2ZHOA

Crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
151
Chain Sequence
b'DKAVTGVALDLDHAQIGLIGIPDQPGIAAKVFQALAERGIAVDMIIQGVPPSRQQMAFTVKKDFAQEALEALEPVLAEIGGEAILRPDIAKVSIVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPAEYAEAALRAVHQAFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Crystal structures of the regulatory subunit of Thr-sensitive aspartate kinase from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 34
structure length 151
sequence length 154
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zhoA01
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zhoA02
3KWMA 2FGCA 1Y7PA 3P96A 2JHEA 2ZHOA 3AB2B 2J0WA 4M8LA 5IS2A 1RWUA 5T41A 4LUBA 3MTJA 2QRRA 1LKZA 1PSDA 3ENQA 4GO5X 3S1TA 1SC6A 3ENWA 3AB4B 3TUZC 4X84A 3DHWC 3OFGA 2CDQA 3O1LA 3TUJC 3L7OA 3DDNA 1YBAA 5IT0A 2PA3A 1M0SA 3HHEA 2PC6A 5JJBA 3N0VA 2RQKA 3MWBA 4GMKA 3IBWA 2NYIA 2P9GA 2MDAA 2LVWA 2RE1A 3CEDA 3W7BA 3AAWB 3OFHA 2F1FA 1UJ6A 3U7JA 3IXQA 2KO1A 3LOUA 3UW1A 1LK5A 2QMXA 2I9SA 4NMLA 3MAHA 1KS2A 1ZPVA 2RQMA 3OBIA 3K5PA 1U8SA 1LK7A 2P9EA 2DT9A 2P9CA 2JOQA 5FIIA 4PWUA 4IO1A 3TUIC 3OFFA 2DTJA 2F8MA 3OFEA 5IT4A 2H9ZA 3DC2A 3LUYA 4GO7X 1UJ4A 1XTZA 2LQJA 1YGYA 2QSWA 1O8BA 3ENVA 2QMWA 3NRBA 1UJ5A 2J0XA 3DHXA
chains in the Genus database with same CATH superfamily
1S9EB 2PO4A 1K0TA 3P8BB 3PY8A 2CQDA 2A18A 3HHLC 3M6VA 1U1PA 3LAKA 2I38A 3ET6A 1YBUA 2XM3A 1OMSA 4P2MA 2XB2D 1Q86T 3Q8SB 2RAQA 2EC0A 3QRQA 3EGZA 1FA0A 3PDNA 2LKZA 3LF0A 5L1LA 1RKJA 3H40A 3FRZA 4DV1J 2JH3A 3U1LA 4FZVA 1LW0A 2YWKA 1ZH5A 5J2PA 2FIUA 1RQ0A 1VDHA 3R9LA 4MKVA 1E6VA 3AD9C 2VBXA 5LMNJ 2OHDA 4PQAA 3MCSA 1TUWA 3VAJA 1RLCL 1EHWA 2YWWA 4JV5J 3R5JB 2HBYB 4A8MP 3GFXA 3KJVB 1IUJA 3ISZA 3P3DA 1YJVA 1UA1A 2D69A 3G6XA 2LXFA 2C2OB 4FYVB 5HJXA 4H4KA 3BB5A 3D2WA 1FJEB 2VU5A 4K4XA 4UUXA 1NPPA 3KJVA 2M88A 3P45B 3N28A 4PAAA 3NGRA 2ZH3A 2SXLA 4OHYA 3PCOB 4C0BA 4WCEQ 1TV6B 3VR1A 4LF2A 4WYLA 4RW6A 2BM0A 4OJGA 4DCPB 2AWZA 3JTNA 4GC7A 1XC9A 4QU7A 3AOAA 5F8NA 3IAS9 1IKWA 3CF5Q 3DLHA 2VICA 1PBAA 2UUAJ 3HHLD 4W98A 1RISA 1ZAWA 5B0DA 2MPUA 1S99A 4ZIVA 4M5KA 4RWXA 3PZPA 4MYTA 4U96A 4CH7A 2BRKA 5D4OA 2Z58B 1NHUA 1Q8LA 4OYXA 1DTTB 2HS0A 1PJ6A 2HZAA 2ZC3A 1FWPA 4EO6A 2HGNA 1VRUA 1LWXA 3TYTA 2HSEB 2J0WA 2DHAA 3C14B 2J6UA 5DDPC 3W9HA 3DRSB 3QZ7A 2KFZA 1H38A 3FEXB 2CVEA 4YS2A 2RU3A 1ZZFA 3CCRS 2V2KA 3SQOP 2DGSA 2FJAB 4MT1A 1TKZB 3Q8VA 2HEKA 1VISA 3JQMA 5F8GA 4O3PA 4CI0B 3MCMA 1EETB 1FFGB 3AAWB 3HVRA 1PCAA 2QFIA 1OPIA 1DRZA 2OP5A 2XG8A 3AXKA 1NK0A 6AT1B 1KQKA 1ZM4A 5DJBA 1VBYA 4LFCJ 1TL7B 4HYKA 2ILZA 3O3LA 4YHHJ 4ZS6A 1S7HA 1Q8BA 1D0EA 2ZBRA 2YH0A 4P52A 1RWWB 1FNMA 3UQSA 3PRBA 1ZAVA 2F4FA 2HBRB 5GADI 5FJ4A 2Q1LA 4ZCMA 2ZBPA 5KFEA 4FXDA 4N7TA 1XN9A 2AGQA 2WK4A 1LW2A 2DK2A 3W65A 1VJQA 3V81B 2MQOA 3OVAA 3N6LA 3W60A 5AXNA 3V81A 1XMQF 2OGUA 2F1FA 1A9NB 2QX0A 3N79A 4DL7A 2I1RA 2OO4A 1X9WA 4ZN1A 4BHQA 4OI1A 1JLFB 1BQNB 4RW4B 3M2UB 3SSSA 2EFPA 1MWZA 3JYTB 3F56A 1KD1T 2O3DA 4WE1A 4EMDA 2C2RA 3V6JA 4DF4A 1NB2A 3M8WA 2FJEB 3RRKA 2MKYA 2ZBCA 1H98A 1W7WA 3M2UA 1S49A 4Z37A 2JEFA 2AP6A 4WFZA 3WIUA 4KGVB 4OX8A 3P49B 2EKYA 5D77A 4CH1A 3LP0A 4JI3F 2UVVA 2QGFB 3MPYA 2N4CA 2Z8QA 1JJCB 1VQNS 3L09A 3CJ8A 3D1OA 4GO5X 1HNIB 2EFNA 1RYRA 5E7OB 4C0OC 5IV4A 1HHTP 1WC5A 3BSCA 3UCZP 4ZPBA 2CQ3A 3FZBA 4F02A 5D4PA 2XNRA 5DQGA 4HI2A 3EVMA 3CJ2A 4Q44A 1OYEA 5HROB 2BBEA 4ZPWR 1TKXA 4KKOB 4F26A 1EP4A 3CCLS 1CG2A 4WK1A 2W2NP 3RAMA 5KT3A 3W3SA 4QIEA 1RUSA 1RT3B 2VBWA 2E1PA 3R7BB 2IVMA 4I69A 5ADZA 2E9RX 4NA1A 2B43A 4UOHA 4KKOA 4WU3A 4LF5J 4FNHA 2P8IA 2GHVC 4RW9B 1RT3A 4DV4F 3J7A1 2IBKA 4EWTA 1XNRF 3OTOJ 2DCUB 4TYBA 3T1AA 2LFVA 1NKEA 2DBBA 1JK9B 3HHLA 1NK7A 1Q95G 2YPZA 2FD2A 3NG8A 2FVQA 4FYXB 5IV3A 3T6BA 3C16B 4HI1A 1CPZA 4R8UA 1LQ9A 3UWTA 1FRJA 2MQPA 2CPIA 4ILLA 2PC6A 2PEHA 2JC0A 1SL1A 1GX5A 4KPYA 2Q6CA 4C8OA 3C16A 2I5JA 5CZXA 2LU2A 2YKNB 2DHXA 3R5BA 4Q7AA 3KG0A 3TEGA 2D7SA 3HPOA 3ILIA 4A47A 2OSQA 4ETZA 2HZVA 2IM2A 3A8JA 4JI4F 3R5CA 3NNHA 4E0DA 3PX4A 4P74A 1GMWD 2DJWA 2HHQA 2QE5A 2R2UA 5M2RA 3A3NB 1B0PA 3TARA 3M9MB 4O3QA 4DR1F 2MSSA 2VFTA 4Y34A 5LXYA 1S72S 1TFWA 3FCVA 4FPIA 5A76A 4ED2A 5KT7A 2HBQB 4JI0F 3KUGA 4CT9A 4NLYA 2XTJP 1HQEA 3KUEA 3UDLA 2M0GB 2KTQA 3VAGA 5HAOA 3A8IA 4OI4A 1C1CB 4ZN3A 5A2QU 2DR5A 1MROB 5GVQA 2K2PA 2HBZB 4JV0A 1VR6A 4N56A 3UCGA 1YVFA 3GONA 3GWCA 4RUAA 2D3O1 5KFXA 1HQUB 3TR5A 2KB2A 3DI6A 3K2YA 1XMOJ 1MROA 1OY8A 1XBWA 2IAJB 1S57A 3DLLQ 4X62F 4M63A 4CNYA 2NCKL 2VG7B 1VC0A 4QOTA 3HVWA 3CJTA 2OJ3A 2H5JB 3PR4A 5J2QB 1L3VA 4BC9A 2UUCJ 4I4BA 1VLYA 4YFUA 1CS4A 1VQPS 3D0IE 1HBMB 3HJFA 2BE9B 2CPZA 4CYUB 1NCLA 1UVMA 4TNOA 2JHEA 2AD9A 2KFNA 4FBTA 3VALA 2RVJA 2B4PA 3QRPA 2IRYA 2DRDA 3DYAB 2V67A 2XZDB 1DAXA 4CYUA 4M5GA 2GCFA 2R2SA 4TU7A 2PI5A 2J0QD 5LSRA 4JV5F 2G0CA 1FEEA 2E29A 4CLYA 1NXIA 3J80U 4LQ3A 2DR8A 1T3OA 3LAMA 5DZ6A 4LF9F 2EFOA 4YDDB 3HVTB 4BWMA 2CDRB 1SV5B 2JX2A 3CNQP 5G0RA 1U1LA 3NKYA 4IOCQ 4WZQA 3RR7A 4ERDA 4C9DA 5BJRA 2YTCA 3HVTA 3EWGA 2Y8YA 3H25A 1WHVA 2XY6A 2QYCA 4OYAA 4AL7A 4C0HA 4DWIA 3HZEA 3L95X 4NYZA 1VFJA 1AB8A 1H3DA 2ZJQQ 3M30B 2JEGA 