2ZI4A

C4s dck variant of dck in complex with l-da+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 228
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi4A00
1NI3A 4DUGD 2W6ID 3X2SA 1KDOA 3SJZA 5BXQC 2WSSA 1II0A 1XJQA 3RRNA 3BS4A 4BLSA 4HI0E 1GVNB 1J90A 4PC2A 4LBVA 3W8NA 3K9NA 2HT1A 3CRMA 4LDJA 4LI0A 4P31A 1G7CA 4DCSA 1NP6A 3B78A 1YZLA 2RKOA 1XD8A 3B1YA 1Z08A 1N5IA 4HSEA 3AQ4A 1XMJA 2C99A 5FOUA 4G5GA 1KI6B 3HU2A 5EE1A 4B73A 2CJWA 3KTAA 1OXSC 4BFSA 4RZ3A 4UXIA 1XMSA 3N70A 4NYIQ 1X1RA 4LJ9A 1PVOA 5FOTA 1CJMA 2PCJA 3NTUA 2R2AA 2ZJ5A 2PJZA 3U7GA 4UNNA 4L15A 4R2HA 4GMXA 3AM1A 2OAQ1 5K8IA 1Z6TA 5KOYA 1KZ7B 4F91B 2IC5A 1EFRD 1G7RA 4LPKA 4LYJA 3ZLJA 1DG1G 5BW8A 5HCNA 1SVKA 5FPKA 2ORIA 2JLVA 1RE0A 1YKSA 4LJ6A 1OXUA 3TKLA 1KO5A 1G3MA 3VX3A 1MT0A 3V9PA 2JJ1A 4ZIRA 4MGYR 4F93B 3KQKA 1E2EA 1OXXK 1SKQA 2FPKA 1XZPA 1B23P 2PMKA 1EFHA 1G3UA 2ZI9A 4OK6A 5SZHB 3VMFA 3ADDA 2REBA 4BFZA 4PQYA 2QAJA 3MMPA 3U4QB 3LBIA 2V6IA 1YU9A 1OV4A 2JLZA 1GL6A 3CWZA 2DY1A 3K53A 3OESA 3K0AB 4Q9JA 5JWRA 1GOTA 1KK3A 3WP1B 3OZXA 2FSIA 4K81B 1E9FA 4QOSA 4DZZA 3U6BA 2E1RA 1JAHA 4M9ZA 3BOSA 2MSCB 4BFYA 4FWTA 1MABA 4ZI3A 1N6HA 2WHXA 4TLDA 4B32A 3K0FA 2JLSA 2ZE8A 4D0GA 1G8GA 2N46A 4BLQA 1GRQA 3QVUA 3TR5A 3IBYA 4GI7A 2IS6A 1N6NA 4KHZA 3THOA 1M74A 3N5CA 2XEXA 1E3MA 3TUZC 4TTRA 1SXJC 1V43A 4Z54A 4XH9B 1E2NA 4G3XA 1Z0AA 3A4MA 3CR7A 2WJYA 4LJAA 3W5IA 6Q21A 4D82A 3NHBA 5CK4A 1FOEB 2OO7A 2PEYA 2ZANA 2QEQA 1NIJA 2GJSA 1Q1EA 2HJGA 2CJWB 2W6JD 3KTAB 1DAKA 3ND9A 5K8TA 3AVYA 3F3YA 2X19A 4NH0A 4IDHA 2F1IA 4A0HA 3B1WA 4Q4JA 4A2QA 3R9IA 3OE7D 3EZ2A 2XOKD 2UZ3A 2V4ZA 3A37A 4GBMA 3QF4A 3R20A 2XXAA 4Z1MD 4UJ3A 3DZ8A 4PZZA 3W3ZB 4BRUA 3Q7PA 2IYXA 2J0SA 3D7MA 4D81A 1E1RD 3Q7QA 4NU0A 1R8SA 2IYQA 3HWSA 3JVVA 2GEUA 4TSFD 4TYNA 5AJWA 2WJJA 2ZRHA 4B43A 2F1JA 5AJZA 4ZIRB 2B92A 1JXOA 2R44A 3WY9A 4U02A 4OI4A 2FMXA 5EP4A 2ZRBA 4TT3D 3RLFA 3VNUA 3UATA 2NZ8A 3RRZA 3GLGA 2IYLD 4P0TA 4IDPA 3L82B 1MO3A 5EE5B 1CR2A 3CO5A 2R6GA 1E98A 2J45A 5G3YA 3ZIAD 5KPDA 4OHYA 3MRSA 4KFTA 3BE4A 3ZZUA 1N6LA 2BMDA 5FPTA 2AXNA 3KX2A 4NYIR 2FEMA 2F9LA 2F43B 1MABB 2C03A 4F7WA 4EIWA 4A15A 1N3BA 4Q5IA 4B44A 1XPRA 2BMEA 3K0FB 2ZRNA 3LBNA 4M21A 1Z5ZA 4NYJR 2ZS9A 3RNLA 1E0KA 1DAEA 1KI8A 4LX0A 5J4YA 1UM8A 4TWZA 2OEPA 2DR3A 2BV3A 2CMKA 4WBSA 4CEHA 4IVPA 4M1KA 2GTPA 3AF1A 4QC2A 2W58A 2FNAA 3U7HB 2ZE7A 3SC3A 1XPOA 2ZROA 4RZUA 4TMVA 3L0PA 4W9MC 3MD0A 4LJ8A 3L8ZA 1ZIOA 2WPDD 1FMJA 4B3DA 3U3KA 4EJSA 3LFUA 2X2EA 1OLOA 1KAGA 1QF9A 1IAQA 2R8RA 3IEVA 1LW7A 2GAAA 1SHKA 2J59A 3OFND 1U98A 2ZRLA 1P2UA 1KKMA 4Q4JB 4DCUA 5L8VA 3UXMA 1X1SA 2V1XA 4KAXA 2VA8A 1R2QA 1CR0A 4DCNA 3DVLA 3QF4B 4BLPA 2AD1A 4A1FA 2XXAB 4TL7A 1ZM3A 4RKFA 4PXAA 2BCJQ 2GXUA 1TQ6A 1UKEA 2FFAA 1E94E 3AVPA 1X8KA 1LF0A 1U9IA 1ZAKA 1FUKA 3IO5A 2NG1A 4FCTA 3U5ZB 4LHZA 4RFSA 4ZDJA 1U99A 1OH8A 2FF7A 4IW3B 2ZI5A 4W5HA 4R98A 2GCPA 3IIKA 4WZ6A 5JJLA 1T9HA 2IT1A 2AFHE 3WRYC 2J1LA 1YR9A 2WICA 2VTKA 4P4TA 3FE2A 3H2YA 3V4FA 1XEXA 3GLGB 2PEZA 2J0QA 1JR3E 3EZ9A 3FKQA 1F6BA 4HB4A 2VHCA 4C4PA 1QDEA 3QEOA 1ZUIA 4EQ6B 2GK7A 2WKRA 3SYLA 2EU8A 2IXGA 2ZUCA 4EFNA 3VKHA 1T5LA 2NO9A 1FW6A 2Z5FA 2GBLC 3RC3A 5J47A 1N0VC 3MGCA 5FUYA 1KI9A 1D6JA 2IWRA 4KSCA 3TH5A 4IEEA 3W3AA 3EA0A 3MAAC 1XEWX 4ERNA 5IK2D 1CP2A 4XJXA 1M7HA 2JDID 2ZTSA 2I4IA 3QEJA 1X3SA 3FMOB 2CHQA 3QENA 4V02A 3ADBA 2KWIA 2ZUBA 1OH7A 4L8GA 4CW7A 4UNPA 1WMSA 2W00A 1OHHA 2VO1A 4S2EA 2MSDB 4JS0A 3LW8A 5LD2B 4NTZA 3ZYCA 2ODBA 3AVVA 1XCGB 1T3LA 5LBIA 2OT3B 2Q3HA 5HE9A 4YDHB 4DCVA 2F1HA 4EJSB 2RGNC 2GVZC 2P3SA 1R0YA 4A8JA 4QRHA 5E4FA 4B2PA 1R5NA 4Q9HA 2BKEA 1TQ2A 1J7KA 1ZJ6A 1UKVY 1UKZA 1AIPA 1A2BA 4FCWA 5CDFE 4WZBE 2J41A 4XVRA 3B9PA 2IX3A 1IJFA 4QM6A 4KBGA 1P7CA 1XX6A 2ZM5A 2ATXA 2XITA 4JVNA 2BM1A 3BFVA 1GNRA 2IYVA 2PX0A 5ELXA 2YOGA 2Z4SA 2MMGA 4C0QC 4RFSB 5BWMA 3VFDA 5JRJA 3DO6A 3TIFA 2HCJB 5D3QA 3ASZA 2J87A 2RGAA 2FE4A 1QZXA 4PPGA 3NC0C 5FFMA 2FA9A 2ZS8A 1ZVQA 1VCIA 1Y63A 2GDJA 3MFYA 1ANKA 4HDQB 3LLMA 3AVUA 4LV5B 1NY5A 1J99A 2C96A 4IOJA 2OBNA 1JPJA 4ZDKA 3PUYA 3K0EA 1YJ5A 1HY3A 4M1MA 4FCVA 5JJKA 1G19A 3SYNA 1TUEA 1E9AA 3FOZA 4FN5A 4V0MA 2GA8A 2DFTA 1E79A 2RCNA 1YRBA 1GM5A 4HLDA 1SXJE 2X77A 3A1UA 3GFPA 1NLFA 2GJ8A 5G53C 2O0HA 1E2KA 1H8HA 1RIFA 3PCRB 4CRWB 4K8OA 2ANBA 4RD3A 1EWQA 1CRPA 4E5UA 3E70C 3TW8B 2FG5A 3FMFA 1R0WA 5JRZA 1SULA 4CEIA 1Q22A 4OQMA 1KI7A 4M1SA 5FR2A 4HLQB 2WMOB 3BB1A 1S0UA 4URZR 3SBEA 4C0LA 4F4JA 4MKFA 2RGEA 3LV8A 5JFGA 4M9SA 1G8FA 3PEYA 4OQFA 4MRPA 1D2EA 2YOFA 3DHWC 1L2TA 4PX9A 4HZUA 3HR7A 4A8JB 4ZKEA 1P73A 1DG3A 3H86A 1BYUA 3H1TA 2O8DB 5KUTA 4LPSA 3T5DA 4X8OA 4B33A 2GJ9A 3OIWA 3BXZA 4OHWA 1T5IA 4GSYA 1TAGA 4AKHA 4PC1A 4EKDA 2FPMA 5EXSA 4C3ZA 1TQ4A 2GRJA 2BEJA 2YV5A 2XNDA 2XSZA 3D6TB 4DVGA 4B76A 4TYQA 3AV0B 3IILA 4A2WA 3CIOA 2ZJ8A 3LXRA 3CNNA 3AGQA 3P20A 4JLJA 4LK2A 3QPUA 3B8HA 5JLJA 4LBWA 3DZDA 4RFVA 1VG0B 4G0NA 4UXHA 3ICQB 3GEHA 2AN9A 4ZV4A 3B5JA 2ZPTX 2IF0A 3BFKA 4DJTA 1FZQA 4X8LA 1MR3F 1KO7A 1R0ZA 1OF1A 5LD2C 2BCGY 1U0LA 4UNQA 2JGNA 1XTRA 3DPUA 1ZNYA 3QF7A 3ICEA 1BO6A 