2ZI4A

C4s dck variant of dck in complex with l-da+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
241
structure length
228
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 228
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi4A00
5LBIA 3GLGA 4B74A 2ZSFA 1KI6A 3GJ5A 5IHPA 3AGPA 1EESA 1FNMA 2OO7A 4M1YA 4YMVA 4AKGA 2QMHA 1IN6A 3O8BA 1OB5A 1YHNA 3TLXA 2FNAA 4JVMA 1H8HD 1IM2A 4IKEA 3D31A 2H57A 2BKUA 1E2MA 3SR0A 5KU1A 3B2EA 1GM5A 2RGAA 1YQTA 5B58C 4EAQA 4CW7A 4CYMA 3MJRA 1CJUC 4BFZA 1L8QA 4LRWA 4UNPA 4LBWA 4TT3D 1RVDA 2IYSA 5L3SA 1PLJA 4QHSA 2WKQA 2Z5FA 2X2FA 2GTPA 1TQ2A 3RLFA 2OM2A 1E1QD 4D81A 3K70C 1IOZA 4XVUA 3PJRA 4C7OB 5FOSA 5F9HA 3FTQA 1UJ2A 4UXIA 2XNSA 4URXR 3RSOA 1Z3IX 1A7JA 1Z2AA 5JCZA 3DMNA 4NH0A 4OHYA 1L7VC 1COWA 1UDWA 1UKEA 1EFRD 1ZD8A 2MSDB 1U94A 4G5SA 4Q1BA 1G6OA 5E7MA 5FR2A 4B3DA 3NEJA 4B35A 4DXAA 1S9DA 1HEIA 1KAGA 3IKJA 3U3MA 4PANA 3EZ9A 5D3MB 4PC6A 1RJ9B 1E4YA 1Z0DA 4IHQA 3SYLA 4BECA 2P3SA 4LV6A 1GAJA 3KTAB 2RHDA 1RYHA 3A8TA 2ATXA 3CPHA 4G01B 3T06B 2QRZA 4LYFA 1UADA 3UKDA 4DSTA 1E32A 2TMKA 4ACBA 4DT1B 1OH7A 1A1VA 1EX6A 2WWWA 2IK8A 5CITA 3HR8A 1YZUA 1QF9A 1MO3A 4ZDWA 2QZ4A 1D9XA 2KBEA 2ZRBA 4RCYA 4BZPA 1QVAA 3IIKA 1WP9A 2FSHA 4LZZA 5TY0A 2IUUA 1G8YA 1G3UA 3QXSA 5LDDC 4XD7D 3TE6A 2NZJA 3BE4A 4ZCIA 2WAYA 5EXPA 3CR7A 3THYA 221PA 1AGRA 1HH4A 4HLQB 2D4HA 4M9XA 1WBBA 4BFTA 5CB6A 2QU8A 3SE0A 1QHHB 2PZEA 3RWMB 5FTJA 3A6PC 2PMDA 3H4MA 2O8CA 2IXFA 4RFSB 2R2AA 2WWGA 3B6EA 1XPRA 3OEED 1IXRC 1VYUA 5J4KA 1VDZA 3LY5A 3AVVA 4ZDIA 3QXXA 4ABYA 1TEVA 2ORWA 1N0WA 2GZDA 3AH8A 1AJEA 2ORVA 1WF3A 1XXHE 3D7MA 3E1SA 1YR6A 3ZD6A 4NCKA 1T9HA 1R0YA 1XNJA 3D3QA 1XBTA 1F48A 1W0JD 2WWIA 4RVCA 3T12A 3A36A 1E2EA 4OJKA 4TMTA 1Y63A 3LLMA 1HE8B 4JYBA 4JZKA 4URZR 1EWRA 1EX7A 4HAZA 2XNDD 4II7A 4PC7A 1N25A 2N1BA 1AM4D 3ECCA 2ZYTX 1M34E 3VKHA 4ZPXA 5EZ5A 2YHSA 4FI3C 2HXSA 2ZE6A 3NDPA 2F3RA 4AIIA 2H8KA 3LBNA 4WZBE 2IYVA 3WNDA 1DAFA 3QQ5A 4MKIA 2RGBA 5EXXA 4MGIR 4KSBA 5AJXA 5DN6A 2IWHA 3VKGA 4Y0AA 5A4JA 2W83A 4PC2A 1T3SA 3SHWA 2NO9A 4DBLC 3NHAA 1A2KC 3KJGA 4HDCA 2VP9A 2QTVB 1NN3A 3SU8A 3GP8A 4ON9A 4F7WA 4IOKA 4ILEA 3NKVA 3VKWA 4LWZA 3A4LA 4QM7A 1X1RA 2JIZD 4XWKA 4PAQA 1CS4C 5L3SB 2IEZA 5JECA 2ZR9A 3DO6A 2D3WA 1P73A 5HCIA 1OPXA 5KSPA 4EPXA 3AVUA 3AKYA 1KI2A 1G18A 2IYQA 2X19A 5JLJA 4JVLA 5FL3A 5L3RA 2ZXUA 4RZUA 3QKRA 1NSFA 3ADCA 1U8YA 4WAUA 4B3XA 2JEOA 2VHTA 4GBMA 3X1WA 5HZKA 2E87A 2JLXA 2J0UB 1Z0IA 5EXSA 4JT4A 2IEYA 5FR1A 4YXWD 3EASA 3U61B 5DE3A 4TYQA 4IOJA 4PZZA 4QJ5A 5G3ZA 4F93B 1GNRA 2VA8A 2JJ2D 3P4XA 4PO9A 4ZDKA 1QZXA 2QPAA 4DDUA 4D4KA 3SNHA 2NG1A 2JLYA 4OHZA 4PSVA 3AKCA 1E69A 2ZRCA 1WCV1 2Q6TA 1DBSA 1EG7A 3K70D 1DARA 2GCOB 2BCGY 4WIAA 2RGGA 3CUEF 1BS1A 2D74A 2H17A 1XEWX 2D7CA 4DEXA 1JR3D 2D2FA 1VCIA 1XMJA 2CL6X 4Q1FA 4B2IA 1RIFA 3U7FB 3DDCA 4A0GA 1NN5A 2WJIA 4FMDB 2O8CB 5HTKA 5CM9C 2W6JA 3GPLA 4BUJA 2KJQA 1YZKA 2F1HA 2OG2A 2BVNA 1XTIA 3R9XA 5JZVA 2P65A 4XOIA 4B2LA 5J4HA 4BZXA 2J0QA 4LJ9A 4QXAA 4DLSA 3C4JA 1ZBDA 2PJZA 2RGDA 1UEJA 3LH5A 4LYAA 1WDTA 2H18A 2IYYA 2GJAA 4KFRA 2MMGA 3K9HA 1KAOA 1HUQA 4A4DA 2WSSD 2F9LA 4X8OA 1V43A 1N0UA 4I99A 4JKYA 1CRQA 1P75A 2ODNA 1NI3A 1P2UA 1OXXK 3MUFA 1VCOA 5CJPA 1N6LA 2DB3A 3KQLA 3B9QA 3L8ZA 4BLTA 1Q57A 2QMUA 1NN0A 4OQNA 4D4MA 4DSOA 1RRCA 2V6IA 1IJEA 3CONA 3H86A 3KJIA 3TVDA 4V0MA 2ZJOA 4IVPA 3B7GA 2D06A 1UKZA 1OFIA 5FL7A 1K5GA 3V9PA 2ZU6A 2FE4A 1P5ZB 2FWRA 3BFVA 4Q01A 1WXQA 2GZHA 4E5UA 4YMUA 1OSNA 1Z47A 1FOEB 1XZPA 5JS8A 3GJXC 1NY5A 4TWZA 3RS3A 4PC1A 2DY1A 2EFDB 4B34A 2GXSA 4MKGA 4IDNA 1DAHA 1CR4A 2KB0A 5DGXA 4QBIA 2VLIA 3B1VA 1Q1ZA 2KE5A 4LJ4A 3AVOA 2QUZA 5HCNA 1OIVA 3OFND 2VQSA 1VIAA 1DADA 1P2VA 1WQ1R 2GCNA 2E9SA 2RHMA 4MRRA 4D26A 5GVRA 4HAWA 4C4PA 1G4UR 1NLFA 2QRNA 5AWFC 1KI1A 2VYFA 2ZJ2A 3HJNA 3Q7QA 4EQ6B 1Z22A 3U7HB 4A0HA 3GJ6A 2OZEA 4D6PA 1LVGA 1VG8A 3GLIB 4CEHB 4DDTA 3KKPA 3AP1A 1S1CA 4NYJQ 3QG5A 5D3QA 3I61A 3QKRB 1DAMA 4Z51A 4RD4A 3ZS9A 1EXMA 5AUPB 2BC9A 3BB4A 1KMQA 2BJVA 1G9XA 4M53A 2OUKA 1G8HA 1KZ7B 2FX3A 4ZV4A 821PA 1WBDA 1NMXA 1BO6A 3OESA 3SFVA 4PR0A 4RZXA 5FUYA 4P33A 5CB8A 4UKDA 2FPMA 2ZI5A 3H84A 1FW6A 1CEEA 2GVDC 4AG5A 2FPLA 4FMCB 2KBFA 4YONB 2NZ8A 2IXGA 1DE0A 1FNNA 3K9NA 3TUIC 2IX3A 2IUTA 2QQEA 2R8RA 4TZ0A 1U98A 2F55A 1MKYA 5CM8B 2YWHA 3WNBA 4HAYA 2XTMA 5FPSA 2RGEA 4EKDA 1QHSA 2VL7A 3MWJA 4ESVA 3RAPR 2OCYC 5F3WB 4M21A 4UXJA 3EPLA 4KBGA 2Z0MA 2RGXA 1E2HA 3BK7A 1Q44A 2CDNA 3ZDQA 1KDOA 6Q21A 3WBJA 5K8LA 5FBQB 1HQCA 1YZGA 2W00A 4U5XA 2FFQA 2WKRA 4Q9IA 2IA5A 3BS4A 3J81k 1KJYA 3WHLA 3VNUA 3CNLA 1SXJA 4AK9A 2G1JA 4HUQA 4OYHA 4JVSB 4AY2A 3OF5A 1NY6A 4B73A 1BYIA 5FTLA 5AUQA 4MRPA 5DSZA 4HLCA 2XGJA 5K8UA 4PZYA 1ESNA 4NKRA 5H70A 3W90A 4DUGD 2REOA 2WIAA 4XSHA 2VEDA 5DN6D 3QBTA 5GADl 1NNEA 4AKHA 2YVUA 1FX0A 1G5PA 4DRZA 2IYXA 1TEXA 5FOTA 1OKKA 2SHKA 4BLRA 2DCUA 2CEAA 4Q1CA 4V0LA 5DO9A 3SJAA 4KLNA 3NIBA 1KNXA 1YR8A 3MAAC 2ZITA 3UWKA 2VBCA 1F2UA 3EZ2A 2V1UA 3I32A 4XIGS 4QNMA 1YE8A 2CCKA 3PQCA 1DAEA 3GJ8A 2L0XA 3VQTA 2O8DA 4NYIR 2GXUA 1NF3A 3WMGA 1H8HA 5DNYB 3IQWA 1D6JA 1P62B 