2ZHKA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 1)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
total genus 34
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhkA00
1ULFA 3V0BA 1Q8OA 1SBFA 4DQAA 1HKDA 1LOBA 1SLBA 4LBQA 1BQPA 2I2SA 3AP5A 2AYHA 1BXHA 1DYKA 3ILRA 4GALA 1WUVA 3AP9A 4U36A 4XJWA 1S0JA 5DUUA 1G9DA 2D6NA 4YZ2A 3WDTA 1AX1A 4YG6A 4FPYA 1J1TA 1VLNA 1UN1A 2D3PA 2GN3A 2LTNA 2P3KA 4XTMA 3WG4A 4C1WA 1LOCA 3ZXFA 3WDYA 3ENRA 3VKFC 4K20A 2YV8A 2DUQA 3C2UA 3PVOA 1RITA 1AXZA 2VW0A 3OBRA 4YGEA 5CAZA 4YM1A 4IQPA 1ULGA 4Q8KA 1Y7BA 4YLZA 3WDXA 4SLIA 5L73A 3ZVXA 3AX4A 3OYWB 4C1XA 3KQRA 2ZGUA 3A4UA 4Y22A 5FREA 1LHWA 2NZ9A 1YI7A 3FLRA 4RA0A 1W0PA 3ZSMA 4Y1ZA 2DTWA 1FYUA 4ASMB 1DQ2A 2OVUA 2A6ZA 4YZ4A 3AZXA 1S0CA 2HYKA 2PHWA 1ONAA 4YFZA 3M2MA 3PMEA 2GNTA 4FPFA 3POYA 3B00A 4D69A 5IK4A 1CIWA 4CRQA 3IPVB 5FRAA 2OW4A 1QU0A 4FP3A 3N7MA 3SISA 5DZGA 1MS5A 4FOWA 2WT1A 3AJZA 3AP6A 4AGVA 1MS8A 1H30A 1ZM1A 3W58A 3FBYA 2WQZC 2DV9A 4DRVA 4Y24A 3O12A 5GZDA 3RG0A 1PZ9A 4YZ1A 4ISQA 3QLQA 4Q1PA 3RQ0A 1KJLA 3AFKA 3BIWE 1WBFA 1W6OA 2EIGA 5DXDA 3VKNA 3WVJA 1HDKA 2P34A 3OYWA 4Y1YA 1LOFC 1CONA 3LSEA 4W65A 3WOGA 1TEIA 4XOGA 3WDUA 1Z0HA 1G86A 4Y22B 4P9WA 4AVVA 2ZGKA 4YW2A 3JU9A 3WCSA 1N1VA 2DURA 1MS3A 4JCKA 4U2AA 4BMEA 2YY1A 3OY8B 4XJ8A 2DVBA 1GBGA 1Q8PA 1UZZA 2VW2A 3TAYA 2ZGLA 3ZYPA 3B9CA 4AYUA 4CTEA 1JUIA 5GLVA 2VH9A 1B09A 1H9PA 1LOEA 2FMDA 5E89A 1Z78A 1C57A 2B7YA 2DUPA 2DWRA 5E88A 3RSJA 3IPVA 1YRZA 4XBNA 3T1LA 5F9TA 3NV2A 4M00A 1LGCA 1LECA 1AJKA 2ENRA 3WDWA 1DFQA 1OQ1A 1A78A 3V0AA 2Q5TA 3M3EA 1SLAA 2UU8A 2ZMNA 1N3PA 1ENQA 4HANA 1AXYA 3NWKA 2PHRA 1DQ4A 3D5OA 1W6OB 1YO8A 1LHVA 4BQ1A 1WD4A 1LENA 3AZZA 2AREA 1UAIA 2R0FA 1V6JA 2GNMA 3OBTA 1KDMA 5DZFA 1V6KA 1F9KA 3APBA 3AZVA 5IK8A 2VUAA 5T5OA 3V65A 2LALA 3IN9A 2A71A 2CY6A 4ZKTB 2XB6C 3VKMA 2WT0A 2D7FA 4FP2A 2WLQA 4M3CA 3USUA 2P2KA 1QNYA 3HN1A 4BOWA 4WVVA 2A70A 1Q8QA 1DQ6A 1WW5A 1LEMA 1GZ9A 2DVAA 3WG3A 1KITA 5T54A 2ZGRA 4AWDA 2A75A 1LOAA 1W6NB 1X50A 1QOTA 3MPPG 5IK7A 3B69A 4PBOA 1MS4A 3WUDA 1SLCA 5JOWA 2WSVA 5IT6A 1G7YA 3RMXA 1QGLA 4UW6A 3D6EA 3BOPA 2VW1A 3PVNA 4P9XA 1SBEA 1SLLA 2WKKA 3N7LA 1WLWA 3B01A 3T1MA 4AVTA 4LBQD 5GZFA 4UW5A 3V0BB 2ZGNA 1LCLA 2JKBA 3AP4A 1BKZA 2EF6A 4LBNA 4AGRA 1FNZA 5E8AA 2GMEA 4L8QA 4JRAA 3WNXA 3WLUA 4XTPA 1G9BA 2R1BA 2R49A 2W39A 4Y1UA 3ILFA 2P3JA 2D3RA 2YZ4A 4Q2FA 4YM0A 5T55A 3A0KA 3NV1A 2NP0A 3ATGA 1GICA 1LULA 2DVDA 1OFSA 5T5JA 3WHUA 4YG3A 2ZAAA 2OUJA 2WJSA 1IKQA 5BYNA 1HQWA 2ZMLA 1S0IA 1RIRA 1ULEA 4GKYA 2D6KA 1GZCA 2D44A 3VV1A 3ZXEA 1I1EA 4Z8BA 1LESA 1LGNA 2ZMKA 3MW2A 1LEDA 2ERFA 4ATFA 2D6PA 3V0AB 2R0HA 1QDOA 1SFYA 3U4XA 4Y1XA 2ZGTA 1FAYA 3IM0A 4FQZA 5HCBA 3PVEA 1GZWB 1NLSA 2ZHNA 3KM5A 3R4SA 1MS0A 1GSLA 1W6MA 4GA9A 4FPOB 4XHBA 1BYHA 2EALA 4XXPA 4FPHA 1DQ0A 1KJRA 3LCPA 4YGBA 1DYPA 1JOJA 3D4KA 4ZXKA 3WG1A 4FPGA 4XJAA 3M3OA 5CBLA 4FQ4A 2VY0A 3INAA 5GLZA 1GNZA 2AH2A 1W6PA 2EXKA 3N7KA 4Q26A 1LU2A 3DGTA 3N36A 1GZWA 4XJUA 1IS4A 2DVGA 3FFZA 2E6VA 5GM0A 1JHNA 5DG1A 5T5LA 1O4ZA 1S0EA 3DUIA 1ULDA 3FLPA 3OGGA 3L2YA 2ZHLA 4FPKA 1SCSA 1YYNA 1SBDA 4K21A 2ZA9A 5HCAA 2UWBA 5JMCA 2SLIA 1ENSA 4GXLA 1I3HA 4P14A 1VIWB 1CN1A 1AX2A 2ZHKA 1BJQA 1DQ5A 2NYYA 3RS6A 1RINA 3BTAA 3SNMA 1QOOA 3N3HA 5GLWA 2WT2A 2CNAA 3MEPA 1F5FA 4FOQA 4YM2A 2A3YA 2PHXA 2JECA 4GWMA 1MR5A 5T50A 3SLIA 1H9WA 1NXD1 1AXKA 1W6QB 2EAKA 2TEPA 2WNEA 5GLUA 4ATEA 5DG2A 3IKWA 2ZGMA 4YGDA 1LHUA 1N3OA 1FX5A 2BQPA 1KRIA 1WW4A 5IK5A 3M3QA 1Q8SA 1FV2A 3IMNA 2ZKNA 3O0VA 2AENA 4Y1VA 4CZSA 2PHTA 4WZFA 1A8DA 5CB7A 4LBLA 2DVFA 1UX6A 2XG3A 3SH3A 4HL0A 2YROA 1GV9A 3AK0A 1QMJA 2PHUA 4NO4A 4P9YA 2DYCA 5EXOA 3AYEA 4BMBA 1S0BA 1DIWA 1YXWA 2P37A 1MACA 1KQRA 1N47A 2DU0A 4XE9A 4YZ3A 5EYXA 3W59A 1CPMA 4YW5A 2OUHA 1MZ6A 2JDZA 2YXSA 4FPCA 4YW3A 1W6NA 1Q56A 1S0DA 5H9RA 4GKXA 5JLVA 3O0WA 1LOFA 4M3CF 4R9CA 2JE9A 1ENRA 3GALA 3RRDA 1LGBA 2G4IA 2GNDA 2D6OX 2A6YA 1JYCA 1R1ZA 3AJYA 3JUUA 1QKQA 1YIFA 1UZYA 1WBLA 3NV3A 3UL2A 1AZDA 2A6XA 2CYFA 1D0HA 3AZYA 1GLHA 3BODA 1AJOA 1C1LA 5F5QA 5HCFA 4F83A 1WLDA 1DHKB 1N3QA 2GMMA 2NM1A 3M3CA 1DZQA 5DUVA 4BPZA 4Y20B 3MW4A 1CQ9A 3GNEA 4XBLA 4XMAA 3WV6A 4DS0A 5GZCA 1VAMA 4YGCA 1W0OA 3ASIA 4R9BA 5GLTA 1DBNA 4NOTA 3WZ1A 2ZBJA 1PZ8A 2D3SA 5KXEA 3FUOA 2CL2A 2A3XA 4GWNA 2AR6A 5DZEA 1WLCA 1LHOA 1V6OA 4YW4A 4FOYA 1MZ5A 2DU1A 1JXNA 2A7AA 1N1TA 1N1YA 1KDKA 2D43A 1LJ7A 2W52A 2V73A 4UW3A 2ZGSA 3ZSLA 3OY8A 3SH5A 4YM3A 1FATA 3UJOA 4XXAA 1S1AA 4XIOA 1LU1A 1Q8VA 2Z42A 1W6MB 2A3WA 3O5SA 5JOYA 3FUQA 1HLCA 4H55A 3M1HA 2UWAA 3POWA 4LBMA 4R9AA 1F31A 1UKGA 4LBQB 2C9AA 4YW1A 2A6VA 1LHNA 2AUYA 3CNAA 4PBPA 1ZA4A 4XJZA 1C4RA 1MVEA 4RL7A 1CR7A 5DUWA 5T5PA 2W08A 2KM2A 1V6IA 1QOSA 2A5ZA 1BZWA 2ZGOA 4UW4A 4FVVA 2ZGQA 4BLIA 1G9AA 3WUCA 5KXDA 2A6WA 3RMYA 5IUQA 2EXIA 4M3CB 3USUB 3TB0A 1W6QA 1IS5A 4ITCA 2EXJA 2D6LX 1MS9A 4FPEA 4WV8A 4I30A 1D2SA 1URXA 4MYEA 1PZ7A 1LTEA 1V00A 5EYYA 1V6MA 3ZYRA 1QNWA 1UL9A 4R9DA 1WW6A 4PF5A 1APNA 4K1YA 5CA6A 3T2TA 2JE7A 4OZXA 1JW6A 1MS1A 1VAVA 2WSUA 3HR9A 3O0XA 2EXHA 2UWCA 2NN8A 2ARXA 