2CPJA 3OLAA 5LMUJ 5F8IA 1SPBP 4X64F 3CJ5A 2C3PA 4I6YA 4IDKB 2CPDA 1SKWA 3J81U 3H2VE 2GIFA 3IRXB 1WSRA 3QWPA 2BJ9A 3ZO7A 2I8EA 1YRXA 2OI2A 4DFKA 5CABA 1AFJA 4YR3A 1QSSA 4USHA 3FJ2A 3PTWA 2R2RA 1FXLA 3ILLA 3TQ1A 4IDKA 1VHFA 3VVTA 2CQ4A 4GKKF 2KYXA 2WTFA 3IRXA 1IBLF 3OUYA 1YKWA 1UEKA 1FKPA 4EYHB 3C15B 3SFUA 3SEOA 5KFGA 3TW0A 1X4CA 2AQ4A 4NLUA 3BH7B 5E3AA 2DNRA 4UQTA 2JFDA 4K8RA 3QPIA 4OZJA 3MEGB 1WORA 4U9RA 4C8KA 1VQ4S 4M95A 4DZDA 3QGIA 4M5HA 1F9FA 1N5VA 1BY9A 4DV0F 2GQCA 3HFVA 1F60B 1FESA 4LF8F 3UPFA 4OV6A 4IO9Q 4EYIB 4Y2AA 3CDWA 2HVZA 2IJRA 4UOCA 2GQ2A 2XWYA 1KVIA 3IAM9 3G6YA 1YDLA 4LF6F 3RBZA 1KBRA 2L08A 1ZM3A 4LT6A 1OY6A 4ZJLA 3VGSA 1TL5A 2DGUA 2DGTA 5HANA 2Z2ZA 4K4UA 1NZ8A 5L8RC 2EG1A 1FXRA 5A8KB 2HQGA 4P2SA 4F50A 2CPEA 2DGXA 2QA1A 3OFGA 2MXYA 3DRYA 9RUBA 1UW4A 4YHHF 4C3MA 4RNOA 1U48A 3I0RB 2AV5A 3THVA 4HEA9 5H1SV 2CJKA 3OFHA 4X2BA 4URSA 1JIHA 3MUVP 3J7Z5 1WEXA 5F8HA 1FKAF 3WQPA 3I0RA 4TQRA 3MM6B 3TO8A 2XLJA 4DFPA 4NLRA 3CSKA 5DZ7A 2YKAA 2G1DA 1U0HB 1NSKL 4N41A 2A0FB 4U95A 1TR0A 1NDLA 1RKIA 4JUZA 2QA4S 2CPXA 3TA1A 1T03B 1NK5A 2QL9B 3NRBA 3CCUS 3W5ZA 4DF8A 2KT5A 1MN9A 2HHSA 2R7RA 2V9KA 4CLUA 2CIMA 1NBEB 2LLZA 2VASA 2B8QA 2NXNA 4DDFA 4WJBA 3AD7C 1QVFR 3HLUA 4XPEA 3QWUA 1JB0C 3T1HJ 1U6ZA 2FHJA 3GIKA 3BGUA 2JNJA 2FZKB 5DM6Q 8RUCA 5KTQA 4J90A 9ATCB 1N36J 4MKAA 4TVAB 4X4QA 3N0VA 1NDCA 2EEYA 1WD6A 4E98A 3Q0AA 2RHQB 3OJSA 2KO1A 2UVRA 3KLEA 4CT8A 3BGRA 2KXHA 3ZZUA 4C4WA 4DR4J 2RUGA 2RT3A 3RB3A 1EQMA 5IT4A 5CYJA 4RL1A 2E44A 5LXRA 3CWJA 3RYLA 1HNXJ 3JSMB 3QNWB 3C6TB 4C11B 4DQSA 4KTQA 2CZ4A 5FLXU 3UN3A 1CQMA 3DFEA 4ZPTR 2VFUA 4OMFG 3PV8A 5C24A 1T02A 3LA0A 4LF5F 2XZWA 1T7PA 2ZH5A 4ANCA 3TI0A 4C6AA 1KQFB 2A2DA 2IJFA 4FVCA 1ZM9A 2ZDPA 2XYHB 4PG7A 5GAEI 2V69A 5EX3A 1G6BA 3Q8RB 2ERRA 1IWAA 4ZPAA 4JI5J 2QZ8A 2RH3A 5C25A 3AA8A 2GAHC 4B9LA 3DDIA 3KLIB 2BDPA 5KFCA 2M5YA 2F5GA 3C8YA 2ALZA 2I0XA 1HD0A 2QV6A 1WF1A 1GH8A 2BJ7A 1RBOB 4JI2J 1F6TA 3B4MA 1XIQA 1NRKA 4N8OA 3SBMA 4O3NA 1RT6A 2L9DA 3MCOA 3BN4A 3ENQA 5CYQA 1W25A 3NCRA 1SKRA 1MW7A 2J6SA 3FK4A 1HNVB 2YH1A 4KGMA 3QT8A 1EJ7L 4C8YA 4OYZA 3CCMS 3A1YG 4DCOB 4FS2A 1B0VA 2XLKA 5CQGA 5KFQA 4M5MA 3DRRB 1UVLA 2Q66A 2C2KB 4I2QA 1JLAB 2V8HA 4CO4A 5GMDA 5A8RB 2CQIA 5KFRA 2AGOA 3ZXWA 2F40A 2G13A 2VBZA 4DUYF 2MEWA 2AW0A 3D66A 2ZFHA 1B70B 5E3QA 4NOHA 1U1NA 3DRRA 2E5LJ 1N5QA 3IG1B 4MIBA 1N6QB 2A2CA 3THTA 5A8RA 2C42A 4F3MA 4WF9Q 3O5TB 4LFAJ 1NPRA 5LT5A 2HNYB 1S59A 3WX4A 1LWCB 4V1Ak 3G82B 3UDCA 2RS8A 4Q43A 2ADBA 4OFZA 4X65J 1HMVB 1WUUA 3CPWR 1C0UB 3CD6S 4OHZA 3R5AA 2VG6B 2RMLA 4ZHRA 1HHSA 2C22A 1QAYA 2W2PP 3M6XA 3G86A 2KKHA 2E5HA 1TUGB 3MMCA 2UUCF 2M70A 4KH1B 3H5YA 4WKRA 4IFVA 1KFSA 4ICLA 4K4YA 3OW2R 3W2VB 3BH6B 3UR3C 2ZZNA 3DRPA 3D6TB 3BKTA 4CO0A 4NMLA 4ED0A 3W2WB 1SQGA 2BA9A 2C3UA 4RU2A 2W4CA 2M2BA 4K2XA 4HTJA 2C2EA 4DPXA 1FO1A 2FUG9 2QO3A 2YWFA 3DC2A 3D5MA 2DY1A 3W2WA 2J7WA 2OFHX 2QA4G 1LWEB 4KAIA 5DDQC 2KZZA 2FGCA 2V5HG 3NAIA 3QO9A 2KHCA 5I3UB 5H9EJ 3H5SA 3AFGA 1KVJA 2RD5C 4OJ3A 2ZNYA 1PYOB 2DYAA 3GJRB 3D0GE 2BKOA 3PM9A 1D8YA 1K8AT 1HYSB 2GVDA 2LQ5A 1U1RA 4RU9A 4G1PA 1S1TA 2V2QA 2Y1LB 1X60A 1OIAA 4TQSA 1JXLA 5DRKA 4LSLB 1Y3JA 4N8NA 1GTHA 4ZVOB 2MKKA 1K44A 2DO0A 4A8WA 2BM1A 1RTIB 5B0EA 5LJ3Y 1HW8A 2CZVC 4DR3J 4NCGB 2DNGA 3T19A 1BWEA 2VC1A 1NZAA 1NH8A 2DRAA 1CQNA 4U6PA 1C4AA 4DS5A 4ZLLA 3TZYA 3MR7A 1L3UA 1HKAA 4ZP9A 5BR8F 2J0XA 2HK2A 3TEHB 3R97A 1VGYA 5HBMA 4I2PA 4ATNA 4G1QA 4AL6A 2BE2B 2HHHJ 3W9IA 1X7VA 4QWAA 1HBOB 2H54B 3I9V9 3QJPA 3DM2B 4HDHA 2CDQA 3CXCR 2BE2A 1MWQA 4DJBA 1UWAA 4DQIA 1WC1A 2HHTA 2GS8A 3O6QA 1G4CA 2ZUAA 1AYEA 1HBOA 1K9MT 1SQEA 4LVOP 5AJ3J 2W2OP 3PKYA 1ZYQA 3CJKB 2HFOA 4ECRA 3OTCA 4JI1F 4URGA 1VBKA 2HQCA 3MAHA 4NYOA 2AJ4A 1TUVA 1RWNB 3PW5A 2ZVIA 4RUHA 1VBZA 2W2MP 3G96A 1VS3A 3C6UB 3UD5A 1RHQB 5C42B 2KG0A 4DR5F 1RAHB 3OFEA 3KK3B 2KHDA 5DLGA 2MQ8A 3TVKA 4NI2A 4TKTA 1N32J 2GZOA 5IWAF 4G3IA 3VQTA 5C42A 3MFHA 3FCWA 3SDEB 3Q8UA 3KK3A 1M90T 2GMHA 5DQHA 2R9LA 3CT9A 3DMJA 3P5TL 4CLSA 3DGPB 3CB4A 1Q81T 3QGGA 5C2GA 3TQEA 1DLOB 2NLWA 4KY3A 2CQHA 4ZITA 4EO8A 2ASLA 2X3DA 3ZTPA 2HHXA 4PG5A 1RHMB 3AT1B 3DGPA 4ZPVR 1JLGA 2GGPA 2NSBA 3KLGB 1DLOA 4RBVA 3EGVA 3T9NA 2ZC4A 4LQ9A 4W90B 5J1PA 1RAAB 4WU2A 3TAMB 3PKMA 3MOJB 2KVIA 5AT1B 1TKTB 4NMXA 2NSCA 2FVPA 2LXIA 1X4GA 1IBMJ 1RJJA 4TLRA 2HMIA 3PYFA 4G6VB 4F8RA 4FS1A 1Q16B 4H4MA 1BQXA 1TKTA 2HLUA 5K8MA 3G2XA 1M1KT 1O51A 2CPFA 1NSQA 3LWLA 3GJSB 2HYIB 2KJVA 1HNZJ 5HSPA 3GE9A 1G7CB 2P6SA 4B9TA 2LMIA 5I4MA 5T41A 4OIXA 4DZ6A 5KG5A 2K8GA 3CE8A 1REVA 2M52A 2W4DA 4WP8A 3E8OA 1FRHA 1ZZNA 3TA2A 3MURP 3FVYA 5ETRA 4F04B 4NLOA 4OX9J 5JJBA 5LOQA 3ISNC 4DL6A 4U7UD 5EDWA 4F3QA 2VKRA 1U2RA 1IR2A 2VA2A 2AEFA 4DPYA 1SVDA 5I42B 4JI6J 3JQJA 5HQ8A 3CUNA 2YY3A 2MZRA 3CIMA 3GIRA 2HK3A 3EVWA 4ID5B 4M5JA 2CQ2A 1SC3B 3HHKA 2D3ZA 2GIRA 3N5FA 2GMJA 2H1YA 3BR8A 4CTAB 4U7CA 4LFBJ 4NEYA 5IOLA 4KBIA 1LWFB 2XSJA 4ZVTB 3M6WA 1DURA 1KDNA 4DR7J 1F2HA 4RNMA 1CC7A 1KR4A 2XBPA 3M6UA 2W8LA 4YQWA 5BYSA 3CMQA 1QAJA 2OH2A 3ZFVA 2HHVA 1OSCA 1T9XA 3MOZA 2BANA 3ZZOA 2J7UA 3CCES 3NS6A 1S9GB 5J2NB 5B09A 3PIOQ 3H8YA 3H5XA 