2ZI4A

C4s dck variant of dck in complex with l-da+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 83
structure length 228
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi4A00
1XJQA 1G3RA 1KJYA 3ZZ0A 3OEED 5F2EA 2I1VB 3BORA 1YU9A 3CW2A 3BS4A 2VP5A 3T5DA 2H16A 1P9WA 4A0GA 3I1FA 4IRUB 2FV8A 4IW3B 1G291 5EE1A 3KKNA 4PPGA 3IUYA 5HE9A 4DSOA 3CKLA 2IYVA 1TPZA 1RRFA 3GJ4A 1KMHB 4DCUA 1AGPA 1N6RA 1G3UA 2AWOA 4L15A 2FG5A 1YRBA 4IVQA 1R5NA 4GBMA 3NKVA 3RSLA 3GLIA 1N5IA 2G88A 2GF0A 4KLNA 5TY0A 4GFDA 2Q6TA 2G6BA 1JXOA 2C77A 1LB1B 1W1WA 3V4RA 3U5ZB 5FR1A 5IRCD 2QP4A 3KFXA 1CIPA 1KY2A 4Z8YA 4JLAA 2J0VA 2IHYA 1VECA 1ZM9A 1HH4A 2R9VA 1ZM7A 2VHUA 4NE2A 3T12A 2YNMA 1XWIA 4BEBA 3RS4A 4Q9HA 4F7WA 4ZDIA 4PPFA 5DNYB 2QSZA 3LD9A 4P3YA 3A4NA 3QXXA 1R0WA 5L3QA 3EZ9A 1KI8A 4BZPA 3HR7A 1AN0A 4ZIRA 3M4YA 2JA1A 1TX4B 2ODEA 2C8VA 4TTPA 2ZR0A 1MO3A 5SZIA 1WXQA 2GCPA 1FUUA 4HAYA 2BM1A 2Z4RA 3DHWC 4MITA 1HT1E 3HPRA 2KB0A 1EFHA 2WAXA 4CVNA 2GJ8A 1XFAA 5D3MB 4FCVA 1TUEA 4C0KA 3AVWA 2C95A 1U8AA 4C7OA 1JXMA 1Z07A 2IYYA 3ZD7A 2FPKA 3E70C 3IIMA 2O8FA 4IDOA 2VIIA 2ZSAA 2LKDA 5L3SB 3OEHA 4C0JA 3A1SA 4LJ6A 4ACAA 1Y3AA 1Q12A 4RD2A 2ZJZA 5FOSA 3CPHA 2AN9A 3MGCA 3KXIA 3I32A 2G3YA 4B76A 2FX3A 5C1BA 3RC8A 1NY5A 3VKWA 2ZSEA 3EPHA 4DLVA 2YOFA 3QQ5A 3WBJA 1F2TA 1BIFA 3IBGA 3GFTA 4H1VA 1RC8A 3CR7A 4DT1B 1ESNA 4B32A 3P20A 4ZDKA 1ELOA 3GCGA 4BLOA 4V0NA 1T9HA 2JLRA 1E2IA 1QF9A 4Q00A 2GEUA 5JCPA 1S3SA 1VYVA 2BKUA 5FTNA 1CTQA 521PA 3CRQA 4CDGA 2VSOA 1OHHA 3EZFA 2RH5A 4M1OA 4DRZA 1QHGA 3TJZA 3TMKA 4CT4B 4Z1MD 2F1RA 2V55B 3QBVA 4JKIA 1R0XA 1YZQA 1N6OA 2X8AA 2ZUBA 1U94A 3HWSA 3K1JA 5AJZA 4CW7A 4EDHA 1D8TA 2ZM5A 2QQEA 4MGIR 4Q1CA 1FZQA 1IQPA 4Q1FA 2IYWA 2ZRFA 3ZZTA 5JRZA 4LOAA 2OILA 3QPWA 2BBTA 1IN5A 5KSPA 3NDBB 4BFWA 3BD9A 5D3MA 3SE0A 2ZXUA 3RS7A 3LX8A 4CEHB 1M8PA 5AJVB 1FNNA 3R9IA 5JEDA 3ONWA 2HT6A 3F5FA 2CK3A 4LZZA 3U3OA 5HE8A 2OAQ1 3CH5A 5KDOA 1OH8A 1D9XA 1S9HA 3O47A 2YHSA 3ICEA 4DIEA 2ZYUX 1XD2B 4R2IA 3CZQA 1E9EA 3PUXA 1DO2A 1YR7A 5TXGA 3BXZA 1CXZA 1P7CA 5JWHA 5F98A 3FOZA 5IHPA 4URXR 2W6JA 1KO1A 2QA5A 3U3RA 3RRNA 3GQBA 1HURA 1W4AA 1A2KC 4XJXA 2D3WA 2GCOB 4MKIA 1MT0A 1J70A 1E94E 5E7IA 4D80A 4D4KA 4KAXA 1N6PA 3UMRA 2CJWA 1M6NA 3G82C 2C9CA 4A8JA 2QRNA 1RJ9B 4O2RA 1FMLA 3ZQJA 4RY2A 2B21A 2HF9A 1TNDA 4C9BA 3FMOB 1G8FA 4M22A 4NBSA 2P6UA 1AIPA 2KBEA 3DKPA 1ZYUA 1JJ7A 3KB1A 3KKPA 3OIVA 4HYYA 5E7MA 3FVQA 3HR8A 2BM0A 3EX7C 2A30A 1XCGB 1AGRA 1CRPA 3AF1A 1DG1G 1OYYA 3U3JA 1P6XA 2IYRA 2NZ8A 1KSFX 1KAOA 4OKSA 1HTWA 1KI4A 3E1SA 2REBA 1R7RA 4CEIA 1IXRC 4Q18A 4DB2A 1L2TA 2Q3FA 3Q9LA 3WRYC 3GEIA 2EW1A 3KX2A 1MOZA 1G64A 5EZ6B 3MRSA 1W2GA 5CM8B 5DN6D 3GLHB 4DCNA 3KJIA 5HR5A 4L9SA 4RZ2A 5KHOC 1NF3A 1E2QA 1XZPA 4OQXA 4Q9JA 3ZIAD 2EQBA 5KPDA 4GDFA 2HUPA 4PTLA 2CNWA 2DFLA 3CF6R 4PC7A 5EE9A 5GJWC 2XGJA 1F2UA 4Q9KA 2GBLA 1KDOA 4B73A 2ZYWX 4O3MA 1VHTA 3FKSA 1GIAA 2G0NA 2IYQA 3FKQA 1DAEA 4FMDB 5TMPA 3EPKA 4BLSA 1FP7A 5DIFA 3O8DA 3TQCA 1XD2A 2RCNA 1NN3A 4NHOA 1KDRA 2KWIA 2Z6VA 2E9SA 4NYMQ 1KO5A 1KI6B 1CJMA 2KI5A 2N1BA 3BFVA 4GZLA 3I73A 4E07A 4N0DA 3L0PA 2NPIA 5KSYA 1HQCA 5DSZA 2QMEA 3CRMA 1ZUHA 2WSMA 2JASA 3HPQA 4JBWA 3A8TA 4FMBB 2GA8A 4DDTA 1E0AA 1J7KA 2VHCA 2PH1A 3T1OA 1XEFA 5HTKA 5F3WB 1TQ4A 1LF0A 3CZPA 4KBGA 4D0LB 1Z22A 2J5XA 4EFNA 1TL7C 3D8BA 3VMFA 4A8JB 1ZM2A 2ODWA 4D0GA 2PEYA 3DM9B 3PUWA 2IEYA 2J0UB 4HLUC 1SQ5A 3BH0A 1IOZA 5AWFC 1CJUC 1VDZA 3GP8A 4HB2A 2RGNA 5FTMA 4X8OA 2WWXA 3ASYA 3LXXA 4B3XA 1OH7A 4FWTA 2WSSD 1XF9A 3DMNA 3W6NA 1P60A 1N3BA 2IF2A 4LHXA 1OFHA 2J3EA 2XJ9A 1AM4D 5KU1A 1QG4A 3FHOA 2JAQA 3SU8A 2FGJA 3P1JA 3KQKA 3PEVA 5G3YA 1EXMA 5E95A 3IIJA 5JJKA 2OAP1 2FFHA 2J0UA 2QP3A 2WJYA 4LJAA 5BWMA 1SVMA 5EE5B 3C5CA 3OIWA 1AS3A 2WOOA 4K8OA 2UZIR 1N6IA 1TUIA 2W00A 4LHZA 1ZU4A 1KI6A 1HE1C 3UG7A 1G20E 2NO0A 4GSYA 3TIFA 2I1QA 5CLLA 2O8EB 2QI9C 3ZH9B 5G41A 1Z3IX 2GEVA 3G0HA 2ZANA 5DYGA 1PJRA 2JJ1D 3EASA 4BFXA 3L8ZA 4FMCB 4K81B 3C15C 4F38A 3HDTA 3L0OA 4YLGA 2GZHA 1CULC 4KSCA 2BDTA 4TSFD 4GNKA 3PXGA 2RMKA 4MA4A 2Q9CA 4GMDA 3ZVLA 2OO7A 3BFXA 2D7CA 3Q3JB 4PXAA 2ZRMA 3HJNA 1WBDA 1S4QA 3U6KA 4JJZA 2QTVB 4NDZA 1I4DD 1M7HA 3K8YA 4PQRA 1XMVA 4BRUA 3QKTA 4I99A 2B8WA 2VF8A 5GVSA 1ZUNB 3LBHA 1LY1A 2C78A 4W5WA 2GWHA 2ZS7A 1K5DA 2ZJ5A 1AQUA 1GM5A 1GNPA 1AK2A 2BHRA 4LK2A 2F1IA 3SI7A 3NEYA 1MO4A 1QHHA 1OFTA 1S3GA 4TWZA 2XOKA 2ZUDA 2FSHA 3GJXC 5P21A 2AR7A 2GAOA 5TVKA 5FTKA 4Q1EA 3NBZC 4QGGA 3ASZA 1ZC3A 4Q4JA 1A1VA 4WOPA 1OB5A 2NQ2C 2XZPA 4C0HA 1G3IA 3QENA 2PL3A 3N70A 1LS6A 4PO8A 4DBLC 3O8BA 3P27A 1D9ZA 1MH1A 2JEOA 2SHKA 1SKYB 2ZE8A 4LC1A 3RS2A 2C03A 2ORIA 3F8TA 4CEIB 2BMEA 5JSZB 4HUQB 2A3RA 2ZJ8A 4TMZA 1QHHB 1KDPA 3THWA 4QBFA 3VR6A 2ZUCA 4AWXA 3ZS9A 1ZNWA 3K70B 1XXHE 4QBIA 5FUVA 4RKEA 4DHEA 1A5TA 3BK7A 4M9SA 5AUQA 4BLTA 2OFWA 4IOJA 3KQLA 2D06A 2IWHA 1ZUIA 5HZKA 1OB2A 1I2MA 1N5KA 1OXTA 4OK3A 1J99A 5J5CA 5FFMA 3WMGA 2IT1A 2PCJA 1ZBDA 2XTZA 2FOLA 1W36C 2ZI4A 3A37A 4ASUA 2MSCB 3KL4A 3SC3A 5B64A 1G16A 1VG8A 2W2XA 5LD2B 1KK3A 1Z8FA 1U8ZA 3QE0A 3OEHD 1AZSC 1IJEA 1E9BA 1F3OA 