3AYAA 1QF3A 1CVNA 5KXBA 1N1SA 3OJBA 2PHFA 4PQ9A 4BLJA 2V5YA 5JOZA 1UMZA 3UK9A 2RHPA 3A0NA 3WG2A 2GN7A 3ZPYA 4JC1A 1JYIA 3R4UA 5T52A 3N35A 5JOXA 3V64A 3ZXLA 1LOGA 1C1FA 2R16A 2FHRA 2H0BA 5AVAA 3H0OA 1W6PB 3AYCA 2E53A 2D6MA 3MW3A 3ZXKA 1VALA 1WD3A 3AP7A 4XJ9A 1UPSA 5SV8A 2ZABA 5GZEA 3ILNA 1S0GA 2DTYA 4AGGA 1FV3A 4AVSA 4TZDA 1GNHA 1IS3A 2YMZA 4LBKA 1LODA 3FLTA 5DUXA 2VU9A 4YG0A 2ARBA 3AXDA 1O4YA 1FNYA 1OKQA 1ULCA 3AYDA 1DQ1A 4K1ZA 4Y20A 1AVBA 1CJPA 4LBOA 4PCRA 2ZZJA 1CPNA 1GYKA 4FOVA 5KXCA 3I4IA 3NV4A 2P3IA 3WDVA 1G8WA 5H9PA 1MVQA 4M3CE 1XQNA 4XILA 3ZSKA 3ZXJA 4XBQA 3SITA 3ZSJA 2E7TA 2ZACA 3PJQA 1WCSA 2ES3A 2PELA 1A3KA 2GMPA 2NMOA 3AZWA 2E7QA 3QCWA 5GZGA 1DLLA 5CNAA 2NMNA 2ZHMA 2E51A 2W68A 3HMYA 1AX0A 3POSA 3WHTA 4M01A 5JVVA 4WVWA 1G9FA 3UJQA 4XYXA 1IOAA 2R1DA 1JN2P 3LSDA 3I8TA 2AGSA 4Q27A 4XMIA 5GALA 3SH4A 1JBCA 4BM8A 4YZ5A 2CTVA 4XIKA 4Q1RA 5LK5A 4Q8LA 4XZPA 2VXRA 1GANA 3B3QE 4Y26A 3AXEA 2GALA 4XDQA 1IKPA 1WW7A 2CWMA 2UURA 4XHXA 5H9QA 5EWSA 3N7JA 4FPLA 3WCRA 1U0AA 3OPZA 1CESA 1SACA 2CWSA 2GDFA 2ZGPA 1AF9A 1QDCA 1V6NA 3VUOA 1SLTA 3VKLA 2GNBA 4LBJA 1SCRA 3VKOA 5GJ6A 4ISRA 2SBAA 1IS6A 1HQLA 1V6LA 2JD4A 4FPJA 4TYSA 5JDBA 1SLIA 1EPWA 2C5DA 5H9SA 1G9CA 4DPNA 4KBBA 3R05A 2DUOA 4DFSA 1GKBA 3Q9OA 1DGLA 4DRRA 4YFWA 1S0FA 2JJ6A
chains in the Genus database with same CATH superfamily
1ASJ1 5FV3A 1S2BA 1ULFA 4NVPA 4LHLA 2EICA 4NN0A 4RQPA 3VBUB 1SBFA 4WZCA 2C1FA 4DQAA 1GOHA 1MZEA 3RI9A 3W21A 5CFCA 3H3UA 2AYHA 1BXHA 1DYKA 4ES9A 1REFA 4LT5A 4AFBA 4QX5A 5FP3A 3AP9A 3TNPB 4Q4V2 2WA3A 5LA2A 4GMP0 3U78A 1K3IA 1UZWA 4FPYA 1J1TA 1HV1A 2JIJA 4IERA 3WG4A 4YARA 4AI8A 4XZUG 2RS53 3MIEA 2HBTA 3B94A 3I2IA 3OUIA 5FXZA 1XU1A 3LF7A 4EN6B 2VW0A 1AXZA 2CDOA 4YGEA 4XUOA 3ZDVA 4JV4A 1Y7BA 4Q8KA 2MEV2 3EO6A 1FT9A 3RYPA 1NLQA 3KVBA 3ZVXA 3MIDA 3KQRA 4JQRA 2UY8A 3A4UA 4Y22A 2NZ9A 2Y0IA 2VULA 2B5HA 2GC0A 4UI9L 1CAUB 4OI1A 4B1MA 4KL1A 4ASMB 5FXVA 4YZ4A 5CFCB 4ZXEA 3VD3A 5KHJA 4YFZA 3M2MA 1O8SA 2FZ2A 1RYYA 4AF9A 3TEZA 5F3GA 3THPA 4PDWC 1J84A 4A6OA 1M06G 1ZZ8A 4BB3A 1F4AA 1W9FA 3WINE 4LTAA 2OIIA 1QU0A 3I3DA 3UKNA 1DG6A 1MS5A 5EJ1B 3DECA 2RDQA 3AJZA 3AP6A 5FZ1A 4AGVA 3FBYA 4DXTA 3E5QA 4MH0E 4W6WA 3RG0A 1NA1C 1AYN3 1JHJA 3RJRA 4ISQA 3RQ0A 3ZYBA 1KJLA 3BIWE 3EYPA 3VBOB 3WVJA 2VMGA 3KGZA 3GXUA 4Y5SA 2EAAA 2HWB2 2P34A 3ACIA 4QDRA 1TMF1 3OBZA 3WOGA 2DCYA 4XOGA 1HJFA 1Z0HA 4Y22B 1ACCA 4P9WA 4JAAA 3EXUA 4YW2A 2KA3A 3PIGA 3WCSA 3OEBA 4JCKA 4B4QA 4CCOA 5J7MA 4RFT0 1IQAA 4FAGA 1AUYA 2XBO2 3IT8A 3AMHA 1IPKA 4TTGA 4ZU5A 1PM7A 1QJEA 5JIAA 3ZYPA 1POQA 3W5MA 1JUIA 3KT1A 1JS9A 4IEXA 1XYOA 5E89A 2DWRA 2DUPA 1RUI2 3N4MA 3ZN5A 1YRZA 4XBNA 1HV0A 3WR0A 3WT3A 3DV8A 1LGCA 4AI3A 2YC2A 3I59A 1DFQA 1A78A 4CEYA 4W6XA 3VHNA 1ENQA 3RWKX 1UMHA 1DQ4A 3EJKA 4CCKA 2YU2A 3D5OA 5BY5A 3J7NA 5C6CA 2PLV2 3K48A 5FUNA 4NRMA 1UAIA 2JDPA 2GNMA 3PU8A 1KDMA 3VL8A 4CU7A 1V6KA 5FZEA 1F9KA 3APBA 1MZFA 2LALA 4QPIA 1UYPA 2FMYA 3LGRA 4BISA 5C9AC 5FUPA 2VL4A 4AVBA 3VKMA 4QAWA 3USUA 1ZBA2 4QPGB 1UX7A 4NIDA 4WVVA 4AXOA 1Q8QA 1WW5A 1LEMA 2JB8A 1GZ9A 1X82A 2VZQA 1GUIA 1KITA 2ZPXA 5AC92 2ZGRA 2JDHA 3QH7A 3ACLA 1LOAA 2WZPP 3VBHB 4PLNA 1X50A 2W1UA 4MLOA 4DXZA 2RE9A 5FKCA 3VBRB 3WUDA 3PUIA 2WSVA 3GBWA 2WA4A 4HPKB 5LATA 1PVC2 5BNPC 1G7YA 1W8NA 2XVKA 1QGLA 5D21A 4X6QB 2QQUA 4UW6A 5FLHA 4XFFA 4IDZA 1JI6A 2HWF1 1SBEA 1SLLA 3WNLA 4AI0A 1NCQC 1PVC1 3J4UH 3NAPC 5FZGA 5GZFA 3ES4A 4UW5A 3V0BB 4YWAA 2XL9A 2JKBA 1AR61 1UU5A 5FPXA 4Z1VA 4XF9A 1OXCA 2Q1FA 2GMEA 3CL1A 4L8QA 3VBOA 5JR2A 2JE8A 3UKVA 1NA1B 4HPKA 3WLUA 3ETPA 2XUMA 3ORJA 4XTPA 1G9BA 4Y1UA 1EAH1 5L7OB 3A0KA 4AHWA 4Y5Z0 1LULA 3WEZA 1W8WA 2QQPA 4QPGA 1HXS2 3G7DA 4NE9A 2XQRA 3KLSA 4GH4C 3WHUA 2X09A 2OUJA 4QU2A 3WQ1A 4GKYA 2D6KA 2VZOA 2D44A 2G1MA 5FK8A 5FZOA 3S57A 4Q0UA 3JCIA 1WCKA 2R061 3B93A 4P08A 5LZ6A 1I1EA 2QQJA 4K6BA 5FMCA 1H1AA 2X5IB 1C8M1 3DEMA 4JQTA 1H2LA 1PMJX 3OPWA 3PJYA 4Z8BA 3S7EA 5B4XA 1LGNA 3MW2A 2BDRA 2D6PA 2V72A 3V0AB 1SPPB 3I59B 3BU7A 1ZBA3 2MEV1 5CVRA 4PI2A 4TWTA 1FAYA 3IM0A 2WO3A 1F35A 3PVEA 4LPLA 5FZ6A 4A7KA 5HBAA 1NLSA 2J1TA 4XF0A 1MS0A 2Y0OA 2HWD1 2VBDA 4JHTA 1DQ0A 1KJRA 3LCPA 4YGBA 1DYPA 2JIGA 4UFJA 3DF0A 4ZXKA 4AOCA 5SV5A 3ZN6B 4QKDA 5CBLA 4FQ4A 2VY0A 2B9VA 5GLZA 5TSWA 5DQ0A 4LUMA 2DCKA 2NPIA 4QPIB 5ACA1 1IPJA 1LU2A 1ODNA 4XJUA 5F32A 3JBG1 2E6VA 5L36A 1JHNA 1F4HA 1VBA3 1Y9QA 5FPLA 3DUIA 2WUHA 4CCCA 1WMEA 2DCZA 3GJAA 2ZHLA 4FPKA 4URTA 4IL7A 1RUI3 5ERLA 2RDSA 2VD7A 4H3WA 4E2GA 3HBKA 4YVWB 3OCPA 4A7ZA 4GXLA 2H6BA 3PMSA 4R4XA 2ZHKA 5I0SA 2RR12 4HONA 1DQ5A 3BI3A 4PQQA 3BTAA 5D8AC 4PIXA 3RZZA 3N3HA 3VBRC 2WT2A 2G9GA 2BU9A 1QXRA 2JDYA 3MEPA 3POBA 4JHZA 1O3QA 1F5FA 2PHXA 3K51A 3JD72 1YHFA 2WS91 5GLUA 1AXKA 2EAKA 3HN3A 3GYDA 4D6QA 4OCTA 1WZXA 2ZGMA 2DBIA 2PAEA 5IK5A 5FBJA 3LD8A 4L97A 4ORFA 4E2SA 4CZSA 2Z5WA 1OLME 3RDIA 4NRPA 4WZFA 4LBLA 1CAWB 5LEKA 1UY1A 2YROA 4ASKA 5IW0A 3POJA 4FO9A 4HVOA 3ZFGC 1YXWA 4HT1T 3SMHA 1IGOA 2IZWA 1BVP1 2BBAA 5FCCA 4H14A 3W59A 2VOVA 4AQTA 2G9ZA 5DN2A 3U07A 5A3NA 1ODMA 2OUHA 2WNUA 2Q4SA 1RUC2 1TQ5A 1MQTB 