3IKJA 5KTYA 4PAQA 2Z43A 4EJSC 1NJFA 4PANA 2IS2A 2PT7A 1PV4A 1BKDR 3EZFA 2ZVPX 3CNLA 3NBXX 4QG7A 5DN6D 5CJ2A 3NKVA 3AH8A 4ZCLA 1WBDA 2Y8EA 4KYUA 1EG7A 1VIYA 2XJ9A 1YZNA 2A9KA 5FR1A 2OCPA 3WNCA 1N6RA 1UJ2A 2W2VA 4B35A 3ZZTA 1JEEA 1G8HA 4B3GA 2NPIA 4TYWA 4CEIB 4DSTA 3U7EB 4YDSA 5E95A 2IUUA 5IRCD 1OW3B 5AUPB 1AJEA 3FHTA 1AKEA 1OKKA 1R4AA 3RAPR 2PCLA 1OFIA 2JJ8A 1DVRA 4PHTA 4TN1A 1KAOA 3O8BA 1GSIA 3G5UA 1EK0A 3OEHA 821PA 4AKIA 1GIAA 3AP2A 1ZNZA 1UDWA 2FZLA 3R7WA 4OHVA 5IT5A 4H9GA 3T1QA 4TLCA 5JZVA 5CYOA 4JKIA 1HA3A 2J46A 1NJGA 1OIXA 3GJ3A 3NHAA 4R71A 1KMHA 1CJUC 3I5XA 3K1JA 5BN4A 3U60B 2XB2A 5JEEA 3SQWA 3OEED 1HT1E 2WZQA 3O8DA 4OKSA 5FBWB 1GUAA 3THXA 4FW9A 4US0R 4DSNA 3C7KA 5TXGA 1Z63A 2WAXA 4JT4A 2O8CA 3FHCB 2J7KA 4IOLA 3IO3A 3W5JA 4HAWA 4BFVA 3QKUA 4HEJA 1LTQA 3TQFA 1W4AA 5EE9A 4PAMA 2YZ2A 2AD5A 2QGNA 1VECA 3F8TA 3UMSA 2RAPA 3SQXA 1M2OB 3M4YA 4H1UA 4JL6A 1N6IA 1QHSA 2LWIA 2A30A 2CNWD 5H68A 4DLWA 1XCMA 3TAUA 4EPXA 1W0JA 1F3OA 1AS2A 1N6OA 2IW3A 5J5CA 4N1AA 5A5GA 1W4RA 2F7SA 5C4GB 5E3HA 3CW2A 3LQRA 2SHKA 2D62A 2ZRFA 1P9RA 4OQLA 4WVFA 1CXZA 1E1QD 3RHFA 4L4UA 1NBME 3RDPA 3UMRA 2FJUA 2ERYA 2JIZA 3HDTA 2JLXA 5B57C 2C78A 1LB1B 3QKRA 3LAWA 4FMDB 5DHAA 3TVTA 121PA 3BJIC 3M1IA 2QAGC 3SZRA 1E2LA 2LKCA 1L8QA 2OESA 4NMMA 4MRSA 2YINC 1GG2A 4YXWA 2ZJBA 2QTHA 2QTVB 1UAAA 3PUWA 3LXXA 2QG6A 3ND8A 4DLYA 5GADl 2BHRA 1FP7A 4M1YA 1DO0A 2EFGA 4JLOA 2ZIAA 3PG5A 2AR7A 1DADA 4I1VA 1NN5A 4GNKA 1LF5A 2DFLA 4I4LA 1DOAA 1AA9A 1ZNWA 2OBLA 3ZJYA 3KQNA 1I4LD 4GZMA 1KDRA 5EUQB 1CU1A 3GEEA 3ZS9A 4IXMA 4FI3C 2W83A 1S1CA 1DPFA 3BRWD 3EX7C 1T0JB 5C2JB 3EG5A 5JCPA 1KMHB 1OH5A 1VHLA 3B1VA 2QU8A 1P61B 1P6XA 5P21A 1CJVC 1FX0A 4LYAA 3RS0A 4XTCS 1KI6A 2O8CB 2F55A 3FMPB 1WE2A 1GL7A 1ZM4A 2ODNA 2EQBA 1MO4A 1Z2AA 1AM4D 4LJ4A 4WA7A 3WYAA 1J8MF 1FNNA 5JECA 3C14C 4O3MA 3KKQA 3DM9B 3FB4A 5DGXA 3TW4A 2O0KA 5JI2E 2A78A 4NCNA 3P32A 3EWAA 3TMKA 1XF9A 1P2TA 3LVQE 2Q9BA 1GKIA 1P2VA 2X1VA 521PA 3GLIA 2VP0A 1T3HA 2OFXA 2ZI4A 1W48A 1DARA 2PZGA 4URYR 1ESMA 1KIMA 4CT5A 1Q1BA 4HDCA 4EPWA 1KSFX 4V0LA 1N0UA 1G4UR 2FU5C 3VR6A 3EIEA 4QBFA 3KQLA 4AI6A 1W36C 5H1YA 3CF2A 1OB5A 1GP2A 2CHGA 3EZ7A 4FMDF 1CULC 3A1WA 1CTQA 3QKRB 1QRAA 2W2XA 3TR0A 2RHMA 2XTMA 2BOVA 5E7JA 4PQFA 3GLGE 5GJBA 3VKWA 4MUBA 5JHHB 2WKQA 1IN6A 1E4YA 2IK8A 4QHTA 2D74A 5SZJA 2ONKA 3WP0A 4AC9A 4DSUA 3Q5DA 1E9DA 4UNSA 1OE0A 3RWOA 1W36B 4PO8A 3HP1A 4II7A 1D5CA 4JL5A 5FTMA 2QBYA 4W7SA 5KYKA 2ZRAA 3R9XA 4Q9KA 3HU3A 4KFRA 5EXPA 1FMLA 3NEYA 4B3BA 1EESA 2JCSA 2RGCA 1UEIA 1HV8A 4Z8XA 1Z0FA 1II8A 1I2MA 3RS7A 3GJXC 1HQCA 1US8A 2GWHA 3QKSA 4NP6A 5L3RA 4PO9A 4PSAA 3IIJA 1FX0B 2BM0A 3GJ7A 3PVSA 3WRXC 3JZMA 2F6RA 4EDHA 5TARA 3FVQA 2YWEA 4FIDA 2QQEA 1Q1QA 4URVR 3RRMA 1KO4A 1E9EA 1OJLA 2IXFA 4MUAA 3SDZA 3SHFA 1KSJA 4MYUA 1QG2A 2PH1A 1YR8A 4Q48A 2GBLA 4F4CA 4JLBA 3I8SA 3LWNA 2VP2A 3T1TA 2VRWA 2CL6X 3HPQA 4DHEA 1T0HB 3FFAA 4W5WA 2CK3A 4JZKA 4URUR 2HT6A 4NYJQ 4MGZR 4US2R 2FWRA 2WSMA 2QPTA 4JL8A 1JBKA 4NKRA 2NZJA 4DWJA 3CPJB 3GLIB 3CBQA 1EFCA 1NBMA 1W7AA 4KCGA 3G82C 4Q18A 2ZJ2A 1NG9A 2OE2A 4CGZA 1BMFA 1NRJB 1XNJA 5HR5A 1N2CE 2RGNA 2W0SA 3IPYA 3V4RA 1KI4A 3BB4A 4L16A 1PLKA 4B74A 3SYKA 4HUTA 2ANCA 1N6PA 2WWWA 4PSVA 2CLCX 2J5XA 4DIDA 1P2SA 1OH6A 3AVXA 3AVQA 3KKNA 1PZNA 1EFRA 4GP7A 5CJPA 3LO5A 2J9RA 1D2MA 3CX8A 3HYRA 5FL3A 2QTFA 4KFSA 3IDQA 1H8EA 4OI1A 3MCAA 2F43A 4Q19A 2QBYB 3QVVA 1WB9A 2ZR9A 5CB6A 2BWJA 1G5PA 1E9BA 2GZDA 1L4UA 3DDCA 2EFCB 4B6EA 4LYHA 4TTQA 2HUPA 1Z0JA 2ECKA 4N0DA 3VX4A 2QORA 1Z83A 1VCNA 1II8B 1YQTA 2XNSA 3MG9A 3UIEA 1NF3A 4KSBA 1W49A 3K70D 4L5BA 1ETUA 1US8B 4WAUA 3QKSB 4S35A 4RVCA 1G3QA 4D4LA 2ZSDA 2ZRCA 3NH9A 1AKYA 2C5LA 1K5DA 1VCMA 2OXCA 3FFBA 3TRFA 4HAXA 3O8RA 3EAQA 3JVUA 1AK2A 4PZYA 1N5JA 1GNQA 3CH4B 2G88A 4MA4A 2PZEA 2C95A 1DS6A 1Z2CA 2VSFA 1JR6A 1D9ZA 4RD2A 1FP6A 3I72A 5EXTA 2QY9A 1GTVA 3CZPA 3WHKA 2HLDD 2OUKA 4B2IA 5B30A 4F92B 3FKSD 5AJXA 3ZS8A 2ODWA 2R6CA 2JASA 3VU9A 4ITRC 5JSZA 4Q4AA 4DDVA 5J40A 4TQUS 2W2TA 2F1RA 1O87A 5C46F 3FHOA 5FI0B 2G6BA 3I4LA 3QBTA 4M1OA 5CIWA 5DHFA 1W4BA 2IYUA 4BE7B 4PPFA 4XD7A 4MYTA 5SZKB 5K8UA 4Q9LA 4DEXA 1Q1ZA 2W6JA 2IEZA 2HJVA 1KDTA 3SFVA 3GP8A 2ZSAA 5KDDA 2QSYA 4TZ6A 2ZRJA 4DDTA 4M9QA 1FFHA 1FTNA 3AKYA 1AZTA 3SOPA 3QXCA 2XOKA 4EQ6A 5EZ6B 4FXPA 2AFIE 2H18A 2P6NA 3KJHA 4MQBA 3CF6R 421PA 1A1VA 4Q4HA 2BVNA 3R7WB 1CS4C 2IYSA 1VYVA 2WKPA 3K0CC 4LHYA 4R2IA 3T5GA 4V0ME 4TSFA 1DE0A 1E9SA 2ZRKA 4Q7JB 2HDNB 4OJQA 1XJCA 3C5CA 5DSZA 2G1JA 4TT3A 4BEBA 1JJ7A 4Q9IA 2OILA 2VLIA 1Z29A 2QPOA 1ZINA 3BERA 2NPFA 1XTJA 3A6PC 2VF8A 3NDPA 4M8NE 3SI7A 4J0QA 3U3JA 3ZIAA 5HZKA 3S1AA 2DWQA 1C9KA 1D8TA 4HZIA 4C2TA 4HB2A 4O25A 3PEUA 1R7RA 2KSQA 1XTSA 2V1UA 5CB8A 4D25A 2FZ4A 3HYTA 2WWFA 2A5GA 5EXXA 1YHNA 4G5RA 4Q4LA 4RZXA 1W5SA 1WCV1 5G3ZA 1RC8A 1ZMXA 3CM0A 2C9YA 3GLFB 2J7PD 1XD2B 2VYFA 1LV7A 5JCZA 3TSOA 221PA 4IDNA 4D80A 2BBSA 1Z6AA 3OIUA 3KZ1E 4A36A 1CR4A 1ZNXA 4MKHA 2WWIA 3SJAA 2GXSA 3VU9B 4EFMA 2IF2A 5JSZB 5BN3A 3THYA 2D4HA 4Q4AB 4CYMA 1TADA 3PUZA 2D06A 3PEWA 4BPBA 1CEEA 5FTKA 2V3CC 2AK2A 