4L3KA 3KLHA 4P72A 2R8JA 3NS7B 4J37A 2LQBA 4G65A 2ZEJA 2P6TA 1Y5LB 2FLLA 3E2EA 4OJ1A 3DKDA 5J2NA 2F4VF 1RK8A 3SCKE 3CO0P 3EJMA 2VV5A 3TJ9A 1RT2B 2GW8A 4GKJJ 2E7VA 2HGMA 1X5TA 2ALYB 2RDJA 2LA6A 3GV7B 4Y6IA 1QAXA 5L46A 4PUOB 3ISND 4ES1A 1RT2A 5GADU 4Y3CA 2LEBA 3W5XA 3GFYA 2L9WA 4LUBA 4CIOA 2HVIA 2AJQA 1SC6A 4MIWA 1SCJB 1VLOA 3LGHA 4QYRA 3LP1B 2QLFB 3G87A 2J9EA 2NXJA 2QN6B 4ES3A 1R8AA 3OTBA 1ELOA 4QWDA 3SSRA 1IR1A 4DPOA 2MYFA 2UXCJ 3I5AA 2OIHA 3K0JA 5A2QY 3LANA 4BDPA 4DU8A 4WIQA 2IPOB 2P9GA 4USUA 1R7IA 4UT4A 1H6KX 2EK6A 3B82A 3HCXA 5KFDA 2RF2A 2W4PA 2PFFB 2Y9HA 2WSFC 2OPPA 3SQGA 5ETMA 4DUZF 1IBKJ 3EX7B 1X4DA 4LRFA 1QTMA 3BYRA 2HQIA 2Y0BB 1S1WB 2X1FA 2CWXA 3D1HA 2HAFA 2IVYA 1CBKA 5M2PA 1YG0A 5ETTA 3NGDA 4L72B 4ED3A 2QEXS 1I1GA 2VIHA 1EARA 2Z30B 3FSYA 1FE4A 1S1WA 1BHNA 2KRBA 1YJWS 3I9ZA 2NPIA 2UP1A 4DLGA 4KV8B 4M5LA 3K8VA 4PG4A 1GTEA 1S79A 3T1YJ 2ZBQA 3OT9A 4B17A 2ZUGA 5FDLB 2WAQD 1DHMA 5KFZA 1YQHA 1SJQA 3POTB 3J80Y 4LRCA 3KHHA 4C2MA 3HFKA 4ED8A 5HP1A 4JYAF 3MXHP 2ROEA 2RE1A 3US5A 4S0MA 3LOUA 2AEMA 1HLWA 3POTA 4NXNJ 3C19A 4HH0A 2ZOMA 1NKCA 3SCJE 4TU9A 2W1BA 2QFJA 4J9QA 3WBZA 2K1RA 3FBBA 3IR6B 3M9NB 2VJVA 2DPJA 4CM2A 4W4MA 5DG7A 2AKWB 2MKSA 2K3KA 2UXDF 2ZWOA 3HHDA 3TVZA 3EXCX 2VG5A 2VPXB 4WXWA 4TN2A 5K20B 2ZHOA 3KK1B 3UVJB 1RT4B 4WFBQ 2CNNB 2D1CA 3J81Y 2BXJA 1JKHA 3MHYA 2W9AA 1FX4A 1PAUB 1NK8A 4RPFA 4IQMA 4OI2A 3RB0A 3UVJA 5DG8A 1JLCB 3NCPA 4AXIA 1UEUA 4DCJB 4ZVEA 4OZ5A 1NDKA 2MDAA 1HD1A 3CJQA 1S6UA 2MJUA 2ATCB 3MM7A 4PR6A 1N33F 4DOZA 3QLHA 1U8SA 4HLBA 5KFHA 3HD2A 2CZ9A 3V4IA 3CMES 3EPIA 5F8LA 2JEJA 3EVOA 3VAKA 3MDFA 3T41A 2Q3PA 1LV5A 1VK3A 2ZHBA 3HSZA 1YJTA 3UN5A 3IS9B 2BOAA 2CYYA 4OYIA 3ENAA 1KOOA 2L3MA 4DI6A 3H2UB 4KFBB 3FEYB 1FRIA 3ZNUA 3AB2B 3EZUA 3IS9A 5KT2A 4AYBD 2OAUA 5D3GB 3GP9A 2ZM6F 1RT1B 3OTDA 1TP7A 2GO9A 1SBRA 1Y4ZB 8AT1B 3A3PB 2HZCA 1GXTA 4EZ9A 1JMTA 1RHRB 2HGLA 3ETOA 3V6DB 1RT1A 2B9EA 3VWSA 3R5GA 5CAAA 4A8XA 1JLBB 2KZMA 5IXUA 3MMAA 4TYAA 2FJBB 3PIPQ 3CJSA 1V3ZA 1C2PA 1T8EA 3R7SB 1FJGF 4I7FB 2RQMA 3JQKA 1RDRA 3PHTA 1KEKA 2DVIA 4K4ZA 4K50A 3PW4A 5EWEA 4WZMA 4LRAA 2XCAA 3IFEA 1NU4A 2B0GA 2M3DA 1JLQA 3MEDB 2H4WB 3NBPB 4Z7YA 3CTRA 1TVRB 1PYSB 1JLEB 1IR0A 3PVXA 1U1KA 3CDUA 2UXBJ 2MQLA 2NREA 2QJ3A 5L1IA 1R8PA 1YK9A 2YXLA 3MEDA 4W92B 1WDTA 4L73A 2H3EB 2ZD1A 1TL3B 5GAHI 4CP5A 3RAXA 1KQGB 2DNHA 2Z2YB 1RAGB 1X4BA 3OTEA 3RJMB 1HHQA 1PG5B 2B56A 2UU9F 1UVIA 2DNOA 4E2FB 1TL3A 5HLFB 4O44A 3WC0A 2V4JB 1HL6A 1NMEB 1X0PA 4ZCKA 2IMWP 1IKYB 4GVLA 3R2CJ 4OLOA 1XQIA 1RTDB 4K4SA 1N88A 1HBNB 4DSFA 1QSLA 3NGKA 5JUMA 5I3QA 4LR9A 2GC8A 2DT9A 1IKYA 5DG9A 4O0IA 2EI5A 4DLEA 1Q5YA 3M1VA 1RTDA 2Y0SD 2LA4A 3TAPA 4DR2J 1IQTA 2IC3B 5EWGA 3HF5A 3AODA 4DR6J 1SJ4P 2E7XA 1TAQA 2XMUA 4Q0BB 2V34A 2HQFA 3W8PA 1Y7PA 2OPQB 3ADAC 4R5PB 4J9LA 5H9EK 3VTIA 2B4UA 5FLXY 1V5IB 1G1XA 5HVFA 5KFNA 1K1QA 2CPYA 4CO3A 2OPQA 4R5PA 4LSNA 2UVUA 1CEZA 3UDEA 4TU8A 5B08A 4ZVHA 3DLEA 1W2IA 2DGVA 5J1EB 2XMKA 2DXEA 5A8WB 4DQQA 4YR2A 1ICEB 1H0HB 1HNWJ 2CG4A 2RIJA 3MFIA 5J1EA 2QLWA 2PIIA 4K0KF 2VD3A 1SC4B 3BBCA 1NPKA 3M8PB 1S0MA 3DOMB 2ZNZA 1R43A 1DQAA 3G8QA 4QQBA 3K59A 3UI3A 3PYEA 1MMDA 1UJ5A 1REGX 4RW7B 2LEPA 5IM0A 2CKWA 4Y2CA 4NA3A 2HKEA 3ZZTA 4B3OB 2B9XA 2XMMA 4KYZA 2OTLS 4E8UA 3TUZC 4UOFA 2L41A 2A1BA 2LU1A 3BQ2A 1IWGA 4HL9A 2FVRA 1U4BA 1SKUB 1GK8A 2C2NA 4DX8H 4B3OA 3Q8YA 2MKIA 1MU2B 3IC1A 2AF6A 4Q5VA 2N7CA 2AJ0A 4ALZA 2XGQA 1ZPVA 1LK7A 1DTQB 4F0KA 3S8SA 2YNGA 1MU2A 3TUPA 1R27B 4WYWA 2MZSA 4TLQA 3Q22A 1KQSR 2JLGA 3KHRA 3N6NA 2IBOA 5DM7Q 1O5JA 1RBAA 2AZ1A 1FRMA 2MY8A 3BGOP 2MGZA 3A8KA 1PC5A 4FXVA 3OPKA 2JWNA 2R7SA 4PWWA 2XO7A 2K7JA 3CJ4A 5ITHA 4AQYF 5L38A 3K57A 4K5RA 5HMXA 2OUGA 1RYSA 4FF2A 4LBHA 4F4KA 3IO1A 3OR2B 3TUJC 3M2VB 3OHAA 4F0HA 1R8BA 5B0AA 5C5JA 2IA6A 3RGIA 1VQOS 1RTJA 1KRPA 2YKMB 5A6PA 2LVWA 2DNNA 3I0SB 4NRTA 2GJIA 5CHCB 4FNIA 3A8EA 2KT2A 3WDOA 4O3OA 2DNPA 3K5PA 2FY1A 4IKAA 1JNRB 2V8GA 4L6V3 2BW7A 4U8VA 1J5EF 1TK8A 4UY85 1F1BB 3TRGA 4ECTA 4WK3A 2DEJA 4OZLA 4EEYA 3SV3A 1FVQA 3N5BA 4OV1A 4PEOA 4F7VA 3QAEA 2OPRA 3KKFA 4ZDNA 2XC9A 4DG1A 1GXLA 4NWBA 4OZ0A 1G3OA 5BYQA 1LW0B 1N34J 1JJHA 1H2VZ 5J2PB 1VI7A 2DD8S 4M94A 2F3JA 1E6VB 2J5AA 3PX6A 4NXNF 3E01A 3PW0A 3V6HA 1JJ4A 1RHJB 2OEMA 5MLCV 3JTPA 3RUBL 4DV7J 1PO6A 1M0SA 3NLCA 4ANEA 2HLTA 2R2TA 4J9SA 3W62A 5CYMA 3EMTA 3MMBA 3T6JA 1TL1A 4IH6A 2VF3A 4H54A 3LP2A 2IM1A 3N01A 1RWVB 3BR9A 4WFNQ 3IP0A 2BV3A 3KNGA 4R0JA 2MLXA 3PXGa 3HHNB 1RWMB 3CCJS 5K14B 1S6QB 4RW6B 2C28A 3EGWB 1B99A 3FFIB 5LJ5Y 4NXMJ 3S6EA 2QT7A 1IKWB 3KK2A 5T7LA 1WC4A 5K14A 3QATA 1S6QA 2ZZMA 1NJYA 1HPZA 2RKIA 1K0VA 5HJYA 4DFMA 4AXJA 3FFIA 4CM0A 4NZ6A 4ES2A 1HI1A 3A12A 1Q7LB 4KT0C 2V0NA 1UL3A 1AT1B 1BLUA 1U2CA 3HKWA 3SIPB 1YX2A 4LBIA 1XR6A 1RSCA 3LQVA 1VRUB 3TWZA 4HKQA 2OSRA 2XY7A 4A8KA 2BE7D 3LALA 4A8YA 4PPZA 1R3NA 2MJNA 4N47A 3OBIA 4B3SJ 4EFAC 1YI2S 3MM5B 5F8JA 2J6TA 4B3TJ 1M5VC 4QBUA 1FDDA 2QTWA 4Q8EA 1F5AA 3RB4A 3QGPA 1CJTA 4B08A 4CLZA 3H0PA 3MM5A 2QSWA 1O8BA 4QCLA 3J7ZT 1IKVA 2XGPA 1J5OA 1N5YA 1R89A 4LBPA 1YWXA 3OL9A 2VPYB 2ZH7A 3H20A 4DPTA 2BKPA 3HO1A 2ATLA 3PO4A 3DLKB 3FSIA 