2JG8C 1EP0A 1U5IA 2W87A 2VR4A 1AYM1 4J6GA 1W6NA 4EQVA 2HWF3 2YDEA 4GKXA 3W20A 5JSPA 4FTBA 3SCFA 4DIQA 1PX4A 1LOFA 3I54A 1GZTA 3O0WA 4M3CF 1W9SA 1W39A 1ZNPA 4R9CA 2WC2A 2MHFA 2G4IA 2D6OX 2BGCA 2A6YA 3O1UA 1UYXA 3E5XA 3JUUA 2HEWF 2J1VA 3ZO0B 1ZBA1 3UL2A 1AZDA 1NCRC 2A6XA 4F7ZA 1W06A 5HCFA 3BODA 1HIXA 4V2VA 2CHHA 5KHKA 2CV6A 1HJGA 1SZBA 3DXTA 4CPBD 2A73B 1XNTA 3WV6A 3D0SA 1VAMA 1BEV1 4B7KA 5JMOA 1K42A 3ASIA 4QMAA 1H0BA 1OSGA 4H2AA 4P5YA 4IE6A 1NE6A 2R073 4WM8A 3FUOA 3HQXA 1OFNA 3CIHA 3LEKA 1CWPA 2XXZA 1O5UA 5IFPA 5JAXA 4D8MA 1C8M2 4JVAA 4FOYA 3JXSA 3VDDB 4BH9A 1SEFA 3ETQA 1KDKA 4NROA 2OKXA 1LJ7A 4BYYA 3RNSA 2V73A 4XDPA 4P02B 1E5IA 5K0UC 2VZUA 4YM3A 2BGPA 3UJOA 5D8AB 1U5YA 2R042 3N9PA 1C8NA 1I5ZA 3UT0A 4EWDA 2A3WA 3HVDA 3VDDA 3FUQA 3OGRA 3VBFA 4AAXA 3M1HA 4LJHA 1BVVA 3DN7A 4GJYA 3HAGA 4QGMA 3TRSB 4EZ4A 3M7AA 5IVEA 1C4RA 1UU6A 4HKLA 1T2XA 1CR7A 4I2OA 1PO11 4PDWB 2Q8EA 1ZZ9A 4IXLA 4CSWA 2W08A 1NZCA 5ABJA 4QQ2A 3W9AA 1OURA 2JG9B 2A5ZA 1CAWA 2E32A 3CDZB 5JI9A 4MGTA 4D6RA 5JR7B 1D2QA 1IG0A 3DPRA 3PTYA 5JZGA 5KXDA 4CDQA 1G9AA 3J26N 2A6WA 3PURA 1Z7S3 2NQYA 3AKPA 2O14A 4HZFA 1BCXA 5L19A 4BQWA 3MIGA 5FPBA 4WV8A 2VG9A 5FP4A 2OPKA 1W2NA 2XGXA 1V6MA 1UL9A 4K1YA 2RS33 4QX7A 2JE7A 2XOMA 1VR3A 1UOJA 3HR9A 3DPRB 3NMBA 2EXHA 3OGSA 1O4TA 4CDQB 1NCRA 2BYVE 5JZGB 4MVTA 4QB2A 1E57A 5JI7A 3AYAA 1QF3A 1AR83 3VBFB 2VTFA 1QXJA 4KBZA 2CU5A 3RZLA 4E4ZA 1ALYA 2WWJA 4CP9A 3A0NA 4IV1B 3ZXAC 3BN6A 5FYUA 3ZPYA 3KV9A 1HB3A 4JC1A 3T2PA 1J59A 1IPSA 3THDA 4ARXA 5A6XA 1Z7S1 3V64A 3SXWA 5A6ZA 1C1FA 2R16A 4BDVB 3I3EA 2GC3A 3EHKA 4WVMB 3AVRA 4OI0A 1EV13 5LBEA 1XNCA 3LDBA 1G6NA 2DBNA 4XFAA 4Y3OA 5CU1A 1UPSA 4GWJA 4OHYA 5EJZB 1W90A 2X10A 1X8MA 4S2HA 3T3YA 4CDWC 5J09A 2JB4A 5DDJ2 4AVAA 5A33A 1ND2C 2FQPA 3AMPA 2BOJA 5A1LA 4XUTA 4LA2A 4YG0A 2DDUA 1RUH2 1V9U3 1DQ1A 4UXAA 2YBPA 1RC6A 3CHXA 4AI1A 4LA3A 4LBOA 4Q4Y1 5EP9A 2ZZJA 4UFKA 1XE7A 3ZYJB 5BNPB 2Q8CA 1H6XA 3BTYA 1G8WA 1QQP3 5C71A 5FKBA 2WNOA 2XLFA 3VBUA 3VBSA 1JZ7A 1XQNA 2C9KA 1BEV3 2EIDA 1D0GA 3UETA 3ZSKA 5FZCA 3SITA 3ZYIB 4AHXA 4AG4A 1AR93 3LQCA 2FCUA 3GF6A 3LZZA 1WCSA 3AZWA 2PELA 2GMPA 3CU7A 2NMOA 1JUHA 2E7QA 1W2AX 3BPZA 2WN2A 3QCWA 4L0PA 1CX4A 2E51A 2ZHMA 3OGJA 1GR3A 3GZUC 4XFGA 3TEYA 3FX3A 3LOBA 5FZAA 4HOOA 4I0AA 1PMIA 2HWE3 3J9SA 3E6CC 4ZKTB 1JN2P 2P6CA 4XMIA 1H2KA 3BGAA 4XPVA 1NUKA 3C7HA 4E4HA 1GQGA 4MGYE 4G3YC 3T0BA 2GALA 4XDQA 1IKPA 2BNMA 5EWSA 1RMU1 1QJX3 2W0XA 4XFHA 4CDQC 3QBQA 3AKQA 2G9FA 1S4CA 1CESA 1W2OA 4Q4X3 2Q0AA 2CWSA 1AR82 5F3EA 1PGL2 3ZXGA 1CIYA 4FXKB 3VUOA 3ES1A 4Q4Y3 3WF3A 2PN5A 1COV1 2ZCWA 3JZVA 1OOPA 2SBAA 1V6LA 1REEA 3NNGA 2IXJA 2XDVA 2O0OA 2HWE1 2C5DA 5F2WA 3EMRA 3M8LA 4IEPA 4EN7B 1G9CA 1JU3A 2DUOA 4XUPA 1GKBA 1QJZA 2VNRA 1S0FA 1SG3A 4UFIA 1UF2C 2RJLA 2UYBA 4KWJA 1U5XA 1Q8OA 4WBBA 1VBC3 1GQPA 2BEOA 2OXBA 2RDRA 1HKDA 1X9PA 3ABZA 4MOAA 1SLBA 4BE3A 4LBQA 1OI6A 1VMHA 4MADA 5DDJ3 5FOJB 3ILRA 3OGVA 1WCDJ 3KCCA 2ZJCA 1WUVA 1VMFA 4QHBA 4XJWA 5CEHA 1G9DA 2D6NA 1YJKA 1QJY1 4ZY9A 5K4LA 2BTVC 3WDTA 5BNOC 4MXWA 4YG6A 3MLJA 2P3KA 1VLNA 1UN1A 1YWKA 2LTNA 4C1WA 1ENXA 4XVHA 1RUNA 1DF0A 3ZXFA 1KS4A 4OHVA 1O59A 4QXKA 1GP6A 3PVOA 3OBRA 5FZ9A 1XE8A 2HWD2 4IQPA 4MGZE 4YLZA 1OPMA 5FAXA 3PDQA 5EJ3A 4Q4V3 3WDXA 5F7UA 1FOD3 2RVAA 3U1XA 5BNNC 3POEA 4OQ9A 1ZRRA 4LKDA 4D0QA 4QXHA 4XABA 5FREA 4Z2AA 1VBD1 1YI7A 3FLRA 4PIZA 4Y1ZA 3PU3A 5DDJ1 4A44A 4LORA 5BXXA 1DQ2A 2B9UA 2WYSA 2I07B 5FZOB 4XF3A 1STMA 3VBUC 1IZ3A 1ONAA 5K9YA 1XNAA 4OZOA 3PMEA 2X5IA 2YGLA 1RUE3 5A3PA 1RL3A 1X36A 2CDPA 3B00A 3POYA 5HXMA 1CIWA 3CQOA 3CZUA 4TLGA 5FP7A 1I5PA 3ITQA 5DAQA 2VM9A 3N7MA 5DZGA 2RMU1 1H2MA 3GJBA 2WT1A 4Y4RA 1QJFA 1ZM1A 4CXXA 3VDAA 3C8XA 1S55A 3WNOA 3ZFGB 1NY72 4CEYC 4DRVA 4XFBA 4N53A 2AZ5A 3ZFEB 4YZ1A 4P9LA 3QLQA 4Q1PA 1R1A2 4Q4X2 4EV0A 3AFKA 5DXDA 4LUKA 3RZMA 2UY9A 1HDKA 4Y1YA 2XJUA 5JXIA 1C3HA 1CONA 1GWMA 2QQMA 1TEIA 3H3LA 4NMIA 4IEZA 3SCGA 1G86A 4NPMA 4AVVA 4BCUA 4DZGA 5FR3A 5FWEA 4U2AA 4W8JA 5FBZA 2Y6LA 3OY8B 3CJIC 4XJ8A 3PL0A 3I3BA 2ZGLA 3E6DA 2QJVA 3PTRB 4AYUA 2QDRA 4EWAA 1PGW1 1W04A 4PT6A 4UBGA 5GLVA 2VH9A 1UXZA 3WNNA 3OF1A 1Z78A 4AZZA 5C3PA 4CCDA 4COYA 2JWPA 3P5BA 3T1LA 3CBNA 1XYNA 5E16A 1TNFA 3BALA 2VVDA 3NV2A 4IETA 4M00A 3VDDC 4EWEA 5C8CA 2VZVA 5FMOL 3WDWA 3WF4A 3KWVA 3IDCB 4QQOA 3V0AA 4N8MA 2Q5TA 3E97A 5F6KA 4QXBA 1AXYA 3ZKUA 3NWKA 2PHRA 5FQ0B 2QQIA 3P3PA 2AC1A 3S7IA 1UZ0A 2GC2A 2LM3A 2WYFA 2LW8A 4MHRA 3RGBA 3T2QA 4DO0A 2R0FA 2RM23 3HIFA 3OBTA 2OZJA 2FDKA 2QZ2A 1IQDC 3AZVA 5IK8A 3V65A 1MEC3 1OA3A 3IN9A 2A71A 5K0UB 4Q4X1 3OTFA 5FZDA 2EVXA 2V09A 4FP2A 4M3CA 4I3PA 2P2KA 4UWDA 5IJRA 3OUJA 4BOWA 2W3JA 1OBNA 4QDSA 5C8WA 3HNBM 4KI5M 2DVAA 3O1OA 1R093 4AWDA 3DYPA 2XBO1 1F15A 1W6NB 3IDAA 3O7OA 4NRQA 1FPN2 1VBB2 3B69A 5DPNA 4COZA 4PBOA 1MS4A 4HLTA 5JOWA 3RWNA 1FMD3 2XLGA 3BTZA 3LA7A 1QHDA 1CD3G 2TUNA 2VUCA 2VVFA 4E2QA 4P9XA 5FY1A 2KD7A 1V70A 1D4M1 1PNGA 1S2EA 3LPFA 4LBQD 4PHZA 4X8PA 4AVTA 5FYCA 4K8FA 4EJRA 5LCWL 3FE5A 4LLFA 1RUG3 1LCLA 2VZPA 3ZFEA 1BKZA 1PK6C 1XU2A 4LBNA 4WM7C 1UD1A 4OUMA 5LBCA 4L9BA 4BXFA 