4ABYA 2P5TB 1OT3A 2WPDA 5GVRA 1NL3A 1K6MA 2AKYA 1T3SA 2YWGA 1RRGA 1W47A 2CLDX 1RJ9A 5F98A 3H4MA 2FH5B 3AKEA 1VMAA 1QHXA 3OFNA 1UF9A 4CT4B 5AUOB 4RD1A 4DT1A 2EVWX 4LRWA 1CKEA 2GK6A 2NO6A 3SS8A 3T15A 1X6VA 1IXSB 3GJ4A 4TMZA 1G8PA 4EPYA 1UPTA 3DKVA 4TMWA 5CM9C 4D4JA 4Q4HB 4BUJA 5BN5A 5HZHA 1JPNA 4EAQA 5FUVA 1ZC3A 1HE8B 2CCKA 4MDEA 2QE7A 3RABA 4ZCMA 3LNCA 2ZSFA 3WYGA 3RYTC 1HH4A 2R62A 5B64A 3UPUA 2WOJA 2OV2A 4GRAA 2FN4A 4YMUA 1ZW6A 5CLLA 1W44A 4AG5A 3EIQA 5CITA 1E2FA 4M9XA 2YNMA 3C16C 2JA1A 1Z47A 1E32A 1RFLA 4F4IA 3CONA 3EPKA 2BKUA 3QXJA 1G6OA 4DDUA 3OAAA 4LBYA 2G9NA 2DWPA 1S8FA 3FTQA 2WVJA 4XTRA 3T1OA 3S1AB 2N42A 2GXQA 5F3WB 3B13B 1SVWA 3SBDA 2O8DA 5DYIA 3RANA 3BWDD 4OBEA 4JJKA 1IQPA 4E07A 3FYHA 3C5HA 3RSOA 4BFUA 3FDIA 4TL9A 1JJVA 1TX4B 1KSGA 4PQRA 2JDIA 3PJRA 5J4LA 1QHGA 3WHLA 2YOHA 2GVDC 2QAGA 2GNOA 4JLPA 4Q21A 1Y3AA 2ZE5A 3CKLA 3LH5A 3I1FA 3Q85A 3THYB 4G1UC 1G5RA 2ZAOA 2O8EA 1KHTA 2G0NA 5BQ5A 1T8UA 1LY1A 3Q9LA 1KI1A 3CNOA 2OXRA 1F48A 3AF4A 3QBVA 1NIPA 2CL7X 3ADKA 5E7MA 3THWB 2V7QD 2FOLA 1RJ9B 4AY2A 1NSTA 2I1VB 2VHQA 2WWXA 2ODEA 3B82A 3AVTA 4TYYA 3EXAA 3EZ6A 1U81A 1U0HC 3NBFA 4AKEA 1UBGA 2ZS7A 1Z0KA 3BK7A 4DT1B 4KVGA 1P4SA 4MRVA 4XVQA 2QP9X 4ZO4A 2IWHA 5L3VA 4NONA 4B75A 1HE1C 4M53A 3C8UA 4XVUA 3PR1A 4KITB 2D2EA 1KY2A 3AP1A 3QXSA 2GXAA 2CE7A 2DFKB 4NCHA 3CRQA 1RYFA 2WWGA 4I1SA 4OI0A 1CLUA 2Q0HA 2QENA 1Z28A 3AVOA 3MWYW 3I32A 2OBMA 4OYHA 4NYMQ 3KB2A 1GL9B 2DFNA 4RSGA 3TSZA 3K70C 4PTLA 5FOXA 4A0FA 4CDGA 2C9OA 2XX3A 2E87A 4I1UA 4ZI2A 2ZYTX 3ZVNA 2HYDA 1JAIA 1IBRA 3UG6A 2H17A 3NXSA 3LX8A 5JHGB 1E69A 2D7DA 5KSPA 1IY1A 2R6DA 3MWJA 3D31A 4A4DA 2B8TA 1GDDA 5DI9A 1Z07A 2Q3FA 1R0XA 5JMTA 2JLYA 5EJEA 1DTSA 1IHUA 3ZQJA 1U8YA 1DBSA 4U7DA 1FPMA 2RB4A 4Q1BA 3QJYA 2JJ2D 2WAYA 5FOSA 1KSHA 3KUDA 2NGRA 3SNHA 2G1KA 4Y0VA 1TF5A 1XWIA 2QAGB 5SZIA 2QI9C 4F38A 3CRRA 3L2OB 2X8AA 2C04A 3DKPA 3NH6A 1W0KD 1JR3D 4LYFA 5D3MA 4ACAA 1C4OA 1WDTA 2BJVA 2H57A 4D4KA 3ZZ0A 4BLOA 1HUQA 1FUUA 2O8EB 1R6BX 1G6HA 3NEJA 3LY5A 1KOFA 4U5XA 2O8BB 2IHYA 4X8MA 1WQ1R 4RKEA 1U8ZA 4D2IA 2YWFA 3C41J 1PLJA 2UKDA 5H8WA 4GDFA 1J8YF 4M1WA 4NCIA 1G41A 2DPXA 4QGHA 5BYKA 4RJLA 2VSOA 4PHFA 4TLEA 4PHHA 1F60A 3IHWA 5LB4A 5C1BA 2GETA 5KDOA 1KZGB 3U7FB 2FV8A 4H1VA 5HKKD 1K5GA 1D9XA 2VP4A 1SQ5A 4QBIA 3GLIE 1NG1A 1TU3A 3EIHA 2CL0X 1Q20A 3SE0A 3R9WA 4ACBA 2NTYC 2WWHA 4C0JA 1ZU4A 2H7VA 4DKXA 4HDOB 4ASUA 2IXEA 1IM2A 2ZYVX 4KJZA 1Q12A 2EYUA 3TQCA 3UK6A 3AGPA 2GCOA 5FOWA 5KPJA 1IN7A 1GAJA 2P0EA 2XZPA 3PEVA 4P4SB 1W4CA 2Q9AA 1XU4A 5L3SA 2LKDA 4QXAA 1PLLA 3VAAA 3OEHD 1WF3A 4P33A 1PUIA 3K09A 3PFIA 4NDZA 3RS4A 1G4AE 1R8QA 4IEIA 3EW9A 4LUCA 4QGGA 1EWRA 3P27A 4UNRA 2QL6A 5DN6A 1F5NA 3EPHA 4MKIA 3M0EA 1NMYA 2NQ2C 4V0KA 3GCGA 4QM7A 3UANA 1E0JA 2DHRA 1UBFA 4HAUA 4CF7A 1D2NA 1G1MA 2AXPA 4W5JA 1QVRA 3SJBA 3EPLA 2YWHA 2B21A 2QN6A 3W9YA 1SGWA 4G5QA 3PXGA 4A92A 1XBTA 3T35A 1UEJA 2HF9A 4B3XA 3K9LA 4HAYA 2NO1A 3FMIA 5AK0A 3R8CA 5D3MB 1G8YA 3U44A 1LVGA 1MKYA 2YYZA 4R7ZA 2BEKA 4RD0A 5FPSA 1UKYA 5JI3E 2V54A 3KXIA 4BASA 4NYMR 3IBGA 4JT2A 1OIWA 5FUXA 4RD6A 1WRBA 1I2DA 2VL7A 4TLAA 2QROA 3UWKA 1AQUA 5KO2A 1SXJD 4LSGA 4AKGA 4B34A 3MJHA 1NVXQ 5TDHA 3X1YA 3QXHA 2TMKA 1R5BA 2ZAMA 1Z6YA 4JYBA 2YC2C 3KDSE 2WJIA 5DO9A 3OEEA 2AK3A 2ZYUX 3ADCA 2KJQA 1N0WA 3EC1A 1RRFA 4FMCB 4A9AA 4MYHA 4TMTA 3B6EA 4JLMA 1E9RA 3K9HA 2ZE6A 1BIFA 1OYYA 3C15C 4KU4A 3KJEA 1QG4A 5DIFA 1A4RA 1KMQA 3SN6A 3IEUA 1OFUX 1G21E 4E09A 2VHTA 2A5DA 4LJYA 3GJ6A 4BFTA 2FGKA 3PIRA 4ZDWA 2GCOB 3W90A 3A1SA 2XTZA 3GMTA 4C2UA 3KKPA 1U2RA 4HAZA 2P5SA 4PAOA 3WYFA 1VG9B 1S96A 5L3SB 4BQSA 3U3RA 2CNWA 2GZAA 1KKLA 2EYQA 1C1YA 3L0OA 1TQDA 4OI2A 3QY0A 1LNZA 3CR8A 4P4UA 1HQYE 1BOFA 1M34E 2V55B 4KI0A 3H0KA 3ZVMA 4YMVA 1XXHA 4TQ9A 4LHXA 2CBZA 4LJ7A 1F2UA 4PHGA 1E1QA 1TUIA 1GNPA 4KV9A 1Z0DA 4LZZA 1KO8A 1X8JA 1JALA 4IFBA 1KK0A 4QL3A 2DBYA 3W6PA 2ZI6A 3L8YA 2R6AA 2IHBA 3BH6A 3FPAA 4Q03A 4Q66C 2W0MA 3RSLA 3VR3A 2ZSBA 4QHYA 4EUNA 4UJ5A 4IDOA 1UADA 3CF0A 3ZH9B 5EP3A 4G01B 2R9VA 1I4TD 4TL6A 4BECA 3OIYA 2MMCA 2Q6TA 1MOZA 2HV8A 5GJWC 3WNBA 2FDCA 1U8AA 2IUSA 3LA6A 5F9HA 4JLKA 1I4DD 3B1ZA 3QPVA 4IJMA 4OL0A 4O0MA 3U44B 4RCZA 2WJHA 3QG5A 5FUWA 3SHWA 3CRVA 3I3SR 4IXNA 4EPTA 1P72A 3K0CA 2FSHA 2OSBA 1KJZA 5HPYB 2ONJA 2JEOA 4XOIA 3QXXA 1ODFA 1TEXA 3EWSA 2RGGA 5FTNA 3GLFE 4QKQA 4Q47A 2WM9B 3ETLA 1ZM7A 2IYWA 2KB0A 3TGPA 3A1VA 5BYJA 4D0LB 3NBZC 1GRRA 1EFUA 5EE0A 621PA 1ZBDA 1E99A 1XTIA 3BH7A 1PJRA 4FMCF 1AQYA 1KGDA 2H5EA 3CB4A 4NZYA 1VG8A 2P2LA 5KSYA 3GJ0A 3I73A 2ZR7A 4GL2A 3QKTA 4NCJA 3TVDA 5FBRB 4KODA 1Z22A 2GHIA 2OM2A 5DNYB 3QG1A 4CVNA 2Z0MA 2ZUDA 2VH5R 3A4LA 5H70A 1P9WA 4Q7KA 1G7TA 3B2EA 1W2GA 4IOKA 4LHVA 2G77B 3VR4A 1GRNA 5EP1A 4LC1A 2B7CA 1TNDA 1RW4A 4LGMA 4GP6A 3T06B 1T4GA 2WSSD 5A4JA 1COWA 3RC8A 5FL7A 3ZQ6A 1FNMA 1YVDA 5FBLB 1KNXA 3CX6A 1XXHB 4EFLA 4YLGA 5JJIA 1QBKC 4QBGB 2IYRA 3REFA 4B6FA 2XGJA 2HXSA 4JYCA 5FTJA 1F2UB 2O8FA 4BZPA 2C9CA 1XEWY 3DEFA 1EXMA 3U3MA 3AF3A 1DO2A 3SR0A 4BWYA 2ORWA 3NG1A 3P4YA 4LJ5A 1QHIA 1W2HA 2I1QA 4B3FX 2BIFA 3TJZA 1NSFA 