3A1UA 1GVNB 4KFUA 5BYJA 4C2UA 1DOAA 3I72A 2BM1A 2KWIA 3B9PA 2ZRNA 2JJ1D 1HE1C 3FMOB 3T15A 3FMPB 3U6BA 2GXAA 4YC7A 4ERNA 4A92A 4KHZA 2FG5A 3B1ZA 4TT3A 1PJRA 3ZYCA 1AS2A 4QG7A 5EE3A 4M9QA 5L3VA 1M6NA 4JLDA 1W0KD 2YNMA 4POAA 5JRJA 1R2QA 4TZ6A 2V55B 1U90A 2EWVA 3BB1A 5HKKD 5JSZB 5L3QA 3QI2A 2ZRAA 1G41A 2A5YB 1D2NA 2OXCA 3VU9B 1EFRA 1LFDB 1XF9A 1FMLA 2G1KA 1FQKA 1Z29A 2EFEB 2VHQA 2H7VA 3P32A 4V0OA 2K5UA 4G1UC 2QMEA 4GMXA 3U44A 2QBYB 2DWQA 4B76A 3ZJYA 1NN1A 3CH5A 3E2IA 4C9BA 2OE2A 2WVJA 4EJSA 4DCNA 2ERYA 2WWFA 1FL9A 2AK3A 2WMOB 1JB1A 1HQYE 1CLUA 1VMAA 3WYGA 2CBZA 2J46A 4LHXA 1M1YE 2V4ZA 3RSLA 4UXHA 3C16C 1VG1A 4A6XA 5DHFA 4O25A 2WSMA 3IPYA 2VP0A 3ND8A 1G64A 4NDZA 2W6JD 1IY1A 2C95A 1W48A 3E70C 1U8ZA 4NZYA 4URYR 4XD7A 2Q3MA 3MWYW 4L9WA 1ZJ6A 2R6GA 1CRPA 4TMWA 5GJWC 1UKYA 2H1LA 2BMFA 1E2KA 2WAXA 5GJCA 1JAHA 2G0TA 1FP6A 2PCLA 3IEVA 5EXTA 2IF2A 3ONWA 4QBFA 3W3ZB 421PA 2QAGC 1L4YA 1ETUA 1ZC4A 2Z6VA 3D6TB 4LYJA 4NYMR 4JL8A 1MH1A 4LHVA 3RHFA 621PA 3ND9A 3K0AA 2V7QD 4EFNA 1JEDA 1T6NA 3GLHE 3K8YA 3VR3A 2GBLA 3T5DA 5BWMA 1SXJB 4XSGA 2JLQA 3TSWA 2REXB 1VG9B 1YZNA 4B3CA 3HP1A 2LWIA 1ZM9A 3UATA 5JEDA 4OI2A 2WKPA 1UM8A 3C41J 2ZRDA 3FFAA 3GEIA 3HPRA 3IIJA 2GK6A 1ODFA 1RRFA 4M1SA 3W5JA 2XSZA 1XD8A 1P9RA 3KZ1E 4FINA 5IF9A 1FX0B 2QY9A 1TQ4A 1SVWA 2CCJA 1GSIA 3NH9A 4C0QC 3HYTA 2Q3HA 4FCTA 5JRZA 1GZSA 5B30A 4DB2A 4Q1EA 2GETA 1LB1B 5AR1A 4R71A 1H65A 2NO7A 2WZQA 1CJKC 3B8HA 4TL9A 2FEOA 4KFSA 2ODWA 2RCNA 4Q18A 4Q5IA 3WRXC 3GQBA 2O8EB 4B33A 2O8DB 5FI1B 1ZM4A 1U0HC 3T61A 2GHIA 3C7KA 4RY2A 4EPYA 4EUNA 1E2NA 3N5CA 1E9CA 1RKBA 2EFHB 2WHXA 1IN5A 4E09A 1XJCA 1KO7A 1NJFA 4LK2A 4A6PA 2XZOA 1P2SA 4M9ZA 3SFZA 4TYNA 2J7KA 1TAGA 4LBVA 4NU0A 3FFBA 3TAHA 1KMHA 3LNCA 4TYWA 1Z6TA 2HDNB 3ZQ6A 4KVAA 4D4LA 3FYHA 1XPOA 3PITA 1BH2A 4IOLA 1G7CA 2DR3A 2A5DA 1F3OA 4TLCA 1HYQA 1U0JA 4DKXA 3C5HA 4KBFA 1OV4A 2GNOA 2GBLC 2WJVA 4C2TA 2B6HA 1T0HB 5AJVB 5EZ6B 2QI9C 4OK5A 2PH1A 3AKDA 1DS6A 3T5GA 2O0JA 4ZIRB 1DELA 3Q85A 1T8UA 2ZSEA 2FGKA 3VR4A 2JLVA 1Q1EA 3AVYA 2AD1A 4KYIB 1F2TA 3CW2A 4YXWA 2AHOA 1UFQA 2DFKB 4HB2A 4EJSB 2B8TA 3BRWD 3BXZA 1KK3A 1GL6A 3LW8A 3L2OB 2RH5A 1I2MA 3LQRA 4QOSA 1Z6XA 4WXPA 2DFLA 4M9SA 2DFNA 3IGFA 3BORA 1NBME 4NYMQ 1KGDA 1GIAA 1K6MA 1UBGA 5IDVA 4B3FX 3TR0A 2P67A 2ZRFA 4FMDF 5DIFA 1G5TA 4JT2A 1N6OA 4PXAA 3QUSA 1H8EA 4Z54A 2X2EA 2IF0A 2ZQ5A 2ANCA 1NVXQ 4FN5A 4DCVA 1YZQA 1JR3A 2ZSAA 3VHLB 2G3YA 3C14C 2PL3A 3C8UA 2QP3A 4Q66C 3PFIA 2CHGA 1SVOA 4B6EA 1B0UA 2HXYA 4DLWA 3BERA 3DPUA 4TTPA 2VF8A 1A82A 4HB4A 2GZAA 2VSXA 1N5IA 4ZI3A 4MQBA 1OKKD 4U00A 1W4AA 2P2LA 4RD0A 2Q9AA 1NVVR 2QGZA 3HDTA 3VR5A 4ITRC 2RB4A 3EIQA 3FKSA 2O8FA 3CF2A 1KYIA 1II9A 2AX4A 1FUKA 4MGKR 3VX4A 3KKMA 1ZNXA 1Q21A 4N3NA 2P5SA 5F9FA 2OFOA 3RS0A 2BWJA 1YZTA 4CEIA 2OLKA 3LXRA 1E6CA 3LO5A 4PAMA 1GWNA 1P2TA 2GAOA 2HT6A 3THOA 3T1OA 5KPJA 3UPUA 2W6ID 5KNCA 4JBXA 4LOAA 4CEJB 1R8QA 5TV2A 2ECKA 1GNQA 2W58A 4D0LB 4B75A 1M7GA 5H8WA 4JSYA 3CRQA 4IXNA 3BH6A 3EIHA 4EPRA 4PPGA 3CNNA 4OK3A 2JLWA 2Q21A 3GEHA 2RGNC 2F9MA 4XH9B 4WBSA 4DB4A 2XOKA 3LWNA 3EPJA 4NCHA 1D2EA 1AK2A 3OFNA 3TUJC 1E9EA 2ZETA 2WJHA 5LD2B 4YDHB 5CK5A 3N2EA 3I92A 1XMSA 2BMDA 2HLDA 1XD9A 3QBVA 3NC1C 4QBGB 4R98A 3K9LA 4DLZA 4U7DA 2PBRA 5JWHA 3CBQA 1PVOA 4Q47A 4PPQA 3AVXA 1G3QA 3SQXA 3UMSA 1TTTA 1CP2A 3ETLA 4QJ4A 4BRUA 5SZKB 4D25A 3X1DA 3QKSA 1A4RA 4HZUB 4FMCF 1D5CA 1C9KA 5E7JA 2EQBA 2YWEA 1P6XA 1ZCAA 2MSCB 2QROA 2ZRKA 3B1XA 2N46A 3M0EA 3REFA 3X1ZA 4A8JA 1VCNA 1ZD9A 4Y0VA 2XXAA 2FV8A 1KO5A 3NWJA 3FHTA 4ASUD 1Z28A 3QIAA 4CF7A 1W2HA 5L8VA 2IYLD 2IHYA 3DKPA 3HPQA 1KI3A 2ZPTX 3A58B 4UNRA 2XEXA 3DKVA 4ZDJA 1N3BA 4YLGA 1OXTA 1XP8A 2IXEA 4BLSA 1XZQA 4X8HA 2HJVA 1M2OB 2O8BA 2VH5R 1G3MA 1OXUA 1G3RA 3K70B 3FMIA 4UJ3A 1W1WA 1XTQA 1KO8A 2HV8A 3RNLA 4JS0A 1MRSA 1OH5A 2CMKA 1NVVQ 1OIXA 2OXRA 1XTRA 2YC2C 4BZQA 3PEWA 2XB4A 4OBEA 1N5JA 4JYCA 4LHYA 3W9YA 5SZIA 2UVQA 3TK1A 5SZJA 1ZM7A 3ZZ0A 4RZ3A 4W5HA 3TIFA 1ZVQA 3O8DA 1E9FA 1MV5A 3NBZC 2XSZD 2WV9A 3EIEA 1Z6YA 4IDOA 4R2HA 4JLMA 1MRNA 4DCSA 4US1R 4E07A 5C4MA 2NO6A 4FIDA 1A2BA 4KITB 1SKYB 3RRNA 5KSOA 4DSNA 4TLAA 5FPKA 5TVKA 4XWAA 3K1JA 4I1UA 4DEYA 3SJZA 1NP6A 2OAQ1 1GFIA 2GESA 1MR3F 2C9OA 1ZUIA 4EIWA 3GLGB 1LY1A 1KI6B 4TLEA 3CNOA 2ZE8A 1VYTA 2QPTA 3K0EA 2HEIA 3L8YA 1ZMXA 5C18A 5C1BA 3PUWA 3QJYA 3K0FA 3U3RA 1BYUA 4A8JC 1W5TA 4ZKDA 2CE7A 4I81A 5CDFE 4B6FA 4AKIA 1YU9A 3SYNA 2CNWA 3IDQA 3M6AA 1OYYA 3OEHA 2WJJA 4OQLA 3DM9B 3I3SR 2XB2A 3PV0A 1OFUX 1XCPA 2C03A 3IBGA 4CZ2A 4EFLA 1G21E 2OCBA 1SVSA 2BBTA 4MRNA 1CJMA 4BFSA 2PJRA 5B57C 1S1MA 5FTNA 3MCAA 4F38A 2JJ1A 4LC1A 2OBMA 1LF0A 3KQUA 1XB2A 1EGAA 1TADA 2YZ2A 2FJUA 1A5TA 2G77B 4JKIA 2YWFA 1W0KA 2GEUA 2P6UA 1KSHA 2ANBA 4C0JA 2R6FA 4ACAA 2DBYA 3JZAA 1SVMA 5K8IA 3WMEA 1YVDA 1E0JA 4HAUA 4EFMA 5HKKA 2ZR7A 4HB3A 3EWAA 1FTNA 2W2TA 5FOUA 1EWQA 3QOFA 1Z0FA 5K8TA 3U4QA 3IBYA 4QGAA 3WMFA 1RRPA 3KKQA 3O47A 4DCTA 1TQDA 5CYOA 1US8A 4A9AA 4CGZA 3WYAA 1XEXA 2D2EA 4LCBA 3LW7A 3I8SA 3TH5A 1HT2E 3H2YA 5AUNB 4RKFA 2A9KA 2YJTD 4NP6A 2BM0A 5EQTA 3REGA 1H8ED 4O3MA 2IS6A 3PUZA 