4CXWA 4JGYC 4DXSA 2VQUA 3I2DA 2R1BA 2R49A 2W39A 3C7EA 4J25A 1H8TA 4INDA 2D3RA 4Y5TA 4Q2FA 3H8RA 4UBHA 3RZKA 5C4WB 1UYZA 3NV1A 2R072 2DVDA 1OFSA 2VMDA 2GH2A 1ZBE2 4YG3A 4F3JA 4A2UA 2IFWA 5BYNA 1BMV2 1KXGA 1HQWA 2ZMLA 5APAA 1RIRA 4LIUA 2XPJA 1GZCA 2JKXA 2GZWA 1Z7S2 3ZXEA 5IVYA 4B3NA 3C7FA 1AYN1 1MQTA 2JXAA 5BNOB 2RS11 3VN4A 4ATFA 2ZMKA 1LEDA 5DAPA 1US2A 2K2SA 5FTTC 5IYYA 4UT5A 5ANNA 4D6SA 5D8AA 1HB1A 5C3SA 1SFYA 2WZ8A 2ZGTA 2Y38A 4EN9B 2VCBA 3OPTA 4FPOB 2EALA 4FPHA 3K3OA 3RI8A 2VVEA 3I2KA 4L92A 4YW6A 2WNUC 4IEQA 3M3OA 4OFGA 1X7NA 1E5HA 2AH2A 4XETA 1TME2 2RM21 2X8KA 2EXKA 5FLJA 5FYHA 5C8CC 3N36A 2ARAA 1ZZCA 3FFZA 2DVGA 3K4ZA 4IV3A 3U0ZA 3WNMA 5I8YA 1ULDA 1POV1 3L2YA 1AYM2 4RR3B 2EA7A 1IHMA 1YYNA 2KR2A 3WP6A 4A45A 4K21A 4AL9A 1OPOA 3H1MA 4AHYA 3KHCA 2UWBA 2SLIA 3G6JB 1ENSA 1WGPA 5F1RA 4P14A 2I74A 1CN1A 4LOTA 3MDPA 4OI4A 2NYYA 3FJSA 2XKPA 5BUVA 1UMIA 3SNMA 1QOOA 3IMMA 4AHZA 2OZ6A 5LASA 2FDGA 3KS7A 4JX0A 2CSGA 2G19A 4M0HA 1VJ2A 4YM2A 2A3YA 4GWMA 1MR5A 2GH8A 3MLKA 4WM8C 5T50A 2TEPA 3SLIA 4PIYA 5HXVA 1SDDB 1D4M3 1RGSA 4W6YA 1DGWX 5BNNA 1N3OA 1EAH2 2GP5A 4S2FA 1GWLA 2XKOA 3TN91 3ZMOA 4FSJA 4ZONA 3AMNA 1RVF3 2C6SA 2XH6A 1AL23 5A32B 2WS92 4ZU7A 4BIFA 4UYBA 2WFF3 5C7GA 1RMU2 4KG0A 2WO1A 1SFPA 1UX6A 5A80A 3K46A 1K5MC 3GCXA 3IIIA 2H0VA 4QGLA 1QJU2 4K40A 1DGRA 3GBGA 1J3PA 2P37A 1MACA 4YZ3A 5EYXA 2P6HA 4PF1A 2PYTA 4DY5A 2PQSA 3H8XA 4XF4A 1MZ6A 5FY5A 3WP5A 1O91A 5F5CA 1UWWA 1NQJA 3TEXA 1OVPA 5A3OA 1AR63 4AFMA 1SMVA 2P1BA 4RHV2 1RUJ2 4COWA 4V1PA 1LGBA 1QXPA 1PIV2 4A4AA 3O1VA 3SCHA 4ZS3A 2BOIA 2RS13 3BPSA 3RZJA 1RUG2 3ZYHA 1H4GA 1YIFA 3NV3A 5FP9A 4ASLA 2HEYF 2QKDA 2CYFA 2WZR2 3AZYA 5GKAC 1C1LA 5F5QA 4F83A 1FMD1 4K7JA 3Q8AA 2E33A 3D0JA 4MUVA 5KC5A 4CXYA 2GMMA 2QQVA 1YLLA 4Y20B 1CQ9A 3GNEA 3NKTA 4XCAA 4XMAA 2Q8OA 4BA6A 1JH5A 5GZCA 4XQDA 1XNDA 2QBXA 1W0OA 2VAUA 4YGCA 5GLTA 1XRUA 4AR2A 5JUVA 3N9LA 4GH4A 4KWKA 1PZ8A 4URAA 3UGFA 2IC1A 2WIIB 4HN0A 3MFAA 4YPJA 5DZEA 4GWNA 2YB7A 5C3RA 1DLCA 5LEJA 2VZTA 3IAPA 4Y4YA 1MZ5A 4OVEA 1VBC2 2C24A 2DU1A 2I45A 4DUWA 3VD4A 5EHDA 5FZ0A 1N1YA 1OH4A 2D43A 1GU3A 4UW3A 1EYBA 3ZSLA 3P1IA 4HSLA 3U11A 4FXGB 3NNJA 1S1AA 1LU1A 1Q8VA 1W9TA 2IVIB 2WAAA 1QJY2 4LIVA 1W6MB 4MSVA 5FYSA 4IEYA 3E6BA 3S30A 5JOYA 1Y9MA 1AL0G 3WF0A 4XC9A 4LBQB 2C9AA 3CNAA 4I0WB 3P3NA 1LKNA 5FO8B 1TMF2 1ZA4A 4XJZA 2HLEA 2VOWA 2BNNA 1K45A 1HN1A 2BGOA 2WZEA 3CJIA 3N9MA 4NPRA 3PUHA 5DABA 5I0TA 4C8DA 4OULA 1NOVA 1WWYA 4LQRA 3TN93 2GU9A 3Q8BA 2VBPA 1QOSA 2RS12 2XJPA 1OQDA 1NY71 2Y6JA 4LE4A 5A7WA 4FVVA 4HG6B 4JGZC 2C26A 5IUQA 2EXIA 2ZX4A 3USUB 3TB0A 2PXJA 1IS5A 2XWBB 2EXJA 1VRH1 1BBT3 5T5OA 1URXA 4MYEA 1LTEA 1V00A 3MICA 1ASJ3 1QNWA 3FFQA 5JPMB 1O3TA 1CZVA 1TZOA 5CA6A 3MO4A 3JQWA 1JW6A 1MS1A 1VAVA 2WSUA 3ZMNA 2RR13 4XQ4A 5EQUA 2NN8A 4UAPA 4KU7A 1CVNA 1UPIA 2WR9A 3VLBB 1N1SA 4ZS2A 1YIPA 1EV12 4S2GA 2PHFA 4BLJA 1RVF2 2V5YA 1TG7A 5JOZA 1Q3EA 2K46A 3UK9A 4Q4W1 2E26A 1OUSA 2GN7A 4I0BA 3VBSC 4A3ZA 2ZAHA 3T2OA 1J3QA 5I0RA 1VB4A 3LEGA 4QM9A 4DMIA 4WVMA 2Y8KA 2DFCA 2D93A 3H42B 4JDNA 1QJU3 2JDKA 1JMUB 4KH9A 2H0BA 3OOXA 3GDBA 1FMD2 5KHHA 1W6PB 4E8CA 5FYIA 2PHDA 2D6MA 4YVWC 1NCQB 4XFIA 3ZXKA 1WD3A 2B4KA 5FPVA 4XJ9A 3BU0A 2Q8DA 3T0AA 2DTYA 1YFUA 1OUXA 2F4PA 2JDAA 1PMHX 2VMHA 4XUQA 4TZDA 5CADA 4QKFA 4N7IA 1VBE1 2BPA2 3NJYA 4CA9A 1DCSA 1MEC2 2ARBA 1FNYA 1ULCA 2YGMA 3JB8A 1YNAA 4JGZA 2VMIA 4Y20A 1AR92 3WNPA 4BQYA 4L2NA 2HWF2 4PCRA 3JD73 2OX0A 4GH4B 1WCUA 3IWZA 1WA4A 3MYXA 4HK8A 4QT6A 3LDKA 1RUE1 2AEZA 2PMWB 3VB9A 4QX0A 2VOTA 5FK7A 3BTXA 1V0AA 3ZDSA 4KQ7A 1H1IA 3POFA 4KG8A 1FPN3 1VBB3 5BNQA 3ZXJA 4XBQA 3HWJA 3VD7A 1PK6B 3LAGA 4GQ7A 4WM7B 2E7TA 4KMQA 1UNBA 2HWB3 2E7AA 2ES3A 1VB2A 3VHPA 3WQBA 5AC91 5ABJC 5GZGA 1JYXA 5LB6A 2K9ZA 1DLLA 1WCQA 4NR1A 3U14A 3WD5A 2YYOA 4GMP3 5A3WA 1OKOA 2BNOA 5ISLA 2VECA 2W68A 4QX1A 4AFAA 1MQTC 2BWAA 2J1EA 3WHTA 4AEMA 2WFF1 3SEPA 2ZZQA 1ZA7A 3MIFA 4XYXA 1UOFA 3WW1A 3SH4A 4HVRA 4DEQA 3I8TA 4NHKA 4Q27A 4HK9A 3VL9A 1JBCA 1BBT2 4FFFA 3NJZA 2PAMA 4JRLA 4Q1RA 3LIHA 4XIKA 2VUJA 1VRH3 4Q8LA 4COVA 3SHRA 2VXRA 1GANA 3B3QE 4XQWA 2PHLA 4Y26A 4NIIA 4FAHA 3M4FA 3SKVA 4DUXA 1WW7A 3FZ3A 2UURA 1YEWA 1OLQA 1FI2A 1CAXB 5H9QA 5EV7A 2VXJA 3KF5A 2CAVA 4FPLA 4AQ6A 2ZEZA 1J3RA 1EY2A 3AVSA 1YJLA 2GDFA 2VMCA 1BK1A 4N53B 1AF9A 1QDCA 4LR4A 3C7GA 1SLTA 2ILMA 3VKLA 2GNBA 4CCLA 1OMIA 2HWC2 5GJ6A 5IATA 5L7OA 4FPJA 1SLIA 1EPWA 1NT0A 1XXNA 5A7SA 5A1AA 3AKSA 3GHMA 1HQNA 1RHI1 2D97A 3NW4A 3OD0A 4R4ZA 5K0UA 4DPNA 3J7MA 1PNFA 1DGLA 3Q9OA 5EIYB 5F3IA 4DRRA 2LROA 4G9SB 4M4PA 5C3OA 3NJVA 1E5RA 3THTA 2BERA 2HWB1 2J1AA 3J8F3 4K9SA 5F2SA 1RUH1 4RD7A 1LOBA 3W5NA 3Q8FA 3UGHA 1YQ2A 2I2SA 4QPGC 4QHOA 3IDBB 3T4HB 3DCQA 4O61A 4U36A 1Y4WA 4MXWB 3JB4C 4DB5A 1S0JA 4FI9A 5F37A 5KBFA 3BOWA 4YZ2A 5C8CB 2D5HA 3VBHC 1AX1A 3MF6A 2V5DA 1GNYA 2GN3A 2RDNA 4XTMA 3I2FA 5L9BA 4ARYA 2XBO3 5C5UA 3WDYA 3ENRA 3VKFC 1UO9A 4ZU4A 4FBFA 3C2UA 1RITA 1NZIA 2XVLA 3HNMA 4OMCA 4YM1A 2QQKA 5E1RA 2V4VA 3C3VA 3LE0A 4LKSA 4SLIA 1UXXX 4L99A 4N43A 2LS6A 2Y33A 3AX4A 3DKQA 4YVSA 5IVCA 4YW7A 2QDNA 