2ZE7A 4B74A 721PA 1FX0A 3AVQA 4LYHA 3MWJA 4P31A 1MABA 2H7VA 3Q7PA 2VBCA 4FW9A 4UQOA 4YMSA 4W9MC 1E99A 5IK2A 1GTVA 3TVTA 4BECA 3EG5A 2ANCA 2MSDB 4E09A 3THYB 1NLYA 4RZUA 3W6OA 3I5XA 4DB4A 4IJMA 1MO5A 2OXRA 1JNYA 4DEXA 2OE2A 2XSZA 2Q9BA 1SXJC 1OIXA 3BE4A 3CM0A 3K9NA 4DLUA 5C18A 3B7GA 5GJCA 2JDIA 1NKSA 1W48A 3C16C 1SVIA 2R6GA 3AVPA 3FMIA 3N5CA 1U9IA 2PZEA 2QZ4A 3SHFA 4QXAA 4B3BA 4G1UC 2VQSA 5JLJA 3ND9A 3A1TA 1KJWA 4F4JA 4H1UA 4ZO4A 3I3SR 3WMFA 2GXQA 1DS6A 4QKQA 4OHYA 2FSGA 5AJXA 2Q3MA 1KKMA 3IILA 1RRGA 5EP4A 1E2KA 4A82A 4EJSA 4PHFA 1DADA 1HUQA 4HDCA 2GBLC 2IUSA 3EIEA 1HQYE 4UXIA 4QM7A 3E5HA 1E2EA 3EXAA 1KK0A 1X86B 4EAQA 2NMVA 2XX3A 4DT1A 2XITA 4DDUA 2X19A 2GJSA 2J46A 4FCWA 3QSYA 4IDPA 4EPTA 4TLCA 4D0NA 2W58A 4Z8XA 5LPNA 1SVKA 4LJ8A 5JMTA 4II7A 3VTKA 3AVOA 1T0JB 1E0SA 5E4FA 4PHGA 1G8YA 1W46A 2JLZA 4PANA 1F60A 4KFUA 1RRPA 4R98A 3SBEA 5JSZA 3KQHA 2QMHA 3RHFA 4XOIA 3THWB 1G4AE 4BFVA 4LJ4A 5GJVC 3NC0C 4LGMA 4TMXA 2ZREA 3WP1B 4GZMA 3EWSA 1M7BA 3MSXA 3K0FA 4IXNA 1VYTA 4ARZA 2D7DA 4RD1A 5DLQC 3TQFA 4ZI3A 2WWYA 3IIKA 5DHFA 3SNHA 1R6BX 3CBQA 5GADl 2ZROA 3P4XA 2BJVA 4A2PA 2WJVA 3HU1A 2VTKA 4M2LA 1W0JA 3AF2A 5C4MA 3RAPR 4FD2A 2JIZD 3IEVA 5FPSA 2YWFA 1AJEA 1KKLA 5FTJA 4KJZA 4OJQA 3TW4A 2CL6X 2ZRHA 421PA 4GT1A 1BKDR 1S2MA 3U7EB 1JJVA 1NN1A 2GK7A 2OBNA 3L0IB 4TYYA 4US0R 2LKCA 2CCKA 2OUKA 2VPPA 3D6TB 4Q9LA 3RWOA 3VHLB 2A7QA 2A2ZA 3GLFB 5CLQA 1ZJ6A 1ZM4A 1UDXA 4BLRA 3SEAA 2NTYC 1YE8A 2FGKA 5FPTA 4R71A 3LV8A 1XU4A 1WMSA 1DOAA 2YYZA 1XTRA 1OIVA 3TUJC 4Y0AA 3SFZA 4IDQA 4JL8A 4ZV4A 4C2TA 4JBYA 2XZLA 2ODBA 1N0UA 4MKFA 2F1JA 3B1XA 2JDID 2HV8A 3NVAA 2OV2A 1TTTA 2QSYA 3W9YA 3RS0A 4OK6A 4IKEA 4YDSA 4C30A 5M04A 3Q7QA 5AR1A 1YZLA 2OCYC 4E22A 2W6IA 3FYHA 3DMDA 1W5SA 1UKYA 4TZ6A 1NLZA 4CEHA 2UZ3A 2ZETA 4IHQA 3SS8A 1FOEB 1A7JA 1XZQA 2QMOA 2ZS9A 1UDWA 4IXMA 2IWRA 3U60B 1CR1A 4EUNA 3HU2A 2PT5A 2A5YB 3L8YA 1EGAA 1IJFA 1NVWQ 4CEJB 1P62B 1XXHB 5BN5A 4BQSA 2JLUA 1W4BA 4RJLA 1M7GA 3OFNA 2ZE6A 2QGZA 4IEIA 4CT5A 3V00A 4NYMR 3W90A 2O8CB 1A4RA 4FMDF 2Y8EA 3FTQA 5G40A 4W5HA 5LD2C 3Q8XB 1NG1A 4KVAA 4DLZA 3ZVNA 1FQKA 1NVVQ 3KQNA 3PEWA 1TF2A 1RZ3A 2BJWA 3QXSA 1Z6AA 4XVUA 2JJ8A 3PIRA 1SZPA 1GRQA 4JS0A 2PX0A 1UFQA 5FPKA 4GOXA 2J1LA 4RZ3A 4BFZA 2G1KA 1EX7A 1FPMA 2WTUA 1IHUA 1K5GA 1SXJD 2QEQA 4OHXA 1W4CA 3JVVA 3X1XA 3B8HA 1G7CA 3TK1A 3DM5A 2RGGA 1DTSA 4GOJA 1S9DA 3NC1C 2BCJQ 2OCAA 5EXTA 3TE6A 2Q9AA 3QXCA 2YOHA 2Q3HA 4R9UC 2QM7A 1E1RD 4UNRA 1YZKA 4A9AA 3U7FB 5FI0B 1VTKA 3QXHA 2CDNA 4RCZA 1E9DA 1X8JA 2VRWA 1S1CA 1U0JA 1ZMXA 3UKDA 2JLXA 4FXPA 1NVVR 3T35A 3BC1A 4JKYA 1NIJA 1GP2A 2D62A 3THYA 2GEDA 3CIOA 3EA5A 2CHQA 1UJ2A 1OYWA 2WIAA 4X8MA 4AYTA 1NBMA 4DCVA 1DG3A 3KUCA 5DISB 4LI0A 3VQTA 3TR5A 1EFTA 4P4SB 2WMNB 4M4SA 2OHFA 3NBYC 2TMKA 1NP6A 2W83A 3VFDA 2V1XA 4PHTA 4MUBA 1MKYA 4J0QA 3TH5A 2ZRIA 4Q7LA 4TLDA 5FBLB 1OE0A 2RHDA 4JLBA 1XJCA 2VH5R 1E9AA 1RW4A 3LAWA 3MUFA 2JJ1A 3SYNA 3GJ8A 3K0AB 1M74A 5DHAA 3Q85A 4KYUA 1MRNA 3AP3A 2W2TA 1KGDA 4V0LA 3AP1A 1G18A 1G21E 3PENA 5EP1A 1TEVA 2ZQ5A 3GEHA 1Z47A 4G3XA 4DEYA 4C2UA 1BOFA 2V3CC 2QAJA 3PV0A 4QJ4A 2K5UA 1Y63A 2VP9A 4LYJA 4Q7KA 4OHZA 1E32A 2GKSA 4HUQA 2XSZD 4IOKA 3ZIAA 2WMOB 4AIIA 4JVLA 1XRJA 3LLMA 4M1YA 2CL0X 3CX8A 5SZHB 4LUCA 2HLDA 1RVDA 2PZGA 1ZD9A 2EYUA 2X1VA 1JPNA 1UBFA 3SYKA 4AD8A 4RZXA 3RRMA 1XTSA 4GL2A 4HB4A 4JMPA 4YXWD 1F6BA 1TQDA 4JSTA 3U7HB 2AK3A 3AV0B 3G5UA 2CE2X 3ADKA 4BFTA 5AUNB 2QPTA 3SJAA 3CONA 3R20A 1KSJA 3TAUA 3PR1A 2RGNC 5AJWA 3RRYA 5C4GB 1VIYA 3TLXA 2P65A 5EXXA 3R9WA 2ZI3A 4IOLA 3SQXA 2QTFA 1T5LA 3FGNA 1OXVA 2P3SA 1JR3D 1EG7A 4GMXA 1Q57A 2AHOA 3BERA 4TT3D 2IX3A 2FFBA 2VP2A 4B6FA 3RWMB 1Z0KA 1E79A 3CO5A 3X1YA 3OE7D 1FL9A 2NO1A 3KB2A 2QE7A 1WP9A 2VF7A 3A4MA 4PAOA 1IY2A 2JLVA 1ESMA 2QGNA 2GHIA 3KKQA 1WB9A 4Z54A 1I4TD 1CP2A 2YWEA 2R8RA 1G8PA 1OF1A 2ORVA 4O0MA 1ZU5A 2O8BB 5FOTA 4OHWA 3W3ZB 4GP7A 3K9LA 2YKGA 2WWWA 4FIDA 3REGA 4PAMA 2P5SA 3LH5A 2MMGA 2IYXA 4OJKA 4WA7A 3RDPA 3B1YA 1FTSA 1DAKA 1G41A 1FW6A 1E1QD 3ETLA 3RYTC 2WV9A 4TL7A 3W5JA 4BASA 2ZITA 4QGFA 2C96A 1NSTA 2AD1A 2GILA 1E4VA 1NKTA 3T1VA 3VU9A 4AK9A 4BEJA 2JIZA 3H1TA 2ZU0C 4KI0A 5J40A 5KUTA 4DUGA 5C2JB 3UPUA 4NYJR 2V8OA 2J9RA 5FBQB 2PLFA 1D2EA 2ZSDA 4GRAA 5EP3A 4BE7B 1R10A 3TKLA 4Q47A 3H4MA 2NO7A 3A1VA 2XNDA 4HAUA 4LJYA 4E03A 4PC3A 1G7RA 3NH9A 5CB8A 2ZE5A 2QUZA 3AF4A 2P6RA 5BN4A 3W8NA 5LBIA 2AKAB 4FINA 1E2GA 2RGCA 2IA5A 1RFLA 3WBKA 3KJHA 4TQ9A 1E98A 2FPLA 3QF4A 4BUJA 4Q9IA 2IC5A 5JHHB 5HZHA 3R8CA 1YR6A 4N3NA 4B48A 2ZRKA 5J4YA 1B0UA 3A1UA 1KNQA 1R5BA 4A0RA 4YONB 2CL7X 1ZP6A 5EXSA 2QAGC 3LQRA 4A1FA 2OFOA 1HY3A 2CEAA 2FWRA 5JEEA 2DWOA 3L2OB 3RS3A 3OIYA 3J81k 3PFIA 1X3SA 2WBLC 1LV7A 1G5PA 5H8WA 2XXAA 4Z1MA 3WHKA 4DC9A 5H68A 2KE5A 2PJRA 1XTQA 4B3DA 1IAQA 3KXKA 4GI7A 2G77B 4BLPA 1R0ZA 4YMUA 3IHWA 3ADCA 4EJSC 2DR3A 1Z0AA 1U2RA 3O8CA 1Z0DA 1XEXB 3WNDA 1TMKA 3FPAA 4TMTA 4LPKA 4YMWA 1NNEA 2IYZA 2QM8A 3TVDA 2CLCX 3EARA 2XZOA 3HYTA 2RGAA 2O52A 1U9IC 1EFCA 2ZYVX 2QBYB 1AQYA 3AGPA 2GNOA 1J8MF 3QF4B 2NO6A 1K8RA 1DE0A 3ZQ6A 2FH5B 3THXB 2WAYA 1M1YE 