1W49A 4L4UA 1U9IA 2UZIR 1P72A 3GLFE 1WMSA 2A5FA 3THYB 1P9WA 2OBNA 4OQFA 3R20A 1OYWA 4A82A 1KNQA 2B7CA 3CZPA 1ZNZA 4OKSA 4TMXA 4YMWA 5EJEA 1YKSA 2Q3FA 4EDHA 4MUAA 2AXPA 3DHWC 2PCJA 1P9NA 2MSEB 1NL3A 2JDIA 4MH0R 3GFOA 3DVLA 3TRFA 2BHRA 2QL6A 3QXCA 5EP3A 1X8LA 2VRWA 2ZUDA 2GK7A 1ZP6A 4PFSA 4MYTA 2FEMA 1OIWA 3LVQE 2C5LA 4LJ6A 1XTSA 3Q7PA 2ZREA 4M2LA 4R7ZA 3QKTA 3IO5A 5FOVA 3DOFA 2QP4A 1SVIA 2FFBA 1FQJA 4GZLA 3UG7A 1KDTA 3GEEA 3QEOA 3SHFA 4L8GA 1GG2A 2AKYA 2O5VA 3I73A 1ZU5A 5FI0B 2GILA 2J1LA 3FKSD 1NBMA 4W7SA 2B7BA 1XD2A 3O8CA 2ZIAA 2QTFA 1W46A 2V7QA 3I1FA 2HCBA 3TMKA 4IFEA 4JLJA 4HAXA 2H16A 1NLZA 3AM1A 1XRJA 1E9DA 1E2QA 2R6DA 2GEVA 2ZRJA 3TJZA 2QPOA 3QPUA 4U02A 1AIPA 5LB4A 3CM0A 2NOAA 3AP3A 1Q20A 1R8SA 1JQLB 2C04A 5CJ2A 2OESA 5JEEA 4AYXA 1QHGA 5LPNA 2FSGA 4C0LA 2BKEA 3X2SA 4DLTA 4NCJA 3NC0C 4PTLA 3VTKA 3NXSA 3RDPA 2ASEA 4MRVA 1U9IC 3Q8XB 4XJXA 4G5RA 1R0XA 1U2RA 4JJKA 5FUWA 2FOLA 1G291 4OHVA 2GVZC 2XOKD 1GUAA 4TMKA 5FBRB 3SJCA 2FGJA 1NKSA 1Y3AA 3FOZA 5P21A 1L4UA 2G88A 1IXZA 1U81A 3LLUA 3DOEA 4NHOA 1KZGB 4LDJA 3PUVA 2HLDD 3SI7A 3U7EB 2A5GA 3ZIAA 2CVFA 3P4YA 3MGCA 3PUXA 3OIUA 2ZS7A 5JHGB 4RFVA 1OH8A 2DYKA 3LAWA 4BWYA 1Q12A 1ZD1A 4LJ8A 4N0DA 5CLLA 5FUVA 3L43A 3CZQA 3THXA 3KFXA 1UPTA 2ZAMA 1DEKA 1AS0A 1JI0A 2UKDA 4GOKA 4GP7A 1P4SA 4US2R 5JJLA 4M4SA 3AB3A 4MKHA 1Q22A 1CJTC 2PX3A 3L82B 3R9WA 4EPWA 4WA7A 1KI9A 2BEJA 2FSFA 3U4QB 4B71A 3PXGA 1CJVC 1NG1A 4G3XA 4BASA 2X77A 5KNBA 2J0VA 1GKYA 2FZ4A 3L0IB 1II8A 3QKUA 4X8MA 4ZKEA 5DYIA 1X3SA 3Q72A 5J40A 5IRCD 3EZ6A 2YOGA 4XTCS 3OIVA 4RD2A 4JMPA 3CB4A 2IBMA 3IUYA 4OK6A 4QBHA 5FTMA 4A0FA 1Z83A 2Z83A 1Z0KA 4MDEA 3AVTA 4AI6A 1UBFA 1RFLA 3ADKA 2PMKA 4JLOA 1NVWQ 4TLDA 2YOFA 2IYZA 5BXQC 5JFGA 2JA1A 1DTSA 4KYUA 5DISB 4KVGA 4TYPA 5JS7A 2CLSA 1MABA 3LVRE 1AKYA 2Z4RA 4IJMA 3T34A 3PVSA 3TGPA 1N2CE 1E2GA 3U7GA 3QE0A 3TW4A 4JBWA 1VHLA 1HTWA 2WOOA 3NG1A 3QVVA 4AG6A 1GILA 2A2ZA 3LX5A 4LX0A 5SZHB 3RABA 1N6RA 5B64A 1ESMA 1SGWA 3Q9LA 3QF4A 1XEFA 4D80A 3GFTA 1DO2A 3PEYA 1GITA 1UBEA 3CH4B 4TL7A 3OIWA 2BEKA 3ZQJA 2BJWA 3CX8A 4Q9LA 4MA4A 3AF1A 3BIFA 3IPXA 4MITA 2BBWA 4KSCA 5FPHA 3RVBA 5KYKA 3BH7A 2R6CA 4QFMA 5CLQA 3PIRA 3C15C 2CNWD 5CK4A 1XXHA 2GRJA 3A4NA 3OEHD 5KSYA 2HYIC 2A30A 2ONJA 4PC3A 1E2JA 2EVWX 3WNCA 2R44A 3K53A 2AR7A 1RW4A 3RS2A 4NONA 1L2TA 2IUSA 2G0NA 1OHHA 5AK0A 1BMFA 3CX6A 5TARA 4IDPA 2ODBA 1I2DA 2DPXA 1Z06A 5FH9A 2EW1A 2J7PD 2FDCA 3R7WA 1PUJA 2GDJA 4LGMA 1S4QA 1ZYUA 2W6IA 1T0JB 2DWPA 1T5LA 4R9UC 1NLYA 2QAGA 1KI7A 1TPZA 3HWSA 4GOXA 5EP2A 4KO8A 3ZZUA 5F98A 1KKMA 1F5NA 1T3LA 3BFXA 2QSYA 4DLYA 4OQMA 3LRPA 4Q1DA 4DLVA 1P60A 2ZRGA 3P27A 4Q4JA 4XWOA 1F6BA 4LHZA 4HI0E 1YR9A 3S1AA 5JHHB 4DIEA 1TF5A 3T1QA 1GKUB 5CDFA 4GPTA 4IVQA 4M1OA 1T8TA 4OHWA 2OILA 1QG2A 1FPMA 2OV2A 3QF7A 1G3IA 4JL6A 1KSGA 4JJZA 3R8CA 1OF1A 1W36C 1CBUA 1EFTA 1OT3A 1NJGA 4P31A 4G5OA 1O87A 1T4GA 1LF5A 1N6KA 2ZJZA 1EFUA 1AA9A 1E2FA 2A78A 1DG1G 3GJ4A 5DH9A 4BPBA 3CRRA 3CR8A 1KY2A 4CDGA 3ZGXA 3ZVNA 4DVGA 4JLKA 1LV7A 1M74A 2ZVPX 1S8FA 2EYUA 4G5GA 2WM9B 3GJ7A 3WXMA 1G7SA 3ZVLA 3CO5A 4A36A 3AEZA 1E2DA 1II8B 3I5XA 1RE0A 2GF9A 5DI9A 5EE0A 3RS7A 1OXVA 2JDID 4Q1AA 3FE2A 4Z8YA 2HF8A 4ASUA 2W2XA 2AWNA 2QTHA 3V4FA 3WHKA 2OCPA 4QKQA 4P3YA 3ADDA 1ZNWA 3BB3A 2WMNB 3LA6A 2CK3A 5LB2A 3TKLA 1QHIA 2WOJA 1P3JA 2YYZA 2J0SA 2ZS9A 4RD3A 1KOFA 2F1JA 3KJHA 1NBMD 4NMMA 4Q9HA 3T1VA 4IOMA 1JALA 3TR5A 4W9MC 2ZRLA 4HUQB 1JJVA 1ZRHA 3MJHA 5EP1A 4PZLA 4UNSA 4DWJA 2W2VA 2ORIA 4DLRA 1ZM3A 3L0OA 3HU1A 1N6IA 1C1YA 3B85A 2AN9A 3SEAA 3EPHA 3VMFA 3CX7A 4NYIQ 1G20E 2AFHE 4Q02A 1ZU4A 2FF7A 3ZH9B 4KV9A 1QHXA 1NSTA 3AQ4A 521PA 2HYDA 3W6OA 3FKQA 2QT1A 1G4AE 1HT1E 3U3OA 2IC5A 1QG4A 4DSUA 1MOZA 5TXGA 3HU3A 3W8NA 2F43A 3ASZA 3VFDA 3SBDA 4H9GA 4URWR 1ZIPA 1XXHB 4RSGA 4XVQA 2I4IA 3RANA 2WICA 2VP6A 1F2UB 3JVVA 3THWA 1KDPA 4QM6A 3QG1A 2JLRA 2NGRA 4BLPA 4DCUA 1U0LA 4GT1A 3SZRA 1N6NA 2ZYWX 4HSEA 4D0GA 2NMVA 4M0LA 3B13B 4B48A 3TBKA 2QA5A 2J5XA 2GA8A 1NRJB 1LTQA 3GLIE 2YWGA 3R7WB 3ZIAD 2P5TB 2B92A 5KDLA 1E94E 1MT0A 721PA 2V9PA 2IHBA 3VR2A 3EWSA 4C0SA 4PHGA 1S3SA 2QAGB 4ZCLA 2WWYA 3LXXA 2OBLA 4QHYA 4BRWA 3BD9A 5FBVB 3QXHA 4JBYA 2C78A 3G0HA 4TYYA 2YC4C 3TSZA 1KO4A 4AYTA 3EC2A 1TQ6A 4IFBA 1DO0A 4WOPA 2ZRPA 4JLPA 5L3QB 4UNQA 4WZAE 2I1QA 2ZI9A 3B5JA 3FDIA 1WE2A 2Q0HA 4LHWA 4C7OA 5E3HA 3U5ZB 4MYUA 4KJZA 4S2EA 2VP2A 3U3KA 1D8TA 4BFXA 3U44B 3KQKA 4OI1A 1UEIA 3LBIA 4HYYA 5KDDA 2OT3B 1W44A 3VX3A 4A0RA 1XMVA 4PO1A 3BBPA 4HZIA 3TUZC 4OI0A 5D3MA 4RKEA 1VKJA 2B21A 1VECA 2CE2X 2OLJA 1F60A 4PHFA 4GOJA 4WVFA 3KTAA 4N0EA 5CYPA 2ZROA 3IQXA 2W0SA 2Q9CA 4WXRA 8OHMA 3X1YA 1E0KA 2QG6A 4BGDA 5JWRA 1N6PA 4LBZA 3AVPA 2V6JA 3B60A 4IEIA 5HE9A 4TTQA 2CHVA 2XTZA 1PV4A 2GEDA 1W5SA 2IS1A 2OFWA 3EG5A 2GJ8A 2RGNA 2VHJA 1CU1A 3NVAA 1GP2A 1IN7A 1UDXA 1QBKC 1YJ5A 3IHWA 1E0SA 2XZLA 3W8RA 4Q19A 2OAP1 2BBSA 3TVTA 4I1VA 1W36D 1Z5ZA 1HV8A 1QHHA 4MGZR 1GRNA 2YINC 1JQJC 5G53C 3QPWA 3AF3A 2G6BA 1G1MA 3EAQA 3K0AB 4DDWA 3BFKA 5J4LA 5AJYA 2YV5A 2ZYUX 3CF6R 5C46F 2ZANA 3V00A 1NG9A 2C2HA 2R62A 3X1XA 1TU4A 5HZHA 1SULA 