1U0JA 4V03A 2BBWA 4FMBB 4OK5A 2CXXA 3A58B 4JMPA 3NIBA 3CPEA 1XZQA 1ZP6A 2PT5A 3QI2A 4IHQA 4JSTA 2CK3D 3RS3A 8OHMA 1KJYA 1B0UA 1EX7A 3QQ5A 2L0XA 5KDLA 1UBCA 3HR8A 4DUGA 2W6IA 1AS0A 4TYPA 2IS1A 2J0UA 4JBYA 2B7BA 1ZUNB 1KDPA 1NBMD 2WIAA 3M6AA 2ZU6A 1SVSA 3K09C 3N2IA 3QOFA 2PLFA 5TB5A 1OIVA 3X1XA 2JJ1D 3KJGA 1YZQA 4FD2A 1E2HA 4G5SA 1G7SA 4YMTA 5CYPA 3AVWA 5EZ5A 4QJ4A 1BMFD 1SKYB 3LLUA 3D3QA 3DM5A 4US1R 1ZD1A 1J70A 1FQKA 1OSNA 3VHLB 4IVQA 2O52A 3AEZA 1OXVA 3LVRE 3TAHA 4B2LA 3LDAA 1BH2A 4HB0A 1TEVA 1DELA 2XB4A 4ZPXA 1RKBA 1TF2A 2VP5A 1NN1A 3KFVA 4M1TA 3T34A 4M2LA 4YMWA 1BS1A 1G18A 2VHJA 4C0HA 4KLNA 3I61A 3GD7A 5KNCA 2PX3A 3B7GA 3IQXA 4Q01A 4WW0A 3W34A 1H8ED 1XMVA 1YZKA 2OFOA 2OG2A 3FGNA 4N3NA 2YVUA 3UMFA 2IBMA 3ZVLA 5IF9A 1YR7A 4UQOA 3GEIA 1KYIA 2J0VA 3C4JA 2VBCA 5KSOA 1ELOA 3NVAA 2F3RA 4TL8A 3W8RA 1CR1A 2GESA 5LPNA 2DWOA 3T1VA 3X1DA 3E5HA 4CZ2A 2IA5A 5AR1A 2YHSA 5JEDA 5JS7A 2CLSA 2NOAA 2XZLA 4AYWA 4LC0A 2RHDA 3GLHA 4QJ3A 4EPVA 2O8FB 1OPXA 2K5UA 1CBUA 2GF9A 1A7JA 4JBXA 4MITA 2QM7A 2UVQA 4XWAA 1NN0A 1NMXA 3G0HA 3NWJA 3BBPA 3MSXA 4MRRA 2P6RA 4BLRA 4LV6A 5FPHA 3ZD6A 2ZYWX 1EFTA 1ZU5A 2CE2X 2IYYA 3I8XA 5ANRB 4RCYA 5FI1B 1EGAA 2H1LA 4BGDA 4D4MA 1SHZA 2A3RA 1AGPA 1ZIPA 1XTKA 3F0TA 3O47A 2A5JA 2QPAA 3PUXA 4HLCA 1XEFA 1NVUQ 1VPLA 2OAP1 5LB2A 1GKUB 4C9BA 3GLFA 3MUFA 4AURA 1XD2A 4JVLA 5KSZA 3D8BA 1GWNA 2J0UB 4KVAA 5M04A 4IDQA 2WWYA 4EPRA 2Z6VA 1KY3A 3PV0A 1WBBA 3TUIC 2FSFA 3MJRA 4XD7D 5DYGA 2FEOA 2CCGA 4GPTA 1YZUA 1CF4A 1T6NA 1KI2A 1RRPA 3AUXA 1WXQA 2Q21A 4HUQA 4ARZA 3CWQA 4UXJA 1E0SA 2PL3A 1V5WA 3B85A 4NHOA 2HXYA 3VKGA 2WIBA 1P75A 4I1OA 1IY0A 1M8PA 1Z06A 4TZ0A 2B6HA 1IJEA 1JXMA 1M7BA 2LCFA 2NO0A 1N6KA 3GJ5A 4ILEA 4DEYA 4AWXA 1TTTA 1E6CA 2QSZA 5F9FA 2ZSEA 4JJZA 1YRAA 3KJIA 3OE7A 2ASEA 2HLDA 2ZI7A 4TMKA 1R10A 3FKSA 3BH0A 1E2GA 1NNEA 1RPZA 4C0AC 4N0EA 4Z1MA 2ERXA 4JLDA 3BB3A 1YR6A 5F2EA 1E2QA 3TUJC 4UKDA 1E1RA 4LBZA 4LY6A 2QRNA 2ZJAA 3SU8A 3GLHB 3VQTA 5JS8A 4JSYA 3QE0A 3RVBA 4YONB 4OHZA 2CEAA 1AS3A 1JECA 1TF7A 2QRZA 1OB2A 2WV9A 3B60A 1KI3A 2QT1A 3U6KA 2P6UA 3T12A 5TVKA 3BGWA 1NMZA 1QHHA 2Z83A 2F9MA 3QPWA 1G17A 3P4XA 4L9SA 4B48A 1CRQA 3ZVRA 1E9CA 1FQJA 3WBJA 5B2ZA 1SZPA 3AKDA 2CVHA 2XTNA 1MO5A 1NLYA 3CRW1 1XP8A 3NDBB 5UKDA 1KO1A 1G64A 2JLUA 1CJTC 1CJKC 1MV5A 4QFMA 1Q3HA 4POAA 4LHWA 2ZEJA 2AWOA 4YC7A 1XRJA 1G20E 1VTKA 1ZCAA 2GZHA 4XWKA 3WNDA 3AUYA 1AGRA 1P62B 1ZUHA 1MO6A 3LQQA 2G3YA 3REGA 2A2ZA 1JI0A 4DB2A 3K70B 3EARA 3KKMA 5L3QA 5J4VA 2BC9A 2JLRA 2ZJYA 4IKEA 4ARZB 4HUQB 1Z8FA 2ORVA 3LX5A 3KUCA 3GFOA 3THWA 2OZEA 1VHTA 5B58C 1U90A 3CLVA 4HYYA 1EX6A 5TY0A 2FSGA 2AKAB 3Q5EA 2P67A 3VTKA 5FTLA 2X2FA 2J7PA 3EASA 3IHLA 4JBWA 2OCBA 4LCBA 2D2FA 4JLAA 4KFUA 2QE7D 4WZAE 2H16A 2PMDA 5CIQA 3AKCA 1VCOA 2DCUA 5CK5A 4NL4H 1DAMA 3RWMB 3IIMA 3MLEA 3JZAA 4V0OA 4A0GA 3AF0A 1OHHD 1VYUA 3I92A 3OHMA 2ZQ5A 4OQNA 4QJ5A 2IUTA 3QSYA 3VR5A 3OAAD 5DI3A 4PSKA 4JKYA 4GOJA 1Q21A 1R5OA 1UFQA 2A7QA 1IN8A 1QHHB 4BZQA 2PLRA 3GJ8A 3CPHA 1XD9A 2I3BA 2KI5A 2QA5A 4WOPA 4RY2A 1II9A 5CM8B 1E2IA 2BMJA 2ZRMA 5LDDC 2VP6A 2XJ4A 4PC7A 4WXPA 4U00A 1ZYUA 2FFBA 2DYKA 3N2EA 4Q1EA 4TMXA 5AUNB 3ONWA 3KKOA 4QNMA 2VSXA 5TV2A 1T8TA 5IK2A 2ZRPA 1IOZA 5E7IA 1ZD8A 3HU1A 1HT2E 1WA5A 1L7VC 4GT1A 4NBSA 3VR1A 4A82A 3PUVA 4CEHB 4CIDA 1HYQA 5HE8A 1ZRHA 1H65A 1XCPA 5TMPA 2AL7A 2ZRGA 4NPHA 4C30A 1CIPA 1TMKA 4JLNA 4TTPA 1O3YA 4Z51A 2V8OA 3U3OA 1JNYA 1XPUA 3KB1A 4MKGA 4FINA 5L3QB 2VQSA 2HYIC 3BIFA 1A5TA 3F5FA 3ZD7A 1NKTA 2IS4A 3OIVA 2O8BA 1E2JA 3DMDA 2R6FA 1Z0IA 1XB2A 3ZDQA 3WXMA 2ZETA 3I5YA 3W6OA 2V6JA 2C2HA 2C77A 1VYTA 2HEIA 3VR2A 3TSWA 1RZ3A 2KE5A 2QQ0A 1WP9A 1NKSA 5KHOC 2H8KA 2V9PA 2ZXUA 2GF0A 2BDTA 2ZRDA 1E79D 5G40A 2OLJA 2JLQA 2D7CA 3CX7A 4MRNA 4BRWA 4C7OA 3TLXA 5J4HA 3EA5A 4PC6A 2QZ4A 1S3GA 1X8LA 3KXLA 4TLBA 1H8HD 3DOFA 1KK2A 4QGFA 2RMKA 4ON9A 2WBLC 1GKYA 3Q3JB 4AIIA 3LBHA 1A2KC 1N5LA 2MSEB 1XEXB 4BEJA 5KU1A 2C98A 1AZSC 1SVLA 3A8TA 5DI3B 4AG6A 4URXR 4CEJA 4P4SA 5KNBA 2IYTA 3BORA 4OJKA 3O8CA 2V7QA 4AYXA 5A0FA 2QUZA 1RRCA 1Q0UA 3HPRA 3P1JA 4Q1CA 3GQBA 3SEAA 4DLZA 4FWIB 4P3YA 4QNRA 3HJNA 4DC9A 721PA 3WBKA 4RZ2A 1U94A 1QHYA 2AWNA 4Q00A 5DLQC 1W36D 2Q9CA 4Q1DA 2ZREA 1SVIA 1XXHE 2XNDD 1LS1A 2XSZD 1G16A 3AF2A 2ZITA 4KYIB 4PFSA 4Q1AA 3WMGA 2CVFA 4I99A 1FL9A 1G3IA 1NVVQ 3L0SA 2VP9A 3CUEF 1E2DA 3MWLA 3PENA 1RVDA 1ZM9A 2J3EA 3KXKA 4JVSB 4HB3A 4M4SA 1SVOA 1NLZA 2EWVA 3K8YA 2BJWA 3A1TA 3BFXA 4JLVA 4KO8A 1Z6XA 4GZLA 4JVMA 1BYIA 4G5OA 4AYTA 1IN4A 1M6NA 1L4YA 4B3CA 4GMDA 3RS5A 3H84A 3V00A 1P60A 2GEDA 2QP3A 2ZJOA 4MH0R 4ESHA 2GEVA 3AP3A 4Q7MB 4HLUA 3E2IA 4DRZA 3RRYA 1Z6GA 2QMHA 4DLXA 2JJ2A 1MRSA 1DAIA 1Q57A 3ECCA 3BC1A 2NMVA 4C7OB 2QMOA 1ZC4A 4BFXA 4DIEA 4ASUD 4BZXA 1SKYE 1W46A 1OYWA 5GJVC 1Q44A 2ZRIA 4O2RA 1W0KA 1JR3A 3E1SA 4A2PA 4BLTA 2A5FA 4PO1A 1S9DA 2ZR0A 1YZGA 2F3TA 5HCIA 2QT0A 2PJRA 4ESVA 1NY6A 1IY2A 2BBOA 2E9SA 3EC2A 4P32A 4CEJB 1OKKD 1HTWA 3GPLA 2G83A 2RGDA 1LS6A 2AHOA 3OF5A 2PZFA 2EFHB 2R65A 2WJGA 4ZDIA 5IHPA 3IPXA 3NC1C 4B47A 2WTUA 4RD4A 3FWYA 2CDNA 4XSGA 5CLQA 4AK9A 