4JLPA 4PO9A 1OXXK 1DO0A 1SHZA 3X1ZA 4QBGB 2VHQA 3IHLA 2V7QA 2BIFA 4FCTA 1CJTC 1N0WA 3QG5A 1WRBA 2ZI9A 4HZIA 1LVGA 1TF7A 3IQXA 5JWRA 1GITA 4UXJA 4EQ6B 4D25A 2XTNA 2QT0A 2ZR7A 3GJ3A 4AKIA 1DELA 2KJQA 5AUPB 1KSHA 2YOGA 3B13B 3GLHE 2GK6A 1R2QA 2DB3A 5FR2A 4F4IA 1U99A 4C0QC 5HKKA 4X8LA 5L3VA 3BBPA 3T06B 3U4QB 1LW7A 2CLDX 5TDHA 3LRPA 4CZ2A 5GJBA 1W5TA 1ZIPA 3QJYA 2FF7A 1G3MA 1GG2A 1H8EA 2A5JA 2BBOA 5DI3B 4IVPA 2CVFA 1L7VC 3MWLA 3GLIB 5L8VA 3TAHA 3QKRB 5E7JA 2ZRDA 4GOKA 2OLKA 4QHTA 1SKYE 4B47A 3H2YA 4M0LA 3VR3A 1QHNA 1KMHA 4U00A 3M0EA 5FUXA 3QY0A 1XBTA 3KQUA 3KTAB 1AKYA 2B8TA 2OXCA 1HA3A 4BFUA 3B82A 1ZRHA 3OZXA 3T61A 2W6ID 2ZRAA 1US8A 4MRNA 4B43A 2ZJYA 3T1QA 4XVRA 3IGFA 2QENA 1YR8A 1QZXA 3C7KA 3SR0A 1ZNYA 3LW8A 1G7SA 821PA 2QPAA 2NGRA 3DOFA 3NDPA 4PZYA 2IEZA 3DZ8A 2V6IA 2DPXA 3GLFE 3VX4A 2ATVA 1GKYA 1U0LA 2FA9A 3O8RA 1GDDA 4JBXA 1XTIA 4XWAA 5JI3E 1CS4C 1P9RA 3CLVA 1EWQA 1PLLA 2EFHB 4UNNA 4G5RA 1K6MA 1TEXA 1Z83A 4PSAA 4B3FX 4LBYA 2CNWD 5DGXA 3AVVA 1DAHA 1N5LA 4URZR 4B33A 3M1IA 4NCJA 4DVGA 1P61B 1Q1QA 1IN6A 2GESA 4NCHA 4DLRA 2BC9A 1P3JA 2GJAA 2NO9A 3JZMA 5J4HA 5K8UA 1HE8B 4OQLA 4US1R 4M1MA 1KZ7B 4NPHA 2OBLA 3PEYA 2QN6A 1UEJA 5EE3A 1NY6A 1JAIA 1UKEA 1GILA 4GPTA 1J8YF 2GZDA 3BFKA 1ZM3A 2OM2A 2GF9A 3EAQA 3UATA 2CCJA 1W36B 2ZAMA 3N2IA 2NZJA 2G83A 4M1TA 5B57C 4A6PA 2QQ0A 1W49A 4HB3A 4ZCMA 1VKJA 1CBUA 2FPMA 2J7KA 3P32A 1P2TA 3CRVA 1KDTA 5KNCA 2OCBA 1BMFD 5LB4A 2P0EA 1G8HA 4QHSA 4L9WA 2YWHA 1OKKD 3K0AA 3AM1A 1R8SA 4EJSB 3WP0A 4ESVA 4KODA 4US2R 5FBRB 1U8YA 3WYFA 3WYAA 4Q21A 1W0JD 5EUQB 3QVUA 4TT3A 1U0HC 4Q02A 5EZ5A 1V43A 3CNOA 1SVLA 3B1ZA 1TADA 3GJ6A 1X8LA 2RHMA 1OXSC 5KYKA 4DLYA 3PITA 4JT2A 2O0HA 1ONBA 2QMUA 2F9LA 3I8XA 1YRAA 2GJ9A 3OHMA 2RKOA 4LBVA 2HT1A 1XMSA 2YC2C 1DAMA 4YMVA 1WBBA 1OLOA 2R6DA 1W44A 4EPVA 4RFVA 5HPYB 4B44A 1OSNA 2AFIE 1XDBA 1XD9A 4IDHA 5JJIA 3C14C 1ZC4A 2F1HA 1WF3A 2XNSA 1Z6TA 2F3RA 1E2MA 3LA6A 4HLUA 2W0MA 5EUMA 3FHCB 3ADBA 3B9QA 2PMKA 4B3CA 5IF9A 2QY9A 2G1JA 2R65A 4QFMA 2ATXA 3C4JA 4MKHA 1HYQA 1E9CA 1AKEA 4URYR 1D6JA 2P5TB 3ZJYA 3RRZA 1X6VA 3BOSA 1QRAA 2CLSA 3HU3A 2V4ZA 3I72A 1W47A 1F5NA 3TW8B 2J7PA 3GLGE 3QUSA 2IYSA 3GLGA 4RD0A 1CEEA 3AUXA 2XNDD 3BWDD 2O8CA 4YMTA 2GCNA 4PSVA 5KNDA 2IUUA 2AD5A 3C8UA 5CK4A 1E2LA 4ZKEA 1E9SA 4AKHA 4QJ5A 4JVMA 2VYFA 2WVJA 3QIAA 4LV8B 1Z5ZA 2R62A 3C41J 3AVUA 4OQFA 1DARA 1II8A 4XVQA 1R0YA 3MAAC 4OI4A 4UXHA 1VCNA 4JL5A 4URUR 5G3ZA 4EPYA 1N6LA 1BYUA 5E3HA 4FN5A 1TF5A 1Z0FA 2VSFA 3QKRA 5EP2A 4TMWA 5CIQA 2VP0A 5DI3A 3F3YA 3R7WB 1Z0IA 4S35A 3W6PA 3FFBA 1QHXA 4NH0A 3CWQA 4AKGA 5BXQC 2GDJA 1YHNA 2JCSA 3BRWD 3SFVA 2C99A 1KY3A 1E4YA 5K8LA 1OW3B 3R9XA 1NLFA 1SXJA 2J41A 1NJFA 2QE7D 1WDTA 4LHVA 4M1SA 2BBSA 3VR5A 1JR6A 3AEZA 5TB5A 4C0AC 4N1AA 4Q5IA 3OIUA 5FOXA 3K70D 4PQYA 2ODNA 1RE0A 4URVR 2QPOA 3WXMA 5JRJA 3QVVA 1Z6GA 2J0QA 1XPOA 2ERYA 3NBFA 1P2VA 4ZCIA 1PUJA 3GEEA 3DDCA 5DI9A 4D4JA 3MJHA 4BZQA 4LYFA 3K09A 1E6CA 4G5QA 2HEIA 5L3QB 2QBYA 4HAVA 2OFXA 3W3AA 4KHZA 4AURA 4CGZA 3OAAD 2J0SA 2ZJ2A 2J87A 5KSZA 1PUIA 2D4HA 3NBXX 4JLOA 1VCIA 1ZW6A 2BKEA 2WJHA 3QXJA 3VNUA 3GFOA 4HZUA 1SXJE 1W0KA 3ZS8A 4ASUD 1BYIA 5KOYA 2G9NA 2O8FB 2AKYA 1LFDB 3CX6A 2DWPA 2EFDB 4YDHB 1XEWY 4TTQA 4H9GA 1GZSA 2IF0A 3R7WA 1Z2AA 4URWR 1UBCA 2PMDA 3EZ6A 4I1SA 4LJ5A 4RKFA 1VYUA 4XH9B 2F43B 3MMPA 3ECCA 2J7PD 2YC4C 4G01B 3CRRA 4BGDA 1E0JA 2FE4A 1ZD8A 3LWNA 3K9GA 1ETUA 1J90A 1HV8A 2ZRGA 1GAJA 1FQJA 1DAFA 4KFRA 4KO8A 3H0KA 4D6PA 4MRVA 4TZ0A 3GJ7A 3LW7A 4KFTA 4Q4HA 5B2ZA 1Z06A 1GL6A 3U7GA 2H8KA 3EA0A 3Q5DA 5H70A 3AKDA 5JS7A 1DAIA 1AS2A 1DEKA 4LSGA 2HLDD 2OZEA 1CKEA 4C0SA 2ZRPA 1CJKC 4YXWA 3TSZA 2OBMA 4XD7A 1E2FA 4DSTA 3SOPA 2H18A 2A5FA 4MRSA 3V9PA 3QOFA 4KXFB 1VG0B 5BN3A 3K9HA 1GWNA 1Z6YA 1EFRA 3VR1A 3JZAA 1GKUB 4P33A 4DIDA 3SQWA 2IYTA 4A0HA 4ZKDA 1Q22A 2R44A 1BO6A 2IHBA 4IFEA 1T91A 3VU9B 1VCMA 3K0CC 1OT3A 2QROA 8OHMA 1Q1BA 2HDNB 4Q7JB 1KK2A 1KJZA 3PJRA 2GVZC 1RRCA 5K8IA 2QNRA 4ILEA 2ZVPX 2W2VA 4G0NA 2JGNA 4NZYA 1C9KA 4P32A 3WRXC 5HCIA 4A4DA 6Q21A 1TAGA 1C1YA 1N5JA 1FNMA 3EWAA 5TARA 3B1WA 2J59A 2QU8A 2ZJBA 4HAZA 4B3GA 5JI2E 5JWOA 5IDVA 4LBZA 2UVQA 1ZNXA 3SZRA 3UWOA 3T5GA 2QORA 1E0KA 4QJ3A 5JCZA 3U2QA 3OAAA 3ZGXA 4AC9A 4ZCLA 2DFNA 3CH4B 1JR3A 1FX0B 1XEWX 4GP6A 4NKRA 2WJIA 3MLEA 3W8RA 5CITA 2VO1A 2N46A 4MH0R 5A5GA 2ZAOA 1E1QA 1CR0A 1MRSA 4WZ6A 1G7TA 2C2HA 2W6JD 1J2JA 3K09C 2IL1A 4JLMA 1TQ6A 2PLRA 3N2EA 3TSWA 4DLTA 4XTCS 2V9PA 3BGWA 4ZI2A 1RPZA 4M53A 1H65A 3F0TA 1GRRA 1F2TB 4QNMA 2ZI7A 3QNUA 4V0ME 5CB6A 2DWQA 3OESA 4A2QA 1KO4A 2JJ2D 3NWJA 2BBWA 2AWNA 1E3MA 4BLQA 1GL7A 2AL7A 1GRNA 4QRHA 1A82A 2BMDA 3PG5A 3A58B 1JPJA 1IXZA 2R2AA 3CR8A 3QG1A 3FDIA 1KI9A 1JECA 5JBQA 2C98A 3NG1A 4UNQA 2QP9X 4A6XA 1NMXA 1AZTA 1XPRA 4R7ZA 1H8HA 3LQQA 3IO3A 1KI3A 5FL7D 3GJ0A 4PPQA 2AFHE 3MG9A 4ERNA 1COWA 1ZD1A 3LXRA 4YC7A 1XPUA 2NG1A 1N6KA 3AVXA 1DAGA 1UKVY 2IK8A 2YZ2A 4BPBA 1Z2CA 1IY0A 1JQJC 4DXAA 1NI3A 1L8QA 1YKSA 3IBYA 5EQTA 1D2NA 3RNLA 2R6CA 2ZI5A 4KYIB 4HUTA 1E96A 1WQ1R 2A9KA 2A78A 3RABA 4DSNA 4DSUA 2BMFA 2DY1A 3GLGB 2WKQA 1HEIA 