3AF0A 4V0ME 1NIJA 4B32A 3W3AA 1ZM2A 1GKIA 1QVRA 3NHBA 4H1VA 1V5WA 4M22A 4DUGA 1TL7C 4BLQA 3EA5A 1IY2A 4D4JA 4GNKA 1TF7A 2PLFA 4LJYA 4NE2A 1AS3A 4CVNA 2P6RA 1Q3HA 4A1FA 4IVRA 4L16A 4B2PA 3N70A 1XPUA 2QM8A 2Z43A 1OHHD 3WYFA 3DEFA 3ADBA 1BMFD 3V4RA 4BLOA 4FCWA 1KTVA 2F43B 3AGQA 2OFXA 4UQOA 3K0CC 1W7AA 1IAQA 3EZ7A 1JNYA 3IEUA 121PA 1ZCBA 3THWB 4FXPA 3W34A 2PT7A 4P4SA 5AJZA 4BQSA 4W5JA 4O2LA 3SDZA 4AC9A 1XU4A 4PQRA 3SYKA 2OCAA 4PHTA 2I3BA 1CR0A 4MGYR 4AYWA 4D82A 1CTQA 3DMDA 4N1AA 4PO8A 1EFCA 4BFUA 4LV5B 4I1SA 3LDAA 5DLQC 3HR7A 2HCJB 4HLUA 1BIFA 4GRAA 3ICQB 1QHYA 3DZ8A 2ZJ8A 3CWQA 1KMHB 4OQXA 3AV0B 2F1IA 2LKDA 4DLUA 1AZTA 4M1TA 3FPAA 4Q7JB 1RC8A 1MO5A 4FWTA 4HDQB 3CLVA 2ZE5A 2QMOA 3OAAA 5DHAA 2WIBA 1IHUA 5JJKA 2JGNA 4M1MA 4E22A 4K81B 2IS4A 1JEEA 3K09C 2RKOA 4URUR 1UKVY 2CJWA 1R5NA 3QNUA 1QHNA 1XDBA 3PG5A 5E95A 4BEBA 3L0SA 2XX3A 4ARZA 1E9BA 5KPDA 1E2PA 3W6PA 3EPKA 4RD1A 1F2TB 1ZUNB 3RRYA 1JR6A 5KOYA 2VF7A 4I1OA 4IEEA 2J0UA 2REBA 1GOTA 3E5HA 3MD0A 3TNFA 2EFCB 3MWLA 2CK3D 1JXOA 2RAPA 3CRVA 1AZSC 4C30A 3GCGA 1Z07A 2B8WA 1J70A 4JIMA 3W6NA 1X6VA 5FFMA 1SVKA 2E1RA 1KHTA 3BJIC 1SXJE 4KXFB 1X1SA 5JMTA 3A1WA 5TMPA 3NEYA 2ZRHA 3AVWA 2NPFA 2GCOA 1K5DA 5BQ5A 4DZZA 3HYRA 5KUTA 1X8KA 3VAAA 4HLUC 3VR1A 1R4AA 2VHUA 3TQCA 2CLCX 1YRAA 4CRWB 1ZUHA 1T91A 2VSFA 5EUMA 3WY9A 2ZU0C 2ZR0A 1NMYA 2NQ2C 3KB2A 2BIFA 1PLLA 1TUIA 3RS4A 1U8AA 3EXAA 1IBRA 2GJSA 4HB0A 3EC1A 4TSFA 3ZS8A 4GSYA 4KAXA 1XEWY 2QAJA 2ODEA 2VPPA 4JLAA 1W4CA 2CL0X 4JLVA 2O8FB 1YZLA 1E1RA 2AL7A 2GF0A 1PLKA 5BN3A 1KK2A 1SZPA 3UANA 2F1RA 4GP6A 3H1TA 2FPKA 1TUEA 1NIPA 5J4YA 3O8RA 1KK0A 2QORA 2Z4SA 4HUTA 2WPDA 2J87A 5FOXA 4CEIB 4DJTA 1Q3TA 4XTRA 3GLHA 4PPFA 1JECA 4L15A 4X8LA 2AD5A 2GXQA 4V02A 4P4SB 3BGWA 1PZNA 2BMEA 4Q4HA 4PSAA 5GVSA 1R10A 1UF9A 2BCJQ 5KO2A 1FZQA 1Z6GA 4FMBB 2G83A 1ZAKA 3EARA 3F3YA 2J7PA 3RRZA 1O3YA 4C0AC 2IS2A 3U3JA 4W5WA 1RZ3A 3CF0A 3EZFA 3WP0A 1TF2A 2ZI7A 1MO6A 4LUCA 3OZXA 2ZJBA 1G6HA 4QJ3A 3U60B 3KUCA 2A3RA 4B3GA 2P0EA 1ELOA 4BFVA 1J8YF 3DM5A 4B3BA 5TB5A 4K46A 4ESHA 4ZCMA 1KJWA 1ZW6A 2DHRA 4RJLA 1SQ5A 1N5LA 3OHMA 3AP2A 1XFAA 4L9SA 1HA3A 4DIDA 4Q03A 4EQ6A 1UAAA 2O0HA 2CJWB 1IY0A 1QRAA 3GLIA 4CEHA 1X8JA 3QKSB 4ARZB 5GJVC 1XTKA 1OE0A 3LFUA 5ANRB 2IWRA 2ZS8A 3I8XA 4EPTA 4Q9KA 2PT5A 4A8JB 2A5JA 2XXAB 3U2QA 3MRSA 4LJAA 4OI4A 4QGHA 2FFHA 5AUOB 4YMTA 2OHFA 2X1VA 4O2RA 4M8NE 2WWXA 3UMRA 1ZIOA 3TW8B 2EWWA 1CKEA 1KO1A 4EPVA 2VSOA 1Z2CA 4ZI2A 5DI3A 2YKGA 1KSJA 1WRBA 1Q1BA 5J5CA 2QN6A 4XVRA 1XMIA 5HE8A 3ASYA 2QT0A 2O8BB 2WBLC 2HF9A 4C3ZA 4NYJR 1Z63A 2GJKA 3AKEA 2F7SA 1SKQA 2CLDX 1JBKA 2XJ9A 4TL6A 4A2PA 1CR1A 3A1TA 3IHLA 2JLZA 4M1WA 5HR5A 4MYHA 2FSIA 3K9GA 2PEYA 4NCNA 2XAUA 5CIWA 3QSYA 4V03A 3ICEA 2FFAA 1RRGA 5KTYA 4IW3B 3ZLJA 1AKEA 2ZRMA 1XX6A 2ZI4A 4Q4LA 2FMXA 4Z8XA 1TMKA 3SS8A 2OSBA 4KLZA 1G19A 3MLEA 4CT4B 4YDSA 2HT1A 2AWOA 3BC1A 5BW8A 2VP4A 3TQFA 3JVUA 3NBYC 2BMJA 3OE7D 4YQFA 3MFYA 3KXLA 1G17A 2GWHA 1E0AA 4DLXA 3F8TA 2ZI6A 4Q7MB 1CIPA 4Z1MA 1LW7A 3K0SA 3K0FB 1E9SA 4NCIA 1E9RA 2ZI3A 4QHTA 2JASA 4OJQA 2VIIA 4FWIB 4V0NA 3IILA 2ZRIA 1FUUA 1DAIA 2EFGA 3GLHB 1U99A 4URVR 4QC2A 3LBHA 1KIMA 3L0PA 4NL4H 4LV8B 3BH0A 3P26A 4Q4HB 4MYCA 1CF4A 4JVNA 5J4VA 1TU3A 1DAKA 1KK1A 2R65A 2F6RA 3SC3A 3KX2A 5IT5A 2XITA 3KKOA 4PQFA 1J2JA 4F4JA 4IXMA 2J41A 1OXSC 1VTKA 1S0UA 2QP9X 3OAAD 5DYGA 1N5KA 1OB2A 1DPFA 3CWZA 2O0KA 2ZTSA 2J45A 4QGFA 5JCPA 1XTJA 3TSOA 1DG3A 4YMSA 3U6KA 4GMDA 2NTYC 4ZO4A 1N6HA 1S3GA 4LPKA 3DL0A 2C99A 3UXMA 1COWD 3LQQA 5M04A 4NTZA 1R7RA 3LV8A 4S35A 3RYTC 3NH6A 2QE7A 2IT1A 1SHKA 1XJ0A 2QQ0A 2QM7A 1M8PA 4J0QA 4PSKA 2ERXA 2IYUA 3EW9A 2X8AA 2WJGA 5JSZA 3EX7C 1GRQA 1P61B 1US8B 3VU9A 1XEXB 4US0R 1IN8A 1J8MF 4AKEA 2GKSA 5FOWA 3T1TA 5A0FA 3IO3A 5JI2E 2QBYA 4G5QA 3MMPA 3CPEA 2PZGA 3ZZTA 5F2EA 1JR3E 2XZPA 3KL4A 3T35A 4JL5A 1JPNA 1AGPA 4D0NA 2V3CC 5KNDA 2IYRA 3FHCB 4LPSA 5DI3B 3D8BA 2LCFA 4P0TA 1G8PA 1DAGA 4TMVA 4KODA 5TDHA 4AD8A 3A37A 3PCRB 2IYWA 3GFPA 5H68A 3WRYC 2CHQA 2CXXA 1ZNYA 2GCPA 1CR2A 4GL2A 1AQUA 4TLBA 1KKLA 3M4YA 3VNVA 4QRHA 1J90A 1SKYE 3H0KA 2O52A 1C4OA 1AN0A 5FTKA 3EA0A 4MKFA 3TAUA 2ZJAA 2VP5A 3I5YA 1G7TA 1XCMA 1OH6A 1OFHA 3G5UA 4V0KA 4B47A 4BE7B 5EE1A 1G7RA 4TSFD 1IXSB 1S2MA 3RWOA 3GLGE 3UMFA 4F91B 5EE9A 2OEPA 4PAOA 3AUYA 1E1RD 1XD2B 4H1UA 1E4VA 1E79A 1FFHA 4P32A 3LD9A 3QVUA 4M1KA 3KXKA 4Q4AA 2JLUA 1S9HA 3F0TA 3FB4A 1UBCA 3FMFA 4FW9A 4B44A 4BFYA 1MO4A 4TTRA 3UIEA 4NPHA 3SN6A 3HU2A 2N42A 2WPDD 4MDFA 2VO1A 1IJFA 1LNZA 1T5IA 2D7DA 3GJ3A 3IIMA 5IK2A 1I4TD 2C9CA 2NPIA 3ZVRA 4DDVA 4PQYA 2W0MA 3UWOA 1JAIA 1JJ7A 3AVQA 3AF2A 3FGNA 3KFVA 4FD2A 4DHEA 4F4IA 4KFTA 1LS6A 2PEZA 1J99A 4HEJA 4L5BA 2RMKA 2Q9BA 2JAQA 1CULC 2AXNA 3RC8A 3ZD7A 1KSFX 4IDQA 2ZE7A 5BN4A 1R5BA 5E7IA 5G3YA 1Z6AA 2BBOA 2I1VB 4P4TA 3NBXX 4NBSA 5G41A 5FUXA 4A15A 2O8EA 5JJIA 1W4BA 4PX9A 2JATA 4A2WA 1HY3A 2QSZA 4AURA 1WB9A 1VIYA 2H92A 5EE5B 1VCMA 1R0ZA 4Q9JA 4R2IA 4QGGA 3THXB 3NDBB 3C5CA 3DZDA 2QNRA 5FPYA 1GRRA 2ONKA 3R9IA 2ZSBA 3SOPA 2PLRA 1OW3B 1R0WA 3AF4A 4CT5A 1E1QA 4OHXA 2NO0A 2MMCA 4WW0A 4MUBA 