4XSHA 1G3RA 5AJYA 2BBTA 4OHXA 5EQTA 4YQFA 3ZGXA 3RS2A 2P65A 2REOA 3TK1A 4QGAA 5HKKA 3KL4A 3QNUA 5AUQA 4M22A 3IQWA 2IL1A 1J2JA 2ATVA 3WMFA 1ZM2A 2VPPA 1JB1A 1ZD9A 3L0IB 1ZCBA 4DXAA 4URWR 4DDWA 1ESNA 3NBYC 1U9IC 1GFIA 1MH1A 2G0TA 1NN3A 2WMNB 2ZU0C 4C0SA 4YMSA 1MRNA 4DB4A 2EFDB 4MGIR 3J81k 1XDBA 5FBVB 2AX4A 1S4QA 3AB3A 3A4NA 4XWOA 5GVSA 2GJAA 1W1WA 2EW1A 3CH5A 4LOAA 4TQAA 4DCTA 4HZUB 2GAOA 3GFTA 1M7GA 4L9WA 4WIAA 1N5KA 1QVAA 1M1YE 5CDFA 2FFHA 2VF7A 1W0JD 1FTSA 1GITA 2FGJA 3TBKA 3UKDA 4DBLC 4E03A 1XJ0A 1OFHA 1TU4A 1S9HA 2FX3A 1VKJA 1F2TA 1ONBA 1XTQA 2GJKA 2C8VA 2ZVQX 1HURA 4O2LA 3CZQA 4DLSA 5G41A 5JBQA 2IYZA 3A36A 5HTKA 3BD9A 1SVMA 2RGBA 1E96A 2JIZD 2JAQA 3U61B 3T61A 2XZOA 3EPJA 2CHVA 2Z4RA 3K0SA 1VIAA 2NIPA 1XMIA 1NVVR 5JWOA 5C18A 3P26A 3DMNA 4C0BA 2JLWA 1P9NA 3BAFA 4YXWD 1KJWA 2WOOA 1IXRC 1N25A 4IRUB 1P5ZB 3QUSA 3TNFA 2NO7A 4IOMA 3QIAA 1UBEA 1DAFA 4MYCA 2BMFA 2FFQA 4A8JC 3DL0A 3UWOA 1SXJA 2EFEB 4GOXA 3VHXA 4DLVA 5DH9A 1HEIA 4PZLA 4IFEA 5C4MA 4HAVA 5AWFC 3K9GA 4KLZA 2Q3MA 2QM8A 2XAUA 3KFXA 1AN0A 2QNRA 1T91A 3B9QA 4X8HA 4B71A 4K46A 2KBFA 3KQHA 5FBQB 3B1XA 2VIIA 2HF8A 3X1ZA 1A82A 4C0KA 1QHNA 3GLHE 1TL7C 4GFDA 2VEDA 3U2QA 5IDVA 1VG1A 2ZJZA 4DLRA 1S1MA 2IEYA 2OHFA 1K8RA 1E0AA 2RH5A 4OQXA 2OCYC 1LFDB 3KQUA 4DLTA 2QMUA 3R8FA 4I81A 4NE2A 2DB3A 1W5TA 4E22A 2A5YB 1DAHA 1S3SA 2OFWA 1G9XA 4ZKDA 2GCNA 4V0NA 1IONA 4Y0AA 1KTVA 2H92A 4Q02A 1XFAA 3SJCA 1Z3IX 2O0JA 5GJCA 3X1WA 5FOVA 1DEKA 4A0RA 1F2TB 2QGZA 3LRPA 5FH9A 1G291 4Q7LA 4D0NA 2RGXA 4WXRA 3THXB 4XIGS 1G5TA 2D3WA 2YJTD 4JIMA 5AJVB 3ASYA 1JQLB 4MGKR 1YE8A 3PQCA 4PPNA 1JEDA 2REXB 2OCAA 4GOKA 4QHSA 4A6PA 4AD8A 2B8WA 4OK3A 4NCKA 3Q8XB 3IUYA 2QP4A 1OXTA 1IN5A 3SFZA 3PITA 2ZI3A 2FPLA 2YKGA 5K8LA 3UG7A 1JQJC 4BFWA 3LD9A 3W6NA 4A6XA 1E4VA 3LW7A 1E2PA 4ZCIA 2GKSA 3MWKA 5EUMA 1KK1A 4D26A 1KNQA 1RYHA 1YZTA 3DOEA 5JWHA 4PPQA 2YC4C 1UDXA 2JATA 2VHUA 1COWD 1PUJA 1P3JA 3WMEA 5FL7D 5FPYA 4M0LA 3I62A 4DSOA 5EE3A 1NVWQ 1SXJB 2UZIR 4PR0A 4DLUA 4R9UC 1X86B 4KBFA 3L43A 4PC3A 3TE6A 1VDZA 1GILA 5J4KA 2CCJA 3Q72A 4HATA 4LWZA 3U4QA 5DISB 2EWWA 4HLUC 2OLKA 4KXFB 4IVRA 5KNDA 2QMEA 2WJVA 2N1BA 5DE3A 1DAGA 3K0AA 4LV8B 3VNVA 2HCBA 4Z8YA 1IXZA 2O5VA 4Q1FA 1E2MA 4MDFA 1OFTA 1S2MA 2PBRA 4QBHA 1GZSA 3IGFA 2KBEA 5EP2A 1Q3TA 4D6PA 1TPZA 2GILA
chains in the Genus database with same CATH superfamily
4JI5B 1FRNA 4CF3A 2W6ID 2BI4A 1IZ9A 4LF8B 2WSSA 4GICA 4XCVA 3QLUC 3RRNA 3Q41A 1UBNA 1I30A 3U7JA 3M7IA 5LKRA 4K26A 4WBNB 3DULA 1EA5A 3ZXXA 3KDPA 4PC2A 3PC4A 5D3KA 3QFSA 2HDWA 4P31A 4FNMA 3P0IA 3ZWDA 4BRZA 4BVAA 1UR5A 4DCSA 1NP6A 2Z1MA 4EBBA 3OY2A 1NVKA 1YZLA 1U2DC 1RC1A 1XD8A 1IM5A 2PMBA 1N5IA 3B1YA 4DV3B 3EMVA 4HSEA 3AQ4A 5HTOA 5DYWA 1KZ4A 4KYVA 5FOUA 3T9FA 3DHEA 1KI6B 4IQGA 3KZCA 3UFXB 3L4KA 1A72A 2PRIA 4RLFA 3V48A 4BFSA 3QU2A 1NJ6A 2UYCA 4C5BA 3N70A 4NYIQ 1U7XA 1V9LA 1YHZA 3R23A 1TD9A 5FOTA 2PV0A 3GQVA 4C4RA 5I9MA 1D1QA 3U7GA 3AR3A 4XCQA 3AM1A 1MRZA 1E66A 1T1RA 3WLQA 1WHTA 4ZV7A 5LQMA 1AZWA 1RTTA 1LI5A 8ATCA 4F91B 1ODKA 2BGTA 1EFRD 1JP7A 5JYDA 3HL4A 4LYJA 3F67A 1SVKA 1ZCJA 2VZ9A 4OD0A 5FPKA 3HY3A 1BGVA 1RE0A 1Y1KE 2MJLA 3FNGA 1YKSA 3HVJA 4LJ6A 4DJAA 1OAAA 3TKLA 1C7JA 4DUYB 4MGYR 4C4AA 3DL4A 2GYVA 3NM6B 2R97A 4IH4A 4JI4B 1XZPA 4O4IB 5SZHB 3HV2A 4OK6A 1UXIA 1WLSA 3O8QB 2Z9CA 3IVRA 1EHYA 3MMPA 1OAOA 4EJMA 1TTHA 2B99A 3A2LA 3LBIA 2V6IA 1TM2A 4OGKA 1LRJA 1VKOA 3N6RA 1OV4A 2NSDA 4IIGA 4QDJA 2P9BA 2QUBA 2D2IA 5D2CA 3NWOA 4ND8A 3EZLA 2ID7A 2DY1A 3DE3X 3ETJA 3MIIA 3SYRA 1CFJA 4D8YA 4P0QB 2EL9A 2PFGA 1X7XA 2XBMA 2PR2A 4RY0A 3H1EA 3SF8A 5DNWA 1ZG3A 2ZB2A 1E9FA 1H1DA 3MT7A 1P3Y1 3P0RA 4ECAA 5A3QA 3ZVKA 1IEWA 2IPLA 3HGTA 4DM3A 2VNKA 4A10A 4M9ZA 3BOSA 3NATA 4N40A 2IOFA 3CRZA 1TK2A 2CMFA 1N6HA 4ETWA 3UHFA 4OX9Y 2POCA 5EMJA 3K0FA 4D0GA 3TXAA 1FSPA 1GRQA 3I2KA 5ESWA 4CL8A 4YK7A 1TW3A 2X9LA 3THOA 5T41A 1I2BA 1Y9ZA 3OPXA 1U3GA 3GJSA 4UAJA 3TUZC 4HNSA 1SXJC 4KN8A 2J0EA 2VYCA 4PSDA 3V4OA 4QZVA 1ULSA 3PFWO 3HP4A 1HZZA 3A4MA 3R7DA 1D1PA 4TV8A 5JHGB 2DJ5A 2X8LA 2CD9A 2EQAA 3DLTA 4FS8A 2OY0A 5CK4A 1Q84A 4CV3A 2PEYA 2ZANA 2LZ0A 1GRCA 4HYTA 3HA2A 4OY3A 3REQA 3S44A 4EO4A 1PNRA 1NIJA 2C9ZA 1YZYA 3A6LA 1LDYA 3INYA 2W6JD 4DMRA 1RP1A 2A58A 2E0IA 3LPLA 5K8TA 1WMEA 4MW0A 3L7OA 3IAS1 3AVYA 1DXYA 2AJCA 3F3YA 2HMWA 2ZUWA 1OGJA 3B52X 3VSBA 2HU5A 4A0SA 4A2QA 4NXNB 3N0WA 4L07A 2Q0SA 3D7LA 4F97A 5I7WA 4DR5B 5THXA 3VOAA 4L4SA 4NJMB 2EP5A 3WADA 3R20A 1Z37A 1U0SY 2QX9A 3DZ8A 4UJ3A 1U2EA 1G5QA 2PM8A 1W4ZA 2WILA 4PZZA 2EZ8A 2WJ6A 4MKXA 4NG4A 4DVJA 3CUKA 3Q7PA 4XVCA 3HO1A 4QOHA 4NU0A 1X9HA 3TRKA 1R8SA 4FZ3A 4XIIA 2GPJA 4BB0A 2GEUA 4OH7A 2FWIA 3EA4A 3FA2A 2BZGA 1J8QA 5AJWA 5AJZA 1DIAA 5ITSA 2B92A 4I3HA 4Q7QA 4ZARA 4X62B 2C57A 5K99A 3UATA 2NZ8A 1X80B 4ZO8A 3RRZA 4H7EA 3NXKA 2IEDA 2NNLD 5AW1A 1I01A 4IDPA 3JQBA 4XI9A 4RVFA 3C3JA 1MENA 4OHYA 4OCZA 2MYPA 4PICA 1BX1A 4LXXA 4XAQA 3NOOA 1YRWA 1P0QA 1F9EA 1NLMA 4KFTA 1SU7A 3ZEAA 4F3RA 1D2AA 1RWQA 3T0IA 3BE4A 4EW1A 2Z4TA 4IDAA 1MDBA 2BMDA 1URPA 5IJ9B 1W5AA 3OT5A 5EHGA 1IH8A 3VDQA 5HP4A 2VSNA 