2RAPA 4OK5A 5K8TA 1XTJA 3BB4A 4B2PA 4LHYA 1GOTA 3RSOA 4OQMA 1P2UA 3AUYA 4ZDJA 1VG1A 2OT3B 5CK5A 5KPJA 4DLXA 1YZTA 3WMEA 2F9MA 3BB3A 4B71A 4LV6A 5CM9C 1LNZA 4MKGA 4C4PA 4JVNA 3CUEF 2ZYTX 2NPFA 2RGXA 1XB2A 1XCPA 4BWYA 4D81A 4OHVA 1MV5A 2WWGA 2DYKA 5J4KA 4M1WA 5A0FA 1BMFA 4L5BA 1DBSA 3CNLA 2D2EA 2CE7A 3IQWA 4MYCA 1VG9B 4KCGA 1ZCBA 1FMJA 1PZNA 2BVNA 3NEJA 4JYCA 5JJLA 3TGPA 3R8FA 2IYLD 2IUTA 1GNRA 1IN4A 1G5TA 3QI2A 1OFIA 3B1VA 1QVRA 3Q72A 2ANBA 2WWHA 4ITRC 3UG6A 4BFYA 1T8UA 1QHYA 2GAAA 3EC1A 4Q1BA 1E9RA 4Q4HB 2ONJA 4QHYA 2CHGA 2GTPA 4NL4H 4KITB 3EZ7A 4AYXA 2A5DA 2REXB 1YJ5A 4KVGA 1JEDA 1VMAA 4HLDA 4NP6A 2YJTD 4LJ9A 2BOVA 2GVDC 4BFSA 3B9PA 3TR0A 2EFEB 1KZGB 4CYMA 2R6AA 1IONA 3LLUA 1BS1A 5DYIA 4OI0A 2B7BA 1NBMD 2F43A 4RSGA 4IFBA 2WSSA 1CLUA 4KV9A 1GSIA 4TL8A 2VLIA 1KHTA 3KFVA 4JYBA 3K53A 3UWKA 3AQ4A 5L3SA 1XXHA 3WY9A 1NJGA 1U98A 3WHLA 3VAAA 1T4GA 3VKHA 3I62A 3B6EA 3TBKA 2VSXA 1Q3HA 4L8GA 4L16A 4OI2A 1UBGA 3UXMA 1BH2A 4DLWA 1XP8A 3FB4A 3ZZUA 4CEJA 1VCOA 4IOMA 4JLKA 5FOUA 4CF7A 4Q4JB 3BH7A 2FSFA 1KSGA 3SYLA 1R4AA 2PCLA 3D7MA 4V0OA 1M34E 4DUGD 4JLJA 5CIWA 4P4UA 1VHLA 221PA 4MGKR 3GMTA 1N25A 2HCBA 1I2DA 3AF3A 3WNBA 4HDOB 3MFYA 2FJUA 3X1DA 1UM8A 3AKEA 1C4OA 4FWIB 4M9ZA 3T15A 1OXUA 3VR4A 1FUKA 1NMYA 2I4IA 3HP1A 4JVSB 3AF0A 2XB2A 4LCBA 3BJIC 5C46F 2BMJA 3IO5A 3WNCA 2C5LA 2AK2A 3PUVA 4D2IA 3E2IA 5DE3A 1HT2E 1G6OA 5J4LA 3CWZA 2I3BA 2GZAA 3BB1A 4Q48A 5FI1B 2PEZA 4B75A 1SXJB 4WZBE 2R6FA 4UNSA 1CF4A 2Q0HA 2IS1A 1N6HA 5KTYA 2AX4A 4B35A 1OH6A 2X2EA 3CPJB 2WKPA 3OEEA 4TLAA 1G9XA 4TLBA 1D2MA 1NIPA 3U44A 4Q19A 3ZVRA 4NCIA 3QEOA 1IXSB 2NOAA 5FUYA 5UKDA 2FEMA 2IXEA 4QBHA 1QHIA 3KUDA 4LDJA 4DJTA 4RVCA 2PZFA 4PR0A 1E2NA 4ARZB 2QG6A 4HEJA 1TU4A 3SJZA 1G5RA 5JS8A 1NMZA 2FN4A 5IT5A 4NMMA 5KO2A 1RJ9A 3UMSA 3K0CA 2MSEB 3B5JA 3DVLA 3PCRB 3AKYA 4A2WA 4BZXA 2CK3D 2ZR9A 1KK1A 1UKZA 3DPUA 2ORWA 2FDCA 2CXXA 3D31A 2WHXA 1N6NA 4QC2A 4XSGA 2GXAA 4MDEA 1SGWA 2YV5A 2ZVQX 2FZ4A 1JB1A 1II8B 3CPEA 4PHHA 3PEUA 2ERXA 5CYPA 4Z51A 1T3SA 2FZLA 3QKUA 1UF9A 3D3QA 4LHWA 3FE2A 2H5EA 1ANKA 4TQAA 4C0LA 3K0SA 4TMVA 1SVWA 4HDQB 3ADDA 3MWKA 2CBZA 5TV2A 4RD3A 2JLYA 1G8GA 3QPUA 4MYHA 3Q5EA 4C0BA 1O87A 2QAGB 2E87A 1VPLA 2H57A 2JLWA 1XMIA 2WOJA 3SDZA 1OJLA 3CX7A 1G3QA 1VIAA 1CJVC 2E1RA 4PPNA 1NG9A 1GVNB 1FP6A 1L4UA 1JEEA 4AG6A 3ZYCA 4PX9A 2XTMA 1Q21A 2B7CA 2JJ2A 4A36A 2IXFA 5CJ2A 1P5ZB 4EPRA 1KI1A 3RS5A 2BEJA 5AK0A 3GFPA 3SJCA 1QVAA 4Q03A 3KXLA 2ZRCA 4OI1A 3VR2A 2IS4A 1LTQA 4QL3A 4RFSA 2H1LA 5LDDC 4OBEA 2EYQA 4AYWA 4JT4A 5BQ5A 1S1MA 4I81A 3DO6A 1W4RA 4G5GA 1F2UB 3QBTA 4HB0A 4I1OA 4HSEA 2BWJA 5B58C 4RD4A 2EFCB 3FHTA 4IDNA 3GD7A 5BYJA 4XD7D 3LX5A 3B60A 3VNVA 2ZRBA 4LY6A 2C9YA 4X8HA 4HATA 4PFSA 1FTNA 3I5YA 1GL9B 3DKVA 1P73A 4R2HA 3MD0A 4E5UA 1P4SA 2QTHA 1Q3TA 1CR2A 4DCSA 2V1UA 3UIEA 2B92A 4MYTA 1KO8A 2VA8A 1T5IA 3K0EA 5D3QA 5FTLA 4NONA 2WJGA 4HLQB 1XTKA 4V0KA 5FBWB 2O8DB 2FFAA 1Z29A 3IPYA 3ND8A 1I4LD 4OL0A 3A6PC 4TL9A 1IN7A 4TN1A 1XCMA 2FU5C 2OG2A 3QKSB 3L82B 2G0TA 3CF2A 5ELXA 4FMCF 3EC2A 4TL6A 1YZUA 3TNFA 2WWFA 1E2DA 2GRJA 2LWIA 1KOFA 3FKSD 1JAHA 3L0SA 4DDVA 2D74A 1N0VC 4DKXA 4Q4AB 2JLQA 4AKEA 4KBFA 3AB3A 2WPDA 1KMQA 1M2OB 2XXAB 2BV3A 1CRQA 4W7SA 4P0TA 1Z0JA 2OLJA 5FOWA 2V7QD 3W5IA 3K0FB 2IW3A 1UEIA 2DBYA 4IEEA 4P4TA 2YWGA 4TTRA 1IM2A 2LCFA 5EJEA 3BH6A 1W2HA 4C7OB 4JL6A 2IS6A 1RKBA 3BIFA 1KNXA 3GJ5A 2HF8A 2HYDA 2Z43A 4ZIRB 2AXPA 4WZAE 4MRRA 1JBKA 4JLNA 2GCOA 4TMKA 5HKKD 2O8DA 2ZRJA 4F92B 4D26A 1Q0UA 4F91B 1UBEA 1Q20A 1GNQA 2MMCA 2P2LA 3I61A 1KTVA 1E79D 1T3HA 1UADA 1RIFA 3H86A 1MR3F 3M6AA 2DFTA 3TUZC 5J47A 1MO6A 2ZIAA 3I4LA 3PVSA 3K70C 3SJBA 4QG7A 3IEUA 1OIWA 1ZIOA 1W7AA 3SBDA 4CIDA 1E2PA 3AKCA 5HCNA 2X77A 2OEPA 3OF5A 4WBSA 1W36D 1WCV1 2XAUA 4EFMA 1ZINA 3EIHA 2HYIC 2VHJA 4PAQA 3LFUA 2PT7A 1CR4A 4TQUS 1Q1EA 3SN6A 5FL7A 2WIBA 5FH9A 2FNAA 3MCAA 4DWJA 1II0A 4LX0A 4WXRA 4UJ3A 4JIMA 3X2SA 3NHAA 2WKRA 2O8EA 2Z83A 1QG2A 3RC3A 4D4MA 3A1WA 3QEJA 3S1AA 4ABYA 2WWIA 2N42A 3AP2A 4RD6A 4EQ6A 3AVTA 2YINC 1G4UR 1S96A 1T6NA 2O8BA 2QT1A 4EPXA 3JVUA 2WJJA 4XSHA 2GETA 1SHKA 3LVQE 3UMFA 5CDFA 4V0MA 3KJGA 4A8JC 2RGDA 1Z28A 3GPLA 4I4LA 3NTUA 2XJ4A 1Q44A 2OCPA 5JZVA 1NVXQ 2Q21A 1NVUQ 5DN6A 3B78A 4O25A 5SZJA 3UANA 3LDAA 4DCTA 4MYUA 4M8NE 1G1MA 5L3RA 3LBIA 5AJYA 1WE2A 4W5JA 1IY1A 2EVWX 4BRWA 3MJRA 3QF7A 4A0FA 3TSOA 4B2LA 3I92A 4XIGS 4D82A 4EIWA 2HXYA 4LRWA 4I1UA 4POAA 4DZZA 1NL3A 1DPFA 4PQFA 2WPDD 2REOA 1LS1A 4WAUA 2WICA 3THXA 1S0UA 4QGHA 1T8TA 5J4VA 1T3LA 1FFHA 5LB2A 3GLFA 2WM9B 3H84A 4QOSA 5ANRB 2HCJB 3B85A 4AI6A 3S1AB 3KZ1E 4Q66C 5FUWA 2BEKA 4S2EA 3P26A 5CDFE 1E69A 2CHVA 3REFA 1NRJB 1D5CA 2HJVA 1OKKA 1XMJA 3A4LA 3CB4A 1OHHD 2V54A 4V02A 4ON9A 4B34A 1EX6A 4G5SA 4PZLA 1XNJA 4KU4A 3QPVA 3U3KA 5EE0A 3NHBA 1MABB 4KFSA 3U61B 2JATA 1Z6XA 3BAFA 4L4UA 4NYJQ 3FWYA 4U02A 3X1WA 2C9OA 1E1RA 2O0JA 1N2CE 3TRFA 3EIQA 4ZPXA 5F9FA 1ODFA 5SZKB 2F7SA 2CCGA 5BYKA 1KIMA 1NN0A 2ZRLA 4Q1AA 3QKSA 1EWRA 3FMFA 3LY5A 4QNRA 1TU3A 1ZVQA 3DL0A 2QRZA 3FFAA 1ZAKA 4Q7MB 4NYIR 1NSFA 5FPHA 1S8FA 4EPWA 2EWWA 