1NMZA 4GFDA 2IYTA 5FPTA 4C0BA 4QL3A 3RS5A 3WP1B 4Q7LA 2G9NA 3QY0A 4HDOB 4LI0A 4JLNA 1SXJC 2KI5A 4HATA 3CRW1 2C77A 5FBLB 4BEJA 4ZIRA 1CXZA 2UZ3A 5BN5A 1E2IA 2QEQA 3B1WA 1IONA 1G8GA 1W4RA 2FZLA 2FN4A 1ZINA 1J7KA 3BWDD 4TQ9A 4Q21A 1E3MA 2CVHA 4G0NA 3KB1A 4LJ5A 2AK2A 2ZSDA 1M7HA 2V8OA 4RCZA 1OJLA 1MABB 1E9AA 1PUIA 3QXJA 1Q0UA 1I4DD 1T3HA 3I4LA 1SVLA 4E03A 2Y8EA 4C0HA 1NKTA 1QDEA 3N2IA 3GLFA 1W36B 5C2JB 1DVRA 3KQNA 1W2GA 2HJGA 2ZJYA 3FWYA 3QF4B 3LX8A 4CIDA 3OEEA 3BOSA 4HLDA 3KDSE 3RC3A 1AQYA 4JSTA 4Q4AB 4Z1MD 3MWKA 3GD7A 2VTKA 4LSGA 1R5OA 2VHCA 1GNPA 3UK6A 1TNDA 1G5RA 3PUYA 2IW3A 4TQUS 1LS1A 1OLOA 2YOHA 1YR7A 3KQHA 1W0JA 4PHHA 2D62A 4GZMA 4KU4A 5J47A 3CPJB 2HUPA 1HURA 2ZUCA 4Q7KA 1II0A 1XCGB 2DWOA 2NO1A 1TX4B 3QENA 1SHZA 1Z08A 2XNDA 5FL7D 4LC0A 4HAVA 4TQAA 3G82C 5AJWA 4EJSC 3PEUA 2F3TA 3P20A 2EU8A 2JJ8A 4LBYA 3JZMA 2P6NA 2LKCA 2J3EA 2H5EA 2IL1A 4FCVA 5H1YA 4B43A 5HPYB 5JWOA 1E2LA 4DC9A 3QPVA 1GTVA 1BOFA 2J59A 3AUXA 4CEJA 3A1VA 2R9VA 1Q1QA 3I62A 2CCGA 4Q4JB 2QE7D 4GDFA 5C4GB 4IRUB 3CRMA 4RD6A 4TL8A 3Q3JB 2A7QA 2CL7X 4I4LA 4C0KA 2C8VA 2GJ9A 3S1AB 5G40A 2JLSA 2R6AA 2ZYVX 3NTUA 5UKDA 2ATVA 3B82A 2BV3A 2GAAA 4PPNA 4O0MA 4QNRA 2RGCA 3PENA 1M7BA 2QENA 2JIZA 1E99A 2KSQA 1K8RA 2XJ4A 4LJ7A 3CKLA 3MSXA 1G16A 2PZFA 1OFTA 1KI4A 2BDTA 1KI8A 1G8FA 1FP7A 3KUDA 1XJQA 2WWHA 5CIQA 2WTUA 1D2MA 1RJ9A 3SBEA 1R6BX 1EK0A 3K0CA 3W5IA 2ZM5A 3Q5EA 3UG6A 3VHXA 3WBKA 4F92B 5GJBA 3CIOA 5ELXA 2C9YA 2FA9A 1FTSA 3A1SA 1W47A 2EYQA 4UJ5A 4KCGA 5JBQA 3ZVMA 5B2ZA 3GMTA 4DT1A 3Q5DA 4OL0A 3F5FA 2J9RA 1B23P 4HZUA 2NIPA 2C96A 3NBFA 1IQPA 3RRMA 1JXMA 1VYVA 3FVQA 2ZAOA 3VR6A 2AFIE 1KDRA 4Q00A 2ZEJA 1IN4A 2FH5B 3KXIA 2C98A 1FMJA 4F4CA 3OIYA 1GDDA 1EFHA 2JJ2A 3GJ0A 3PR1A 2BOVA 3QEJA 4D2IA 3SQWA 3MG9A 1Z0JA 3P1JA 4GI7A 1GL7A 4A2QA 2ZJ5A 4KI0A 5E4FA 3BAFA 4Q48A 1VHTA 5KSZA 3KJEA 1D9ZA 4LYHA 4RFSA 2XTNA 1VG0B 5FBWB 3PEVA 1E79D 2QGNA 4TMZA 1NVUQ 1X86B 3K09A 4AWXA 1ZC3A 4RZ2A 3GLFB 1S96A 1XWIA 2V1XA 3A4MA 4K8OA 3B78A 5IK2D 1SXJD 3KKNA 1JPJA 2JCSA 2FU5C 4JLBA 2V54A 1E96A 1E98A 1ANKA 3R8FA 1KY3A 3M1IA 5JI3E 4BFWA 5KDOA 1GL9B 4LY6A 4IDHA 5LD2C 1RYFA 1KJZA 5EP4A 3OE7A 1WA5A 1N0VC 1YRBA 5EUQB 1ONBA 3B1YA 1VPLA 5BYKA 1BKDR 2PX0A 4UNNA 3FHOA 2ZVQX 3SJBA 1P7CA 2WSSA 1I4LD 2WJYA 4TN1A 2ZUBA 4WZ6A 5A5GA 4MRSA 1Z0AA 5KHOC 1RPZA 2AKAB 2DFTA 4P4UA 1Z8FA
chains in the Genus database with same CATH superfamily
1MQSA 1MC8A 2NUBA 3L04A 4IMJB 1K6XA 2ZSFA 1H1LB 1VSVA 1VB3A 4O0LA 4A27A 2OO7A 3ELDA 1YUBA 2YH2A 1W5EA 1X9HA 1IN6A 3GFGA 3H7IA 4V2UA 2VNSA 1XYYA 4J29A 4JVMA 3D31A 4EWLA 2BKUA 1E2MA 4KRYA 4G0WA 4RTNA 2Z56A 1GM5A 4EAQA 4BZWA 3AF6A 5JAZA 1AV7A 1CJUC 2NU9A 1GJRA 4QX6A 2I71A 4F2GA 4MR9B 4HC4A 3R5FA 1EU1A 5L3SA 1PLJA 5U4QA 4QHSA 4KKXB 5HILA 3IT0A 3H2ZA 2X2FA 4IIDA 1TQ2A 2GPJA 4P3OA 3PJRA 5FOSA 4ND5A 3FTQA 1UJ2A 3S0JA 5F9HA 1HETA 5HKOA 3RSOA 3H8JA 3K4PA 4Y2SA 5FJIA 2PKRA 2PV7A 4BEWA 5A9SA 4UREA 1YA6A 4NH0A 1DC5A 5AJTA 1UKEA 5AOAA 2GYVA 4GZ3A 4UARA 1NZDA 2WF9A 3PT5A 4IDFA 2PIDA 4G9GA 4Q1BA 3NEJA 3ZWYA 3U39A 1L4HA 4IHJF 4IY1A 5BWNA 1HEIA 3I9OA 1DCKA 4PANA 2W93A 3EZ9A 2WD7B 4KO4S 5D3MB 2VDMB 2Z95A 2WI8A 3TTWA 4PGMA 5K0BA 2ACKA 4AT1A 5JMWA 4H1HA 2HR1A 3A9RA 2JGAA 3K31A 3B5IA 5SICE 3CPHA 3NKFA 4EMSA 3T06B 1W30A 3UKDA 4L75A 2KM1A 4K9PA 2UDPA 3RVKA 1LI5A 4JSRA 1IEQA 2WWWA 2IK8A 3HR8A 2WJZB 4X41A 1MO3A 4LY3A 1D9XA 2HN9A 2ZRBA 4BZPA 3QYFA 1ZZGA 2Y6UA 1KVTA 3IIKA 2FSHA 4LZZA 2YXDA 3FJOA 3FN4A 2HIMA 3QXSA 4IBOA 5LDDC 3KJQA 4XD7D 3E27A 3LSTA 4D4IA 5EXPA 3UHPA 5IJZA 2DERA 4B1FA 3CR7A 3E03A 221PA 3C3KA 3RJ5A 3ZXXA 2D4HA 4BFTA 3VRHA 1U9JA 2W9XA 3RGWS 3SE0A 3RWMB 3OUUA 4K6KA 3A6PC 1WJGA 4RFSB 4MUNA 2WWGA 3B6EA 1XPRA 3OEED 3NKLA 3S4YA 1VDZA 1WXEA 4B40A 2GUWA 2OCDA 2P69A 1TEVA 3HK2A 2POCA 4PZ0A 3EH1A 2ORWA 3QUBA 4F6LA 1JDJA 3AH8A 2ORVA 4HX2A 3E1SA 1S2OA 3GNTA 4E5NA 1BXGB 3I6QA 5CA1B 4K26A 4F4UA 4NCKA 1T9HA 2XHEA 1R0YA 4G1FA 4M55A 1R15A 4FUTA 4ZT7A 4UASA 1F48A 5ITSA 3C5EA 4RVCA 3T12A 5K4HA 1UOOA 1J4AA 4M1EA 1CRZA 1Z5VA 5HEKA 5A05A 2IVZA 3R76A 4M0PA 4YIKA 4TMTA 3SKXA 1V6AA 2FPIB 4OIFA 5LMZA 4QATA 4JZKA 1Y4ZA 5COBA 4URZR 4EM6A 5JSFA 1NNUA 5CP8A 1EWRA 1EX7A 3ROXA 1CZKA 2XNDD 5FB3A 1YS2X 1DC6A 1OV6A 5JLAA 4J0EA 3ECCA 4GOLD 3EIFA 1LTKA 3NYRA 4DC1A 2ZWAA 5AKZA 3JVDA 1YR3A 5CFLA 3IXQA 2OR3A 3INRA 4FGSA 2CXQA 4C43A 3AESA 1FNDA 3NDPA 2WYUA 3CH7A 4QXPA 1L4LA 3WNDA 2IWHA 1G8MA 1U7TA 2RGBA 3DOHA 4KWTA 4KSBA 5TMDA 3TFWA 4N5LA 3MJEA 5A4JA 2O59A 5EY5B 2PNJA 4GYKA 3NPAA 1P3Y1 3V34A 5KQSA 5JS1A 1PSZA 4WOKA 4YJGB 4PWZA 1RAEA 3UJ3X 1SUDA 3CGWA 3A06A 3H1FA 1M6YA 4CF6A 1CPYA 4DHWA 3AETB 1SB8A 3U13A 3D6JA 1M5RA 1C4XA 1PWEA 4ON9A 2SCUA 4WLVA 4ILEA 4IIEA 3TZQA 1T2UA 3VKWA 3ZTYA 5BWOA 1X1RA 2NU9B 2WYOA 1BHO1 2C9ZA 1IOVA 5C1PA 3PQ4A 1USWA 3I42A 4EVIA 1QMGA 1T9GS 2IEZA 3ENVA 4P5PA 5L3SB 1WZUA 3NBMA 2C7VA 3H2HA 4UU8A 5B3LA 2ZAYA 2H0RA 3RKRA 1OPXA 2J5BA 2FZWA 2H1FA 4EPXA 5G2OA 4JWTA 4LXHA 3ZK8A 4AZTA 4LKOA 3FVRA 2Q5QA 1G18A 4NCXA 2IYQA 2HDWA 1ZKDA 2VJMB 2X19A 1ZOOA 3NO4A 1N1EA 3P0HA 3MOSA 4JVLA 4YH1A 2FPWA 3RH0A 