2ZGUA 1KFUL 2DF7A 3ZSMA 4RA0A 1I9RA 3H50A 1W0PA 1PGSA 1GWKA 2DTWA 4HXCA 4A7YA 1FYUA 1PIV3 3T0DA 1JYTA 2A6ZA 1S0CA 2HYKA 2PHWA 1RJ8A 1S2KA 3OBAA 1EPZA 2JDMA 1CZTA 2GNTA 1X8EA 3DPRC 3GZEA 3IB3A 2PLV3 5JZGC 2IWGB 4CCMA 2BVBA 3C7OA 1DZRA 3JD71 1YQ8A 3PIJA 1JODA 5IVVA 4CRQA 2J1RA 3IPVB 3MV11 1W9YA 2OW4A 4LO8A 3SISA 3ZFGA 3ZXDA 2D40A 1XNBA 4FOWA 1OLMA 2XJVA 1JYWA 2DV9A 4Y24A 3VHRA 3O12A 5GZDA 4CCEA 3JBG3 1PZ9A 1X9TA 2BRTA 3KVAA 5LA9A 4BU2A 4CDWA 3UGGA 1WBFA 1W6OA 4QKBA 1ND2A 3HQRA 3VKNA 4CPBA 1AR62 4FTSA 3KGLA 2XONA 3KV4A 4IE5A 1LOFC 1F5JA 3LSEA 1RUJ3 2HH9A 4W65A 4GB31 4B7EA 1AHSA 2RS32 3WDUA 2ZGKA 1P8JA 5EPAA 2VZSA 2V4AA 4AEDA 4BMEA 2WZR1 2WL1A 4DOUA 5IVFA 1GQHA 2BJSA 2VNOA 2Z79A 3AFGA 1UZZA 2VW2A 3TAYA 3U4SA 3B9CA 3I7DA 4YVSC 1VAKA 2VUDA 1B09A 1H9PA 1LOEA 2FMDA 3I3QA 3MUY1 4Q0SA 3BUCA 1C57A 3RSJA 3BB6A 3M3IA 1AR81 4E8DA 5A32A 3IPVA 5F9TA 1UY4A 4IE0A 4BHPA 1UKRA 3MHZA 5C33A 3JQXA 4G4FA 1JYNA 1COV3 1HRI2 1LECA 2VOXA 4HKOA 4PI0A 1OQ1A 4AE2A 1VBE3 1ULOA 3M3EA 4QD2A 4WVZA 3ZKYA 3O1MA 5FMOS 4CP2A 3ZFFB 1EAH3 2WWUA 4PLOA 1W05A 4RGGA 1W6OB 1BEV2 1YCIA 1LENA 2XLAA 2AREA 3AZZA 4B1LA 4BWOA 2OT7A 5DZFA 2E63A 4JTOA 1HRI1 2VUAA 2YHJA 1DU3D 1RUF1 4O9GA 2CY6A 2VMEA 3B9IA 2XB6C 5M0TA 3SC7X 2WT0A 2D7FA 3QD6A 4BK5A 2WLQA 4KWLA 5A6QA 1QNYA 1WMXA 1ZZ7A 3FHQA 3HN1A 3JBG2 3MFCA 3VBFC 3ZOIA 1F8VA 1DQ6A 1RUJ1 2OA2A 1UIJA 3J7HA 2R32A 3K77A 4MV2A 5T54A 1A34A 1CGPA 3HOBA 1XE0A 1YUDA 2A75A 2AACA 2VTXJ 4CCNA 1CZSA 1Y43B 1QOTA 1OOPC 3TNQA 2YPDA 3RFRA 2VTXA 1NAEA 1JOPA 5KC6A 4N43C 5JPNB 4IEUA 2YG0A 3RMXA 2R063 2VW1A 2BWCA 2RS51 3T1MA 1WLWA 1CAVB 3B01A 4R8HA 3DYMA 2D5FA 4E27A 3E1F1 1KS5A 1PO12 4BJ0A 2ZGNA 4GZ9A 5ACA3 1GFF2 3T4VA 2IXKA 4CP0A 3KV5A 3AP4A 1NG0A 2EF6A 2FZ1A 4CDWB 2WNVA 1AYN2 1W99A 3TWIA 4QPYA 1ND2B 4YYOA 3I2HA 5JWPA 2P3JA 4YM0A 1NCRB 2HWD3 5CFCC 1XB9A 1K5JA 3KZ4C 3ATGA 4GULA 2NP0A 5T5JA 4D7YA 4EROA 2W1QA 2W9XA 3KT4A 3O1RA 2BZDA 4Z07A 4DY3A 2FCVA 4X8NA 1S0IA 4NWWA 5BNPA 3VV1A 1F2NA 3KCXA 2BW8A 3HBZA 1GP4A 5A7QA 3LEIA 5I8SA 4CEWB 5B4NA 3S6PA 3VBSB 5LBBA 4FFHA 2W1WA 2P3YA 2ERFA 3LFIA 1CJDA 1BK0A 1NE4A 2R0HA 3VBOC 1QDOA 3SQOA 1OD5A 4LO4B 5HCBA 4FQZA 2GSYA 3IZOA 3ZFFA 1JTZX 2JEMA 2ZHNA 3KM5A 4HBNA 3POIA 3R4SA 1GSLA 1TMF3 5IFTA 5A33B 5HV4A 3WG1A 3D4KA 3NNFA 1PGW2 1XSQA 3O1PA 4FPGA 4CDUC 5G04L 1PVC3 3INAA 4JZRA 1GNZA 1AR71 2VOKA 4JDMA 2AEYA 5J98B 2CGNA 1WLTA 4M4RA 1NLRA 1IS4A 1K5MA 3PLQA 5DG1A 5T5LA 1C8M3 1O4ZA 1S0EA 2LRPA 3WSOA 3OGGA 1JZ5A 1ND3A 1EUUA 3KCYA 4KGQA 4RFRB 3VZNA 1RUD1 5A3LA 1ZVFA 2VE1A 4XUNA 4EN0A 5FY0A 3P6BA 5JMCA 1I3HA 1WKYA 2ZTNA 1VIWB 1OD3A 1TME3 1BJQA 1RUOA 3ZYFA 2Y6GA 4HKWA 2W2IA 3RS6A 3TBDA 5GLWA 1BHGA 1OOPB 1D7PM 2OQ7A 2PA7A 1DGRN 5IVBA 2R043 2QQOA 2JG8A 2BVVA 1ZZBA 2WNVC 2JECA 4XAAA 1HXS1 3ZX7A 4CCJA 1W6QB 4RS5B 5CIRA 4BQ3A 4ATEA 2XL7A 3O1TA 3DYOA 3IKWA 1PGL1 4YGDA 1LHUA 1KRIA 1WW4A 5BPXA 1VE0A 3N9QA 2R071 4LLOA 1JZ2A 1O6UA 1VBA1 3ZR5A 1FXZA 2CGPA 4N53C 2ZKNA 3CJIB 3O0VA 5CKNA 3ACFA 2PHTA 5KR7A 1A8DA 2N7GA 2ZX2A 3SH3A 2QNKA 3CKHA 1RUD3 3FBMA 3LKJA 1OC1A 4HL0A 1NYWA 1GV9A 5FPUA 2PHUA 4NO4A 5FYZA 4K3UA 4LK6A 2DYCA 4IW3A 5EXOA 4BMBA 1CAVA 1D4M2 1QH7A 4HETA 4QQLA 5CISA 4CDUA 3I49A 1KQRA 1N47A 2DU0A 3B02A 4XE9A 5FY7A 4GD4A 1L3JA 1CPMA 2RS31 3BIEA 2H6CA 3LPGA 4FT8A 2YXSA 5FYMA 3HT1A 2WZR3 3ACGA 4FPCA 1OA2A 3VBHA 3AMMA 1R092 1RMU3 1S0DA 1UY3A 5F6LB 5FZBA 5JLVA 5FUIA 1LNSA 1A6CA 4CU8A 2JE9A 1ENRA 3GALA 3RRDA 3K75B 1RUH3 1W8UA 2IXLA 4LXLA 4CUAA 5ACA2 1R1ZA 1V9U1 3BYWA 2FDIA 5HV0A 5CYYA 5IHRA 4OUSA 4CVUA 2ZX1A 4P9GA 4RHV1 1GLHA 2L9LA 1AJOA 2QFEA 4COUA 4PJYA 4JTNA 3VZLA 3WW3A 1UW8A 1N3QA 3KV6A 2Y6KA 3USSA 1VPHA 3PNAA 2NM1A 1B35B 3CO2A 1DZQA 5DUVA 2IFRA 2VPVA 2JX9A 3LWCA 3A21A 4XBLA 5FPAA 5J3UA 5FJKA 4R9BA 2VJXA 4NOTA 5LK7B 5CG8A 1K5MB 5FY8A 4NHYA 5KXEA 1XOYA 1R1A3 2XJTA 3MI8A 2A3XA 4Z92B 4CEYB 1WLCA 3L2HA 5JSOA 4LEJA 1QJX1 2WINB 4YW4A 3ZFEC 3ECQA 4JGYA 2A7AA 1N1TA 1W8FA 4P00B 3K4DA 4Z82A 1H8TB 4J1WA 2W52A 4EN8B 1JZ8A 4NPLA 1J58A 3GZAA 2MPFA 2ZEWA 3Q8CA 5LY1A 1XC6A 4A3XA 3MF9A 2WAOA 3DXUA 1FATA 3D3AA 4M0NA 1POV0 4XACA 4FFIA 4XXAA 3I2GA 1QQP2 1ZZ6A 4RGAA 1GOFA 4XIOA 2BBVA 3UKTA 4AFDA 4MGSA 2OS2A 1H2NA 4S2DA 3POWA 4R9AA 1AR73 1F31A 1UKGA 3T08A 5IK7A 3RZGA 2A6VA 3H1YA 2AUYA 5LRRA 2QQLA 3FHIB 3WW4A 1EV11 1VMJA 1W3VA 2RJKA 5D2AA 2UYAA 1MVEA 2TNFA 4RL7A 2WO7A 5DUWA 2BUKA 4Q4Y2 3O14A 2P4EA 5BNOA 4NIGA 4KNCA 4R52A 1V6IA 2ZXQA 1BZWA 2ZGOA 5DMYA 4B4PA 2ZGQA 1RUI1 1Y3TA 3IBMA 4BLIA 1VP6A 3WUCA 2QVSB 3I2OA 4E4SA 3RMYA 1C5IA 4M3CB 2IUWA 4GB33 1TME1 1W6QA 2RM22 3HPNA 4ITCA 2VNGA 4RS5A 2D6LX 4A6SA 3K3NA 4I30A 5EYYA 5FZIA 3ZYRA 4PF5A 1APNA 3DL3A 4LNVA 1KEXA 2FDFA 3T2TA 2HBUA 4OZXA 5C9AB 2FBEA 4LHNA 3O0XA 2UWCA 3OG2A 4QPWA 4IEVA 4BQ4A 2W91A 1AR91 2ARXA 1CAXA 2R6QA 2XJQA 3OJBA 1W3XA 4CDUB 2JDUA 4RR3A 5FZMA 5FZFA 3I3MA 2RV9A 5KWRA 1XSRA 2MEV3 1UMZA 3H8OA 5A1FA 1WA6X 4LO7A 2RHPA 3V56A 3WG2A 3MLLA 4O9EA 5FY4A 4META 3R4UA 1JYIA 1ULPA 2Q1MA 3ZN6A 4QDQA 2ET1A 3VD5A 3IIAA 4NHMA 3RYKA 3ZXLA 5AVAA 4F8AA 1NXMA 3AYCA 3ZIXA 2E53A 1C28A 4QX8A 