4GBED 4J2HA 2EJBA 4ZCPA 1VE9A 1T35A 3IHKA 3SIXA 2NXEA 1UAGA 1YS1X 3OBBA 4JNCA 4EIWA 1N3BA 1F4PA 1QKIA 4BQNA 2BMEA 4M21A 1M67A 3ETEA 1KI8A 3O4FA 3OFVA 3VKGA 1OC2A 1LX6A 3WJ1A 4WBSA 3P2IA 1X92A 1WW3A 1XFDA 4NICA 4PU0A 4U6NA 1BDBA 1T3TA 4AO7A 3U7HB 3EXFB 2ZE7A 1UEXC 3JTEA 4JU9A 4BQQA 1WEKA 2ZROA 1PQYA 4TMVA 4N65A 3GCZA 1BU8A 1JMYA 4JR1A 4RCVA 2CKDA 1C9YA 1Z88A 2ICAA 2HWXA 3PC2A 1ZIOA 1B26A 4LJ8A 5TT0A 4B6PA 1GQYA 3U3KA 3BSWA 4J7CA 4F96A 1OLOA 3QYAA 1QGUB 1DB3A 4AT1A 3LQ1A 1L3CA 3SQOA 3VTKA 5ARBA 1QGYA 2R8RA 3MWGA 3IEVA 1NVAA 4YRFA 3C1UA 4ID3A 3LU1A 3VC7A 1LI4A 2A94A 1ID8A 2Y27A 3N0VA 1RM0A 1TLLA 4K40A 1V7CA 4Q4JB 5L8VA 3UXMA 1PFVA 1U4OA 1MD9A 1I5OA 2V1XA 2VA8A 1R2QA 3BUSA 4D8WA 2GRAA 2BN4A 2J9GA 1VGRA 1VLQA 3AERA 4HDMA 4QXRA 4UAUA 1F14A 3MGGA 1OGIA 3EVTA 1RYZA 1PBNA 2YZMA 1TQ6A 2IEGA 4PAWA 4PXAA 4ZYYA 3PI7A 3AVPA 3FTEA 1LF0A 5JXGA 4U9IS 5AVQA 2HQBA 4EHDA 4BNWA 4R98A 3GH1A 4AJHA 4WZ6A 5EP2A 1RHMA 1L5KA 3ZWYA 3W0LB 5JJLA 4HRXA 1FTGA 4MJLA 4XYMA 2GEKA 2GTIA 2J1LA 5AO9A 1Z12A 1UK9A 2YNMD 3KWFA 4C3VA 2VTKA 1E61A 1SU4A 4IIBA 1QF6A 1PR4A 5J2UB 3TIXB 4D9EA 1PZEA 3GLGB 2J0QA 4ZGBA 1ZGHA 3FKQA 1H6AA 5DVZA 1FJHA 3KOYA 3R3SA 1AKUA 4C4PA 3H0EA 5FEUA 3QMPA 3ILYA 4G36A 3I12A 1Q0QA 2GK7A 3NGMA 3LWDA 1KXZA 2EU8A 2IXGA 3KQMA 4KC0A 2NO9A 3DZBA 1C2YA 1EZ1A 3GDHA 3S68A 4GDMA 2GBLC 1ZIDA 3R6GA 3LC0A 1N0VC 4I66A 1VSVA 5KKNB 2DUJA 3DHVA 4ENTA 3W3AA 1I7PA 1PFGA 2XNKA 3EA0A 1CP2A 3LI2A 1EDBA 1KRHA 3BXXA 4X64B 1X42A 4XYEA 2JDID 4AY5A 2I4IA 4IYRA 3QEJA 1ZZEA 5BYAA 3FMOB 3QENA 4U9UA 3ADBA 2KWIA 5E9JA 1N75A 4CW7A 1EYZA 1V9CA 2XBUA 4BEWA 1XAJA 1FFCA 1OHHA 4S2EA 7REQA 1HQDA 4P92A 3BYZA 2XYPA 3C70A 5H16A 3AWDA 3ZYCA 3NTXA 3PRYA 3VPCA 5BR4A 2GVZC 1R0YA 4WMLA 3WLKX 4B2PA 3S0JA 4XB1A 1TQ2A 2H6EA 3I52A 4E31A 2B8JA 4KREA 1UKVY 3R24A 4MVJP 1W75A 1N2HA 2I8AA 4GHWA 5KQLA 5E4TA 4GGMX 16PKA 1NYRA 1YD7A 4XVRA 3TXXA 2WIFA 2GYUA 3FZYA 1SBYA 2UAGA 1OA1A 5BQXA 2EFJA 5FWXB 1Z8DA 5DP1A 2PBLA 2A0YA 3COZA 3L8CA 3G9XA 4TSKA 5C8YA 4DLNA 2BM1A 2O2DA 2OTCA 3NLLA 4L4ZA 3BFVA 3JASA 2IYVA 2YZNA 3EGXA 2YOGA 4INAA 1QX4A 2SCUB 3BMCB 2IV2X 3MFQA 1M73E 5BWMA 1WLYA 4BBPA 3LZDA 1N2CB 2J67A 4Z9YA 5IJXA 1J42A 2OHHA 3K9CA 3VZQA 2K2WA 3ASZA 4PPGA 1POXA 2Y0CA 2ZG6A 3NONA 4Z5XA 5F33A 2FA9A 3S1LA 2XUKA 1Y63A 2HZ7A 1ZOPA 1AKMA 1YI1A 3MFYA 1ANKA 4YDRA 5BW4A 3X3HA 3L7LA 3X1JA 4AF6A 4YROA 1CZNA 2OYCA 1C0PA 3FFTA 5JG7A 4GPIB 2QTNA 3PUYA 3U81A 4BX8A 3D3JA 4AO8A 1HY3A 3L1JA 1G19A 3QEBZ 1SBZA 5TPWA 3K5PA 4AUNA 3DDOA 3K8QA 2B78A 3LRXA 2Q4OA 3C85A 3EVCA 1RHRA 3BE5A 1QK5A 3A25A 1GVHA 4FOPA 1W2WB 1FMTA 3DHYA 1E64A 3EXHC 3LLSA 2NU9B 1HNWB 5C51B 2DTXA 2XV1A 1L9XA 3IVMA 5HF5A 1NLFA 5FDFA 1G55A 1CUZA 1E2KA 2IVFA 3OQMA 1SQ6A 2L2QA 3RKRA 4K8OA 1H2XA 3UO8B 5JPCA 1PG2A 4RD3A 2WHEA 2DF8A 1CY8A 1MQSA 2G09A 2BGNA 4JT8A 4KN9S 1PD1A 2OZKA 2G76A 1SULA 3PNYA 1ZK3A 3KPJA 4FKBA 4W1RA 4EO7A 3ECSA 3B70A 2F9FA 3EFOB 3SBEA 3P9CA 1FFYA 2BONA 1UZLA 2RGEA 2W2MA 3LV8A 3AY6A 5HKAA 3TD9A 3FYDA 4LVUA 1MNQA 1BHO1 1N7IA 1YDHA 3UOWA 3LY7A 4OHBA 4DCOA 3FFWA 3UAOA 4WLNA 2YOFA 4HZUA 5CXQA 1PE0A 3CT4A 2G8NA 4EABA 3JARA 2O8DB 2GJ4A 2O57A 5KUTA 3D81A 4H60A 4WPGA 4B33A 4E5KA 3GLKA 3JQEA 1K27A 3OKAA 4L4YA 1U9JA 1TAGA 4AKHA 1GL3A 3ANLA 4HN9A 1FDVA 4PC1A 2FPMA 4CMHA 5KIAA 1IUKA 1RIIA 3WL5A 2P9CA 2YV5A 1F0KA 2XNDA 2MSNA 1SM4A 3IILA 2QVBA 4EF4A 3L4BC 4TKZA 3LXRA 5LM3A 3CNNA 1EVJA 1Y4ZA 5AVSA 1WSAA 2PZ8A 1RYDA 1PSZA 2X0NA 5FP0A 2O7VA 3E7DA 3M34A 2OD9A 3NT2A 4ZVOA 1MV8A 2JIPA 4RFVA 4G0NA 1QLWA 1Z39A 1U3DA 2IP1A 5CDTA 3SXJA 4LF6B 3NPMA 2IF0A 2R96A 4MIOA 3JD2A 1KO7A 2PU5A 2ZXFA 1B1AA 1R0ZA 4U7FA 5FBHA 2RDMA 3EQ8A 1YASA 3UAZA 2AEJA 4EJFA 1JTEA 2WP8J 4U2CA 5JASA 2X5JO 3TTSA 3F7NA 3QF7A 3SQLA 3TBHA 1TD1A 2MSWA 5FA5A 3IKJA 5H80A 1UJNA 4K86A 5KTYA 2Z43A 4EJSC 2X42A 2HV9A 3TL3A 2PXCA 2PT7A 4ITUA 3ACCA 3HSSA 1BKDR 1Y4AE 2C9MA 2G7MC 1ZO8A 4ALLA 4QG7A 3CHYA 5BP7A 2UVPB 1FDRA 1SRQA 3P9PA 5HK9A 3DOIA 4BO4A 1A7AA 2QQFA 2Y8EA 4JC0A 1H1LA 1UODA 4OFZA 1EG7A 1VIYA 3H9CA 3R6TA 2EIXA 1M5TA 3VV2A 5F2NA 2A9KA 1AK1A 5ALFA 4O1HA 1H23A 1JQKA 5CVVA 4B35A 1A76A 3TCXB 3HNPA 3ZZTA 3UJAA 1JXQA 2NPIA 5JE8A 5J9FA 1O97C 3K35A 4NATA 3PJDA 2QTVA 1RMQA 5JMWA 5E95A 4IIFA 2P41A 5JSKA 3TQSA 5EJ9A 5JNWA 1GKKA 5AUPB 3BGDA 3NBAA 3FHTA 1OKKA 1U3WA 5K20A 1W93A 2C7VA 4PHTA 4L2IB 3HDQA 3WIDA 4JV5B 3LIIA 2GPAA 3K92A 3O8BA 1IBKB 1GSIA 3OEHA 1CQPA 2P78A 821PA 4AKIA 1NM5A 2YXLA 2P4SA 1ZNZA 3PWTA 1UDWA 4FFVA 2AZMA 5IKPA 4KGDA 5ALZA 1I10A 1NWCA 4HVTA 3T1QA 1HA3A 3ZE6A 4DJDC 2WNIA 2VHWA 3NRJA 1L7AA 1KMHA 1YFZA 3K1JA 5IT4A 2XB2A 1CPYA 2B2NA 3AQIA 2JHPA 3HXTA 3OEED 4NS1A 3O8DA 3MXOA 4JMLA 5CLIA 3DB1A 4EYGA 1HORA 1HSZA 1L6IA 5LZ8A 1DCFA 4FW9A 1WKBA 5E9AA 4E1VA 1VKZA 3EH2A 3MWFA 3X2EA 1PYOA 3RJTA 1QK3A 2XB6A 4FDTA 2K4MA 2QNBA 2J7KA 3FHCB 3R5HA 4I5EA 4MHSA 1YQEA 2VPWA 1LTQA 3FN4A 4YAJA 5DU2A 3KQHA 1VXOA 3NM5A 4C5CA 3CXRA 3TOZA 5BT9A 1AKQA 3JD4A 1RE1A 2AD5A 2NAPA 4JJ7A 4UU0A 3WGGA 2RAPA 5MN5A 2GTHA 2I7DA 3SQXA 1H5UA 2VF2A 3I0MA 3M4YA 4H1UA 4YRGA 4D3FA 2ZJ3A 2YX1A 5H68A 