3SWN C;  3CPW S;  1B8A A;  3IKM B;  1U8R A;  2A3L A;  1YIT A;  3OYI A;  2P5I A;  3X20 B;  4NL3 A;  4K86 A;  3KFU A;  5CKD A;  5GAN 8;  4PJO C;  2GF7 A;  4XU2 A;  1M1G A;  3G71 T;  1KQ2 A;  5CIU A;  4Y91 A;  4XEO A;  4HCC A;  2QQR A;  3TRE A;  3LWH A;  3X26 B;  1VQ4 T;  3L42 A;  2K5I A;  2R57 A;  2VGN A;  2JTF A;  4N4H A;  3ZEH A;  2Q7G A;  1QF6 A;  3OYE A;  3JB9 D;  1YHQ T;  1QVF S;  3OSV A;  3OY9 A;  1N8R U;  4OVA A;  2EQJ A;  2BKD N;  1YJN T;  5HGQ A;  4JJN K;  3HSB A;  4M75 D;  2QQS A;  4TVW A;  5AYF A;  1UEB A;  3P8Y A;  3CCM A;  3S6W A;  2DU7 A;  4KUD K;  2DQ3 A;  4O5V A;  4JDS A;  2DVE A;  4A54 A;  4FL6 A;  1VQ7 T;  2PQW A;  4DOW A;  4NCX A;  3GNG A;  3CCS A;  4WF2 A;  2CJB A;  3CC4 T;  1IL2 A;  3HRK A;  3PT9 A;  1N6A A;  1V29 B;  3RES A;  2GFU A;  2HQX A;  2RHU A;  1S72 T;  4HWP A;  3A7A A;  4HWT A;  1VQM T;  3R07 A;  3NTI A;  4H2X A;  1Y7X A;  3V7C A;  2MF2 A;  1Z7M A;  3F70 A;  4YCU A;  3CME T;  3LH0 A;  4PJO F;  1X6O A;  2ZCF B;  4YRL A;  3FLG A;  4P5N A;  3VV0 A;  1YIJ T;  1NJI U;  1B34 A;  4ZGJ B;  4P72 C;  2QI2 A;  3JB9 J;  3TU4 K;  3BY7 A;  1YIJ A;  1Q81 U;  1P92 A;  4L5G A;  5GAO l;  2G4C A;  3JCM e;  4BE1 A;  3RF1 A;  2QXF A;  3OA6 A;  4H2W A;  1Q86 U;  3L4G A;  4C92 B;  1G51 A;  3QJY A;  2EJ9 A;  4M7A C;  5D6X A;  2K3X A;  3BFM A;  3DB3 A;  3FJP A;  1H4V B;  4YCW A;  4HA8 A;  3EAE A;  4TVR A;  4J6X A;  2ZZE A;  3MCA B;  2NLU A;  4FSX A;  3KBG A;  4HKE A;  5KCO A;  3AHU A;  5J39 A;  1NJ1 A;  2K4Y A;  4J6Y A;  4JS4 A;  3JCM W;  1B7Y B;  3UDC A;  2Q7H A;  1K8A U;  3G6E A;  4YP0 A;  2WSE E;  3QTC A;  1VQ6 A;  3OB9 A;  4R55 A;  1N27 A;  2CZ1 B;  2WSF E;  2Y4Y A;  3MEY A;  2XI9 A;  4C8Q C;  2QEX T;  4P3P A;  1ZHI A;  4M77 E;  2RHX A;  4KT0 E;  1X75 C;  2ZZG A;  4M75 A;  3M5A A;  4RG8 A;  4G84 A;  2M9U A;  1E22 A;  4H2T A;  1UGQ B;  5GMK h;  4ZTF A;  2VXE A;  2EAY A;  3CC7 A;  2I4N A;  2X4W A;  1YFS A;  4IUT A;  3GIB A;  3M53 A;  1H4Q A;  4FT4 A;  1KMM A;  4KR2 A;  2L8D A;  2J3L A;  3HY1 A;  2E10 A;  4MMK A;  5GAN d;  1NPR A;  3VYG A;  3TEH B;  1Y71 A;  2X4Y A;  2E41 A;  2LRQ A;  1E1O A;  2ZXF A;  1H4T A;  4BY6 B;  1FWZ A;  4CS3 A;  4E7H A;  3N5B B;  1WPY A;  4LDV A;  5LJ3 g;  5GAN f;  2JZ2 A;  2RHZ A;  2E5Q A;  4PL6 A;  3UT1 A;  4ZTJ A;  5GAO q;  2ZR3 A;  4LVJ A;  3ME9 A;  3OYN A;  2AMC B;  4TTV A;  3VQV A;  4J5Y A;  3JB9 I;  1X01 A;  4JRI A;  1KC8 U;  2RJD A;  1UGP B;  1M8V A;  1Z7N A;  4BWA A;  2LT1 A;  2Q5H A;  3CCV A;  2FVU A;  