5HOQA 3FVWA 4GXNA 4CQMB 4XGNA 2F1OA 3JYQA 4LQDA 3RSCA 4GW3A 1SQGA 3QKRA 2DY0A 4KIJA 4JXXA 2WU0A 5FPQA 1U8YA 3VVBA 5IVPA 1NXXA 3I1YA 4B3XA 4GBED 2H31A 2JEOA 3X1WA 4BHTA 1Q7RA 2V3WA 2E87A 5IVKA 2HSEA 4DIFA 3E7XA 4RSRA 4LE1A 3O38A 4JT4A 5FR1A 3R7LA 4YAUA 3EASA 3K1ZA 4XQGA 3F2IA 4IOJA 1ZOIA 1XL0A 2VA8A 2L19A 4CEIA 1L7NA 4K2HA 4CCYB 1P18A 4LDZA 3T4PA 3K0HA 3G2IA 3C7TA 1QZXA 2QPAA 4D4KA 4DVJA 2ZR8A 3UGTA 2PIAA 3FPCA 3GO4A 5TF0A 1H3EA 1E69A 1LBQA 1P7WA 1QIIA 2NXNA 3NJRA 1C7QA 2EZ4A 3OZIA 4K9LA 4LGVA 5ALQA 3TKAA 1J06A 3DOJA 1EG7A 3N7TA 3P2OA 1CT9A 3GA7A 3RVMA 1YTUA 3CUEF 1BS1A 1QCCA 3UMCA 2H7CA 1XVTA 2D7CA 4K9QA 3DOUA 4PX3A 5F4BA 1ZL0A 4JP3A 3TB6A 1JQ5A 4RVSA 4DEXA 4DPLA 3E9DA 1A98A 1RM4A 2G1PA 4A0GA 3P0FA 4FMDB 3SC6A 5AVQA 4II3A 4NAVA 1Z4QA 5IJ0A 1EHIA 3GPLA 1Q7TA 5CW1A 5B58T 1L5LA 2B0JA 2BVNA 2NTNA 4P7FA 3I04M 4H3KB 1PTKA 1GLGA 3AR9A 3GA5A 4IS2A 3W7AA 3RQSA 5EZSA 5J4HA 1PR3A 2NSDA 4REMA 4BZXA 1KJIA 3KK0A 5LLTA 2O2ZA 2C4HA 2ATCA 2IYYA 4MTCA 2MMGA 4BTLA 4TN5A 1ZGJA 1KAOA 4YRAA 2QYOA 1WDMA 3TS1A 3MPOA 1H2ZA 4FNOA 1RTKA 1OX6A 2NVUB 1DMRA 3RK4A 3DL7A 4ZVMA 5F9MA 1CRQA 1KBOA 2ODNA 5CB0A 5EMHA 1DKMA 3RUFA 3H2IA 4LOLA 3KVVA 4YQEA 5MHTA 5IM4F 3IH5A 1OXXK 3KLOA 3MUFA 1V1RA 3WLEA 3ZDZB 4HDMA 2I67A 5AKLA 2K6GA 3NUGA 1N6LA 3MBIA 3L8ZA 2RG7A 2QMUA 3AX6A 4HQLA 5EA2A 2OYCA 4PRYA 1RRCA 1D07A 1MAVA 2D1QA 1UQRA 3DQZA 1DZIA 5LA6A 3TVDA 4CHGA 4UDNA 2ZJOA 4IVPA 1UOPA 4CLEA 1ZRSA 5EJIA 3IURA 4NBRA 3V97A 4C6TA 5CD1A 3RJMA 3MCTA 1UKZA 2AI2A 4FDTA 2F1KA 1JG3A 2ZKLA 4MVJA 2AFHB 2ZU6A 1O4WA 2HDHA 2FWRA 4BATA 5K0NA 3RSSA 1SBTA 4LOKA 1ULBA 1Z47A 1XZPA 1ZLXA 1OJ7A 3GJXC 3EXIB 1YL6A 4C20A 2IPXA 4QZVA 4KLAA 3Q10A 3OA2A 4TXNA 2DY1A 4BKOA 2EFDB 2ID9A 2WMDA 3FSJX 1SCBA 3OTHA 5DGXA 5LU9A 3ZGOA 4G8BA 5EC8A 1QIGA 2PXAA 5LXTB 5DPMA 4LJ4A 4R01A 3IAXA 4PLGA 4S0XA 5I7VA 1UPCA 2QUZA 2VQSA 1C0PA 4EI9A 2W8BB 4MRRA 4N40A 4C87A 2AZ4A 3ZXIA 4DV0B 1L7MA 2VJAA 4UEJA 2IFTA 4C4PA 4COOA 2HMAA 2XUGA 5AWFC 3RUPA 3Q7QA 5KYUA 2HBZA 2XCSB 5MN4A 2ID4A 1ZSNA 2G5GX 4F5WA 3EMDA 4A0HA 3GJ6A 2OZEA 5DEOA 1VG8A 3BYZA 3AG5A 2DJ5A 2XUQA 2HGSA 4DDTA 3RT7A 3P8ZA 5LUAA 4H4EA 1O95D 3QKRB 1Q0LA 3PFGA 4YYZA 1D6SA 3Q3EA 3UJ9A 3IAM1 1JKJA 2BC9A 1P0IA 1KMQA 1T8RA 2B2CA 2PO7A 4XUCA 4JBGA 5TT0A 2QQGA 4NFLA 3S68A 2GBPA 4CKZA 4WLEA 3DZJA 4U6NA 1NVDA 2IZ6A 2JGFA 3BF8A 3ITDA 1V1MB 5IWCA 3HVIA 4BEVA 4XYMA 5JJBA 3J81A 2XYQA 4HK4A 5BY2A 2YXLA 2BELA 2JG3A 1SM4A 3RNOA 3OKFA 3SKYA 5CB8A 1N5DA 2BFBB 4RDHA 4DR5B 1F4LA 1CEEA 3KQPA 4QD3A 1EUCA 1G5HA 3ZWVA 4BN5A 4HVTA 3V33A 4OGKA 3UHAA 2NZ8A 2IXGA 4X97A 2X14A 1I7DA 1Q15A 1L4BA 3OU6A 1IPFA 2QRPA 2IX3A 3UEOA 1QQAA 4L51A 3QMPA 4ABTA 3HNOA 1QO0A 2XMQA 5CM8B 3B36A 2XTMA 3S6JA 4YR9A 2P30A 1QHSA 1U7PA 4JJIA 2QZJA 5EGNA 2FMIA 3ZCTA 3KV1A 4AS1A 1TECE 2YL2A 1H2BA 5C7IO 4G8CA 2Z0MA 1YQDA 1UMCB 3L1VA 3IAUA 3IERA 4U39A 3RK0A 2P9BA 4K6HA 1ONSA 2R8BA 1U31A 1WCIA 2FK7A 1MB4A 2NYAA 2HIAA 4BWGA 6Q21A 1P1JA 4H1TA 5IJ0B 3L06A 4V2IA 3WBJA 1A8IA 4RK6A 1YUNA 3TCNA 2W00A 2RK6A 1DMSA 2OHHA 3G59A 4XIFA 4LXQA 4UE2A 2HWKA 5CA0A 3N87A 3KVNA 3E7PA 1YDFA 5HFJA 1SXJA 2H85A 5KX5A 1M67A 4E5PA 4OYLA 2Y9MB 4Y2UA 1HNZB 1NY6A 1Y7IA 4AY2A 4B4OA 1P0MA 1BYIA 5FTLA 2BFAA 3ZDDA 3VU8A 4HLCA 3PE3A 5H59A 2EKBA 1R3UA 1OGYA 1K08A 3QX7A 4PZYA 3H42B 2H8GA 4DUGD 5JAOA 1NNEA 4AKHA 3M70A 2YVUA 1MB2A 4HDMB 4DRZA 1INLA 3I9V6 5HM6A 1TEXA 4L3OA 1GGJA 3QVTA 1VL1A 3DDNA 2JHPA 4BLRA 4YV0A 4HFRA 1YDHA 2DCUA 2XMDA 1V39A 4Q1CA 2QHXA 1PP4A 4Y0NA 5DO9A 4KLNA 1JMVA 3FG9A 1XRQA 5FNVA 5LA6B 4EITA 3NIBA 2B61A 4JQSA 1YR8A 3CUTA 3MAAC 1E8NA 1H5QA 3UWKA 2NXEA 5DM60 4C6TB 4F1JA 2BR4A 2Q41A 3KYBA 2GZ2A 4J0CA 5JV5A 2FDXA 3P94A 3I32A 2RHBA 3MJSA 4BB9A 3PDIA 2Q5JA 2FAXA 1L7BA 2PX2A 4L95C 2AMVA 2HWXA 3PNLA 1FEZA 4L8LA 3WMGA 4BP8A 3D7RA 4B6SA 4I55A 4RDIA 2Y3IA 4KFUA 5BYJA 3I72A 1PFKA 2BGRA 1T1RA 2JJ1D 2GT1A 3T15A 3U6BA 5IBPA 1ZRMA 3FFWA 2RHOA 4W5NA 2VQ6A 4BVKA 3ZWMA 3ZYCA 3GC6A 1PJRA 4C2UA 4DBLE 5EE3A 1QGYA 2GN6A 1M6NA 3CURA 4JLDA 5L3VA 1W0KD 1AQNA 1LLCA 1D2AA 4IUDS 2IHJA 5DASA 4B6QA 5CGZA 3AG6A 4FU0A 1VSQA 4GPZA 3BFPA 1HC7A 4TZ6A 2V55B 3HUFA 2QUHA 2OC9A 2PKWA 3KOZA 4XA8A 1MX3A 1QCZA 1TC2A 2VDUE 5K0JA 2WG1A 2OXCA 3GNLA 2GERA 2DR2A 3TZEA 2YMMA 2O2HA 1CD5A 4UVEA 4V0OA 3Q9NA 2OXTA 1JKJB 3A70A 2QMEA 3ENQA 3OA0A 1VE6A 2DWQA 4N0MA 3E9CA 4KYTA 3L4SO 3CH5A 1H3FA 3E2IA 4FGKA 4C9BA 2RHLA 1U5BB 5E6SB 4DCNA 4JXZA 2ERYA 2WWFA 1L1RA 2G9RA 3PDCA 1JTFA 2LRHA 3KHSA 5F52A 3WYGA 3CN7A 1LWNA 2V0NA 2UXCB 1YVEI 4EKNB 2V4ZA 4Y2HA 4YAWA 3FYDA 3C16C 3CZAA 1M72A 5DHFA 3ZE2B 3DC7A 2YY5A 2NT4A 1GNTA 3GT0A 3GZJA 2W6JD 4OXRA 2C95A 5F51A 2QNBA 4OBBA 5TT1A 4GXQA 4UUAA 1W9HA 4S0ZA 2IZ5A 3QVGA 4URYR 3M9WA 4XD7A 1WMFA 2H2WA 2DX7A 4L9WA 3I2HA 2R6GA 4DDKA 4TMWA 2AQHA 2ICAA 5FFNA 4FS3A 1FLDA 1T36A 4XPZA 4EY3A 2BMFA 1AY0A 1JAHA 1RZUA 2ISCA 2ZUEA 2P9YA 1E64A 1J6UA 3P9XA 4PRKA 2K7ZA 1ODLA 4ND2A 1E8DA 4QBFA 3SSAA 3RO7A 1RCUA 4D8XA 3FVVA 1ZC4A 3SR4A 3H13A 3UAGA 4AL4A 4QYXA 3DFZA 2DP4E 4ZODA 621PA 2Q6OA 3AEXA 3KAPA 1K7XB 1JE1A 2IGBA 3BTUA 4R6XA 1W94A 1ULHA 2V7QD 