2BQUA 2BJDA 4ZPCA 1NLKL 5HL7Q 1XNQF 5KG2A 5DLFA 1G2EA 2H5EA 3K58A 4FP9A 2KU7A 5E3RA 3ZZRA 4PPDA 1U26A 1RE1B 3DLKA 5KFYA 2YWHA 5KFFA 4IR9A 4X66F 2ZOGA 3MWBA 3IBWA 2U2FA 2UXBF 4L76A 1U0SA 2CNOB 5KFJA 2XYPB 5IZHA 3OLBA 3VGTA 4AUKA 4NLSA 4PCQA 1GAOA 2O66A 4DL0C 3KLVA 1TTHB 5AXLA 7FDRA 1LW2B 2FZGB 3FMBA 1UZHA 3BN7A 2OMOA 2AJ2A 4K5SA 4B9SA 3TJ8A 3NGUA 2GV1A 2ZWPA 5A0YA 3EUNA 4ZMMA 1UFWA 4CLPA 4KGKA 1WDDA 4IOAQ 1EQ0A 4OX7A 1NSPA 4J9KA 3GG1A 3D28A 4J9PA 1RWUA 3J7YU 1T11A 4KIAA 1A7GE 2DR7A 4HHHA 1LOUA 5ETOA 3DLJA 4WP9A 1X0FA 5DQIA 1TAUA 4WE1B 1D09B 3AQPA 4P73A 4DR6F 1F3VA 1PBUA 3NNCA 1SJ3P 3DOKB 3AXMA 2G2OA 4MTPA 1M1GA 1EKRA 2EBEA 4GMKA 4ZVUB 4JI7F 5K8OA 2QC3A 2XWXA 2IJNA 1Q0NA 3LP0B 2RQCA 2BW2A 3DOKA 1I94J 5E41A 5IQQA 2IHR1 4NLTA 2MLYA 4O3SA 2QA2A 5F0UA 3VHQA 4HT7A 5HMWA 3MR2A 2W01A 2BMBA 1QVGR 2HVEA 2HS4A 2OELA 2RQ4A 3VF0B 2FHOB 3HDSA 4BWJA 2MZJA 1FXDA 4B9UA 1TKXB 3RBEA 4O23A 3QIPA 5ETPA 1EP4B 3GPAA 1RWXB 5IS2A 4ZJQA 2RS2A 1X4AA 1Z2LA 4CO5A 1VQLS 3Q8QB 5EN1A 3JSBA 3ZZYA 1S10A 2MKJA 3KJQB 3KJFB 1SH2A 4RW8A 3RBDA 3MEEB 4YY3F 2DH9A 2VOPA 4H4OA 2IYGA 3M8ZA 2ZH4A 2MZ1A 3CC7S 1H72C 3BSOA 2B4VA 2D9OA 1IN0A 3NY0A 1HARA 3PACA 3MEEA 3HHLB 1Y9OA 5FIIA 2EK1A 1GEHA 2ILYA 3NGSA 1QDUB 4R8UB 1U24A 4O4GA 4JI8F 3AOBA 1RTHB 1R0BG 1SL0A 3SYZA 1MG7A 4OHXA 2W9CA 3CDBA 3ZTSA 2I5JB 2HRTA 4JV1A 1R31A 2AEJA 4DV5F 4ZVQB 1RTHA 3ICLA 5CD4A 2W7AA 3MTJA 4ECWA 5D0RA 4DL2A 5ETLA 1B7FA 1WI6A 1URRA 2J76E 2IRUA 4U67Q 2F9JA 3H90A 4EZ6A 2D3OR 4HH1A 3RRGA 4KHPF 1R8CA 4IH7A 4WFAQ 4B9MA 2QLJB 2R7TA 2YNIA 1XEZA 1N5SA 4KQZA 3I4HX 2CWKA 2VB6A 2KXFA 3MM9A 4P71A 2VBYA 4J9UE 2Q43A 5M2UA 5HN0A 1T9VA 1T05A 2KFYA 2Z2MA 1M5PC 1HQEB 3CCSS 2ROGA 4IOBA 4NZ7A 2POKA 1FERA 4HDGA 2DO4A 2E1MC 5GAGI 4DSEA 4XTTA 4NYPA 4D3GA 1IQZA 1ZOTA 5HQMA 4DV2F 2AYEA 2BKNA 5L9NA 4NL5A 2HNDB 3I5BA 3K17A 1UETA 1NK9A 1KHWA 3DI6B 1HWIA 1KTQA 4OYMA 4LVNP 1UVNA 2Z2LA 4H4KC 4HACA 2HNDA 4LJMA 2DGWA 3MPVA 3N4WA 3HT3A 3ILOA 3M2RA 1CS4B 5D0GA 3GCWP 4J91A 4QYZJ 4ZK7M 3MR6A 4CLFA 2W7PA 4FN5A 5KG3A 1CJUA 1HWUA 2GX8A 5J2MA 3D1QA 4AL5A 4ED7A 5KG7A 2R3VA 4DV1F 3O2IA 2DNMA 1MWYA 5JVGQ 4ZIWA 4LRBA 3GB0A 4PXDA 1FRXA 4XDCA 2ZKUA 1S1XB 4DU7A 3FRYA 4DX7A 1KLMB 1N56A 3R3TA 1SUQA 4PABA 3LGNA 5LMNF 4IQXA 2BJEA 4Z2XA 4DV6J 2EWHA 2G1HA 4P9SA 2C3YA 3BBBA 1S1XA 4ER8A 3WIVA 5IT9U 1KLMA 1VOMA 3PG9A 5G0RB 1VQKS 1T95A 1RHUB 1PAEX 3B8HA 4M5NA 4NLPA 2CJ9A 2G0IA 3PEJA 1XMQJ 5E0OA 1VQ8S 3IM8A 3NGTA 4PQUB 4L74A 3MECA 3GYXB 2GVZA 3B78A 5L39A 1IXKA 5K5MA 4PQUA 2R7XA 3CD7A 5KG0A 5KG6A 1S6PA 1U25A 4OHVA 2KG1A 3B54A 1ZS6A 1VQMS 2XS5A 1KHVA 2WOMA 2R8HA 2WW8A 1NM2A 4WIIA 2UUAF 4UF4A 1RWOB 1RGVA 2XS7A 3VVUA 4JI3J 3ETMA 3AHPA 3OUYB 4ZOSA 4NEZA 4F4AA 5HK4A 2PDAA 1FHTA 1MSWD 1FKPB 3BF4A 3EZOA 3KUHA 2F63A 3OL6A 3OSNA 4QWBA 4K4VA 4J9MA 3WZ0A 2IY5B 3DLGA 4Q8FA 1SJFA 3IWXA 4TY8A 1EAYC 1RAJA 3R7NB 2RJZA 2DHHA 1C4CA 4YDXA 4CCHA 1PJ7A 3GU0A 1CJVB 3HULA 3GLJA 3L4BC 2RHSB 5IC6B 1SKSA 2ZITA 2MTLA 1IBCB 5SUHA 2KXNB 2IVFB 1HR0J 4Y2MA 1CJVA 2CUYA 3C2PA 1GX6A 4ZVRB 3KMSA 1WC3A 2Z56B 3G4SS 3R6GB 1PIEA 2J0SD 2ABYA 4DV4J 4NPOA 3QJJA 5BYRA 2DTJA 4J9VA 3MGJA 4YB6A 2VH7A 5IFMA 6FD1A 2H65B 4LIWA 2ZE2B 5KFIA 3P6YC 1WC6A 3L9ZA 3MZIA 4CLWA 2KJWA 1VC5A 3DOLA 4ELVA 2AT1B 3BQ1A 4LFCF 1E6YA 4EU0A 3SZ2A 1UMJA 2DNLA 2HWTA 5L9XA 2ASDA 2RRAA 2HWIA 1GMWA 1K47A 2ZE2A 2VONA 2ZHAA 3MD3A 4QIGA 1N5TA 4C7QA 1BGXT 3CCWA 1M1HA 3ENWA 2MHNA 1WHYA 4K4WA 1Y3KA 2FJDB 3Q23A 2PMZD 2P5VA 2VA3A 5CD4H 1DBDA 3SMZA 3V2UC 2X3GA 4XK8C 5E3PA 1SIZA 5K8NA 1VYAA 3I32A 3KDNA 4DX6A 4JI4J 3MR5A 1FKOA 2XMVA 4YB5A 2NQPA 3U27A 4RNFA 2K7KA 3M32A 5D4LA 3H98A 2GQQA 4RR5A 3L7UA 1WTBA 1Y5NB 2XLIA 2M7SA 3J7AN 4BC7A 1VQ7S 2X1AA 2MMYA 4DR1J 2FZCB 2C3MA 3TUIC 4X4RA 4GO7X 3IR7B 2F8HA 1SB6A 2J9CA 1YIJS 4ID8A 4JI0J 4QR2A 4JP8A 4IG0B 2NZCA 4CO2A 4ECQA 4RNHA 4YOEA 1Q78A 4ECZA 2BZ2A 3KLEB 3BGRB 2VJUA 1RI7A 1N0UA 4IG0A 2XMWA 3VGUA 1V6HA 4QPTA 3Q83A 3DHWC 3U1MA 1CSJA 1NJZA 2H4YB 3M8RA 5FD1A 2NUUG 3NP5A 1RAIB 2RQKA 3HVAA 3IWLA 3KFWX 4X62J 4ZCIA 1UW9A 2HVHA 1S9EA 4MFBB 4LMZA 2LQ9A 1RWKB 2F7VA 4USKA 5ETNA 2EC2A 1WG5A 2C2MB 4OI0A 1X5OA 5B0BA 3GJQB 4MFBA 1VIOA 1IVZA 1P1TA 4DBQA 1M5HA 5T14A 5C24B 2QL5B 5CA5A 1YJ7A 4QR0A 1WELA 3G8TA 4J9RA 1N4LA 3G9CA 2V9WA 2E5IA 2O1PA 1FJCA 3AH6A 1F2GA 5K8PA 5LSLA 3BGLA 5C25B 3OTOF 4ED6A 4WFYA 4LF9J 2H5IB 5C2CA 2DPIA 3EPGA 1XWLA 2MZTA 1WHWA 3CW2C 4FBUA 2X1BA 1X9SA 1VQYA 4USMA 2ASYA 2PGCA 3W7BA 1YJUA 4C97A 3J81j 4NE9C 3AQOA 3M8YA 4GRSA 1RT6B 1EKSA 2KYZA 3I4PA 2P9EA 4LR8A 1L3KA 3GV5B 5CYQB 1GMUA 4AFFA 1SC1B 2FQQB 1LNQA 4RZRA 2HS3A 1TV6A 1NUEA 2PT0A 1WC0A 3FGVA 4RUBA 4X64J 1HWKA 3R1HA 2EFGA 3KMQA 3DGVA 1FTRA 2EPIA 1W2BR 3TZZA 3AOCA 3SCIE 5GAHU 4I2QB 2L48A 3QFHA 4DX5A 1Q7YT 3NOGA 4GKKJ 4QWEA 2IFXA 3D3BJ 3I5CA 1IBLJ 4F3OA 1Q4RA 2YQ0A 4AT1B 2VDHA 4PG8A 2FPHX 3QQCD 3W66A 1PILA 1DTTA 1ZA2B 3O1LA 1YRUA 5IT0A 5L1KA 1WKJA 2V63A 1D8ZA 3NCQA 1I51B 1XR7A 2JLFA 2M8DB 3Q2TC 2BJ1A 4DV0J 3WX8A 1XR5A 2RNEA 4QJVA 1IJFB 3VGVA 4YMEA 4LF8J 1FD2A 2H48B 3CD0A 2RILA 4OQJA 4EBEA 3T3FA 2Y8WA 3C14A 4FYDA 1F5BA 4G1IA 3DRSA 4USWA 5KFBA 1QSYA 2R8KA 