5JCTA 3NAPB 2ORXA 3KQ4B 4HSJA 3PVBB 3AP7A 4CUGA 4LITA 2Z69A 5CKMA 5SV8A 3ILNA 1S0GA 5BNNB 4MHUA 3I97A 4AVSA 4C0HA 2IVJA 4NUBA 2YMZA 5IVJA 4JGYB 1LODA 3FLTA 3FWEA 4MGIE 4AEKA 5C70A 3RZHA 1H4HA 3AXDA 1O4YA 1OKQA 4K1ZA 1W28A 1AVBA 4RS5C 3UESA 5IAXA 5JXGA 1TNRA 1CPNA 1GYKA 4FOVA 3GHNA 3NV4A 4CUCA 4GB32 2P3IA 1QIQA 2C0ZA 5H9PA 3WDVA 5FFOC 2B45X 1MVQA 4M3CE 3S5AA 3WY6A 3CEWA 3Q8EA 4MXVA 3ON7A 1GP5A 1TVGA 1W03A 3OSDA 4XILA 4BXSV 1RHI2 2EIBA 5T3NA 3CF6E 3ZSJA 2ZACA 2HWC1 1A3KA 1YQ6A 3CZJA 3ZPOA 5CNAA 4AEDB 1YFXA 2NMNA 5JSRA 1O5LA 3MIBA 2YC0A 3HMYA 3POSA 5FPZA 2O8OA 4M01A 4OYUA 4DNYA 2B8MA 5ANQA 2XVGA 1IOAA 4PLMA 1QEXA 2AGSA 4RYDA 4ZZ8A 3BCWA 4MO3M 5I0DA 4BM8A 5I91A 1NKGA 2WNUB 4NHLA 4PDWA 5LK5A 3RJ2X 4NWVA 4XZPA 5D1IA 3WF1A 4AQSA 2KXLA 1QQP1 2VC9A 1VBD2 2F6BA 5C9AA 1DYOA 3AXEA 2RJ2A 3F2ZA 4JKLA 3NSTA 1R083 1AYM3 2JICA 1T6GC 4QM8A 5LBFA 1U0AA 3U37A 3URFA 3PUQA 1SACA 1EUTA 1PO13 4MGKE 4W4ZA 3WNKA 3MIHA 3FL7A 4L11A 2XR4A 1IG3A 1XPWA 3J8F2 5FLIA 3VKOA 2JD4A 1HQLA 1PHMA 4MGQA 5FYYA 2RMU2 3B7MA 3OUHA 1W8ZA 2JG9A 1W8HA 2FDJA 1WMDA 5A7PA 3HQUA 1BLZA 3HT2A 2ZEXA 3LB9A 3ZN4A 5A7OA 4YFWA 1IS3A 4XFCA 4D3WA 3GBFA 3GM8A 1UQXA 2EIEA 3V0BA 4WM8B 3UNPA 4CDXA 1ZRFA 1H8TC 1WMFA 2Y26A 2HWC3 1AL22 3UV9A 2XJSA 4IESA 1BQPA 1RUF3 3AP5A 4E4DX 4GALA 1L7LA 2LUWA 5FO9B 3CJXA 2W92A 5DUUA 5FZ4A 1JOBA 2WQ4A 4MZUA 2WDBA 4IV1C 3ZM8A 5C4WC 4QB6A 2D3PA 3NAPA 2HEVF 2ZX3A 5A7NA 1LOCA 1UY2A 1ST8A 2XWJB 3FC0A 4ONUA 2F17A 5I8TA 4K20A 2WNVB 5KHGA 2YV8A 4ET7A 5A3UA 2DUQA 3MGUA 5L9VA 3EQEA 5F3CA 5CAZA 4QGNA 2VQTA 4RN5A 1ULGA 3A23A 4Q0VA 1JU4A 1ZYBA 4LKEA 3X29B 1L7RA 1HXS3 3NKGA 5L73A 3WQ7A 4C1XA 1GMMA 2HKXA 3OYWB 5CKQA 4C90A 4OQ8A 5FP8A 1SPPA 1RXFA 4P9JA 1LHWA 1HRV2 1QH6A 4RGKA 4TLFA 4UFMA 2J1SA 5FYVA 1CX1A 1DGWA 1RXGA 3VZMA 1W8TA 1VBA2 2OVUA 1J83A 1JZ3A 3AZXA 5FXWA 3ALQA 4FPFA 5F8PA 3N9NA 2VQ0A 3R0RA 1RJ7A 2J22A 5G05L 4D69A 5IK4A 1ZRDA 4JKKA 1FPN1 1VBB1 3FN9A 2PQQA 4B8EA 5FRAA 2A1XA 3LDRA 4FP3A 2WO2A 4A42A 2D98A 2IXIA 1JZ6A 1MS8A 1H30A 1RUG1 3W58A 2WQZC 3FHAA 1UOBA 5HCHA 4Q4V1 5LA0A 2DCTA 4N9HA 1OLRA 2Y60A 3GZTB 4QKNA 5A3MA 3D8CA 1OQEA 1HW5A 2E31A 1UYYA 2EIGA 1LAJA 3T30A 1L7QA 3OYWA 5F5AA 4IV1A 5C4WA 2DCJA 3AC0A 3AMQA 1O8PA 4KGGA 5BV6A 3TEWA 1B35C 2DFBA 3JU9A 5FZLA 1N1VA 2DURA 1MS3A 2YC4A 2Y6FA 2YY1A 1ND3B 2P5BA 4OHWA 2DVBA 2X29A 4P9IA 1XJAA 3BVCA 1GBGA 1Q8PA 1UZVA 2MNGA 4QQPA 4CTEA 2QQNA 3GCWA 3BKZA 2J1UA 4H7LA 3RYRA 2IXHA 4FTEA 1PO23 5A6YA 4UF0B 2B7YA 3I2JA 5E88A 3KHBA 3POGA 4GJZA 3HEIA 1RUF2 4RR3C 2TBVA 3KB5A 1R091 1NQDA 1AJKA 2ENRA 4OHZA 1HRV3 2JG8B 1AL21 2WFPA 4LOSA 4OMDA 1SLAA 2UU8A 2FDHA 2ZMNA 4IGPA 5FZ7A 1N3PA 1QWRA 4HANA 3MPBA 1H6YA 5DAWA 4A41A 1YO8A 1LHVA 1WD4A 4KWUA 2JENA 4O7XA 1US3A 2Z4FA 3WX5A 4N7UA 1W8OA 1V6JA 5FZHA 1U12A 4IE4A 2ZOEB 4LO5B 4I01A 4LHKA 4CE8A 4CU6A 4CEWA 4FFGA 5DAXA 3PUAA 2WS93 2WQ8A 2WABA 1FOD1 2R30A 1KD7A 2GAUA 3IAQA 4ZPIA 4HMZA 1T6BX 3ME2A 2A70A 3NVCA 3N9OA 4TN7A 4UF0A 3WG3A 3AM2A 4AI9A 5FIXA 3HJRA 3KMHA 1VRH2 5CG9A 5LW9A 3MPPG 4MX3A 4CP1A 1SLCA 2VZRA 2ZS6B 3T09A 1MPXA 5IT6A 2CGOA 4XF1A 5I93A 3D6EA 3BOPA 1YQCA 3PVNA 2OPWA 2WKKA 3N7LA 1H8VA 4HFSA 5B2GB 3H3ZA 4CP9B 3AL6A 1RVF1 4IUGA 3ZFFC 4LK7A 2ARCA 3HD8B 2ORZA 4V2WA 2E9QA 4RQPB 1VRBA 1FNZA 5E8AA 5FZKA 3H1WA 4AGRA 5L9RA 4JRAA 1B35A 3WNXA 4D94A 3KSCA 2WLPA 2CAUA 3L9JT 3ILFA 3OD4A 4QPIC 4AVCA 5JXJA 2YZ4A 1KGYA 2W94A 3RVHA 3PUSA 5T55A 2VCAA 2QTWB 3NL1A 1ZRIA 1PK6A 1GICA 4Q5OA 1PM4A 4WM7A 4BQ2A 3CMGA 3WF2A 2ZAAA 4AW7A 4MG2A 2WJSA 1IKQA 1LR5A 1E5SA 2QQWA 3PHMA 1ULEA 4YSFA 3GGLA 2WRAA 3O1SA 3ROUA 3LIGA 1ND3C 4DEVA 2ATFA 4N90A 2VCCA 4IV3C 3VZJA 3VGIA 3B5LB 2W47A 2BV4A 1LESA 3FMGA 5ABJB 4YRDA 5JIUA 4Z2WA 2WFF2 4I3GA 4EE2A 1ZRCA 3U4XA 4Y1XA 1HB4A 1UY0A 5K7PA 1GZWB 2XJRA 3KD4A 5FZ8A 3VZKA 5AFBA 3DKWA 1W6MA 4GA9A 2VGDA 5I0UA 4XHBA 1BYHA 4XXPA 2B46X 4BQ5A 1QJY3 1JOJA 3NQHA 5J96B 4XJAA 4CYDA 1W2TA 3CLPA 2FD8A 2O1QA 4CDXC 4I09A 1W6PA 3N7KA 2X53S 4Q26A 3DGTA 4NIAA 4DXRA 1GZWA 1Y9GA 2ADDA 1KFXL 1NCQA 3NNMA 5GM0A 5EFUA 2C4XA 1PO21 2BP6A 3FLPA 1R64A 3VDCA 3H7JA 1OH3A 4XEZA 1SCSA 4LMFA 1SBDA 4AI2A 5J1XA 2GP3A 2ZA9A 5HCAA 5JXHA 5FY9A 1H1MA 3WP4A 1HRV1 4E9KA 1SQ4A 2NLRA 1AX2A 4JGZB 4D7SA 4QB1A 5FDBA 4YVWA 2YBKA 1RINA 3UYJA 4CEWC 5F39A 2ZX0A 3OEAA 1ZBE3 2CNAA 3SEEA 4AEDC 4BQXA 5FYBA 3S0MA 2ID4A 2HWE2 4FOQA 5CFDB 4QX2A 5CZKA 3NJXA 1H9WA 1NXD1 5FO7B 2WNEA 5J36A 5DG2A 2K0GA 1HX6A 1FX5A 1NA1A 2BQPA 4GIQA 4JKMA 2O8QA 4W50A 2YU1A 4RSUA 3M3QA 5HI0A 1Q8SA 4HN1A 1FV2A 3IMNA 4I02A 4XAEA 2AENA 4Y1VA 3AKRA 5CB7A 2DVFA 1PVXA 2PAKA 2XG3A 3OB8A 4LULA 3S5QA 5FMBA 5FWJA 3IDEA 2PLV1 1RTVA 2P17A 3AK0A 1QMJA 3H9AA 4YVSB 2J7MA 1BBT1 2JD9A 2Q1ZB 3AYEA 4P9YA 1S0BA 1DIWA 4UOJA 3ZR6A 1U5ZA 2B39A 3LEMA 2W5FA 4YW5A 5C3QA 2JDZA 3NNLA 3K2OA 3HNYM 4YW3A 1UCXA 5FYTA 1Q56A 5H9RA 3VBRA 3H8UA 2Y64A 5LY2A 1POV3 1YI9A 2RG4A 1VBC1 3QH6A 4KU8A 3SKJE 2GNDA 4NJ4A 1JYCA 3VZOA 3AJYA 1QKQA 3M70A 1JYVA 1UZYA 1WBLA 1J1LA 3EBRA 1RUC3 4GMP1 1D0HA 1DP0A 1OT5A 4FCAA 4UFHA 2WN3A 1W0NA 1WLDA 1DHKB 3WP3A 1JZ4A 2B42B 2ETEA 1SHWB 5IAVA 