3ZVMA 1V5WA 1SVSA 3GLHA 4NCNA 1SKQA 1F48A 1OFUX 3MWYW 1EK0A 1NN5A 4FI3C 4B6EA 1Q1ZA 1KI7A 5JHGB 2PX3A 1UAAA 5JFGA 1G19A 2GJKA 3A36A 2L0XA 3KKOA 2ZS8A 1A2BA 1UPTA 5CYOA 4F93B 2Z0MA 5B30A 3ZLJA 3VHXA 4TYNA 2VL7A 3C5HA 4TLEA 4MUAA 4EFLA 1W0KD 2RB4A 4Y0VA 2EFGA 4I1VA 4G5OA 4LC0A 1H8ED 1PLKA 3L43A 4M9QA 4AG5A 2Z4SA 5DH9A 3ZDQA 5IK2D 5KNBA 2PBRA 1RYHA 4XWKA 2KBFA 5FPYA 2DCUA 3U4QA 2AXNA 1QBKC 1GUAA 4UNPA 3DOEA 1Z08A 2QL6A 2XEXA 2ZJOA 3T1TA 1JI0A 1DVRA 4LJ7A 4YQFA 3EPJA 4LBWA 4HLCA 1X8KA 1SVOA 2CJWB 2EU8A 4MRPA 1H8HD 2P6NA 4TSFA 5A4JA 2YVUA 4A92A 3I8SA 4OQNA 1KYIA 3WYGA 4Q4LA 3ICQB 1R8QA 2XB4A 3AGQA 1E2HA 2KSQA 2B6HA 3PUZA 1US8B 1JQLB 2Z5FA 4KSBA 5H1YA 4WIAA 3RANA 3ZD6A 1L4YA 1KO7A 1P75A 4HAWA 4ESHA 3RLFA 1E9FA 2ZEJA 2ZTSA 3LNCA 3V4FA 4TYWA 2FEOA 2FFQA 2IXGA 1WA5A 4JZKA 4KLZA 4OYHA 1CU1A 3NXSA 3CNNA 3DEFA 2GXUA 2D2FA 2FSIA 2O0KA 4HI0E 2HXSA 3U3MA 4PZZA 1NBME 2RGEA 2ZI6A 5DO9A 2BCGY 2ZSFA 4B2IA 1G6HA 3P4YA 4RFSB 4DDWA 2VP4A 4LPSA 4PC2A 2ONKA 5FBVB 1U81A 4PSKA 4NU0A 3LBNA 2J45A 4A15A 1XD8A 2X2FA 4EKDA 1P2SA 3OE7A 2C04A 5FOVA 3B2EA 1TQ2A 2OESA 1II9A 1P9NA 3PUYA 3VX3A 3EW9A 1OPXA 4NYIQ 1PV4A 1JR3E 2IYUA 3NIBA 1P72A 1EFUA 2H92A 2VEDA 1YZGA 3LVRE 4C3ZA 2DHRA 3IPXA 3IKJA 4Q4AA 1KI2A 1RYFA 4MDFA 4JLDA 4XWOA 2ZU6A 2A5GA 1ZCAA 2XOKD 3KDSE 1YQTA 4WW0A 4TYPA 2QAGA 4DLSA 4UKDA 1PVOA 4MGYR 2ASEA 2V6JA 4M21A 4TYQA 1EESA 3SHWA 4U5XA 2CMKA 5EXPA 3VKGA 4Q1DA 2ZPTX 4M1KA 4LYAA 1GFIA 2W0SA 5FL3A 2VHTA 2RGBA 4CRWB 3CF0A 1PLJA 3AH8A 3HYRA 1LF5A 1XX6A 2P67A 4P4SA 1YVDA 121PA 3IDQA 2ECKA 1E2JA 3TUIC 4IVRA 2EWVA 2NIPA 1OV4A 4JSYA 4MGZR 1OH5A 2OSBA 2ZSBA 4N0EA 5GVRA 5CJPA 1B23P 2PJZA 4XTRA 2DFKB 1QDEA 4JJKA 3KKMA 3AVYA 4WXPA 1U90A 4NTZA 1T0HB 4O2LA 3UK6A 1XEXA 3PQCA 2UKDA 4PO1A 1O3YA 1JALA 2ZJAA 4PC6A 3CRW1 1R5OA 3T34A 2WZQA 2H17A 2F55A 4D4LA 2O5VA 2CVHA 4QM6A 4HZUB 5AUOB 4HAXA 1AA9A 4LV5B 5KDLA 4LWZA 3U44B 1AS0A 2JLSA 2F3TA 3KJEA 1SULA 2IS2A 2HJGA 3FMPB 3DZDA 2FMXA 5JECA 4NCKA 4Q01A 1EFRD 4RCYA 3OFND 1COWD 4U7DA 1IBRA 1XJ0A 2GXSA 1YR9A 1ZNZA 3LO5A 5G53C 4PC1A 4QGAA 1X1RA 4V03A 1G17A 4F4CA 5KSOA 5F9HA 3W34A 4ACBA 3GLIE 4AY2A 1KAGA 1IN8A 2IBMA 3THOA 1Z63A 3EZ2A 4WVFA 1GKIA 4M9XA 1YZNA 4MQBA 3U6BA 3KTAA 4JLVA 3NH6A 4K46A 1QHSA 3RVBA 4ZDWA 5BW8A 621PA 5KDDA 2VP6A 1X1SA 3EPLA 2ZRNA 4UJ5A 2F6RA
chains in the Genus database with same CATH superfamily
4PZEA 1KDYA 3PF8A 1FVHA 1KJYA 3C8ZA 3U4GA 4K9OA 4YV0A 4AJPA 5BVHA 2I1VB 2O3TA 4ZCRA 1RMTA 1NOIA 1A9QA 3IPCA 1YU9A 3L7MA 3HKCA 3V48A 5FOQA 1F7UA 2NSLA 4M8IA 1BGXT 4KVFA 3GZ4A 1CUWA 3KKNA 3IUYA 5AOBA 1RAAA 4A5SA 3F6PA 2D0DA 3CKLA 1NYTA 1TPZA 4H3HB 5JNTA 3PQ8A 1HDGO 1EUDA 1JIJA 1E3WB 4D4HA 4L9RA 1FK8A 3KUKA 1X8XA 4OPMA 3IBTA 1QO9A 3FNHA 4L15A 4B3HA 4Y3UA 1YRBA 3RJ5A 1R5NA 1NMQA 3T0GA 1N5IA 2G88A 4KQIA 4OHRA 4J3FA 3FUXA 4II3A 2C54A 5FR1A 1OZHA 3DLTA 4JXJA 3CRZA 5ECGC 3IA2A 2QSJA 4Z8YA 1HM5A 1FTGA 2VQDA 1GQQA 4JLAA 4YT2A 3HDHA 3HADA 3A25A 5D5PA 2R9VA 3LCCA 2VHUA 4NE2A 5EXDA 2VDNB 1DC8A 4IIUA 4WSOA 3T12A 4ECEA 5EAIA 1N5MA 1G8MA 1A2OA 1UXJA 1YBFA 2R00A 4YPFA 3RS4A 3ZYZA 4F7WA 4ZDIA 4KXNA 3EXHB 3TW8A 4PSCA 4CIWA 3UMJA 1ZH8A 2QSZA 4FCCA 3LD9A 3NIGB 3L7DA 4DXHA 1CS0B 4DCGA 4BZPA 5L3QA 2QM3A 4QT4A 3C3KA 4Z4FA 3DBRB 4ZIRA 3M4YA 3EB9A 2JA1A 3TZQA 1DBQA 2R68A 4NNJA 1CEQA 2NYUA 2ZR0A 4PFKA 1MO3A 2GRUA 3DBOB 3HHPA 4KSYA 3EUFA 1CZNA 1NQTA 1YVEI 3BF8A 3MWFA 3DF9A 1OMOA 3HZHA 3HPRA 2KB0A 1EFHA 3QX8A 5CA1B 3USES 2WAXA 3ORQA 3ZK7A 4HGPA 3L9XA 5BSTA 5KVCA 1AKUA 1AXGA 1KYQA 1V5IA 1W5BA 4G6ZA 3COPA 4OGGA 1RP1A 1TUEA 3FSJX 3WRVA 3A4TA 4D97A 1BMDA 3AVWA 5C32A 4CTMA 3JAWA 2PL1A 3ZD7A 2AEMA 1GTG1 3BSWA 1PJ8A 3LUJA 4EEKA 1U0BB 2FPKA 2M6SA 3VUEA 1QLJA 5EMHA 1EUZA 3DE7X 4MUEA 1X19A 1YQ9A 2ZB4A 1AO0A 2ZSAA 5L3SB 5IZCA 1PWXA 2OHHA 4K3VA 1E1YA 5DX0A 1Q12A 2ZJZA 1EP2B 4F11A 4OHCA 1V6SA 1R6DA 3CPHA 4PLTA 3V80A 2F8SA 1K0FA 3GZJA 5REQA 4HL6A 3GPBA 1W52X 3I32A 1QH1B 2G3YA 5EJMA 3HFSA 3RB8A 4B76A 3ACBA 5C1BA 3H5IA 1NY5A 3VKWA 2MSNA 4C0SA 3PKIA 4BMDA 1EM8B 3WQRA 4YUYA 1O4VA 3STUA 1TA4A 1YS4A 4YO8A 4M37A 2ONCA 1N9GB 3QU7A 4DZRA 5FUQA 4BNKA 2X22A 3AG6A 4KNYA 2XIQA 5TIIA 4V0NA 1T9HA 3H5TA 3O90A 5CVCA 4TTSA 2EARA 4Q00A 1DMRA 1WW8A 2GEUA 4S2UA 1CTQA 3EUEA 4AMVA 1ISRA 4K7JA 3EZFA 3RVRA 4CODB 5CIYA 2WTNA 3I8OA 3VV2A 2NZXA 2HQBA 4WBNF 1QHGA 1P5FA 3AWDA 4Z1MD 3GT0A 1NXVA 5KNCD 1NC1A 2F1RA 1R9NA 2G4LA 1F8YA 4EF4A 4IDEA 3E3LA 3BDVA 5ENDA 2XMGA 4CLRB 5T8KC 2QQEA 4MGIR 4Q1CA 1FZQA 4WNAB 2FEAA 2ZRFA 1P3DA 3G9XA 4MUMA 2O2EA 1RWBA 4GMHA 1NUAA 4Q3KA 4ER6A 4GGMX 4EH1A 1V8PA 2VXYA 4L28A 3WSWA 2PS3A 1CQJA 1H6CA 4PF1A 4M1ZA 2OXTA 4OUDB 2MSKA 1PR3A 1HOTA 2PSFA 3QU2A 5KSPA 5JTTA 2XKJE 5D3MA 3SE0A 1UJ5A 4UTZA 4ZCSA 3SGLA 1M8PA 4CEHB 1YDWA 1T13A 4QO8A 3SIWA 4OH7A 2SNIE 5HE8A 3KB6A 2OAQ1 3MWEB 1OH8A 1FYDA 4BMZA 2VDKB 1ZH2A 3O47A 1S9HA 2UZ0A 2XH8A 1KJ8A 2BTEA 3ICEA 4JC8A 2ZYUX 2B2NA 1E9EA 1RBYA 3B8EA 2FSVC 2Z98A 3KEOA 3I5MA 3JXEA 4IS2A 4TWRA 4P92A 5TXGA 3RO7A 1AGNA 1KP9A 4WLUA 1FE8A 1U1GA 2OYRA 3FOZA 1LSSA 4URXR 1ZVMA 4TV8A 2HADA 4I9UA 3EVFA 1RBZA 