3ULHA 4ZHRB 4N5SA 3BZQA 4LF6J 1R0AB 1APSA 3QMQA 1XMOF 1TKZA 3MUTP 2VHGA 3MMCB 1RZMA 1SJ1A 1EETA 3GIMA 4IYQA 3UO0A 1R0AA 4IFVB 1LFPA 1IJEB 3VCDA 2GIQA 4ICLB 1NDPA 3HD1A 2XULA 1CULB 5DGAA 3DRPB 1KSPA 3SFGA 3I55S 1NJWA 1U45A 1B3TA 1ITPA 3NEKA 3KLFB 1OY9A 2WBRA 3KG1A 3IGVA 1TL7A 3UDVA 2AMCB 8ATCB 4TXSA 1CULA 2BR0A 4PXCA 1BE4A 4F4XA 2DIVA 4NASA 3DDNA 4FYWB 3OVBA 4NLQA 2Z0GA 3KLFA 3UD4P 4DV6F 3Q24A 3K89A 4U7UK 4DPUA 1ZPWX 1NJIT 3CC4S 1TQLA 3FQLA 5KFLA 4B3RJ 1GFWB 1O0PA 5B0FA 3W9JA 3QO9B 4C8LA 1KS2A 4X4VA 2IM0A 3ZTRA 2HPUA 2G9OA 2QMUB 4X4NA 4KGXB 3MR3A 4ZPDA 4F4ZA 3V5RA 1RT5B 2N82B 2B8PA 2GVDB 3CCTA 3F44A 4RUCA 1DQ9A 3NS5A 2IM3A 1H2UX 1S1TB 5F0WA 3BEGB 5B0CA 3QGHA 3TX8A 2NR0A 4Q2MA 1OO0B 3PW7A 1RT5A 1TMMA 3PJWA 2KM8B 1N54B 3QRRA 1JLFA 4DEZA 1BQNA 4RW4A 2QG9B 5LMUF 1OYDA 5E2QA 3JYTA 2VUGA 3CO9A 2F65A 4KRWA 2G2ZA 3V4MA 3UD3P 4URQU 2JEIA 3FUYA 5KT6A 3PEHA 3N9UC 5HBMB 4I2PB 3VZIA 4ZKAA 4G1QB 3QSYB 3VV2B 1PKUA 1HNIA 4I6AA 2FLPA 2ZH8A 3PX0A 5DS7A 2UUBJ 4YEAA 5AE1A 1KLNA 4OHWA 2DGOA 2G0JA 1TK5A 2QLBB 3QBCA 3NMAA 2A3JA 2VFVA 2CAJA 2HG4A 3R1LA 4M1KA 5KG1A 4B3MJ 1FD8A 2M4MA 1NK4A 1XJWB 2ZVSA 3D9BA 5HROA 1PJ5A 1HR0F 2M8HA 5BXIA 4U8YA 2PI4A 3MCNA 1K1SA 1M5KC 2VQEJ 2B5JB 4DUTA 3VAMA 3BKFA 3B4DA 4ED1A 2BUNA 5H9FJ 5F41A 3W61A 4PRFA 1FJ7A 1V9OA 3E51A 4JBCA 2B5JA 4ZA1A 4NI2B 4RW9A 2OEJA 1ROFA 4A4JA 3I87A 1YJRA 4LREA 3QT5A 2C3OA 3BSNA 3TP2A 2WSCC 2FLOA 2FGOA 5L1JA 2FDNA 2PN6A 1AUDA 1ZA1B 1TKDA 3DNCA 1D9DA 4DPWA 1WF0A 2AJ1A 3DMJB 1LEOA 3ZTOA 3VAFA 1A0OB 4CLLA 2BQRA 4DL3A 2E9ZA 4KHMA 2MQMA 4YN3B 1FTCA 1OQ3A 3JB9k 2R8IA 1JLGB 1UTAA 1NHVA 3DXSX 2NZ4A 2GGPB 1YZ6A 3DHXA 5KOXA 2DH8A 1I5OB 2YKNA 3IA0A 1X8DA 3NAHA 4K59A 1MMNA 1UPMB 4WKYA 2YKQA 1D9AA 3PYGA 1VBXA 3QIDA 4NCAA 3W1YC 2BABA 4MMOA 2W8KA 4PG6A 2E5GA 3LGMA 1M5SA 2HMIB 2NUHA 4DXLA 3VZHA 4H4MB 2KH9A 1R6VA 2J7KA 2G4BA 4QIFA 2NS1B 3LW5C 3L7OA 4BLGA 4DUYJ 2E5JA 1P1LA 5D4NA 3T1HF 2DXFA 3OXLA 4QYZK 3TOQA 4MK8A 2XMAA 2FHMA 1N36F 1VRTB 2K3IA 2Y3YA 2GNKA 2DEIA 4ETXA 4A8OA 2V8DA 1REVB 4FXWA 5K9FA 4DQRA 3DN9A 1FNOA 3RRHA 2HQ3A 1S4EA 1OS5A 4CRJA 3K8WA 1C1CA 1P6TA 4K2JA 3UE2A 2F8MA 1WWHA 1VRTA 1QM9A 2ZH2A 4BCAA 4JB8B 1AZSB 1P9QC 1DY3A 5F3TA 4DR4F 2MZQA 3LH2S 3H2LA 1FWLA 1KWMA 4WBFA 2FHJD 4FF4A 1HQUA 2XCPA 4KHRA 1AZSA 2IAJA 1FRKA 5U47A 1HNXF 1B64A 4HHJA 2IA0A 2VG7A 2WVBA 4NLVA 4DL4A 4ZP8A 5HMYA 2D9PA 4OLPA 5J2QA 2YBVA 2ZH1A 4OZ1A 1X4HA 5KT5A 4UZBA 2VODA 2O01C 1HBMA 2VPZB 4QU6A 7FD1A 2MB0B 3TA0A 1TU0B 3GFZA 1WOPA 3ONQA 2XSJB 3DYAA 2LP4A 4UOGA 4EBCA 1X4FA 4MIAA 1Q1KA 5CCLA 2K06A 3W64A 1U1MA 1S0VA 4JI5F 1UJ4A 2BANB 5AE2A 5JXSA 2XEXA 2FJVA 5EUHA 3GZ7A 3NXZA 2V4QA 4L75A 3KLHB 1XERA 1SV5A 4RO0A 1AA1B 2BX6A 1A6LA 2FB0A 2E1CA 2HFVA 4JI2F 2C2ZB 1J27A 3TX0A 4ILRA 1UKUA 1VQSA 2J8AA 6FDRA 2YQ3A 3GYNA 2I2YA 2CXEA 1FDAA 4M5DB 1C1BB 1RU2A 2V2ZA 2KI2A 3M30A 3RB6A 1AW0A 1FF2A 4QPXA 2XY5A 4M5DA 1C1BA 1S1UB 3M8QB 2QMXA 4MJKA 2I9SA 1Q79A 5MAOA 4I67A 2V6AA 4NX9A 5DETA 2FJXA 3MF5A 5BR8J 1S1UA 3M8QA 3HMJG 4YR0A 2V8PA 2UV8A 2E5LF 2FC9A 2O5DA 1EX8A 4MYUA 3C15A 4RWWA 5EWFA 4LFAF 1VQ5S 2XS2A 3Q2SC 2CFXA 1S97A 3NOCA 4EK2A 4X4PA 3MEGA 3FQKA 4R0EA 1VHIA 3I6PA 2RF2B 1WG1A 2X7IA 3MEKA 4J7CA 4UY8T 2E66A 2WVCA 2WVDA 2OPPB 3SQGB 4N77A 1UP1A 4ECYA 4X65F 2IIHA 3PRVA 1S77D 1MLAA 2CA9A 5EHHA 5KOWA 1HQ2A 2LYVA 4JI1J 5LM7E 1NEEA 1UVKA 1D1UA 5JVHQ 1UJ6A 4DR5J 1ZM2A 1BXNA 3C46A 1L5UA 2OD4A 4UZCA 5A8KA 5IWAJ 5KFWA 2ZKTA 4PZVA 2W24A 3CCZA 3D67A 2KM8C 1FDNA 2H9ZA 2DHGA 3D6FB 2KVQE 2PMWA 1SXLA 4EI2A 3N6MA 5HI7A 5HP1B 4B3RF 3DRXA 4LF7J 3TAQA 1HI8A 5D0HA 5C7PA 3RAQA 4KH0B 3W8GA 4ED5A 4LSZB 3LPYA 5IT9Y 2EKNA 3B6BA 3MM6A 1NK6A 1PSDA 4USVA 1RAOA 3OD2A 2MY7A 4UQGA 4P2XA 2R7UA 1U0HA 4ELTA 4O4RA 2QSFA 2VQFJ 2H51B 2WRMA 2K1RB 5KFVA 2QLXA 4J9OA 3KTQA 1TMJA 3M4XA 1T03A 4ZVSB 4JOUA 2PMHA 5KG4A 5KFMA 3BV8A 3F41A 3FBEA 3KNAA 4AE5A 2VG5B 2VKZG 4WXOA 1D9FA 3IN5A 4A48A 5D6GA 3DCAA 1S0NA 2YKPA 3P5BP 2JZ5A 4OZ3A 3BM7A 1JKHB 2GJFA 4KB7A 2YVSA 4C98A 1T94A 1XTZA 1U1QA 3O44A 2W2QP 3D68A 1FK9B 4DR3F 1OWXA 1Q5VA 1B4SA 1U09A 2CNLB 2G2YA 1T9YA 2UZAA 3WC2A 3CVKA 3RW7A 2HFSA 5CH7B 1U02A 3MM7B 3JAMU 4KC5A 1FK9A 4IFYB 3RG6A 3QLHB 1BC6A 3D4JA 3G71S 3CCQS 2OTJS 1DQ8A 2YKOA 2NXCA 3V4IB 4K7QA 2UUBF 1R8HA 5E5NA 5HVGA 1HA1A 4CH0S 3BBFA 2ZJPQ 2HHHF 4B3MF 2OFGX 4IFYA 2N4DA 3JS9A 2CADA 2DGQA 4ITSA 3ZZ0A 3JSMA 3R5DA 3C66A 4LF4J 2HRYA 4V19J 3C6TA 4C11A 4M5IA 1HW9A 4MKYA 2ZBIA 4X4OA 2VQEF 1Q53A 4XO0A 5GAGU 3LTOA 2J9DE 3DLBA 2FVSA 1TK0A 2RUSA 5AJ3F 1AXQA 2LCWA 2VDIA 2GAGC 4IUFA 3RW6A 3PYDA 3FBFA 4P7VA 2XZTB 3AJ1A 4P7TA 3IR5B 2DIUA 1WNEA 3ZZZA 4DMZA 1JXEA 2YNFB 1GQEA 1RA7A 1VQ9S 1VJWA 4DN0A 5CCMA 3MMAB 4PXBA 5KAKA 4D3HA 3PJ9A 1N32F 2RU9A 2KRRA 2RDDA 5F3ZA 2YNFA 1Y0HA 3H5UA 3BDEA 1IKXB 4KO0B 1YJ9S 3KLIA 3H59A 3BQ0A 1Q8IA 4MAKA 1JLQB 3BGFA 2B51A 5KFUA 2DR6A 1H74A 1IKXA 4KO0A 2P2CB 2LEAA 3BO3A 2AIRB 3FEZA 1KP6A 4I56A 2F4VJ 4DS4A 3IRWP 1VC6A 3HSDA 4FYYB 3OL8A 1Z4UA 1NNDA 3FDSA 2MHEA 2D74B 4TY9A 1NH7A 4HT5A 1RACB 2VC0A 4K4TA 2ZD1B 3JSYA 3EICA 2V94A 1HNVA 1X4EA 1PYTA 3TNVA 3AA9A 3GQCA 1RABB 2YX1A 3R8YA 2Y1IA 3VQSA 3HSGA 1IBMF 