3U10A 4AK3A 3M3CA 1ASJ2 4IEOA 4BPZA 2JG9C 3MW4A 5FXXA 4DS0A 2X05A 4YNIA 1X33A 1XYPA 3EB7A 5EZWA 1DBNA 1YFYA 3WZ1A 1PX3A 2YBSA 2ZBJA 4XCBA 1VBE2 3F95A 2D3SA 5AC93 2CL2A 4BK4A 1MEC1 2AR6A 5FZ3A 3MZHA 2QUOA 5AFEA 1LHOA 1V6OA 4ES8A 4EYUA 5LRSA 4B4RA 1LB2A 1JXNA 5LA1A 2IXCA 1FOD2 1OF3A 1VBD3 2YUEA 5A70A 2ADEA 4D7TA 2VO5A 3J7LA 4P5HA 2W95A 3QACA 2ZGSA 5FMDA 1RUC1 3OY8A 3SH5A 2YFZA 1UU4A 4AQ2A 2FCTA 2OYZA 4ZHNA 2F4LA 1REDA 3MUZ1 5IWFA 2GC1A 2Z42A 3O5SA 1UOGA 2OQ6A 3KF3A 3MBWA 1HLCA 1QJU1 4H55A 4JDOA 3ST7A 3VHOA 2XQXA 2UWAA 4LBMA 5KHIA 1RUE2 2VMFA 1ZX5A 4YW1A 3ZLIA 1LHNA 1OHFA 2RMU3 1O3SA 4PBPA 1YQ5A 2XHKA 2PFWA 1R081 2VZ1A 5T5PA 3WQ0A 2BFUL 2VQAA 4BZ4A 2KM2A 1Q5OA 1RB8G 4UW4A 5FQ0A 1YFWA 1TE1B 1AR72 4J1XA 4LHSA 5CFDA 1OA4A 2R041 4QQHA 4CU9A 3NRUA 4QX3A 2PTMA 2WWSA 1O7FA 1MS9A 4FPEA 4EZHA 1D2SA 1NX9A 1PZ7A 4OLLA 3RPQA 4R9DA 1WW6A 4UFLA 1DDLA 3ACHA 5AVPA 1HB2A 1A8MA 5A3TA 3MV01 1ZREA 3R4DB 2VBBA 3AKTA 1YC61 2Z2SB 5KXBA 1PO22 2VCMA 4PQ9A 5C5TA 3ZYGA 1HN0A 3AB0A 3NO8A 2X5IC 1W9WA 4O65A 2ET7A 4TXWA 2HJIA 4TSVA 5T52A 4CUBA 2R062 3N35A 5HPOA 2QCSB 5JOXA 3A7QA 1GOGA 4N43B 4Q0QA 1LOGA 2FHRA 2QZ3A 3KT7A 3VDBA 3H0OA 2QE3A 1BMV1 2HYXA 4K8RB 3MW3A 1VALA 4NHXA 3LA3A 1XBFA 2ZABA 5GZEA 4QWNA 5F5IA 3TOJA 2JDNA 1W2UA 4AGGA 1FV3A 4OI2A 2RR11 3ELNA 4DINB 1GNHA 1SDWA 5FOBB 4LBKA 5DUXA 3R6SA 5J48A 2VU9A 4RHV3 4AFCA 3VD9A 2Y6HA 3E5UA 3AYDA 1XNKA 3TYJA 3THCA 5CFDC 2J42A 1CJPA 2YFUA 1SFNA 1DZTA 4LE3A 4GWIA 4Q4W3 4GAZA 3I4IA 2RS52 3LA2A 5KXCA 2R7EB 5J37A 2W1SA 1I6XA 1ZBE1 4AEJA 4NAMA 4XW3A 3U75A 3LFMA 1R1A1 3ZSEA 1OVSA 2VZ3A 4N9IA 1V9U2 4XDOA 4AAPA 4DUVA 1LRHA 2Q30A 2ZEYA 4RQPC 1D4VB 3PJQA 4IE7A 3J8F1 3K4AA 4NAOA 3TN92 4Y33A 2YPJA 4BIOA 4QHZA 1AX0A 1CAUA 4Q0PA 1M4WA 1R082 5JVVA 4QXCA 2XHNA 3A22A 1QJX2 2XMLA 1G9FA 2XUEA 4WVWA 1RHI3 4LKFA 3UJQA 1QY4A 4IGQA 4LO6B 4IGOA 2R1DA 2Y34A 3LSDA 2BFUS 4OHXA 4YZ5A 5GALA 3LOIA 5DAVA 2CTVA 1UIKA 3D82A 4H7MA 5FJHA 5K8SA 4QU1A 4IV3B 4C91A 4X6RB 2CWMA 2W46A 4XHXA 2ZKLA 1RUD2 1K12A 1COV2 1HRI3 2VNVA 3N7JA 4XURA 4B29A 4NIHA 4Q29A 3QOPA 3WCRA 3AL5A 3OPZA 1C5HA 4C0BA 2ZGPA 1V6NA 4LBJA 4SBVA 3ZIWA 1SCRA 3WW2A 2WBKA 1PIV1 4ISRA 5E6HA 1IS6A 4TYSA 5LWBA 1O3RA 5JDBA 4ZZ5A 5H9SA 4Q4W2 4KBBA 3R05A 4OUEA 1OF4A 1Q43A 5A7WB 3WXPA 4DFSA 4HVQA 4CDXB 4BQ1A 3H7YA 4IEWA 5L7OC 2JJ6A
chains in the Genus database with same CATH topology
1ASJ1 3VBUB 1S2BA 1ULFA 4NVPA 4LHLA 4NN0A 4RQPA 1SBFA 4WZCA 2C1FA 4DQAA 1MZEA 3RI9A 5CFCA 3H3UA 2AYHA 1BXHA 1DYKA 4ES9A 1REFA 4LT5A 4AFBA 4QX5A 3AP9A 3TNPB 4Q4V2 2WA3A 4GMP0 4FPYA 1J1TA 1HV1A 4IERA 3WG4A 4YARA 4AI8A 2RS53 3MIEA 3B94A 1XU1A 4EN6B 2VW0A 1AXZA 4YGEA 4JV4A 1Y7BA 4Q8KA 2MEV2 3EO6A 1FT9A 3RYPA 3ZVXA 3MIDA 3KQRA 4JQRA 2UY8A 3A4UA 4Y22A 2NZ9A 2Y0IA 2VULA 2B5HA 2GC0A 1CAUB 4OI1A 4KL1A 4ASMB 4YZ4A 5CFCB 5KHJA 4YFZA 3M2MA 2FZ2A 4AF9A 3THPA 4PDWC 1M06G 1ZZ8A 3WINE 4LTAA 2OIIA 1QU0A 3UKNA 1DG6A 1MS5A 4AGVA 3AJZA 3AP6A 3FBYA 3E5QA 4MH0E 4W6WA 3RG0A 1NA1C 1AYN3 3RJRA 4ISQA 3RQ0A 1KJLA 3BIWE 3VBOB 3WVJA 2VMGA 3KGZA 2EAAA 2HWB2 2P34A 1TMF1 3WOGA 2DCYA 4XOGA 1Z0HA 4Y22B 4P9WA 4JAAA 3EXUA 4YW2A 2KA3A 3WCSA 4B4QA 4JCKA 5J7MA 4RFT0 1IQAA 4FAGA 1AUYA 2XBO2 3IT8A 3AMHA 1IPKA 4ZU5A 1PM7A 5JIAA 3ZYPA 1JUIA 3KT1A 4IEXA 1XYOA 5E89A 2DWRA 2DUPA 1RUI2 3N4MA 3ZN5A 1YRZA 4XBNA 1HV0A 3WR0A 3WT3A 3DV8A 1LGCA 4AI3A 3I59A 1DFQA 1A78A 4CEYA 4W6XA 3VHNA 1ENQA 1DQ4A 3EJKA 5BY5A 3D5OA 5C6CA 2PLV2 3K48A 1UAIA 2GNMA 1KDMA 3VL8A 1V6KA 1F9KA 3APBA 1MZFA 2LALA 4QPIA 2FMYA 3LGRA 5C9AC 4AVBA 3VKMA 3USUA 1ZBA2 4QPGB 4WVVA 4AXOA 1Q8QA 1WW5A 1LEMA 2ZPXA 1GZ9A 1X82A 5AC92 1KITA 2ZGRA 3QH7A 3ACLA 1LOAA 2WZPP 3VBHB 4PLNA 1X50A 4MLOA 4DXZA 2RE9A 3VBRB 3WUDA 2WSVA 3GBWA 2WA4A 4HPKB 5BNPC 1PVC2 1G7YA 2XVKA 1QGLA 5FLHA 4X6QB 4UW6A 4XFFA 2HWF1 1SBEA 1SLLA 4AI0A 1NCQC 1PVC1 3J4UH 3NAPC 5GZFA 3ES4A 4UW5A 3V0BB 2XL9A 2JKBA 1AR61 1UU5A 5FPXA 4Z1VA 4XF9A 3CL1A 2GMEA 4L8QA 3VBOA 3UKVA 1NA1B 4HPKA 3WLUA 4XTPA 2XUMA 1G9BA 4Y1UA 1EAH1 5L7OB 3A0KA 4AHWA 4Y5Z0 1LULA 2QQPA 4QPGA 1HXS2 3G7DA 3KLSA 3WHUA 4GH4C 2OUJA 4QU2A 3WQ1A 4GKYA 2D6KA 2D44A 4Q0UA 3JCIA 1WCKA 2R061 3B93A 1I1EA 4K6BA 1H1AA 2X5IB 1C8M1 1H2LA 4Z8BA 3PJYA 3S7EA 1LGNA 3MW2A 2D6PA 3V0AB 3I59B 3BU7A 1ZBA3 2MEV1 5CVRA 4TWTA 1FAYA 3IM0A 5HBAA 3PVEA 4A7KA 1NLSA 4XF0A 1MS0A 2Y0OA 2HWD1 1DQ0A 1KJRA 3LCPA 4YGBA 1DYPA 4ZXKA 3DF0A 5SV5A 3ZN6B 5CBLA 4FQ4A 2VY0A 5GLZA 5TSWA 4LUMA 2DCKA 2NPIA 4QPIB 5ACA1 1IPJA 1LU2A 4XJUA 3JBG1 2E6VA 5L36A 1JHNA 1Y9QA 1VBA3 3DUIA 1WMEA 2DCZA 2ZHLA 4FPKA 4URTA 4IL7A 1RUI3 4H3WA 4E2GA 4A7ZA 4YVWB 3OCPA 4GXLA 2H6BA 3PMSA 4R4XA 2ZHKA 5I0SA 2RR12 1DQ5A 3BTAA 5D8AC 4PIXA 3RZZA 3N3HA 3VBRC 2WT2A 2G9GA 1QXRA 3MEPA 1O3QA 1F5FA 2PHXA 3K51A 3JD72 1YHFA 2WS91 5GLUA 1AXKA 2EAKA 3GYDA 2ZGMA 2PAEA 5IK5A 4L97A 4ORFA 4E2SA 4CZSA 2Z5WA 3RDIA 4WZFA 4LBLA 1CAWB 5LEKA 2YROA 4FO9A 4HVOA 3ZFGC 1YXWA 4HT1T 3SMHA 1IGOA 2IZWA 1BVP1 5FCCA 4H14A 3W59A 2VOVA 4AQTA 3U07A 2OUHA 2WNUA 2Q4SA 1RUC2 1TQ5A 1MQTB 2JG8C 1EP0A 1U5IA 4J6GA 1AYM1 1W6NA 2HWF3 2YDEA 4GKXA 5JSPA 4FTBA 