1EVJA 4DIUA 1DHTA 3IP9A 2O7QA 4RJIA 3LO8A 3VPDA 1IK6A 1WP4A 2LPMA 3PRHA 4WJKB 4XGKA 3ZXSA 4AJ9A 5BSVA 1N33B 1E6LA 1V96A 2RCYA 2AMJA 1J70A 2WTMA 4I1RA 4U6QA 3MNFA 1EBUA 3Q9UA 1GSOA 4HRXA 4D80A 1BN7A 1UK9A 4D4KA 4E2FA 1N6PA 2J9YB 1JBQA 2O8VA 1GPDG 2YDXA 3MC1A 2VBIA 4PLFA 1BCSA 1CDDA 4WFQA 1Z8DA 5HIAA 2OENG 1FMLA 4HQNA 3ELWA 4F1JA 2ZJ4A 5JYCA 1RD4A 1E3SA 3FMOB 4MP6A 4S0XA 4TYMA 4M22A 4S1WA 2ZGVA 5ECWA 2FPWA 1LLUA 2LNDA 1LQ2A 3TGLA 3D1VA 5A4IS 3FVQA 2JIRA 4RTLA 4RJJA 4L6CA 4MIOA 3TIVA 1XNHA 3FWHA 2BEVA 2A30A 1XCGB 3VR6H 3P9KA 2OCDA 4GX2A 2PR2A 2IYRA 1EDEA 2WU8A 4LTNA 4PLGA 4X1KB 3WR5A 4E4RA 4L1KA 1OZFA 3G0CA 2VPWA 2VDPB 4FYIA 2INGX 1CY4A 1W9MA 1KI4A 4MR7B 5CGZA 5FWDA 1Z5VA 1TC2A 3BMXA 1R7RA 3MD9A 4FGJA 2EP5A 3IQIX 4JBGA 4MHSA 4QQNA 4OF4A 1X94A 3ZWNA 3I9LA 4M0EA 2EW1A 2W2KB 1VBNA 1G64A 1J0XO 1HSOA 5DN6D 1YS9A 1MC4A 3DZHA 4DCNA 3P9ZA 4AMZA 3K30A 1JKXA 3K5PA 2EBFX 1S2NA 4GVLA 3WISA 5KHOC 2PLAA 3DS8A 4FHCA 1IPHA 4GL4A 4UEQA 3WBFA 4F9GA 4WK0B 1TPYA 4X91A 1USVA 3INGA 5IU6A 4EW2A 4FOTA 4Q39A 4G86A 2XMQA 3OCZA 2AT1A 2GD6A 3TCNA 4BBAA 1N4DA 5HHTA 5A3SA 1PP4A 4B45A 4TRRA 3WYEA 4OMCA 5EE9A 1F2UA 4CM9A 3KJXA 1YHYA 4B73A 2BDEA 5IDWA 1QONA 2NTJA 1HDXA 5FLEX 2IYQA 1T35A 2YZ7A 1C9DB 3P94A 4QPDA 2X58A 3QE4A 4BLSA 3LGXA 3NP9A 1OU4A 1PF7E 4PX3A 1NN3A 2FZKA 3BFVA 1KI6B 2XWPA 1FFYA 1ESCA 4MYDA 3L0PA 1C7QA 4TKLA 2HQRA 3L6DA 5I8WA 1HQCA 4G2TA 4J7UA 5DYTA 1BRMA 3MOIA 2WSMA 1MF7A 3MRVA 3RARA 4BMYA 4JBWA 3HCEA 1O6BA 1TFUA 1FLVA 2P2GA 3ENNA 1J7KA 4FMBB 4B7UA 2PH1A 4DDTA 5CA1A 5BV2P 4LJRA 1L3BA 2L82A 3ZG6A 1PJAA 3SJ7A 1O94C 3EC7A 2BEUB 4KAAA 4DS3A 4IG4A 4F21A 1P8AA 2E7ZA 2J5XA 4EFNA 3B7PA 4E4TA 1YAJA 5JXJA 3DL7A 1DXOA 4TOIA 1L7DA 2ODWA 3H1FA 1BS2A 2J9GA 4LS3A 3WBBA 4DM7A 1EE1A 3DM9B 4HLUC 2IEYA 3RSSA 4LFAB 4L2IB 4KMRA 3BH0A 1GTSA 4IDCA 1PSWA 4C7XA 3LNTA 3AEXA 5FEMA 1PAUA 2QX4A 1WKCA 4NE7A 4I9GA 4NWIA 2Q0QA 4ZAGA 5FTMA 5IZ4A 3HV2A 1PV2A 1VE9A 2EKBA 4O4HA 1XF9A 1KPIA 2GBIA 3W6NA 2IF2A 2ZT8A 3FPBA 1GU1A 3MTBA 3KAPA 1QG4A 2ZK7A 3V8PA 1MEEA 5DCYA 1RKVA 3PEVA 4LFCB 5CDUA 3KQKA 1EXMA 1H9AA 2A0KA 3ER6A 3JATA 2PKRA 1JS1X 1HL7A 1BFUA 4FNAA 1JV2B 1PL0A 4M86A 5HFAA 4NOLA 4RXMA 2OOKA 3EEIA 3KVNA 2IIVA 3CNHA 4K8OA 5E6RA 2FQQA 4KUGA 2E4AA 3CZMA 3FR8A 4ZN6A 4BKOA 4D02A 4Y6GB 5KNBD 1F9EA 1OBFO 1ZU4A 1F7VA 1KI6A 5IULC 3VC1A 1G20E 3VZSA 4DNPA 2JGRA 2RHJA 1F3LA 3OMLA 3T0FA 4L07A 3HJHA 4EATA 4CKCB 2PTHA 2QI9C 2VCHA 2Z2IA 3NHJA 4MJ7A 4QU8A 5G41A 3ZH9B 3KRTA 2Y05A 4YROA 4AJNA 5HK9A 2OKGA 3L8ZA 4JBNA 1PZFA 4B84A 4HUJA 1RWWA 3TOSA 2ZJ1A 1O5IA 2GZHA 1CULC 1L5WA 3K31A 2FG6C 1YQWA 4GF5A 5KYUA 3SVTA 3MHTA 2YVKA 4YWHA 3EY9A 5I3CA 1HE3A 1J24A 1GARA 4ZZ2A 1RRMA 3MRXA 3BFXA 3TIXB 2CLMB 2XTJA 3K9CA 2CJPA 4BJHB 1JFTA 3Q3JB 2DGDA 3D2AA 4NXMB 2ZRMA 2XE7A 1I3LA 4HLNA 3IV6A 4Y6OA 1WBDA 4CMKA 2ERCA 2AV6A 4JJZA 4DV4B 1M76A 1U8FO 4JX8A 3DFUA 1XELA 1FMFA 3DO8A 4ZTUB 1VMEA 2GGSA 3K05A 3M7IA 2JD0A 4BFCA 5JCOA 2P69A 3EZLA 3O93A 4KR2A 4UEJA 4EABA 1QIMA 1YAHA 2G6TA 2D59A 4HN4B 4LXUA 3VJKA 1LY1A 1SA0B 2C78A 4BRSA 4PVCA 2PYZA 1K5DA 1G1AA 1KH1A 1LBTA 1Z74A 1ILWA 4PZCA 4G84A 4RAOA 4RPHA 2OG1A 4LK2A 1JIKA 3SI7A 3NEYA 3GF4A 3NS7A 3RBXA 1FZTA 1QHHA 1MC5A 3WKCA 1REQA 1ST2A 2GEBA 2XOKA 2ZUDA 4U39A 4WCFC 5AM4A 5FTKA 5DVZA 5IM4F 4Z4IA 1WPRA 1G21B 3ASZA 2ACKA 3BREA 3EXHA 2JJYA 4UARA 4ZCQA 5H16A 4DJDC 4ZMBA 1SBTA 4EHFA 4DV7B 5KB3A 1V41E 4PO8A 2A6PA 2HRDA 1MX3A 4YHHB 3QVGA 3N0WA 3O0TA 3O8BA 1P2BA 5AW6A 4GZ5A 1D9ZA 3RS2A 2JEOA 4LRQA 1SKYB 2MCFA 5IJ0B 2XWJI 4LJSA 3EWIA 1QWSA 3F8TA 2YASA 1DG9A 1I6LA 3BMOB 4CEIB 3MHPA 1WETA 2BMEA 2NVWA 3R3JA 3TEFA 3PRYA 4LRXA 4H27A 1IRIA 3NAGA 4RHFA 5JXHA 2AKEA 5HFJA 4HS9A 2I78A 3O7WA 3IPRA 1RWMA 4ND4A 1GZ7A 1SC4A 2B34A 2EHDA 4HOYA 4I6JA 2ZUCA 5DM0A 4DJEC 4Z6KA 1MRZA 1RAGA 3QP9A 2AJLI 1O95D 1N8NA 1SKBA 4PLYA 2DPMA 1XXHE 4CG3A 3K70B 4RKEA 1JXAA 2DR0A 5C53B 3PGLA 3KQLA 1VZ3A 3MRTA 2OFWA 1J0DA 1WDWB 2LUOA 2GPJA 2H4ZA 3IJ5A 3FY4A 4IQ4A 3ZPXA 1N5KA 4I7EA 3DR5A 4EX6A 1OB2A 3LUGA 4QYMA 5F33A 2QLFA 4AJ2A 2IT1A 2PCJA 3AEQB 3N28A 1N92A 4L0DA 4H59A 1T1SA 3E2PA 4B09A 1M6YA 2PO7A 1IN1A 2GYYA 5K2OA 4Y98A 4C6TA 4H7HA 5B64A 1VG8A 2OK7A 4FP9A 5LD2B 1KK3A 2FZ5A 1FBTA 3QE0A 1QPGA 1SIBE 4MPRA 1F3OA 1CFZA 1E9BA 2B82A 3HNPA 4NMHA 3AVQA 2XYQA 1T4DA 3CURA 4LYHA 4RSMA 2IE0A 2PIDA 5JVDB 3TSAA 4P31A 3ANMA 4NV1A 3EMKA 4AZ3B 4ONEA 4AMUA 2Z2XA 1USGA 3IMGA 4FZRA 3TVTA 2OAEA 5EJFA 4E1BA 3PQ5A 1BD3A 4UU8A 3ROKA 4RZUA 3EJ6A 4DB4A 1EI9A 3L9WA 4IJMA 1MO5A 3C3BA 4J03A 1Q3KA 2VJPA 2NTEA 2O0MA 4EGSA 2Q9BA 1Y4SA 2WF7A 1DXQA 3EE6A 4DV1B 2QN3A 3CM0A 1Y5NA 4DLUA 1VJ5A 5CW1A 3DYIA 3E27A 1BEZA 2JDIA 1KAHA 1NKSA 2AZDA 4CQMD 4QQFA 2Y0PA 3C16C 4J0CA 3B5EA 2RD2A 1D0IA 3OOSA 1I2CA 3OT4A 5K3FB 2WC1A 3LCUA 2NTVA 5ICCA 2VQSA 5JLJA 5KYGA 1Y7HA 1WW3A 3BGOS 4KZPA 2P4HX 3PQ3A 1J9GA 4H1UA 1FUYB 4ZO4A 2Y1WA 3I3SR 3RVMA 1ZXBA 5DDIP 2GXQA 3WMFA 3VYVA 4DNFA 4IIJA 1U63A 4OHYA 1GYQA 3DJFA 1KKMA 5EP4A 1E2KA 2YMPA 3OKAA 4EJSA 4YPOA 1HQDA 4PHFA 2GBLC 1NQUA 2VHYA 1HQYE 4R0MA 3E5HA 3ANLA 3QYFA 1X86B 4G1VA 4E94A 