1NJXA 4O44B 2NXUA 2YQ1A 3CMAS 4KE5A 1JLAA 1WI8A 1WEZA 1WTFA 1QTNB 5HATA 1LXNA 4ECXA 4Z7CA 1S6OA 2EFVA 4IRCA 2AYGA 1LXJA 1HNZF 3IG1A 1N6QA 3AB4B 3A3OB 3M1VB 2HNZB 1PC4A 3KYLA 2HNYA 1H2TZ 4OX6A 4QIWD 1ULRA 1LWCA 3HHEA 1FNXH 2J9DA 2B7CB 3G82A 3OQ2A 3HK2A 4DUZJ 2OPSB 4OYBA 4DV3J 2HFZA 2DITA 2HNZA 1HMVA 1FX2A 1EB0A 4OX9F 3UW1A 3EYZA 1LK5A 1C0UA 4RLEA 1S76D 1QY7A 2VG6A 3OL7A 4KJIA 3CC2S 2A6MA 2EBGA 2OPSA 4YB7A 2FJWA 2WVEA 2PSZA 4RX6A 1RAEB 1FT8A 4JI6F 4LSNB 3SXLA 1CVJA 1KC8T 1QUPA 4A8FA 3Q89A 2VFSA 3DLEB 1X9MA 3HX9A 4IR1A 2WB1D 3CULA 1DARA 4USJC 3W2VA 3D3CJ 2R7QA 4P2FA 5THWA 2B3TB 1BWVA 2HHPA 4L3NA 3T5HA 1SH0A 2LDIA 3R2DJ 4LFBF 1AFIA 1F0XA 3LPEA 2XSFA 4JYAJ 4ZCLA 2PEBA 3GYGA 3GJTB 2BRLA 4DR7F 1KONA 4Q45A 2IDLA 3D6HB 3D0HE 2CJQA 1R0CB 4NLGA 2CQ1A 1VRQC 1H73A 1LWEA 1CLFA 2O67A 3FCHA 3I31A 1QJHA 2UV8G 1S0OA 2V50A 1WJ9A 2WHOA 2DNKA 5IM0B 5I3UA 3J7YI 1U6FA 3IGNA 3L3CA 1UVJA 2EW9A 4YP3A 2FLNA 1ACMB 2E1AA 2UXDJ 4DN9A 1V3RA 1HYSA 2CRLA 2JRSA 2XMTA 4KSEB 4QIVA 2QMWA 1U49A 4LSLA 4GKJF 3FZ2A 4XDDA 4FDFA 1U2FA 2KN4A 2CQGA 3OJUA 1UZDA 2BEFA 2W7OA 4XPCA 2MQQA 4NCBA 1F9EB 3PFEA 2XQCA 1RTIA 1QD1A 4C8ZA 3GSIA 2ZDOA 2LXUA 2YNGB 4UUWA 2B7BB 4PYDA 4NCGA 3JXOA 3AJDA 4EGLA 3W5YA 1BD6A 1TZ0A 2WB4A 3RBXA 5H9FK 4OYOA 4NLWA 4Y0FA 2Z57B 1SIWB 3GG0A 2PFDA 4CLKA 3NWRA 3ZNJ1 1N33J 2AX1A 2U1AA 3BS9A 4IH5A 2MGZB 1F3FA 1RCXB 1FRLA 4HR2A 2XYGB 2CJXB 1W26A 3UNGC 2UXCF 3T5LA 2B9YA 4YUDA 1EIYB 5HQLA 5F9LA 4OJHA 3DM2A 3G6ES 4N76A 1U7LA 4FVMA 3K5MA 2CQ0A 4GC6A 3BDPA 2DKOB 3UCUP 2AHOB 1Q82T 3NL0A 3UNYA 3FC9A 4HTIA 3HSJA 5EGYA 3WHIA 3TZXA 1IBKF 1GXUA 3T9ZA 3W63A 3BPSP 1RTJB 1BQMB 3GV8B 2ZM6J 1T3NA 2HW3A 2HQDA 4ILMA 3CJKA 2APOA 5D0EA 4B9NA 4C8MA 4A8SA 3HI9A 2GMLA 1KNZA 1RA6A 1OQ6A 1BQMA 3K7RA 3C6UA 4OI6A 1N52B 3VAIA 2FHKA 5A6WA 3PW2A 3HKZD 1WSVA 3NWGA 2BACA 2FVCA 1FE0A 1FJGJ 3T1YF 1JNZB 1WKKA 2OPRB 1UPPA 4LF7F 3SDEA 4DG1B 3CEDA 4O3RA 2VZ9A 3GR1A 1HFEL 3MM8B 2B6AB 2RSQA 4YB1P 2R7OA 5JMNA 2CJYB 2WBMA 2JSXA 3E01B 1QUVA 4OYWA 1NB7A 3MM8A 1BMQB 4I6WA 2VQFF 3CJRA 2E1RA 3OVSA 2JJ4D 2B6AA 2WSEC 3GSDA 2PE8A 1NO8A 2XI3A 3ENVA 3KLGA 1BUXA 1MN7A 2AX0A 1QE1B 5CYMB 5GAEU 3MMBB 3TAMA 1S7IA 1TL1B 3LP2B 1RB0A 2Z4PA 4M8LA 2UU9J 3RZAA 4R25A 2DCLA 1QE1A 1RP5A 4OZNA 4X4UA 1PGZA 1L3SA 2GO8A 2EVZA 3Q86A 2XNQA 1S4FA 4USTA 5D78A 3M05A 1GT8A 2MKCA 3R27A 3HXMA 3TVYA 3TZWA 2PD1A 5E3CA 4ZLJA 4CDIA 3GTYX 4X4SA 3MAQA 1RHKB 4ZP7A 2IMOA 3KK2B 3IBFB 5T7LB 2CNKB 5ETVA 2N3LA 2ZH9A 2QYGA 1HPZB 4MKBA 1FEHA 2FY8A 2RKIB 2DY9A 3MD1A 3T5KA 1QLNA 4DL5A 2NXEA 2NPFA 4HVZA 3LUYA 3QYYA 4LIRA 1YGYA 4FKYA 4I64A 3OHBA 4LF4F 4NRUA 4V19X 3RR8A 4J9NA 3AJ2A 1OJ4A 1RAFB 1KKHA 5I42A 2V4RA 3I82A 2HFUA 4JV2A 3E3XA 3DU5A 1TFYA 2XI2A 2ADCA 4ID5A 1YRTA 2CVIA 5ETKA 1YBAA 5DDRC 1CJTB 1B0TA 1RXOB 5CZVA 3GFHA 2YX4A 5GMEA 1IKVB 1U8WA 2AJFE 2WW4A 2ASJA 4CTAA 1KOHA 1YZ7A 1U1OA 1J5OB 1N5YB 2MQNA 4K0KJ 1Q8KA 3D7SB 1LWFA 1WG4A 4RBUA 3KXDA 1C0TB 3MPUB 2J8SA 2R7WA 4OL8A 3U1NA 3KJNB 1VK8A 5KFAA 4NZ0A 2VPWB 4I0WA 1C0TA 4Y65A 3M7VA 1EZZB 3O8WA 1VMBA 1S9GA 1YTYA 3QT7A 3IMQJ 1TL4A 3UN2A 3THPA 2DRBA 3QJLA 3P4UB 4ECSA 1FFSB 1N8RT 3S01A 4FF1A 1CC8A 1SH3A 4RNNA 2BOPA 3MUMP 1YSJA 1Y00A 1LKZA 1UFKA 1H7WA 1D3WA 1X5SA 3FBCA 5RUBA 4F2RA 2DR9A 2PA3A 5KFTA 4EBDA 1YBTA 3AD8C 4PUOA 2ZH6A 5A0YB 1UA0A 4CWBA 4ZLNA 5HO4A 2V2VA 2HRUA 1YHQS 2MKHA 1AROP 4ECVA 1JWWA 4ZVFA 4GVBB 1HIYA 3VAHA 2CQCA 3OXFA 2OMLA 4ZJOA 3OXGA 4MK9A 3LP1A 3PJXA 2YWEA 3EXYA 3M9OB 2XO6A 5D8HB 3UFCX 4CLTA 4GVBA 4IG3B 4F25A 3ELHA 3H4BA 3BO4A 4AQYJ 4FKXA 2EG2A 3KDOA 5B7WA 4DV3F 4QW8A 5SZTA 4DR2F 4IG3A 1Z2ZA 2WVFA 2R7VA 4LRDA 3FSXA 1DJ0A 3LWMA 4DSLA 1UFLA 4F0MA 1FFWB 2YNHB 3L7PA 2JFKA 4FF3A 1YJNS 1X5PA 4AD6A 4P75A 2QL7B 4RJVA 2WCXA 2XHWA 1YLXA 3TJAA 2DNQA 2GJ2A 3D54A 2YNHA 4ENOA 3MI7X 4ANDA 2BJ8A 4WP3A 2RDIA 2OLWA 1WHXA 1J5EJ 1JXVA 3CCVS 3U7JA 3QIPB 4P10A 4OI3A 2I6WA 4KV8A 3ITHB 4BS2A 4F4YA 1KVKA 3QT6A 1ZTTA 2D41A 4QZVB 1GNKA 1P27B 4C8NA 1NSAA 1HWJA 2A10A 2B4OA 5FDLA 1RLDA 2FYXA 3ITHA 1HNWF 1QAIA 2GHPA 4MH8A 4DQPA 4RW8B 1S9FA 4NLDA 4H4OB 3I96A 1UWBB 1L3TA 2EXUA 2JC1A 3MPWA 2HHWA 2Y1RI 1SJRA 2YX7A 2DH7A 5B0GA 3GMGA 3LO3A 4Y2KA 2WONB 3QAUA 5KFPA 4UW2A 3QZ8A 3GCXP 1UWBA 1Y5IB 5G4DA 4LF1A 1GMVA 2OKQA 1IM6A 2FC8A 1SL2A 1ZETA 4O4GB 2HVDA 2WONA 3IM9A 4EUVA 3S7RA 1U6BA 1FDBA 2E9TA 2NYIA 3X3UA 1DFDA 4KR0B 2W9CB 4XIUA 3KK1A 3SSQA 1RT4A 4CZCA 3NNAA 3T5JA 4I68A 1XK8A 3EZ5A 3KOAA 2N3OA 3IBCB 3BPDA 3BYPA 4IO1A 4BBYA 1S12A 3D6MB 5DO2A 1JLCA 3TANA 2AYBA 2LQJA 3JTOA 2RB7A 4ZP6A 2YNIB 3ZC4A 2LECA 3DDKA 4F4WA 3MM9B 5CXTA 3CD5A 3CIZA 4B9VA 2HAIA 4ELUA 1MMLA 4XAKA 3PNIA 2WZ1A 1T05B 4F2SA 1Z1ZA 1KN6A 1B7YB 4X84A 2CPHA 5AE3A 1FCAA 4PXEA 1OSDA 4ECUA 3CDAA 2YPYA 3BSAA 2GA7A 1RT7B 2ZOFA 2JVOA 2XHCA 1X31C 5KFSA 4KFBA 3U02A 2GHWA 1NHKL 4QR1A 2ZZTA 3FNNA 1MNEA 3V6KA 1RT7A 2UVWA 4ZVGA 1UCNA 5D3GA 3PHEA 4UTGA 4HACB 2C1EB 3KHGA 4PWUA 4ZVPB 2C2DA 1UEVA 5LL6d 1T9UA 3F73A 3HP6A 4RBTA 2KT3A 2X1GA 1WOSA 2W9BB 4KGZB 3QSIA 2COLA 3IWNC 3V6DA 3M2RB 3OR1B 2IDEA 1JLBA 3OV7A 3BKUA 1XNQJ 4X4TA 1TELA 3KWMA 2V68A 1V5VA 2F9DA 3ILJA 1RADB 1CJUB 2AU0A 2W9BA 