3FCXA 1JEDA 2W48A 4ROTA 5DM1A 5K3BA 3VR3A 4BP1A 4PY2A 5BWMA 5ERGB 1SXJB 2EV9A 4IIYA 5KX5B 5CT4A 2JKVA 2ZIGA 3KZCA 2AYZA 4MVJH 4B3CA 3FSEA 1D1PA 1F9EA 2NZUG 2PZLA 3C1OA 3PGKA 2DSTA 4OI2A 5JEDA 2FKAA 2WKPA 2WUDA 3OKCA 4I8DA 4MUMA 3HPRA 3JWPA 4B7CA 1XMXA 1LZLA 3ZWOA 3WFZA 5IF9A 1QRRA 1JG6A 4QUAA 1SVWA 4LN1A 4CIAA 4U6SA 3V8NA 4ZMBA 4JJAA 5BQPA 2ATIA 2HTFA 4RLFA 1E1KA 1C7RA 1FB5A 1VKNA 2Q3HA 3JATA 1V25A 4Q1EA 2FQWA 3H87A 4E1VA 1H65A 2NO7A 2YASA 4TL9A 5KTKA 4EYQA 4DXDA 5D51S 3AEQB 4ZGWA 1JQDA 3UM9A 1XALA 4WOCA 1AHHA 4GMHA 2WLTA 1ZM4A 2XVXA 5AI5A 4YUZA 3Q9UA 4I9GA 4FOPA 3OECA 4RY2A 3R6WA 4I55B 3PRKE 2O2JA 2AEJA 1Z5UA 2EFHB 3TFOA 4TXHA 1M5UA 1VGQA 1XJCA 5I7SA 4BYMA 4KQHA 4RK1A 4IG4A 3HRKA 5AD1A 1RXWA 4ZQFA 1FTWA 2XZOA 4PEVA 1PJAA 3QH4A 4QQ8A 5DHTA 4DNOA 4M9ZA 1X1DA 2C5GA 5C80A 2VYND 1P4RA 4NU0A 1A9XA 2FW0A 2ZYAA 1R6UA 2WZDA 3T3IA 2JA2A 5DZSA 4OOFA 1Q6ZA 2CYCA 3SF8A 1N34B 5ECWA 1CUJA 3FYHA 3H0EA 3ONDA 2CT8A 2ZIEA 5TE9A 2A5DA 1W5FA 1X7DA 3L6UA 1Y4AE 4M9CA 1U0JA 3OP1A 4U1RA 4BNNA 4KRGA 4DKXA 1OV4A 1JWLA 3L79A 2GNOA 3BQMB 2W42A 1BCRA 1FVOA 3P9PA 1PT7A 4QDJA 2PH1A 3AKDA 1DS6A 4ZIRB 2O0JA 4ZU1X 1T8UA 4NJOA 3HCCA 1Q1EA 4R9VA 4XVHA 3ESZA 2AD1A 3FETA 1F2TA 1L5MA 4TMYA 4ZRMA 1L4GA 2DFKB 2JFGA 3BRWD 1EP9A 1E8MA 1KK3A 3LQ1A 1KQPA 2DSNA 2O5EA 1MLDA 3L2OB 2RH5A 1Z6XA 4GWKA 2E4XA 3W9BA 3F1LA 4TM7A 4JAVC 2FP4B 1NBME 3C7CB 3D6VA 3X1KA 2NSLA 1WPQA 3O4HA 3I39X 4W1RA 4C4SA 3B52X 5LYJF 4MQFA 5DIFA 2Y27A 3LC0A 3QVGB 3BMOB 1PV1A 2AC7A 2ETXA 3OQMA 3LC2O 5BO5A 4Z54A 3PX7A 3S8EA 2VBFA 1ZK2A 3DWGA 3JW8A 2O2IA 1GLVA 3I09A 3VHLB 1T5BA 3UCEA 1JAYA 1TJYA 4F8EA 2RGRA 5C52B 4Q66C 2JBAA 5ITZA 2A1UA 2Y4NA 4EJSB 2I78A 1O9GA 3WLQA 3BERA 1YQXA 3DPUA 4MWDA 2VF8A 1BE6A 3PA8A 4MR8B 2GN9A 5B37A 1IHPA 3VHQA 2QTBA 4KKVA 3VU3A 1JHDA 3DE3X 2WFLA 3T7RA 1M76A 1QFYA 2MWMA 4OLAA 1QVWA 5GZ1A 2VSXA 4UHDA 1AKVA 3GG2A 3KG2A 2GAJA 1W4AA 4EKGA 5IT0A 1NVVR 1R5JA 1MENA 4ITRC 2O0MA 3DWIA 3O1JC 2OORA 4H16A 1GGNA 1M1NA 1VJ5A 2HRRA 2RJ3A 4UVGA 5B1SA 3EZGA 3TQHA 2ZT8A 4JR1A 4LRYA 3LYUA 4LNAA 1II9A 1FUKA 2IH4A 4ZT2A 2B99A 5DNEA 3F2VA 3L41A 3VX4A 4AMGA 1UBMS 3IEMA 2PRYA 2BTOA 4N3NA 4PG6A 2ZYRA 3HKCA 3DFUA 1XTZA 2P9EA 3JATB 2OFOA 5CVVA 1AKRA 4DA0A 4E4TA 4ENPA 3LO5A 3H75A 5LZ8A 3MF4A 2FW8A 4NG4A 2HT6A 3T7EA 1HM5A 4EO9A 1PT5A 3ANYB 3HZZA 1VKRA 2DF8A 5TV2A 1EEHA 2DETA 4M1ZA 2QZSA 4B75A 3CRQA 2Z57A 3OM1A 1F8XA 2WTMA 3A7EA 1ISGA 3TQQA 1UBHS 3R09A 4EHIA 2FSPA 2ILVA 3V7FA 4EARA 3GEHA 3BMCA 1MQAA 1PJ2A 2F9MA 4DB4A 1RI4A 3LWNA 4B7XA 2XAAA 1A9ZA 1BWRA 2GD2A 3EPJA 2LGJA 4A3SA 3BMNB 1DBIA 3Q8MA 3WKAA 3BXOA 3SF8B 3B20A 1TK9A 4UEKA 1Y9DA 2VZ8A 3OLQA 3N2EA 3EQ8A 5ELMA 1U7XA 5ES4B 3TINA 2CV2A 1XMSA 2BMDA 2ZOSA 1XD9A 2HTEA 3QBVA 1ADCA 3ICWA 4HTFB 1QH9A 4P86A 3VHXB 4DCGA 2B1QA 2DKFA 2WILA 4J8PA 5JWHA 3TTVA 3T7TA 3CBQA 3HADA 3V1UA 3O8QA 2FMTA 4PFKA 2VC2B 1G3QA 2Z3VA 2QRUA 3PQEA 2G63A 4YJFA 3LFHA 2PS1A 3NALA 1A4RA 1YR1A 2GB4A 3KJFA 3L8MA 5ILQA 5E7JA 3KSZO 2PMWB 1K7EB 4Y9RA 2ZRKA 1FSGA 1CEYA 4A8JA 1XKQA 2VG8A 2ACVA 1W2WB 2DFPA 4UMFA 1O94D 3G88A 4WK2B 1KO5A 1L7DA 2XXAA 1ACJA 5JVDF 5AM0A 3R4VA 4LF4B 1T6YA 1W2HA 5L8VA 4N5MA 4B3HA 1LPAB 3BJRA 4B6GA 1D2HA 2Q49A 2GPSA 2ZPTX 4HFJA 3IOMA 3VC2A 2D54A 3A3KA 3DKVA 4YLGA 3UT5A 1OXTA 1XP8A 4EGQA 4ZDJA 2IXEA 5IFKA 4FE4A 1LK7A 3O83A 5EIOA 4X8HA 3N6VA 2H2AA 1EX9A 3PFHA 5CPFA 1ND6A 1G3MA 2Q4OA 5I7OA 3KB6A 3K4HA 2IYEA 1F14A 2BDUA 5ALJA 4UJ3A 2JRLA 3LUHA 3DPSA 2NQTA 4GE3A 1F3LA 3VBCA 2ZT6A 2D00A 1HQKA 2CMDA 2JCYA 1PKXA 2XMCA 2FWBA 3EZLA 3NYWA 4GZ5A 1RP1A 3E61A 4JQZA 2NZYA 2I62A 4J3NA 2VPZA 2P11A 3HCFA 5U1PA 3EGXA 1A27A 4AS3A 1PNTA 4RY9A 3U40A 4EHNA 4G0VA 4BZQA 3A6LA 3AUUA 3JWGA 2JBAB 5ITZB 1L8LA 4N01A 4LHYA 1T8WA 4ZAYA 1Z2DA 1EVYA 1N3LA 2B3DA 2H0AA 4MW5A 5SZIA 3W9YA 2PUDA 4Y9TA 1XZKA 2L42A 4O1MA 4ENSA 1OTXA 3DVQX 4HYQA 5FLEX 2WFLB 1KEKA 4IDOA 1MRNA 5F1PA 4US1R 5GWXA 2Q2OA 3UTCA 5C4MA 2NO6A 2JAWA 1KQOA 4KITB 1SKYB 3RRNA 5B12A 4RS4A 4AJLA 3AHDA 4H4CA 3N07A 2A0KA 3CMCO 5C1DA 4OX9B 3H8SA 2GCGA 4PLFA 3VISA 2JHCA 3OPNA 1M1NB 2PXHA 1A9TA 3GLGB 2J4FA 2V58A 3OVMA 5D3KA 1MC4A 4TLEA 3CNOA 3JYNA 1A5AB 5K3CA 1P4GA 2Q7DA 4ERXA 1V6CA 1ZMXA 1B8UA 4IIGA 3PUWA 3QJYA 5EKSA 3KU1A 4BN4A 4A8JC 3D4LA 3HKCB 2FPRA 4OMDA 3SLGA 5IUNC 3BE8A 5JSQA 1AO0A 4I81A 4AKIA 5IBRA 3SYNA 4KVZA 2QZ9A 2V5VA 3AOEA 4ZQEA 3CF4G 4J1NA 3V1KA 1OLUB 3G68A 5ALMA 5EZYF 3PV0A 1ZA1A 4R1TA 1Y8QB 5IABA 4G1EB 2QUBA 3DULA 3EGOA 4YCBA 3ST7A 4BQPA 5JZ9A 2O7SA 2Z2IA 2OCBA 1E4EB 3T4EA 2BBTA 4F5YA 4BFSA 2PJRA 5B57C 1ZOSA 1KYVA 2VJNA 2I7VA 1Z13A 1DC3A 5E0KB 3S2FA 2X0EA 2WZBA 2JJ1A 1I1NA 4LC1A 2E4AA 1PHRA 1CUCA 5IANA 4MWBA 1LF0A 1Z6QA 2HPZA 3V3KA 1U7DA 4D43A 1UBTS 3KQUA 1JFSA 4LJRA 3O82A 3GMIA 2G77B 3JS5A 3UAXA 3D6AA 2CWWA 1JR2A 1W0KA 2PGAA 2YWFA 1DRJA 3SS9X 1MGOA 2ANBA 4ND6A 2E1PA 2R6FA 3K9BA 3WYBA 1U0FA 4ACAA 4C0JA 1GUZA 3M6UA 3JWIA 2DOKA 3WMEA 1YVDA 4QPZA 1VMDA 4K5QA 1NA5A 1QF6A 2XPCA 5WRFA 4R81A 4AF6A 1EFPA 1UIMA 3WOVA 4EFMA 1ZFNA 4CXMA 5LMCA 4YR7A 5IC6A 2DKOA 1L7XA 4QVIA 1EWQA 3HJFA 1MT3A 4YUWA 2BGKA 1P74A 4RXMA 