1RAAA 4CQMD 1FE8A 1MPTA 1AS2A 3H2BA 3H1GA 4GOND 2HPAA 3PP8A 4H1TA 3T4EA 1RZRD 1WABA 4FI3F 3GLSA 1GAWA 2Y99A 3HBAA 4RMIA 5C4GB 2FR0A 4HPJB 1K92A 1UKBA 5IABA 1SEVA 3JV7A 2E4UA 3QBDA 4E70A 2IHTA 1FVFA 1R12A 2VDJA 5IS2A 3IKVA 5B3JA 1LLUA 2FJUA 3RDPA 2OA0A 3STWA 2ERYA 2JIZA 2ID8A 8GPBA 3RVOA 3QJ5A 3NYWA 4LE1A 1LB1B 3DFIA 2CEKA 4JGGA 3VM6A 4UFOA 5DHAA 3TVTA 121PA 2Q99A 3ET4A 4QUEA 2QIPA 3VSAA 1VJRA 4Z4EA 3M1IA 4MW7A 1BS2A 3JU3A 3KOUA 3H75A 2YH2A 4X1YA 4NMMA 4MRSA 2YINC 5FWAA 1GG2A 1KJQA 3T54A 3V80A 3PDCA 1ADYA 1P7YA 2VN8A 4U7JA 1KYZA 2HY7A 3DKRA 2CZGA 5GADl 2VKQA 3ESCA 1IB0A 3T3NA 3LBAA 4K9LA 4Y3UA 3P96A 1DMSA 1NBHA 2H06A 2ZIAA 1DADA 4I4TB 4JLOA 1RJGA 2NT4A 4I1VA 1LWOA 4YCJA 2ZBEA 4GNKA 3TLGB 2DFLA 1BGXT 5AVKA 1ZNWA 5JARA 2Y71A 3K9QO 4PPYA 1YI8A 4LECA 4PGFA 3F74A 3EGIA 4GZMA 3DFKA 5EUQB 3H16A 8MHTA 3WRWA 3BREA 3N6XA 3DAPA 1S1CA 2Q27A 4K6KA 3HNOA 2G7ZA 5DHPA 1CYEA 2CLMB 2DT5A 1YR3A 1Z4NA 5DOZA 2QU8A 5BSHA 5P21A 1OX4A 5CXSA 3W8EA 2J3KA 2FN3A 1XQ9A 1AT1A 3QPAA 4LYAA 3I6YA 4CKEA 1KORA 3QM1A 4XTCS 1KI6A 1I94B 3LTNC 2GARA 1P3DA 1GL7A 3PBKA 2CL5A 1ZM4A 2V59A 2AXEA 5F4BA 5GWXA 2AYXA 1Z2AA 3EMBA 4WA7A 4LJ4A 3WYAA 1FNNA 2NLOA 3PHCA 4O3MA 5F7OA 5I7AA 2C2BA 3FB4A 2IHNA 2LIVA 2R8YA 4CM9D 1ZI6A 3M3HA 2ZBVA 2VZ8A 1K7CA 2MR6A 4OMFG 4D57A 2FE1A 1RAGA 5FFFA 1QNFA 2CFIA 4KQHA 4DQKA 1ISSA 3PK0A 2VP0A 2YWDA 4K3VA 1FS6A 4NQZA 2OFFA 5KCZA 2QR2A 3MB5A 1IQ0A 3E9NA 3HS3A 4NS4A 1ESMA 1KIMA 1VXRA 5JXIA 1Q1BA 4L85A 2Y67A 2AC2A 1G4UR 5KNDD 3AI2A 4O4IA 3EIEA 1W36C 3WYNA 4BO8A 3C8ZA 5J5VA 1R5JA 2VNAA 3K8OE 2CHGA 2XLBA 1H93A 2WJPA 3OOSA 4FMDF 3PJRA 3A1WA 1CTQA 5E6UA 3NTRA 1KFJB 1BH6A 4JKOA 3CU5A 2PWYA 4N0PA 3R0JA 3ND6A 2RHMA 2O3JA 2YVKA 2PUFA 3FLMA 3VKWA 1J25A 3ENNA 4BVLA 2IK8A 4QHTA 2D74A 2JLAA 4ZQIA 2R79A 5HQJA 4B6GA 3GT7A 2AC4A 3KCQA 1FS5A 2G1UA 3Q5DA 4W5QA 1E9DA 2FLWA 1OE0A 4UNSA 1SC9A 4PO8A 3HP1A 5FHRA 2XDQB 4II7A 3ZTWA 2O3UA 4JL5A 2Q5CA 4ENPA 3SD7A 3VPXA 2YQ4A 2LV8A 3A9TA 3UMBA 2HA3A 1B6SA 5KYKA 5TF4A 4F9TA 3V7NA 2AN5A 2C1ZA 3DGEC 4Q9KA 5TC4A 4BDSA 3GXBA 3HU3A 5KX5F 1QSGA 2P2CA 4KFRA 4OGWA 1FMLA 1DWPA 3I2GA 5IJAA 1JTFA 3RGWS 2ZIZA 3ZE7A 3Q10A 4B3BA 1GCAA 2JCSA 1YQGA 3ZNOA 3JYPA 4NXMB 4Z8XA 1Z0FA 1XQXA 1YA8A 3JRWA 3QU7A 2Y9PB 1QOPB 4BO1A 1ZGGA 3AEUB 4EI8A 4GPBA 2WW8A 3QKWA 1Q74A 1QRRA 3H9QA 3QKSA 4PO3X 2PKXA 3GF4A 5KAPA 4PO9A 4CKYA 4XLTA 4DABA 3DOJA 2BM9A 5TARA 4L5CA 2NUTB 5HF8A 1OYVA 1NR1A 2IU6A 2YWEA 4FIDA 2QJTA 4LDPA 4G0XA 1V1RA 4MXDA 3BK1A 4DWVA 2OK8A 1OJLA 5DM60 4J3JA 1KSJA 2W2NA 2FEPA 1A8HA 1YR8A 4L6IA 4FGLA 4F4CA 3I8SA 3KD3A 4P1ZA 3HPQA 5JBNA 1JKJB 1T0HB 4BWGA 3G2IA 4JZKA 5HUHA 4PBTA 5AXBA 3BILA 2C8KA 3WLNA 4CN8A 1R0BA 1ECFA 2WSMA 4QDKA 3SFTA 5J1TB 2PGDA 3CNQS 4JL8A 2NZJA 3S29A 4DWJA 4RSRA 2BFDA 3CBQA 1KL7A 2CXSA 3ITEA 4BJ5A 1QFSA 3BIXA 3D8HA 1QO9A 2JFPA 4Y7CA 2YBEA 3D64A 3HUEA 1ECCA 3K16A 3G82C 4XOUA 4Z0HO 4WOJA 2H2DA 2PRKA 3NNSA 4E32A 1G21A 3GR6A 1BMFA 1NRJB 2H5JA 1F7VA 5F52A 3FGOA 4GEKA 1H2AS 2W0SA 3LC2O 1K0UA 3IAUA 3IA7A 4RPLA 3WGKA 1Q0ZA 2W43A 4CL2A 2LP4Y 3C6QA 1N6PA 4EYOA 2WWWA 2J5XA 3EGCA 2BFWA 1M34A 1P2SA 3NT4A 3KYIB 2BKVA 2FWJA 2O9JA 4N39A 4W1QA 4G86A 3MCTA 1KQNA 3TPFA 5KVVA 5KTSA 3D6HA 2J08A 2C59A 2XXBA 3GEMA 3OLCX 4R1PA 4XGKA 2COKA 3E7WA 1EFRA 3LHIA 3R7WA 2EATA 2ZAIA 1D2MA 1KJJA 2PTHA 4C5AA 2R48A 3IDQA 5L53A 1TJ4A 2WT8A 2PXAA 3EGOA 3O31A 2BPOA 4HYEA 5DXAA 2P1RA 4EA9A 2QBYB 1RAHA 2Z5GA 4JYMA 2BWJA 5CB6A 4DARA 1G5PA 2VAXA 4HDRA 2LIPA 4LYHA 2O14A 1Z0JA 3VX4A 1Z33A 5FQOA 1L4LA 2QORA 4KG7A 5CT5A 2H1OA 2VKTA 3ZGOA 1QG0A 1Z83A 1II8B 3ZU5A 4KSBA 5L4NA 1W49A 2JKYA 4L5BA 5HJEA 3MA0A 4IJUA 3SF0A 1REQA 1TW2A 1SOAA 3IP6A 3OX1A 3TBFA 3V1UA 4BNDB 3CLUD 4KQGA 1CNFA 4NARA 1OASA 4ENQA 2OK7A 1R4ZA 5A9TA 2ZRCA 1XSEA 1BE8A 3N2KB 4B4KA 3DAOA 3JVUA 1KE1A 1E7WA 4U7PB 1N5JA 4KFCA 1HDZA 2G88A 4MA4A 4ND2A 1NT4A 2ZUTA 2W5UA 2C95A 3G88A 4MRMA 4KXQA 1C3VA 5B1EA 2MR5A 2VF5X 5ENVA 1PR6A 3I72A 4ZVTA 4PCAA 2OPHA 5BSFA 1GTVA 4OV6B 5B30A 2HLDD 1Y8AA 1BZYA 5EUCA 3Q8WA 2ODWA 2JASA 5ALMA 5LQSA 3WRVA 4ITRC 1MA3A 3VZCA 5JSZA 1LUAA 4IJVA 2GBGA 3QY9A 4EW2A 4Q4AA 4FDLA 5J40A 1MX5A 1KEZA 4TQUS 3U1BA 1N3IA 4L08A 1O87A 4LDNA 1OLSB 1GTJ1 2G6BA 4WCVA 2LCQA 2G9UA 2PVCA 4QFBA 1GLGA 1S3FA 5DHFA 1F2VA 2OCDA 5L4SA 1NU6A 1MVOA 1VSUA 1XF1A 2HCTA 2IYUA 3WJAA 4BE7B 1YUMA 4NC9A 2CYBA 5SZKB 3NOQA 1GQQA 3OJLA 1NKVA 3USCS 1O57A 3PCXA 2W6JA 4ZJPA 1F17A 3GGPA 4IMIB 1TUBB 4Z9FA 1A69A 1FRVA 2XGOA 3GP8A 3KKKA 4IY1A 2QSYA 3M6LA 3AHCA 4P3PA 2HA4A 1IUPA 3DR3A 3WLRA 3C7AA 5I9SA 1GY8A 1GGNA 2IYPA 5LP6B 4MOWA 2BGWA 2ZIWB 4WBXC 3SOPA 4IEFB 3F71A 3SVLA 4QPZA 4ENRA 5KVAA 3DOOA 4FXPA 3ZY3A 2H18A 2YV4A 3KJHA 4MQBA 1VJ5A 2VJNA 4ZICA 2W7TA 4JI6B 4LW8A 4Q4HA 4F46A 4F3NA 1H0KA 1XCLA 5H0IA 3KZNA 5HJ5A 1K0FA 4YY3B 1RJEA 1VYVA 2I4MA 1Y33E 1B42A 5THQA 4RH3A 1XVUA 4LHYA 4PIVA 3RYHB 2KX7A 3I2YX 4R8VA 4UPVA 5L7TA 1DE0A 2LUOA 5KJEA 4DPMA 2BZ1A 3BDIA 2G4VA 4Q3OA 4G4JA 4Q7JB 2HDNB 1IAVA 1CUSA 1UMCA 3GMIA 3R3JA 1D04A 1U7WA 5T6BA 3U26A 3QTBA 4BB5A 5DSZA 4GEGA 1GUYA 3LPMA 5IC5A 4BNVA 1DHTA 4F0JA 