4A46A 1HI0P 5J2MB 4I7FA 4C48A 3A13A 3EDRB 3OR1A 3G8SA 1P9YA 3S1TA 1FWKA 4X66J 2VFRA 1DZ5A 1N34F 3HM9A 2AZ3A 2DISA 1JQGA 4CO1A 3GR0A 2W25A 4Y00A 3NBPA 1SUQB 2Q79A 1TVRA 1JLEA 3KG4A 1SI9A 1VQ6S 2RRBA 2VOOA 5DGBA 4DV7F 3BO2A 4DFJA 1F9HA 1WOOA 1RCOB 2ROPA 3OSPA 1T0TV 2JOQA 7AT1B 2OD6A 4DHVA 3EDQB 4USIA 3M8SA 4KPCA 3H4DA 1H7XA 1ZTWA 3K5OA 2M9KA 4Q2LA 1O6XA 2AYMA 4CQ1A 5HLFA 1P8GA 2FTRA 2QIFA 3MECB 2V4JA 2DNZA 4RKUC 3KHLA 2GVZB 1URNA 2XMJA 2IYIA 5I3PA 2HIYA 4ZLPA 4F67A 2BVZA 1HBNA 2BQ3A 1S6PB 3MTKA 3PO5A 2IRXA 4J5OA 4PKDB 4NXMF 4C3KA 4WTYA 3JAMY 5HMZA 2D3UA 4NA2A 2WOMB 2VL1A 3RU0A 4JI7J 4I1TA 2DNYA 2IC3A 5EX0A 3BJYA 1HWLA 2X51A 3RTVA 1ZBTA 4DSKA 2Q6BA 1NAQA 3EGNA 4Q0BA 1F5CA 2HURA 2DB1A 1R6YA 2MLZA 2E7WA 4ED4A 2V8VA 2CG8A 5ETSA 4P6QA 1WKLA 3F0NA 2YWGA 2L9NA 1FI4A 2LDYA 3DLGB 1XMBA 3JSRA 5F8MA 4TY8B 2N7YA 5IQ6A 3PR5B 5IC4B 5DDOC 2DHSA 2HFNA 2CQPA 3Q8PB 1UAWA 5AXKA 4FPRA 1RU1A 2Y1JA 4IRKA 3HJVA 4B3SF 2F8EX 1NKBA 2R8GA 3K5LA 5KT4A 3X1LB 1JX4A 1LFWA 3G6VA 5HVHA 4B3TF 2JLEA 4OZ2A 2JVRA 5A8WA 3SCLE 1N48A 1S5ZA 3P96A 3PRDA 2DXDA 2NYHA 1RWPB 2GFFA 2R42A 3SV4A 1FVSA 4NLXA 1Y10A 1T9TA 3R6LB 3C3LA 4B02A 3BREA 4YY3J 2MSTA 4Y28C 2CJAA 2BYCA 4QWCA 3FKBA 1CJKB 1I6JA 3FMWA 4WFXA 2CQBA 3DU6A 3M8PA 4HHUA 4DSJA 3CGIA 3DOMA 1KFDA 1IM4A 1V3SA 2LQ8A 5KFOA 3CJ0A 3MMJA 2B9WA 1OPZA 3DXBA 2OEKA 3PFOA 1RBLA 2HWHA 2CJBA 3HZGA 1CJKA 1XNRJ 3DOLB 5E33A 4RW7A 1E6YB 4OYPA 5D15A 1KTVA 3IXQA 4PYAA 2KDOA 1K73T 5J1NA 4JI8J 3K5NA 1ZAXA 2BJ3A 4MK7A 4DSIA 3ZTQA 3HT0A 2UUWA 3A4TA 1WEYA 1WF2A 4O0NA 1VIXA 4DV5J 3AY0A 3H7HB 2HHUA 1AUSL 1WACA 3SI8A 3MPDA 1YITS 3GIIA 1M5OC 4A8QA 3MAAB 5AXMA 3UR0A 1FKOB 3GIJA 3M32B 1T9WA 5ETQA 1DTQA 2JDJA 4KHPJ 2QRRA 3CDEA 3EE3A 3I56S 2HIQA 4C3LA 5F9NA 4CNZA 3MAAA 1JJ2R 3ZZPA 4F36A 3NMRA 2ZJRQ 1HBUB 2AGPA 1Y11A 1U47A 1N0VC 2EFQA 1S48A 2RRNA 4LR7A 1I3OB 3H42A 2UUTA 2PA8D 2A6OA 1HBUA 1SQFA 1RTZA 5GMKa 4QW9A 3HFZB 4DV2J 2R4FA 2KL8A 2P9CA 1J2VA 5LSOA 4PWDB 3CJ3A 1S1VB 4WTOB 3OFFA 4IRDA 2JL9A 3OR2A 5KFKA 3M2VA 2ACMA 1I94F 1VCTA 3QFWA 3ET6B 3GILA 2YKMA 4WPAA 4PWDA 1S1VA 4Y2IA 2ACYA 3I0SA 4WWSA 3EM1A
chains in the Genus database with same CATH topology
1S9EB 2PO4A 2W9CA 3CDBA 2UZAA 3KK3A 3WC2A 1M90T 1K0TA 3PY8A 2I5JB 2GMHA 2CQDA 3CVKA 5DQHA 4JV1A 2A18A 3HHLC 3RW7A 1R31A 4DV5F 3M6VA 1U1PA 2R9LA 3CT9A 3LAKA 1RTHA 5CH7B 3MM7B 3ICLA 4KC5A 1FK9A 2I38A 4IFYB 3DMJA 2W7AA 3MTJA 3P5TL 3QLHB 1BC6A 4ECWA 4DL2A 3CB4A 1Q81T 3QGGA 3G71S 3CCQS 2XB2D 2OTJS 1DQ8A 2YKOA 1Q86T 3V4IB 3Q8SB 1DLOB 2NLWA 2EC0A 3EGZA 2UUBF 1B7FA 1WI6A 1URRA 2CQHA 1R8HA 5E5NA 1FA0A 2J76E 3PDNA 4EO8A 1HA1A 2IRUA 2ASLA 2LKZA 4U67Q 2F9JA 4CH0S 4EZ6A 2D3OR 4HH1A 2ZJPQ 2HHHF 3LF0A 4B3MF 3RRGA 2OFGX 5L1LA 2HHXA 4IFYA 4PG5A 1RKJA 4KHPF 1R8CA 4IH7A 2N4DA 4WFAQ 3DGPA 2DGQA 4ZPVR 1JLGA 4ITSA 3H40A 4B9MA 3FRZA 3ZZ0A 2GGPA 2NSBA 2YNIA 3KLGB 1XEZA 2R7TA 3JSMA 1DLOA 3R5DA 4RBVA 3T9NA 3C66A 1N5SA 2JH3A 4KQZA 3U1LA 2HRYA 4V19J 3I4HX 2VB6A 3C6TA 4C11A 2KXFA 2ZC4A 4LQ9A 4W90B 4FZVA 3MM9A 5J1PA 1LW0A 2YWKA 2VBYA 1HW9A 4MKYA 1ZH5A 5J2PA 2Q43A 2FIUA 4WU2A 3TAMB 3PKMA 1RQ0A 3MOJB 2KVIA 2ZBIA 4X4OA 1TKTB 5M2UA 2NSCA 2VQEF 1E6VA 1Q53A 4XO0A 2FVPA 5HN0A 2LXIA 5GAGU 1T05A 2VBXA 1X4GA 2J9DE 3DLBA 2KFYA 2FVSA 1RJJA 2Z2MA 4PQAA 1TK0A 1M5PC 4TLRA 3MCSA 2HMIA 5AJ3F 1HQEB 1AXQA 2LCWA 4G6VB 3VAJA 3CCSS 4F8RA 2ROGA 4IOBA 4FS1A 4NZ7A 2POKA 1FERA 4HDGA 1Q16B 4IUFA 3RW6A 4H4MA 1BQXA 4P7VA 1TKTA 2DO4A 2E1MC 5GAGI 4A8MP 3AJ1A 3GFXA 4P7TA 4NYPA 3IR5B 2DIUA 2HLUA 5K8MA 3KJVB 4D3GA 1WNEA 1IQZA 1ZOTA 1IUJA 4DV2F 3ZZZA 1M1KT 1O51A 3ISZA 4DMZA 2CPFA 3LWLA 1JXEA 2AYEA 3P3DA 1YJVA 2YNFB 1GQEA 1RA7A 1UA1A 3G6XA 1VQ9S 2LXFA 5L9NA 4NL5A 2HYIB 2HNDB 3I5BA 4H4KA 3BB5A 3D2WA 1FJEB 1VJWA 4DN0A 2KJVA 5CCMA 4K4XA 1UETA 3MMAB 1NK9A 4UUXA 4PXBA 1KHWA 3KJVA 2M88A 5KAKA 4D3HA 3GE9A 3DI6B 1G7CB 2P6SA 1HWIA 3N28A 1KTQA 4B9TA 2LMIA 1N32F 2RU9A 5I4MA 2KRRA 5T41A 4OIXA 5F3ZA 2YNFA 4LVNP 1UVNA 2ZH3A 5KG5A 1Y0HA 3H5UA 2SXLA 2K8GA 2Z2LA 3BDEA 3CE8A 1REVA 1IKXB 4H4KC 2HNDA 2M52A 4KO0B 1YJ9S 3KLIA 3H59A 4OHYA 2W4DA 4LJMA 3BQ0A 3E8OA 1FRHA 1ZZNA 2DGWA 3MPVA 3N4WA 3TA2A 4C0BA 4WCEQ 1Q8IA 1TV6B 3VR1A 4WYLA 3MURP 4MAKA 3FVYA 4RW6A 2BM0A 4OJGA 3HT3A 4NLOA 1JLQB 3BGFA 2B51A 5KFUA 5JJBA 2AWZA 1IKXA 3JTNA 3M2RA 4KO0A 2LEAA 4GC7A 3BO3A 1XC9A 4QU7A 3ISNC 3FEZA 4DL6A 5F8NA 4I56A 5EDWA 3IAS9 1IKWA 4DS4A 4F3QA 4QYZJ 2VKRA 1U2RA 3IRWP 4ZK7M 3MR6A 3CF5Q 3DLHA 2VA2A 1VC6A 2W7PA 4FN5A 5KG3A 1HWUA 3OL8A 1Z4UA 1NNDA 2GX8A 3FDSA 3HHLD 5J2MA 2MHEA 3D1QA 2D74B 4AL5A 4ED7A 4TY9A 1NH7A 4HT5A 2VC0A 5I42B 1RISA 4K4TA 1ZAWA 5KG7A 5B0DA 5HQ8A 4DV1F 2MPUA 2ZD1B 3JSYA 3O2IA 3CUNA 1S99A 2YY3A 2V94A 2MZRA 2DNMA 4RWXA 1MWYA 3PZPA 4MYTA 5JVGQ 1HNVA 4CH7A 1X4EA 3CIMA 3TNVA 3AA9A 3GB0A 4PXDA 1FRXA 4XDCA 4ID5B 2ZKUA 3GQCA 1S1XB 2BRKA 2YX1A 5D4OA 3FRYA 3VQSA 2Y1IA 1NHUA 1Q8LA 1DTTB 1KLMB 2CQ2A 1N56A 2HS0A 3R3TA 1SUQA 3HHKA 1NJXA 3LGNA 1IBMF 5LMNF 2D3ZA 2GIRA 2ZC3A 3N5FA 2GMJA 4O44B 4EO6A 4IQXA 2BJEA 4Z2XA 2HGNA 1VRUA 2NXUA 2EWHA 3CMAS 2C3YA 3BR8A 4KE5A 4CTAB 4U7CA 1JLAA 1WI8A 1WEZA 1S1XA 4KBIA 1WTFA 1LWFB 