3SCFA 3O0WA 1LOFA 3I54A 4M3CF 4R9CA 1ZNPA 1W39A 2WC2A 2MHFA 2G4IA 2D6OX 2BGCA 2A6YA 3E5XA 3JUUA 2HEWF 3ZO0B 1ZBA1 3UL2A 1AZDA 1NCRC 2A6XA 4F7ZA 5HCFA 3BODA 1HIXA 5KHKA 2CV6A 2A73B 3WV6A 3D0SA 1VAMA 1BEV1 4B7KA 3ASIA 4QMAA 1H0BA 1OSGA 1NE6A 2R073 4WM8A 3FUOA 3HQXA 1OFNA 5JAXA 1O5UA 1C8M2 4JVAA 4FOYA 3VDDB 4BH9A 1SEFA 3ETQA 1KDKA 1LJ7A 4BYYA 3RNSA 2V73A 5K0UC 4YM3A 3UJOA 5D8AB 1U5YA 2R042 1C8NA 1I5ZA 4EWDA 2A3WA 3VDDA 3FUQA 3VBFA 3M1HA 3DN7A 1BVVA 3HAGA 3TRSB 3M7AA 1C4RA 1UU6A 4HKLA 1CR7A 4I2OA 1PO11 4PDWB 1ZZ9A 4IXLA 2W08A 1NZCA 5ABJA 4QQ2A 3W9AA 2JG9B 2A5ZA 1CAWA 5JI9A 5JR7B 1D2QA 3DPRA 3PTYA 5JZGA 5KXDA 1G9AA 4CDQA 3J26N 2A6WA 1Z7S3 2NQYA 3AKPA 4HZFA 1BCXA 5L19A 3MIGA 4WV8A 2VG9A 2OPKA 2XGXA 1V6MA 1UL9A 4K1YA 2RS33 2JE7A 1VR3A 3HR9A 3DPRB 5JZGB 2EXHA 1O4TA 4CDQB 1NCRA 2BYVE 4MVTA 1E57A 5JI7A 3AYAA 1QF3A 1AR83 3VBFB 1QXJA 4E4ZA 1ALYA 3A0NA 4IV1B 3ZXAC 5C4WB 3ZPYA 4JC1A 1J59A 1Z7S1 3V64A 3SXWA 1C1FA 2R16A 2GC3A 3EHKA 4WVMB 4OI0A 1EV13 1XNCA 1G6NA 4XFAA 5CU1A 1UPSA 4OHYA 1X8MA 4S2HA 4CDWC 5J09A 5DDJ2 4AVAA 5A33A 1ND2C 2FQPA 3AMPA 4LA2A 4YG0A 1RUH2 1V9U3 1DQ1A 4UXAA 1RC6A 4AI1A 4LA3A 4LBOA 4Q4Y1 2ZZJA 1XE7A 3ZYJB 5BNPB 1G8WA 1QQP3 2XLFA 3VBUA 3VBSA 1XQNA 1BEV3 1D0GA 3ZSKA 4AG4A 3SITA 3ZYIB 4AHXA 1AR93 3GF6A 3LZZA 1WCSA 3AZWA 2PELA 2GMPA 3CU7A 2NMOA 1JUHA 2E7QA 3BPZA 3QCWA 4BA6A 1CX4A 2E51A 2ZHMA 3OGJA 1GR3A 3GZUC 4XFGA 3LOBA 3FX3A 4I0AA 1PMIA 2HWE3 3J9SA 3E6CC 4ZKTB 1JN2P 4XMIA 1H2KA 4XPVA 1GQGA 4MGYE 4G3YC 2GALA 4XDQA 1IKPA 2BNMA 5EWSA 1RMU1 1QJX3 2W0XA 4XFHA 4CDQC 3QBQA 3AKQA 2G9FA 1CESA 4Q4X3 2Q0AA 2CWSA 1AR82 1PGL2 3ZXGA 4FXKB 3VUOA 3ES1A 4Q4Y3 2PN5A 1COV1 2ZCWA 3JZVA 1OOPA 2SBAA 1V6LA 1REEA 2IXJA 4EN7B 2C5DA 2HWE1 2O0OA 3M8LA 1G9CA 4IEPA 2DUOA 1GKBA 1QJZA 2VNRA 1S0FA 1UF2C 2RJLA 2UYBA 4KWJA 1U5XA 1Q8OA 4WBBA 1VBC3 2BEOA 1HKDA 1SLBA 4BE3A 4LBQA 1OI6A 5DDJ3 5FOJB 3ILRA 1WCDJ 3KCCA 2ZJCA 1WUVA 4QHBA 4XJWA 1G9DA 2D6NA 1YJKA 1QJY1 2BTVC 3WDTA 5BNOC 4MXWA 4YG6A 3MLJA 2P3KA 1VLNA 1UN1A 1YWKA 2LTNA 4C1WA 1ENXA 1RUNA 1DF0A 3ZXFA 1KS4A 4OHVA 4QXKA 3PVOA 3OBRA 1XE8A 2HWD2 4IQPA 4MGZE 4YLZA 1OPMA 5FAXA 3WDXA 5EJ3A 4Q4V3 1FOD3 5BNNC 1ZRRA 5FREA 1VBD1 1YI7A 3FLRA 4PIZA 4Y1ZA 5DDJ1 5BXXA 1DQ2A 2B9UA 2I07B 4XF3A 3VBUC 1IZ3A 1ONAA 5K9YA 3PMEA 2X5IA 2YGLA 1RUE3 1RL3A 1X36A 3B00A 3POYA 1CIWA 3N7MA 5DZGA 2RMU1 1H2MA 2WT1A 1ZM1A 1S55A 3ZFGB 1NY72 4CEYC 4DRVA 4XFBA 4N53A 2AZ5A 3ZFEB 4YZ1A 4P9LA 3QLQA 4Q1PA 1R1A2 4Q4X2 4EV0A 3AFKA 5DXDA 4LUKA 2UY9A 1HDKA 4Y1YA 2XJUA 1C3HA 1CONA 1TEIA 3SCGA 4IEZA 1G86A 4AVVA 4BCUA 4DZGA 4U2AA 5FBZA 3OY8B 3CJIC 4XJ8A 2ZGLA 3E6DA 2QJVA 4AYUA 4EWAA 2QDRA 1PGW1 4UBGA 5GLVA 2VH9A 3OF1A 1Z78A 4COYA 3T1LA 1XYNA 5E16A 1TNFA 3BALA 2VVDA 3NV2A 4IETA 4M00A 3VDDC 4EWEA 5C8CA 3WDWA 5FMOL 3IDCB 4QQOA 3V0AA 2Q5TA 3E97A 5F6KA 1AXYA 3NWKA 2PHRA 5FQ0B 3P3PA 3S7IA 2LM3A 2GC2A 2R0FA 2RM23 3HIFA 3OBTA 2OZJA 2QZ2A 3AZVA 5IK8A 3V65A 1MEC3 1OA3A 3IN9A 2A71A 5K0UB 4Q4X1 3OTFA 2EVXA 2V09A 4FP2A 4M3CA 4I3PA 2P2KA 4BOWA 5C8WA 2DVAA 1R093 4AWDA 3O7OA 2XBO1 1W6NB 4COZA 1FPN2 1VBB2 3B69A 4PBOA 1MS4A 4HLTA 5JOWA 3RWNA 1FMD3 2XLGA 3LA7A 1QHDA 1CD3G 2TUNA 2VVFA 4E2QA 4P9XA 1V70A 1D4M1 1PNGA 4AVTA 4LBQD 4X8PA 4K8FA 4EJRA 3FE5A 4LLFA 1RUG3 1LCLA 3ZFEA 1BKZA 1PK6C 1XU2A 4LBNA 4WM7C 1UD1A 4OUMA 4L9BA 4JGYC 3I2DA 2R1BA 2R49A 2W39A 1H8TA 4INDA 2D3RA 4Q2FA 4UBHA 3NV1A 2R072 2DVDA 1OFSA 2GH2A 1ZBE2 4YG3A 4F3JA 4A2UA 2IFWA 5BYNA 1BMV2 1KXGA 1HQWA 2ZMLA 1RIRA 2XPJA 1GZCA 2GZWA 1Z7S2 3ZXEA 4B3NA 1AYN1 1MQTA 2JXAA 5BNOB 2RS11 3VN4A 4ATFA 2ZMKA 1LEDA 2K2SA 5FTTC 5D8AA 1SFYA 2ZGTA 2Y38A 4EN9B 4FPOB 2EALA 4FPHA 3RI8A 2VVEA 4L92A 2WNUC 4IEQA 3M3OA 4OFGA 1X7NA 2AH2A 4XETA 5FLJA 1TME2 2RM21 2X8KA 2EXKA 5C8CC 3N36A 1ZZCA 3FFZA 2DVGA 4IV3A 3U0ZA 5I8YA 1ULDA 1POV1 3L2YA 1AYM2 4RR3B 2EA7A 1IHMA 1YYNA 3WP6A 4K21A 1OPOA 3H1MA 4AHYA 2UWBA 2SLIA 3G6JB 1ENSA 1WGPA 5F1RA 4P14A 2I74A 1CN1A 3MDPA 4OI4A 2NYYA 3FJSA 2XKPA 5BUVA 3SNMA 1QOOA 4AHZA 2OZ6A 3KS7A 4M0HA 1VJ2A 4YM2A 2A3YA 4GWMA 1MR5A 2GH8A 3MLKA 4WM8C 5T50A 2TEPA 3SLIA 4PIYA 5HXVA 1D4M3 1RGSA 4W6YA 1DGWX 5BNNA 1N3OA 1EAH2 4S2FA 3TN91 2XKOA 3ZMOA 4FSJA 3AMNA 1RVF3 2XH6A 1AL23 5A32B 2WS92 4ZU7A 4BIFA 2WFF3 1RMU2 4KG0A 1UX6A 1K5MC 2H0VA 4QGLA 1QJU2 4K40A 1DGRA 3GBGA 1J3PA 2P37A 1MACA 4YZ3A 5EYXA 2PYTA 4DY5A 4XF4A 1MZ6A 3WP5A 1O91A 1NQJA 1AR63 4AFMA 1SMVA 4RHV2 1RUJ2 4COWA 4V1PA 1LGBA 1QXPA 1PIV2 3SCHA 2RS13 1RUG2 1H4GA 1YIFA 3NV3A 4ASLA 2WZR2 2HEYF 2CYFA 2QKDA 3AZYA 5GKAC 1C1LA 5F5QA 4F83A 1FMD1 4K7JA 4MUVA 3D0JA 5KC5A 2GMMA 1YLLA 4Y20B 1CQ9A 3GNEA 3NKTA 4XMAA 2Q8OA 5GZCA 1JH5A 4XQDA 1XNDA 4YGCA 1W0OA 5GLTA 1XRUA 4GH4A 4KWKA 1PZ8A 2IC1A 2WIIB 4HN0A 3MFAA 5DZEA 4GWNA 5LEJA 4Y4YA 1MZ5A 4OVEA 1VBC2 2I45A 2DU1A 1N1YA 2D43A 4UW3A 1EYBA 3ZSLA 4HSLA 3U11A 4FXGB 1S1AA 1LU1A 1Q8VA 4MSVA 1QJY2 1W6MB 3S30A 4IEYA 3E6BA 5JOYA 1AL0G 4LBQB 2C9AA 3CNAA 4I0WB 3P3NA 1LKNA 5FO8B 1TMF2 1ZA4A 4XJZA 2VOWA 2BNNA 3CJIA 4NPRA 5I0TA 4OULA 1NOVA 3TN93 2GU9A 1QOSA 2RS12 2XJPA 1OQDA 1NY71 4LE4A 4FVVA 4JGZC 5IUQA 2EXIA