1YB6A 1NXQA 4EAQA 4Q34A 2NMVA 5LP6F 3TB4A 4UUMA 1JWAB 4X64B 4EPTA 4P81A 3OF3A 1PHRA 4BNXA 5AW1A 3ICVA 1ID1A 4OXQA 3CJRA 3I1YA 4BWGA 1E0SA 3LKVA 3GNQA 4O4JA 3WMRA 1F0PA 4EG6A 1RRVA 2XVYA 4P2GA 3DC2A 4P9NA 5EVJA 5KHAA 3C85A 2QMHA 3AOGA 3T95A 2DLCX 2D6FA 3ETCA 2XMBA 3RHFA 1I3KA 4G5HA 3NR2A 4I5EA 4JX9A 2PTGA 1GUZA 4UHEA 3WRYA 3MSCA 2VPQA 2ORED 1JWBB 1SAYA 5GJVC 1JSLA 4BFVA 6ABPA 5ALGA 4TMXA 2YX1A 3WP1B 2GTIA 4HYEA 1JAZA 2YCBA 3FSGD 4RQUA 3IR6A 3E9EA 1BZYA 5CTAA 5JSQA 2A3NA 1N34B 4RD1A 3EISA 2QAIA 4ZI3A 5IT9A 2WWYA 1JDBC 2D7DA 5EZYB 3NRBA 4X71A 2IV7A 3I53A 3FETA 2ZIZA 5TSDA 3V55A 1RBQA 4XYLA 2JGDB 3ZY3A 3CBQA 4PCVA 4M7RA 2RH8A 2BJVA 3K4QA 5IS2A 4A2PA 1ORHA 3FCXA 1JHRA 1V2HE 4IUYA 5FWXA 5EFZA 1G55A 4CL0A 2JIZD 3DT8A 1C9MA 1H2FA 5ALKA 1M1YA 4ISBA 4H4DA 4Z4CA 2ILVA 3LF2A 1KP3A 4KJZA 1ZRMA 1F1BA 1E6UA 4YQEA 2OBNA 1NN1A 3HCFA 4TYYA 1UWCA 4US0R 5CXQA 4G26A 2LKCA 4OGLA 2OUKA 5MFPA 4X92A 5DULA 3WGQA 3GLFB 3DFIA 4FK8A 4RNCA 4QARA 3SEAA 1YE8A 5C3MA 5I8ZA 4QPJC 5BOVA 1JR4A 2V45A 4LE0A 1XU4A 3A26A 3UC9A 1DOAA 2YYZA 3RK0A 1OIVA 3NKLA 4KWHA 1MQ8B 2P9FA 1T2UA 3KQQA 4X84A 1O6CA 1XVAA 4RACA 4Y0AA 4JL8A 1L1EA 1QF6A 4BVAA 2FWAA 3CF4A 2PKXA 3CZ9A 1X7XB 4W4TA 4C2TA 2PZKA 1LEHA 5FWYA 3N6XA 2WZDA 1LPBB 2CFSA 5TC4A 5IDXA 2F1JA 2V96A 3B1XA 5C8DA 3ONVA 3E0QA 3DULA 2B99A 2NU7A 1SPBS 3TTUA 2QR3A 1ZMRA 2O7NA 2VT6A 3BFJA 4G0ZA 4OK6A 2J9FA 4JHLA 4C30A 5B7NA 1AHPA 4E22A 3AG5A 3WYBA 2W6IA 3KYDB 4ATNA 3VZQA 3DMDA 3ET5A 3WAKA 4BJ6A 1SIUA 1SPXA 1W5SA 2DX7A 3OPQA 3REQA 4CV1A 2UZ3A 3N2KB 3B20A 5A7GA 1N2OA 4F6RB 2PZLA 1O08A 1Y3BE 1EUCA 3IQFA 5HKOA 3HU2A 2QRGA 1ZGGA 3JQQA 1RQXA 2A5YB 3L8YA 3QHPA 4EVQA 4BWVA 2IP4A 4GDMA 4TTAA 2AFHB 5D84A 2DHQA 3E9NA 3P7MA 4O1MA 1E1MA 3A2KA 4Y6PA 4M46A 1PR6A 1W4BA 1WKBA 2F3QA 4XEHA 1M7GA 3ICCA 3EGXA 1M0WA 3OFNA 5DEIA 5AT1A 5K6AA 5EIXA 3ZDBA 4Z53A 1FDRA 3V4LA 1PIWA 4MRMB 3TRIA 1U1FA 3G02A 4YP1A 2ALJA 4IILA 4OB6A 2CW5A 4NYMR 4BRZA 3W90A 3TOVA 3SFTA 5H02A 4O4HB 2Y8EA 3FTQA 3CVVA 2B5WA 3UMBA 2G1UA 4DLZA 1U9CA 4UD2A 3IL2A 2VDVE 1P45A 3ZVNA 1N5DA 1GPAA 2OZLB 1NVVQ 1Q1AA 4MIYA 4BQEA 1OREA 2VR1A 1FNDA 3D7RA 4D4IA 4E14A 3QXSA 5CFNA 1X7ZB 3PZBA 3VAZA 2RJNA 3SZLA 2QLBA 1C7EA 3PIRA 4R0VA 4IH4A 4KKVA 1LI7A 4X62B 4JENA 2OOSA 4BKPA 1LBHA 2BPOA 4JS0A 4MEBA 5I6DA 5FPKA 2QUAA 5G0TA 4H16A 4O02B 2WTUA 4QFBA 4GEGA 1K5GA 2ATCA 1GQ2A 3NNDA 5A71A 4DC0A 2H0AA 3QFHA 3SIRA 1P29A 3EVEA 1JNXX 1W4CA 1VXOA 3JVVA 2XBLA 4KK4A 3X1XA 4AMBA 3NW9A 2V7BA 2I4LA 4XYMA 1CZRA 4QQ8A 2O2XA 3TK1A 3U4AA 1DTSA 4E1VA 3C8HA 1YE5A 1S9DA 5IT0A 4W5NA 2BCJQ 2HK6A 5EXTA 1SC9A 2LTAA 2NNLD 1SCUB 1Y3HA 5ULLA 1PJ4A 2VXCA 3QXCA 2YOHA 3C98A 4R9UC 4LY9A 5K0GA 1E1RD 3H13A 4A9AA 3CNEA 1NFRA 2QD5A 3LQKA 4ZHQF 3S2IA 1RQ2A 1X8JA 4LAFA 3QVLA 4ZANA 2DPHA 1ZMXA 1QFJA 3T5CA 4FXPA 3UKDA 3C74A 2HGZA 2J5RA 3IVAA 4EA9A 1KIFA 3CUUA 3DVSX 4PCAA 5DK6A 2VRBA 1L8LA 2WUWE 3EZNA 2FI1A 3CIOA 1CEXA 1I7LA 1K2WA 1LW6E 1JG4A 3C3CA 2VLBA 4X8MA 3S2FA 3AONB 3UCXA 2NZ2A 4DCVA 1DG3A 1Z4NA 1CZOA 1DJOA 4LI0A 3TR5A 3HC7A 1J42A 4JNCA 1EFTA 5I9BA 5BSMA 2WMNB 1Y9JA 5JYEA 4A0QA 1NP6A 2W83A 3QK7A 2P91A 4KQJA 2XMRA 3KO8A 4INJA 4N6OA 4MWEA 2ZRIA 4FJ1A 4TLDA 5DGDA 5FBLB 4H60A 3FNIA 3Q8MA 2RHDA 2PAAA 1G60A 2M6KA 1B6TA 1MGPA 2D5AA 1RW4A 4NRDA 3MUFA 2JJ1A 2I7DA 4P84A 1FPQA 3SYNA 1M74A 3P2IA 2W2TA 2CGEA 2IYOA 2W7TA 4MJXA 4HDMB 4JP1A 2ZYRA 3I9KA 4NOJA 5LYYA 3ZJ4A 4BVGA 4DIOA 4BIMA 4OX9B 4FKMA 4K87A 4L02A 4HVTA 4TXHA 3UBMA 3KEFA 1UP6A 3C7AA 2Z57A 3KSZO 2PL9A 3QE9Y 1AZLA 3T4EA 3EK2A 3VR5H 1BOFA 4GP9A 5IM4A 1CUGA 2ZB7A 2ZG6A 2V3CC 1FCJA 5TT0A 5HVNA 1JG3A 3B2NA 1Y63A 3GUVA 3MT0A 4UASA 4HUQA 4OBXA 1QM5A 5JLAA 3OZEA 1RM0A 3GQVA 4UMVA 4ABTA 1XRJA 3DE3X 3LLMA 2H54A 4LUCA 2HLDA 4AD8A 2QVCA 1UBFA 2JAXA 3RRMA 4IV5A 1ZITA 3BKWA 4YXWD 3E35A 3N7UA 4P38A 3AUUA 4JSTA 4WBNB 5ESWA 5K99A 3G0GA 4C88A 4M0CA 2CE2X 1A97A 3ADKA 4HEQA 4BFTA 1JDPA 4BNNA 1ES9A 1ACMA 3AY7A 3SJAA 3WGOA 5GTDA 3CONA 3ZDDA 1BVHA 1FBNA 4MULA 1PFKA 4N39A 5ALFA 3R7SA 3GMDA 4FEEA 3IEMA 5EXXA 1HX7A 3BT7A 1P4HA 3KL2A 1ICIA 2CBGA 1VGVA 1KP2A 1WPQA 3OZCA 2XPCA 1THMA 1YIDA 2QTFA 4KJXA 3TTYA 4A3SA 4ROTA 2AFIB 2P3SA 3PT9A 1JR3D 2XAAA 1OTHA 3EWNA 5CVJA 2PPLA 2AHOA 3BERA 4EEXA 1V7ZA 4EKIA 1YL7A 2YUIA 2RBGA 3NNNA 5LA6A 1Z0KA 2VQ6A 1I7NA 4C2AA 1FL9A 2G40A 2VBFA 1WY5A 3KB2A 2VF7A 4IXTA 3A4MA 4NEGA 5F52A 1WY7A 3VU3A 1ESMA 3KKQA 1AHNA 1WB9A 1X42A 3KSUA 2YWEA 2W6ZA 2WM8A 2P30A 1P1HA 3JSAA 3SKXA 1E3IA 2ORVA 1TKCA 1KAEA 4O0MA 4WFJA 2O8BB 5FOTA 3HN2A 1JP7A 4J1QA 5JAOA 2CZGA 3W7BA 4WPGA 1WCYA 3N1UA 3NTOA 1R50A 1ODKA 2YKGA 1YBAA 4FIDA 3REGA 2WK1A 3TZCA 4EUSA 2WVGA 4F2WA 1UBSB 4KTTE 3B1YA 3PE6A 3LCVB 1FVFA 1ONNA 1QX3A 3EVCA 3L6UA 4O2AF 4TL7A 2L18A 4Y9UA 1ARZA 3FF4A 1VSTA 3L7IA 4V3CA 5KYWA 1NSTA 2HXGA 3H99A 4CN9A 4RK5A 3WZ2A 1JIXA 4OP3A 3RVLA 1O9HA 1YQUA 3DE4X 3IDZA 1BA3A 3A1CA 2JIZA 3H1TA 3HYSA 4KI0A 4RDXA 2XNCA 3WI7A 5C2JB 3UPUA 3W8DA 1OC4A 4NYJR 3V42A 4FT4A 4UUBA 1T9DA 3INNA 1AC5A 1D2EA 5IKEA 2X0NA 3T54A 3A1VA 3OZFA 2XNDA 3GGSA 4LJYA 2HWUA 2HMVA 5ITZA 3NH9A 4ZYXA 2ZE5A 4BAUA 