1KLMA 1VOMA 2XSJA 5G0RB 3TYTA 1LXNA 4ECXA 2J0WA 2DHAA 1VQKS 3M6WA 1DURA 1T95A 1S6OA 2EFVA 2J6UA 4IRCA 5DDPC 2AYGA 1LXJA 3DRSB 4RNMA 1CC7A 3QZ7A 1KR4A 1H38A 2XBPA 2KFZA 3FEXB 3B8HA 2CVEA 2RU3A 3M6UA 1ZZFA 3IG1A 2W8LA 3CCRS 1N6QA 1HNZF 3AB4B 2V2KA 4YQWA 4NLPA 2CJ9A 3M1VB 2DGSA 2FJAB 3PEJA 5BYSA 1QAJA 2OH2A 2HNZB 3ZFVA 2HHVA 1PC4A 3KYLA 1TKZB 5E0OA 1OSCA 1VQ8S 2HNYA 4PQUB 1H2TZ 4OX6A 3MECA 3MOZA 4QIWD 2BANA 3ZZOA 1ULRA 5F8GA 1LWCA 2J7UA 3HHEA 4O3PA 3CCES 1FNXH 3NS6A 2J9DA 2B7CB 4CI0B 3GYXB 1S9GB 5J2NB 3OQ2A 1EETB 3B78A 5B09A 5L39A 3PIOQ 3HK2A 3H8YA 3H5XA 2OPSB 1IXKA 3KLHA 2R8JA 2HFZA 2DITA 2HNZA 3AAWB 1HMVA 3HVRA 5K5MA 4J37A 4PQUA 2R7XA 3CD7A 3UW1A 4OX9F 5KG0A 3EYZA 2LQBA 1LK5A 5KG6A 1S6PA 2P6TA 1C0UA 1Y5LB 2FLLA 3E2EA 1OPIA 1U25A 4OJ1A 4OHVA 4RLEA 1DRZA 2KG1A 5J2NA 1QY7A 2VG6A 1S76D 3OL7A 2OP5A 2XG8A 1VQMS 4KJIA 3CC2S 2XS5A 2F4VF 2EBGA 2OPSA 1RK8A 3SCKE 1NK0A 1KHVA 2VV5A 1RT2B 1KQKA 2GW8A 1ZM4A 2WOMA 2R8HA 5DJBA 1VBYA 2WW8A 4YB7A 2FJWA 2HGMA 4WIIA 2UUAF 1X5TA 4HYKA 1RGVA 2ILZA 2PSZA 4RX6A 2RDJA 2XS7A 1FT8A 4JI6F 4LSNB 3SXLA 2LA6A 1CVJA 1KC8T 1QUPA 4A8FA 3GV7B 4Y6IA 1QAXA 3AHPA 3OUYB 3O3LA 2VFSA 4ZOSA 3DLEB 2PDAA 4ZS6A 4PUOB 3ISND 1S7HA 1RT2A 4ES1A 5GADU 1MSWD 1X9MA 1FHTA 1Q8BA 1D0EA 3HX9A 4Y3CA 4IR1A 2WB1D 1FKPB 2YH0A 3CULA 1DARA 3BF4A 4USJC 3W2VA 1FNMA 3UQSA 3PRBA 3OL6A 3OSNA 2LEBA 1ZAVA 3GFYA 4QWBA 2L9WA 2R7QA 5THWA 4K4VA 4J9MA 3WZ0A 2B3TB 2HHPA 3DLGA 5GADI 4Q8FA 4LUBA 5FJ4A 2Q1LA 4CIOA 4ZCMA 4L3NA 5KFEA 3IWXA 1SJFA 4FXDA 2HVIA 4TY8A 2AJQA 3T5HA 1SC6A 1XN9A 4MIWA 1SH0A 2LDIA 1RAJA 4LFBF 1AFIA 2AGQA 2WK4A 2RJZA 4QYRA 1F0XA 1LW2A 2XSFA 1C4CA 2DK2A 3LP1B 4YDXA 3V81B 4ZCLA 4CCHA 2J9EA 4ES3A 1R8AA 2BRLA 3OTBA 1ELOA 4QWDA 4DR7F 1KONA 4Q45A 3SSRA 2MQOA 3D0HE 2CJQA 4DPOA 3OVAA 2MYFA 3I5AA 2OIHA 3K0JA 5A2QY 4NLGA 2CQ1A 3LANA 4BDPA 1LWEA 1SKSA 1CLFA 3N6LA 2ZITA 2O67A 2P9GA 3FCHA 3I31A 5AXNA 5SUHA 2KXNB 1QJHA 2UV8G 3V81A 1S0OA 1XMQF 2IVFB 2WHOA 1R7IA 4Y2MA 1H6KX 2F1FA 2DNKA 1A9NB 3N79A 5IM0B 5I3UA 2EK6A 3C2PA 4DL7A 2I1RA 2OO4A 3B82A 5KFDA 1GX6A 2RF2A 3J7YI 1U6FA 2W4PA 2PFFB 3IGNA 3KMSA 1X9WA 4BHQA 3L3CA 2WSFC 2OPPA 4OI1A 3SQGA 3G4SS 1UVJA 2EW9A 1JLFB 2J0SD 2ABYA 4YP3A 4DUZF 2FLNA 4NPOA 1BQNB 4RW4B 3EX7B 3M2UB 1X4DA 1QTMA 2E1AA 3SSSA 3QJJA 2EFPA 1MWZA 2HQIA 5BYRA 4DN9A 3JYTB 3F56A 1V3RA 1KD1T 1S1WB 2CRLA 2DTJA 2O3DA 4WE1A 1HYSA 2X1FA 3D1HA 3MGJA 2C2RA 4YB6A 2VH7A 5IFMA 3V6JA 4DF4A 6FD1A 2FJEB 3RRKA 2IVYA 4LIWA 2JRSA 2XMTA 5M2PA 1YG0A 2ZBCA 3NGDA 4KSEB 2ZE2B 4L72B 5KFIA 3P6YC 1H98A 4QIVA 4ED3A 2QMWA 3M2UA 1I1GA 1U49A 1S49A 4Z37A 2QEXS 4LSLA 4GKJF 2JEFA 2AP6A 3MZIA 2KJWA 3DOLA 4WFZA 1VC5A 4ELVA 3FZ2A 4OX8A 4XDDA 3BQ1A 4LFCF 1E6YA 3P49B 2EKYA 3FSYA 1FE4A 4EU0A 1S1WA 1U2FA 2KN4A 2KRBA 5D77A 2CQGA 3OJUA 3SZ2A 1YJWS 1UMJA 3I9ZA 2NPIA 4XPCA 2W7OA 2DNLA 3LP0A 2HWTA 5L9XA 2MQQA 4CH1A 2ASDA 4NCBA 2UP1A 2RRAA 3PFEA 4DLGA 4JI3F 2UVVA 2HWIA 3MPYA 4KV8B 2N4CA 2Z8QA 3K8VA 3L09A 2ZE2A 1RTIA 4PG4A 1VQNS 1GTEA 2VONA 3D1OA 2ZHAA 4C8ZA 3MD3A 4GO5X 4QIGA 1N5TA 1S79A 1HNIB 2ZDOA 4C7QA 2EFNA 2LXUA 2YNGB 4UUWA 4B17A 1BGXT 1RYRA 3CCWA 2B7BB 3ENWA 5E7OB 2MHNA 1WHYA 4NCGA 4K4WA 2ZUGA 4EGLA 1BD6A 1TZ0A 1Y3KA 2WB4A 4C0OC 2FJDB 5FDLB 1HHTP 4NLWA 3Q23A 2PMZD 2WAQD 2P5VA 3BSCA 1DHMA 4Y0FA 2VA3A 5CD4H 1DBDA 1SIWB 3SMZA 3V2UC 3GG0A 3UCZP 4ZPBA 5KFZA 2CQ3A 3FZBA 2X3GA 1YQHA 4F02A 1SJQA 5D4PA 4XK8C 2AX1A 3POTB 2U1AA 5E3PA 2XNRA 5DQGA 4HI2A 3J80Y 3KHHA 1SIZA 3BS9A 4IH5A 4C2MA 5K8NA 2MGZB 3HFKA 4ED8A 3I32A 3CJ2A 5HP1A 4Q44A 1FRLA 2ROEA 3MXHP 4JYAF 2RE1A 5HROB 2BBEA 4ZPWR 3MR5A 1FKOA 1TKXA 2XMVA 4KKOB 3US5A 4F26A 1EP4A 4YB5A 2NQPA 3U27A 3LOUA 4RNFA 2K7KA 3M32A 5D4LA 3CCLS 3H98A 2GQQA 1WTBA 1CG2A 1Y5NB 4WK1A 3UNGC 2UXCF 3RAMA 2XLIA 5KT3A 3W3SA 2M7SA 3POTA 4QIEA 3T5LA 2B9YA 4YUDA 1RT3B 2VBWA 2IVMA 4I69A 5ADZA 5F9LA 4BC7A 1VQ7S 4OJHA 4HH0A 4NA1A 2ZOMA 2X1AA 2MMYA 3SCJE 2B43A 4TU9A 1NKCA 4KKOA 3DM2A 3G6ES 2C3MA 3TUIC 4N76A 1U7LA 4FVMA 3K5MA 2QFJA 2CQ0A 4GC6A 4J9QA 3BDPA 3WBZA 2K1RA 4WU3A 4FNHA 4X4RA 4GO7X 3UCUP 2GHVC 1Q82T 3IR7B 3NL0A 4HTIA 3IR6B 3M9NB 4RW9B 5EGYA 1RT3A 2DPJA 2F8HA 4DV4F 1IBKF 5DG7A 1GXUA 3J7A1 3T9ZA 1SB6A 2J9CA 1YIJS 4ID8A 4QR2A 1RTJB 2MKSA 1BQMB 4EWTA 3GV8B 2K3KA 2IBKA 1XNRF 1T3NA 2UXDF 2DCUB 2HW3A 4IG0B 4ILMA 3HHDA 4TYBA 3TVZA 3EXCX 3CJKA 3T1AA 4CO2A 4ECQA 2APOA 4RNHA 2VG5A 2VPXB 4WXWA 4TN2A 2ZHOA 4YOEA 4B9NA 1Q78A 3KK1B 4ECZA 4C8MA 4A8SA 3HI9A 1RT4B 2BZ2A 1NKEA 2DBBA 2GMLA 4WFBQ 3KLEB 1JK9B 2D1CA 3BGRB 3HHLA 1KNZA 1RA6A 1OQ6A 1RI7A 3J81Y 1BQMA 3K7RA 1NK7A 1N0UA 2BXJA 1JKHA 3MHYA 2W9AA 4IG0A 2FD2A 2XMWA 1V6HA 3C6UA 3NG8A 4OI6A 2FVQA 3T6BA 1N52B 4QPTA 3VAIA 3DHWC 1NK8A 2FHKA 4IQMA 4HI1A 4OI2A 5A6WA 3U1MA 1CSJA 4R8UA 1CPZA 3RB0A 3PW2A 1NJZA 1LQ9A 3M8RA 3HKZD 3UWTA 5DG8A 1JLCB 5FD1A 1FRJA 2MQPA 3NWGA 2CPIA 2BACA 2NUUG 3NCPA 4AXIA 4ILLA 2FVCA 3NP5A 1FE0A 2PC6A 3T1YF 1JNZB 2RQKA 2PEHA 3HVAA 2JC0A 1UEUA 3IWLA 1GX5A 3KFWX 4ZVEA 1SL1A 4OZ5A 4KPYA 2MDAA 2OPRB 4ZCIA 2Q6CA 4LF7F 3SDEA 2HVHA 1S9EA 4MFBB 3CEDA 4DG1B 4C8OA 4LMZA 1HD1A 2LQ9A 4O3RA 1S6UA 2I5JA 5CZXA 2VZ9A 3GR1A 1HFEL 2LU2