4CM4A 4IIBA 1N2EA 1Z0FA 2HMTA 1Q0QA 2AQKA 2FQXA 2FPPB 2C2OA 4JMLA 4NBKA 1TLTA 3H65A 4RY8A 1A0OA 3TIVA 4DCTA 3VZPA 5CYOA 1CZHA 1Z17A 1F9AA 1XEXA 2C94A 2D2EA 1OROA 2IZZA 3H11A 3GGCA 4IHJA 4Q24A 2H3EA 5EMKA 5JJ5A 5F3RA 1SOVA 1PDVA 1U7UA 1WULS 3ND6A 5AT1A 3DE5X 2KHZA 3P0IA 2WW8A 1MEOA 2H1IA 5JYBA 4FDMA 2BM0A 2HO5A 2GEFA 4IIVA 2YYAA 4EVQA 4O3MA 3HBAA 3E53A 1YS7A 3ADPA 4LFBB 1DOZA 1BE8A 2VAPA 4Z4EA 3THYB 1XLVA 3DAOA 3PCXA 1YBVA 2MTBA 1VI2A 4ECEA 4F3TA 1GEEA 1ZNZA 4AJJA 1YKSA 2Q3FA 3AOEC 2PWYA 3HRIA 4EDHA 2XQJA 3ZUGA 3MMZA 3KR0A 1P9NA 4DL9A 2JDIA 4MH0R 1E3QA 1H2FA 1O96A 1U6JA 3TRFA 2QL6A 4YJKA 3SIWA 2X6QA 5EP3A 2IP1A 2GK7A 4HWRA 4Q12A 2ZBGA 4DYVA 2EJVA 4F9FA 4AZSA 3GVXA 4KUHA 4LJ6A 1XTSA 3OD5A 3TPZA 5A71A 3EGXB 1E6UA 3IO5A 3UHFA 4JOCA 2QP4A 1SVIA 3KDAA 2FFBA 1I4WA 1PW5A 3RKSA 5CTJA 3G89A 1KDTA 4ZAFA 3VR5D 1HT3A 2AKYA 3DEJA 4G0PA 4KREA 4J75A 3SVTA 2GILA 4X1KA 4J0DA 3ZHSA 4QLBA 1MXFA 4JNCA 2J8ZA 1FLVA 1XD2A 1Y3HA 3AU8A 3KYJB 4H7FA 2QTFA 1W46A 2V7QA 3AUJB 5B1IA 4PX2A 2HCBA 4R0NA 1GZ4A 2YHAA 5MN5A 4IFEA 1WO8A 3RHTA 2R2GA 2PQ6A 1YGPA 3NAGA 1GAQA 4L1KA 2H16A 2XQKA 2HMYB 1GZVA 4F9EA 1WF6A 1MG5A 5IJAA 4J03A 3C3YA 1Q0RA 3PNSA 1AIPA 2VAMA 5LB4A 4FB5A 2YX1A 4DMLA 4PTYA 2JCXA 1YK0A 4F7DA 5A4IS 5K3EA 1F8YA 2H48A 3NRBA 2EF1A 5CJ2A 5FADA 4YRZA 1SPBS 1C41A 1PR2A 5BMVF 2QUIA 4BNMA 2UUBB 1ZXXA 4EUFA 1TYAE 2X0JA 1QHFA 2YQ5A 4DLAA 1LD3A 3OCYA 5F7XA 4DNQA 2FRXA 4CGYA 1YD7A 4CIXA 2VLBA 1WZ2A 5EN4A 1QR2A 1ZLYA 4G5RA 3S7ZA 1R0XA 1XLTC 2FOLA 2PU7A 4OHVA 2GVZC 1RWBA 2XOKD 4TMKA 2GRAA 3OT5A 4IIFA 5FBRB 3WK4A 3TZLA 5F1OA 1Z73A 4NAHA 3GWGA 4QRDA 1Y3AA 4MYDA 4QEZA 3VVCA 4G5XA 2P35A 4B31A 1L4UA 2G88A 4DM7A 3QLJA 1U81A 3OQJA 3P2YA 5EL0A 1ORDA 4V1CB 3SI7A 5JXJA 3PUVA 3GOHA 1ZH0A 5AKYA 3MGCA 3ORSA 5GP1A 4M6WA 1W75A 3I2YX 5DBIA 4PIPA 2DYKA 2VYNA 1YIAA 3GCDA 3H2KA 1Q12A 4LJ8A 3BFJA 1E66A 1Q91A 2Q99A 3CZQA 4G36A 4P0PB 3KFXA 1A69A 4OLJA 4QOJA 4WVLA 1ZAYA 1JI0A 1SUBA 2IYNA 3AC0A 2H11A 3BMQB 1P4SA 3OQVA 1C9MA 3HN7A 4X1OA 1EFPB 5BSUA 3VU1A 1XDDA 1QJ4A 3D0KA 3L82B 2JD1A 4NK5A 4D74A 1D03A 2GD1O 4J2TA 5CMLA 1N7IA 4I4TB 2BEJA 2VNKA 1QOQB 3PXGA 1E4OA 2DFDA 3NTLA 4I6EA 4PYIA 1CLEA 2HM7A 3EYWA 3WQQA 4D7AA 1WXHA 5KIAA 4KQGA 4DAEA 5MFPA 1FMCA 1X7YA 4G8JA 1Z2OX 4JT8A 4K8RB 1OX4B 4IHJB 1Y5NA 1XF1A 4DMCA 3RHZA 2GHQA 5J5AA 1JJFA 1GKYA 3L0IB 1II8A 2BISA 2D8MA 3ETGA 2CF5A 4IUYA 2QUKA 3BRWA 5JCOA 1DX4A 5IRCD 4JXKA 5EEGA 3MT0A 1X74A 2YOGA 1B14A 1JZSA 3H5WA 3IUJA 2B69A 2M9MA 4YXFA 3LU1A 2W6NA 2NLOA 5IP5A 1JB9A 3C6MA 4UUMA 2I65A 5EJ4A 2C4UA 4OK6A 4QBHA 5FTMA 3FCOA 1GZHB 1Z83A 1ZN9A 2FEXA 2Z83A 4O2AF 5HTOA 1QGDA 4AUMA 1Q77A 2GK3A 4MO2A 1HT0A 2PZAA 3D4BA 2JJQA 2BGGA 4M76B 2DHDA 4R8VA 3WWCA 3BQ9A 4JP2A 1NONA 4TYPA 1P8JA 4L5JA 1CUVA 4L3WA 2WM8A 2YMQA 3ZX5A 1DL5A 2NO4A 4UQLA 3B3QA 2BZ1A 3OX3A 2QTGA 4JBWA 4HDSB 5DGCA 2WJ6A 3QE4A 4OP2A 4RV5A 1ZONA 5SZHB 2GD6A 1NUPA 5G4KB 3P52A 4IP0A 4P4GA 3G17A 3HVUA 3Q11A 3M5DA 3RABA 3S2GA 4ZO6A 4ENRA 5JATA 1YDEA 1Z8NA 3PEYA 5LCXA 1UBEA 4YFVA 4E5DA 5IF3A 2QVBA 4DGSA 4XCQA 3ESQA 3PGVA 5GMOA 4DA4A 3AEKB 4KSCA 1AUXA 5HF8A 1CZOA 2AVNA 3WBFA 3RU7A 2HREA 3PIRA 4IRXA 4NNOA 1XXHA 3WGVA 4GGPA 1RAGA 1HYGA 3N59A 1EHYA 3NAQA 4L2IA 5KSYA 2V45A 4PC3A 1E2JA 3S44A 3TDNA 3FTFA 1RXEA 1R4NA 4M88A 3HGQA 3NHSA 4GOOD 4WWHA 5ALUA 2UZ0A 3K8QA 4IKOA 5DNDA 5IM4A 4O33A 3V48A 4YHBA 1H9CA 5K4AA 1ZI6A 2P6PA 1LRLA 1IBLB 3OP4A 5TARA 3P9QA 5JCOC 1P77A 4UQPA 4QEKA 3F46A 4MW7A 1JQ3A 5EUBA 4LF6B 3R7WA 2ZAIA 3G8CA 2GDJA 4LGMA 4TWJA 1E1CB 1LVUA 2YJ4A 4X94A 2DWPA 4KEAA 5C7OO 3SEQA 1SOAA 1T5LA 2QAGA 1PZEA 1M33A 1KI7A 2VDNB 2WFZA 3K9FC 4GOXA 3ZZUA 5LR6A 3KR9A 5F98A 1Y5IA 2X1LA 3OQIA 1JDBC 4EY8A 4WD3A 3ESRA 3MMNA 2QSYA 1SBYA 3QYAA 4ZU3A 5CEJA 3LRPA 4Q1DA 5LOVF 4Q4JA 4ALLA 9GPBA 1AHNA 3IVAA 3DTYA 4IICA 4LHZA 4M6WB 1U80A 2G7MC 3IIIA 2Y66A 2QTNA 4HI0E 1N8NA 5HIIA 3STWA 3ZNOA 4DV4B 1K0FA 4DIEA 2P7HA 3T1QA 1GKUB 1M0TA 1SCQA 5CDFA 3UUWA 2NUAA 4RV9A 3QEMA 3H7AA 4V3BA 4AO8A 1C80A 1T8TA 4OHWA 4RJ2A 5IAAA 3MHTA 3S27A 1FPMA 1AJEA 1W36C 1KSGA 3R8CA 3FY4A 1EH5A 4JJZA 5EI5A 3DHYA 1J1ZA 5KC8A 5HS4A 4G5OA 1CY2A 2P9QA 1SU8A 1LF5A 1N6KA 2PKCA 1AA9A 3GJ4A 2AR0A 1NHGA 4G56A 1G21A 1KY2A 2JGJA 1DKLA 2OD2A 3S1LA 2V6GA 4DVGA 4JLKA 2QSJA 2WJAA 3NB0A 1N3IA 5B55A 4Y6PA 1ORRA 1EQ2A 4BVHA 7MDHA 3DVSX 3PWZA 2DHEA 4RWEA 3ZVLA 1X7YB 3MT7A 3EF0A 4E2FA 1USGA 4D41A 6CHYA 4QO8A 1OLSA 1E2DA 1II8B 3EHEA 5FPPA 4QFDA 1O94A 2VZEA 1X38A 3ELBA 4MV8A 4BMSA 4Q1AA 1E7MA 3IHTA 4UU0A 4YB8A 5ALDA 4DCJA 3UJ7A 3EXG2 5EQFA 1R16A 3ECAA 3F3MA 1X7XA 2AWNA 4YLEA 2OCPA 4QKQA 2QTWB 5TF4A 3BB3A 2YDYA 3WLRA 1D2CA 2PSJA 1U2SA 2GS9A 4IGAA 3WNZA 1L9KA 3N8HA 5ETJA 1Q1AA 2WOJA 2GN8A 4KAFA 1Z9BA 1SCUB 1IK4A 2CJPA 3IBCA 5BQOA 2AN3A 2ZS9A 3DVAB 5F77A 1KOFA 3TRDA 2FSSA 2JARA 3QVLA 4FFOA 2WT9A 4LX8A 1HX7A 3P5BA 1OZHA 2C2GA 3D8NA 4NMMA 5CDGA 3HA5A 4IOMA 4OB8A 2PQ0A 3TR5A 4EI7A 1WAMA 3C3AA 5FQOA 5E2BA 3LP6A 4HUQB 3UPDA 3KYCB 3NTQA 4PZLA 1JQAA 2IHVA 2JI9A 5DP2A 1JIQA 4A6DA 1PKEA 1J33A 2ATEA 2H54A 4C4XA 3B85A 4QYTA 2MINA 1WX1A 1UWCA 4WERA 3VMFA