4TQGA 1N2CB 5BN4A 4NHEA 3GROA 3UAWA 1OZAA 2RKBA 5I7WA 1OFGA 1E2GA 2CVPA 4H18A 1ZNQO 3T3EA 4ZOQI 3ZE1B 4DDHA 1QLWA 5MN6A 3D4NA 4M49A 3OMXA 4BUJA 3MMZA 4HGOA 2IC5A 5BQFA 3MS4A 4LQLA 5MHTA 5JAZA 1H93A 5EZSA 5JHHB 2V6FA 5HZHA 5IAAA 4KRXA 4WKNA 4D4GA 1DJNA 4BVKA 5J4YA 3F71A 3OM9A 1A4IA 4K9LA 1B0UA 3HJAA 1R74A 2ST1A 2PXXA 1R5BA 3QX7A 4YONB 1OTYA 4N9QA 1S02A 2CL7X 4QYTA 1U6IA 2ADOA 4CF4A 2VSNA 4XJTA 5JSKA 4IJUA 2OFOA 2CEAA 4N3BA 5CXUA 5K5EA 4QWWA 3D1JA 3OIYA 1RYBA 5LP6B 1GPH1 1RS0A 1YKGA 5H8WA 2H1FA 3WHKA 3K2IA 3O31A 1PN3A 1VIVA 4P3PA 4LXTA 2PJRA 3AERB 2IH2A 5F1KA 1LDGA 3KXKA 2O06A 3KSBC 1EQUA 2G77B 5JAMA 1F14A 1AKNA 1R0ZA 5IAEA 4HJRA 3O4RA 2BD0A 3RG2A 3SLRA 1Y8AA 1Y89A 2DR3A 2RGUA 4NCXA 4ZZ3A 1D2HA 4HDSB 3PKZA 3S3TA 4EY5A 1K7SN 1Z0DA 4JC4A 4ALNA 2JIDA 4TMTA 4X7MA 1J39A 2VJCA 1QYDA 4YCSA 4YMWA 1NNEA 4V0RA 1VB5A 3TKYA 4OA8A 3HYTA 3OCYA 2O52A 5F4ZA 1U9IC 3FJOA 1EFCA 4EJMA 5JH7B 2A9PA 3GMSA 2GNOA 1J8MF 1SZDA 2QQGA 3BRCA 3C6QA 3FNBA 2GB4A 3NGLA 4JDPA 1K8RA 2JVIA 1LLFA 1XXLA 1M1YE 4JLPA 1XA3A 5JT1A 1OXXK 1DO0A 3X1ZA 2ZUSA 4QBGB 1VMDA 2VHQA 2B3TA 2NUPB 4P80A 4WZZA 3WE7A 4LYYA 1CJTC 1N0WA 3Q6NA 5C5IA 5J58A 2ZT7A 4Z7OB 1GITA 1O2DA 3KYBA 4KQWA 2QT0A 5H4GA 4FDMA 2DFVA 1XEAA 2YS6A 1IDN1 3G0IA 5AUPB 5A5DA 1KSHA 2XIJA 1R2QA 1VHJA 4J0FA 4PM4A 5FR2A 3UICA 1U7OA 2CXOA 3U80A 1H4VB 2DB3A 2W2MA 5HKKA 3ABZA 4YQZA 4ZJZA 1K6EA 2NSYA 3LRPA 4S1PA 2V5VA 1LSUA 2R66A 4KQMA 4YASA 4A7PA 1ZIPA 1UT8A 3V8BA 1G3MA 1FJXA 1CE8B 2A5JA 4GPIB 4LDQA 4TRNA 1GGFA 1DQYA 4H3VA 3WIVA 1E7RA 4K1XA 3GLIB 5L8VA 3TAHA 1CQXA 4I5IA 4TLLB 5E7JA 1MXFA 1KE2A 2AEFA 1IY8A 2IFTA 2OV4A 4M0LA 4CNBA 3KQTA 2FKNA 1U65A 3M0EA 4AF6A 3W77A 1AKYA 2B8TA 1IJBA 4QNNA 4GHWA 3WLLA 1C1HA 4RHUA 1T3TA 4WCDA 1T0BA 3T61A 1VA5A 3FH0A 5KMGA 3T1QA 1PGOA 5H0IA 3S81A 3L6RA 1K5HA 5B12A 4CQMA 1P18A 4BCCA 2HNBA 5DRTA 3C7KA 4HO1X 1INLA 2PHZA 4FNOA 4N18A 1C3EA 4O59O 2JZOA 3E23A 2ZWPA 2K7FA 4JD5A 2DPXA 4FOOA 4BX2A 2CB0A 4JUAA 2I6TA 3U4MA 1GFZA 3O8QA 4PYQA 1C8BA 2NUBA 1N2GA 4IHJB 3KLBA 4Z99A 1CZHA 3O8RA 3I9V1 1GDDA 2VQ3A 4JBXA 2VYCA 4W9NC 4XWAA 2AOTA 3O3OB 4IMJB 1WUYA 5AKHA 1IVYA 5B6JA 4UVIA 4UQPA 2EFHB 2JGDA 2LCIA 1Z83A 2LBPA 1WXIA 5HIIA 4YJFB 4JBLA 2OB2A 1HRKA 1N5LA 1WSDA 3GRAA 3C3DA 4URZR 3QFFA 2Q45A 1P61B 3I76A 1IN6A 2ODAA 1TM5E 2EJUA 1P3JA 3JZMA 1TB4A 1WS6A 4D44A 3X44A 4ZICA 3LQYA 3SG0A 5J4HA 3FOFC 1VSUA 1HE8B 4OQLA 4XR9A 1KZ7B 5BQOA 1JFFB 1Z4IA 4JP2A 2QN6A 2J3JA 1YNSA 3VDMA 3DEJA 4UDYX 1UKEA 1JAIA 3MT8A 4IR7A 5E2IA 4AY4A 2DXIA 3GG9A 3I9OA 5LKAA 1SQGA 1T2EA 3JQ8B 4XARA 4RV4A 1W36B 2IU3A 1CZLA 1LLCA 3C48A 4OFBA 1Y7IA 3K5HA 1IAVA 2TMDA 2YXEA 1GQSA 3EHDA 2QQ0A 4O33A 4HB3A 5A04A 5B57C 2G72A 2FPMA 4B9EA 2D7JA 2IODA 2RIPA 1G5HA 1CB0A 2LIPA 3P9SA 4I46A 3CRVA 4Z0HO 4CUZA 4XCVA 3QLEA 5KNCA 3HKBB 5E0KB 3QELA 3N7AA 1GLNA 4RIFA 3L8HA 2JA2A 3MJ4A 5LB4A 4B1FA 2YWHA 3K0AA 1G6KA 3QUQA 3QOXA 4EJSB 1KBQA 3LSYA 4UHFA 4AN4A 1ZD5A 4AUNA 2TRSB 4GI3A 4MLZA 5FBRB 3ECSA 3WYFA 1JEQA 3OX2A 2YQZA 1A5AB 5D3ZA 2Q5EA 1U0HC 3BICA 5DLPA 1X1BA 2Q1TA 1S8AA 3F1KA 5DWDA 1P9OA 4O4IB 3TIIA 4C78A 2PUJA 3NWOA 3B1ZA 3JWHA 1KFBB 1J8FA 3PC3A 4A8PA 5KYKA 2QRVA 3DEZA 4JT2A 5L7WA 2QMUA 4NBLA 4BGEA 2GJ9A 1PJ3A 2V3WA 1PJSA 4W8OA 2ZTMA 5LA6F 3T3OA 1HDIA 5ELMA 3DE5X 3CXRA 2OQVA 1DWQA 1WBBA 1EGQA 1UPCA 5EWMA 1OLOA 1XHEA 2A0WA 3UHPA 3DFKA 4G8JA 1K8YB 4DVJA 1XQ6A 4FW8A 1XROA 3WGJA 2GBCA 3QEMA 5TQ2A 1T4CA 2EP8A 3C70A 1E6KA 1UM9A 2HLNA 3C14C 3NT4A 4RS4A 2P40A 2EX4A 3WOVA 2F3RA 2I29A 4BYMA 4IIEA 4ZRDA 5EUMA 3FHCB 5H9VA 3ADBA 1HK7A 5ECYA 1XDZA 2QY9A 3UQZA 5IF9A 4K86A 1E9CA 1E89A 1AKEA 1OFUA 4URYR 5F12A 3HB9A 1TCCA 2GYVA 2P5TB 2XCUA 3DOCA 3ZJYA 1CEYA 4CLOB 1QRAA 1B8OA 3K16A 4MARA 4BV9A 8MHTA 1YS6A 3I72A 2OMKA 2J7PA 4ZGGA 2FF5A 3AEQA 2Q8PA 3GLRA 3QUSA 2X76A 2X41A 1D2CA 2IYSA 3WQHA 4RTNA 3IYLW 4RD0A 3GLGA 1CEEA 3TBHA 2XNDD 2P27A 5CMLA 5B4VA 2XUIA 1R0RE 1TJ3A 1JJBA 1JYFA 3OJCA 1Q6YA 1UBNA 4ZKEA 1F38A 1DC3A 1V39A 3N0TA 2NVUB 1SQ0A 1A72A 4JVMA 2PFGA 2WVJA 2SKEA 5FJJA 2Q4BA 3TFOA 2PWPA 3QIAA 2R62A 1SXIA 1TKBA 5KTRA 4M9RA 3CZRA 5EHGA 1MFPA 3GRUA 3AILA 4UNIA 1LC0A 4XVQA 3ZU4A 5HJ5A 1SN7A 3MAAC 1RI5A 3IAXA 4LSZA 4UXHA 5G3ZA 4JL5A 4URUR 3EQ2A 4Q3LA 1IIBA 1N6LA 3COWA 4FN5A 3W5BA 3DCJA 3R44A 4NCBA 1Z0FA 4HS4A 4OUDA 3H9EO 1ZI8A 5FPPA 3RC1A 2C1EA 1YO6A 3K9QO 1KOJA 2XWBF 4TMWA 4S35A 1A4UA 1JXQA 1ZH0A 1QHXA 4NH0A 3KWLA 4HN2A 4OD0A 5K0BA 3HUTA 1R37A 4HZGA 4AROA 2C99A 5IG2A 1JQ3A 1KY3A 4EYSA 1E4YA 2B1JA 2PD4A 5KINB 1E5XA 4CFYA 1EAMA 3JVDA 4LHVA 1WDTA 1QAQA 3H11B 4OATA 3SE7A 4YX9A 3AEZA 5TB5A 5C31A 3TDNA 3WFIA 4E70A 1JR6A 3BD6A 3USZA 3OIUA 5FOXA 4HWRA 4OTZA 3F7OA 1TM3E 2ODNA 4PQYA 1U5CA 1JHXA 1V37A 1B41A 4BO5A 1TJYA 4K9NA 4IDAA 1I8TA 3SC6A 1NWCA 1VBKA 4OOEA 4RK4A 2CF5A 3FHJA 4HKTA 5DF1A 2E4VA 2CNKA 4RGVA 5HFNA 5JDCA 4JY7A 3MA0A 3NCHA 3RVQA 4DC1A 1B7GO 4P08A 1Z34A 2AEEA 3KJQA 2ERYA 4HWKA 4NBUA 4ZCIA 1PUJA 3DDCA 1CV2A 3AUJB 3CLRD 4R1QA 4BZQA 3AL2A 4JZYA 4LYFA 5LWHA 1DJQA 2HEIA 2E18A 4QSMA 4HAVA 3RLIA 3ZDXB 3G8AA 1KWGA 2VNKA 3AJ8A 4X6UA 3T3NA 1RYYA 3MGGA