2NPFA 3BERA 1IE3A 1C1HA 1O9HA 5ESRA 3A6PC 2ZYRA 1X9GA 4J0QA 5HZKA 1SXGA 5DBHX 3S1AA 3VUFA 4K1XA 4J94A 4C2TA 4GLBA 1R7RA 1K5HA 1TZBA 1XTSA 5CB8A 1EXWA 3AHFA 1JLLA 3HYTA 2WWFA 4B84A 4G5RA 4X7MA 4Q4LA 4WKCA 2Z8YM 2FEAA 3A6KA 4RZXA 2B7LA 2FSPA 2H1WA 2Z8YA 5G3ZA 3LFHA 1P2BA 4IQ4A 4OM7A 1QIHA 2QLMA 4XASA 3CM0A 3V42A 1FJGB 3BGIA 3R7AA 2Q7OE 3M81A 1X9IA 5KAMA 3PR2B 1LV7A 3FNEA 4X95A 5COBA 1SD1A 1UC8A 221PA 1O0SA 1OPRA 1Q0SA 3OIUA 4W8HA 5F2KA 5FNVF 4G2NA 4YCBA 2OWEA 1CR4A 3G59A 1QH8A 4MKHA 3UVEA 3V2IA 2GXSA 3VU9B 4OMUA 4EFMA 5KTOA 4B4WA 3P2MA 4C6RA 4GMGA 5IX8A 3THYA 3IQFA 4BX2A 2GAFA 1B0PA 2CB9A 4P2BA 3HQ4O 1TADA 4ZTZB 2JGRA 1N2IA 1ORVA 5FTKA 3N86A 2AK2A 2P68A 1MA0A 4WCFA 1OD6A 3RTEA 1YDFA 5TE9A 3TQRA 1DZ3A 4J0KA 5K0LA 1M6VB 1P8AA 1ZR4A 3A11A 1JGTA 1L7PA 1OWOA 1K6IA 4G2TA 3N7TA 5K9ZA 3D43A 2CLDX 1P7WA 5EXDA 4ZMSA 3ELDA 4YIHA 3RTDA 2DPLA 1Y7HA 2L18A 1ILEA 3EY9A 3L4EA 3N2LA 5DM0A 2WF6A 4FXOA 3QYPA 1W76A 4ZOBA 2XVYA 4G1EB 4O2AA 5E38A 1HDRA 4BN0A 1XRMA 5AUOB 1RWWA 3T15A 1CKEA 2GK6A 2ZAYA 3I42A 3E9MA 1IXSB 4EPYA 5LQAA 5CGQB 5HQ3A 1WU8A 4ANFA 1WB4A 2YV1A 7ABPA 1XRLA 1CE8B 2CCKA 2ZT6A 3I5AA 3I9MA 1FDSA 2WG2A 2KYRA 4K2HA 4ZCMA 3WYGA 2CV1A 3I04M 1EUCA 2B35A 4UHFA 2WSYB 2EOAA 4FC7A 3I04A 2EBUA 2O3QA 1E3DA 2YNMA 1NVMB 2JA1A 3QBEA 5FTWA 2FW1A 2JGAA 5CNKA 1E32A 3RJ5A 3VYRB 4F4IA 4JXXA 3JAWB 1YTUA 1P0PA 1WD5A 4B3IA 5CA1B 3UJ8A 3WOHA 1TK9A 2BKUA 4ZOAA 5DYTA 1DJOA 4ZT5A 5AKYA 2DWPA 1FVOA 3NAZA 2G9NA 4BX3A 1AQJA 5AW2A 3RG2A 4GVXA 5F3WB 4B85A 3B13B 3PYXA 3JYNA 2HK6A 2VDRB 2Y1DA 3R6LA 3S8EA 3QZUA 2ZK7A 4AJJA 2O8DA 5DYIA 4FEEA 5FRDA 3E48A 3O38A 4B3MB 2D59A 4L72A 4JJKA 3UAGA 5HX7A 1BAPA 3R5SA 3RSOA 4KPGA 3RE1A 2Y1WA 4BFUA 1R8XA 2IU0A 3F98A 1GZ6A 4F12A 2AZ4A 2CVOA 1LJUA 3M6XA 4D9GA 1ITZA 2JDIA 1NF8A 2XQJA 4LQ4A 5MN4A 1QHGA 2BDEA 1CDEA 4LDAA 1ECBA 2O5CA 2HU8A 2YOHA 2WFZA 1MQ8B 1Y3AA 3LK6A 3DW3X 1ULZA 2Q3LA 1XELA 2ZDHA 3I1FA 3Q85A 5BN3B 4J1NA 2Z9DA 5LSAA 3NV9A 3ZX4A 4RX1A 3GNSA 4IV5A 3LWZA 1M33A 1XYGA 2PS9A 4ZAZA 4BNUA 5IDQA 4IPTA 2IYFA 2OXRA 5FX2A 2GERA 3EQ2A 3B6IA 4IUBS 5D7BA 5B1IA 5E7MA 4BNHA 3ADKA 3THWB 3V8EA 2NUAA 2V7QD 3V4VB 2PX4A 1A7UA 1SBHA 2I1VB 1GTMA 2VHQA 2WWXA 3B82A 3DFZA 4QO8A 1A9OA 3EZ6A 4ZI5A 1AUPA 1IC6A 1VBKA 1UBGA 2PFSA 1Z0KA 2VPTA 5DBOA 5EFOA 3C7DB 2FMUA 2Z5VA 1P4SA 4KVGA 4ZO4A 5BRJA 1SELA 4BP9A 5LOVA 2EG9A 2H85A 2UVPA 2W11A 4HY3A 4NONA 2XYHA 4AULA 1T9GS 4G85A 3F6CA 3GBSA 2Z2YA 1T25A 1UP7A 2QI9F 2QTAA 3A14A 4J7AA 1WUIS 4NBRA 3DDNA 4JH0A 4X90A 2FQWA 1EE2A 1YO6A 2WINI 2P75A 3H2GA 5EG5A 1XTUA 1GUFA 1Z28A 3AVOA 1R0CA 2BEWA 2XDYA 3EOBI 1VFNA 1J21A 3E4DA 2V6MA 3BRSA 5E9QA 4O4JF 5LQKA 2D3TA 1CQWA 3B3AA 3GFSA 1NXPA 1X2EA 3COPA 5DK4A 4PTLA 3TLZA 4CDGA 1OXKB 2HO5A 5JS2A 2ZZKA 2DHDA 5CDUA 1TO6A 1XR3A 4X0EA 2H17A 2WJZB 3UJ6A 3EDMA 3E9QA 1VHQA 4L2IA 2D7DA 3H1PA 5KSPA 5AHWA 2G04A 1T5DX 1KE2A 1M5RA 2AG5A 4EA7A 2V5AA 4A4DA 4BLWA 2I7XA 3RU9A 2R5WA 3FJOA 4YRSA 1B16A 4YAKA 1GDDA 3KQVA 1L7OA 1Z07A 2CJFA 1KAQA 5DWVA 2O4UX 2Z6AA 2Q3FA 4F84A 3MTBA 5HILA 4UBJA 5JMTA 5EJEA 3VR4H 2PUJA 2JLYA 1G20A 4A0QA 2EBHX 4G25A 3ZQJA 1MW9X 4XUDA 4U7DA 3WQHA 1CDZA 2XMRA 1FYEA 3S27A 5DOVA 3EDOA 1SCJA 2OVFA 3PSHA 2OGWA 2VJBA 4CMIB 3FSGD 3ZTYA 1BN7A 2JGDB 4Y0VA 5YASA 2QAGB 5SV2A 3CURA 4TS4A 2NTEA 3NH6A 2LXNA 4GZ3A 5BNFA 1ORWA 4MUGA 1CUFA 1JR3D 4RACA 7MDHA 2C7PA 5LWQA 2P9HA 2O8EB 1ZVJA 1I32A 5EINA 1R6BX 2PXXA 5LQRA 3JQ9C 1EGMB 3K0KA 1L8XA 2NXCA 2PRSA 3BEOA 3CCBA 4S12A 5E2IA 4U5XA 4X8MA 4OHRA 4MARA 1EP1B 1Q7TA 3G0CA 3IP7A 1TB4A 4RM3A 4AX4A 5K05A 4JAVC 1C29B 3PQEA 1PLJA 2DCMA 4GAEA 1ZKDA 2DWCA 5FIUA 1G41A 1SIOA 1DSSG 3A7DA 3KLBA 1ZW1A 3B6JA 4PM4A 4MVWA 3OZAA 1KH2A 2IEBA 1NF9A 3UM9A 3U7FB 3MJCA 4EJ0A 2NO4A 2FV8A 5HKKD 1QZTA 1D9XA 2VP4A 4TQGA 5DGIA 5K6TA 4QBIA 3WFJA 3ZK7A 4EKIA 2IGBA 1NG1A 3B2QA 3NIFB 3Q1KA 1IVSA 3UJDA 4EMTA 4KPUB 3QPDA 3ZV7A 2BFNA 2CJPA 5MHTA 2ZB8A 4C0JA 3P9RA 1HMPA 1ZU4A 4DIMA 3WTCA 1DKQA 1POWA 4RELA 2Y1CA 1HEUA 5KTNA 2RK6A 2IXEA 4QASA 3NKFA 3GRUA 4ZCQA 1SO8A 2EYUA 1NULA 2WZCA 3UK6A 4DJEC 2R1ZA 5FOWA 3L6CA 1J5EB 1IN7A 1YFLA 4TWIA 2YUIA 3AHDA 1X1QA 5A2GA 2LCIA 4OHOA 4RGVA 2EG5A 3VAAA 4DV5B 5GV8A 2I4OA 1S2LA 3FAKA 3K15A 1CUCA 1PUIA 1C0KA 5TLSA 5ED0A 3PFIA 3TVYA 1C1XB 1WZNA 3RTBA 2V7TA 3FR7A 1NP7A 3KS9A 4IEIA 4M1EA 2IU3A 2P9QA 2PG3A 4PTZA 4RNDB 3M89A 4W5TA 1UT6A 2WNHA 4J43A 4AJEA 4UNRA 2H4YA 2QL6A 4E4TA 1F5NA 3M0EA 1NMYA 4V0KA 2D7JA 2I4NA 2X3UA 3GCGA 3UANA 4UHHA 1UBFA 3WK8A 4CF7A 3Q9NA 2IZ1A 1D2NA 4GGOA 3U4DA 1G1MA 2AXPA 2EF0A 2OL4A 1AUVA 4H16A 4CU5A 5JSQA 2EZUA 3SJBA 4O4LF 4ZREA 4MP6A 5I3CA 2NX2A 2B21A 4LZJA 2OYRA 3W9YA 4Y6LA 4BC1A 3WIOA 1WPGA 1QLHA 3R77A 1UEJA 3MJEA 3SNKA 2DTDA 2HWYA 2AFVA 1TDJA 1OZAA 3HCFA 2WF5A 2JJYA 4MV6A 2PWZA 1ACJA 1G8YA 1MBZA 5BWCA 1LVGA 2YYZA 4H7PA 3SE7A 3ZBTA 2W37A 5F64A 4Q4DA 4MAMA 4PZ0A 4UEWA 5JI3E 1QFYA 2IOHA 3IBGA 2VDUE 2WWVD 5FUXA 1MIOA 3HKEB 3RJZA 3F2IA 1G8SA 4N47A 4A8HA 2ZIFA 1AQUA 5AIAA 1P5FA 5KO2A 4NEQA 2ZTLA 4I5DA 1SXJD 4C21A 2QNIA 2X8WA 3C1TA 1Z5GA 3MJHA 1NVXQ 2QM0A 3QXHA 2QD1A 2TMKA 3LLCA