4OB0 B;  5FU7 C;  2PVG B;  4C92 G;  5LJ3 e;  3W3S A;  5D6W A;  1D3B A;  4P3O A;  5CKB A;  3GPL A;  3HFZ B;  2E5A A;  3CCQ T;  5CO7 A;  3VU3 C;  3OYB A;  2DD5 A;  3CXC S;  4J7I A;  1YFR A;  4XU3 A;  4C5H A;  4RMO A;  4MZM A;  4CH4 A;  2QHU A;  2D6F A;  1KQ1 A;  5D6Y A;  5C53 B;  1XOV A;  5GAN 4;  2I2L A;  1YIT T;  4ATO A;  1YJ9 T;  4IKF A;  3JCM d;  3RKX A;  3JCM b;  1EIY A;  2FYK A;  1JJ2 S;  2MWP A;  3SWN A;  5CK9 A;  4M78 G;  4BY6 C;  4ZIB A;  1U1S A;  3HPW A;  5GAN 6;  4C0G A;  4A4H A;  4M78 F;  3A7R A;  2JN0 A;  1ATI A;  2Y4X A;  1SER A;  4XU0 A;  1YGB A;  3REX A;  3CC2 A;  2GCX A;  2CIM A;  3I7F A;  4BDZ A;  5IT9 E;  3CC2 T;  3NFC A;  3S3N A;  4BI8 B;  2ART A;  2RJE A;  5F5W A;  4QQG A;  1XTD A;  3MHX A;  5GMK i;  4P74 C;  3PMI A;  1JBM A;  1VIF A;  4C92 C;  4XU1 A;  4KUL A;  4ZGD B;  1BI2 A;  4DPG A;  3M4P A;  4C5G A;  3OS0 A;  2P4T A;  2DEQ A;  4QQ6 A;  1UB4 A;  2RHY A;  4CS4 A;  2A8E A;  3M55 A;  1YCY A;  3OS1 A;  5CQX A;  3CPF A;  1WGS A;  1ADY A;  1NYR A;  4H2Y A;  3C4S A;  2HAX A;  1ADJ A;  3HL8 A;  4HT9 A;  1XQH A;  4Q5W A;  1NPP A;  1GXI E;  3QZ9 B;  3LSQ A;  3QO3 A;  2I4M A;  4L59 A;  2PVO B;  3OYA A;  2MMP A;  2RJC A;  3RAC A;  3PCO B;  3BW1 A;  4F7U F;  1KD1 C;  4M7A A;  3CD6 T;  2K5F A;  3H6Z A;  1WU7 A;  4OGC A;  3IG2 A;  3OW2 S;  4XTX A;  2DZC A;  3MEV A;  2OTL A;  5C6S A;  5KE2 A;  4YRP A;  1H64 1;  1X2H A;  1QW1 A;  4ZN3 A;  5CKF A;  4YRC A;  5CKE A;  4EO4 A;  2CGH A;  2D0Q B;  3WXM B;  4RMF A;  5LJ5 j;  4LDU A;  2P0Q A;  3NEN A;  3GF5 A;  4FM4 B;  2EIF A;  1VQ6 T;  3A31 A;  3UH0 A;  5HK0 A;  3X28 B;  1KQS S;  3M59 A;  2JNG A;  1YHQ A;  2CKK A;  4M77 A;  4RQF A;  4DOV A;  1VQ4 A;  4GLK A;  3QNE A;  3I55 T;  2WSC E;  2EQM A;  3IKL A;  4HCB A;  3OW2 A;  4H02 A;  1I81 A;  2FB7 A;  4JUV A;  1OI1 A;  3ER0 A;  1XNI A;  3GNF B;  2LT4 A;  5GMK j;  4ZTZ B;  1YJW T;  4PHC A;  4PG3 A;  3Q1J A;  4C8Q D;  1R8O B;  3ICA A;  4OF1 A;  2Q5I A;  4RG2 A;  1NJ2 A;  4H2S A;  2RHQ A;  3MET A;  2XID A;  1YBY A;  5L8R E;  4OB1 B;  4FT2 A;  3I56 T;  3UGQ A;  5LJ3 f;  2EFI A;  4M7D D;  4YRT A;  3M54 A;  3REU A;  5DM7 R;  4LD9 K;  2DK3 A;  4M75 B;  3L2W A;  3ERR A;  1E24 A;  3A7U A;  4II1 A;  2QQ9 A;  4YYE A;  3EFR A;  2HQE A;  3OMG A;  3L2Q A;  1VQZ A;  4C5I A;  2X35 A;  3VUB A;  5A0G A;  1M1K U;  1X2G A;  2CJA A;  5ELN A;  5LJ5 g;  1K8A C;  3A8H B;  2DKG A;  3DB4 A;  2HNI A;  4OB2 B;  1RIQ A;  3OD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...