2ZI4A

C4s dck variant of dck in complex with l-da+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate promiscuity of dCK
pubmed doi rcsb
molecule keywords Deoxycytidine kinase
molecule tags Transferase
source organism Homo sapiens
total genus 83
structure length 228
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi4A00
3C7KA 3FMIA 1P72A 1NG1A 4JBXA 1RIFA 2HEIA 5J4LA 4C30A 4HDQB 2HF9A 1S9DA 2C9YA 2O8BB 3L2OB 4A4DA 3Q8XB 2VP2A 4Q9LA 4FXPA 1Z63A 3DMDA 1H8HA 3MLEA 5GJWC 1QZXA 3B1ZA 2QZ4A 5EXSA 4BRWA 2J0VA 4BLOA 4Q9IA 2DFLA 1I2MA 3C14C 4GOKA 2QT1A 4QKQA 1EGAA 1SVOA 4M2LA 1VCNA 1CEEA 2XAUA 1E6CA 2B8TA 1J99A 4DLTA 2WVJA 3DKVA 3RRMA 3NVAA 1G41A 2W58A 3QKRA 3ZVRA 4GP6A 3QE0A 4MGIR 2BMFA 521PA 1KGDA 1TU3A 1F3OA 3OE7D 3TGPA 1W0KA 1DO0A 1KMQA 5BQ5A 3KQUA 2FFHA 3U7EB 1G1MA 2V7QD 4L16A 1GIAA 5EE3A 1EFHA 4KSCA 1ZUNB 4Q1DA 4WA7A 2ZJZA 1OW3B 1NKSA 4ESHA 5DN6D 3AF4A 621PA 1RC8A 1VYUA 1DO2A 1N5IA 5KTYA 4YMSA 4O0MA 3EXAA 4PZZA 1T8TA 2ZRBA 4KXFB 4H9GA 5AK0A 3WHKA 4CEIB 4B3BA 4CT4B 2ZE7A 4MGZR 3TSWA 4EFMA 3QOFA 5JRJA 3THWB 3I73A 1NVXQ 4Q66C 4WBSA 5IK2D 5JWOA 4LJ6A 4QNMA 2DFKB 2J9RA 2GXSA 3BJIC 2ZE8A 1Z2CA 3Q72A 1RJ9B 2UZIR 4M1MA 3EWSA 2X2FA 1U0JA 1DOAA 4BFVA 1XRJA 1JPNA 2YYZA 3U3MA 4PAOA 2G0NA 4BECA 2LWIA 2VP4A 2P6NA 1FOEB 2A5JA 1HYQA 2WZQA 4AIIA 2DPXA 2XTZA 2QE7A 2ZPTX 2BCJQ 4LUCA 3BE4A 1FX0A 2QAGA 4NYIQ 3QBVA 4R71A 5JHGB 1DE0A 4IVRA 2FEMA 1IHUA 4Q9KA 5JLJA 5CLLA 4LCBA 5G53C 3UG7A 1WCV1 1OJLA 2OLKA 3D31A 1KK2A 3RWOA 1GL9B 2VQSA 1XEWX 1FNMA 2BIFA 3FOZA 4A1FA 1CR1A 2QPOA 5HR5A 1BYUA 4MKHA 1G6OA 2D06A 3AEZA 4PX9A 4DSUA 4BFYA 1ZC4A 5BWMA 1EFCA 2PLRA 1KIMA 2QPAA 4JSTA 2VYFA 4KCGA 1KK3A 3ND8A 4ZIRB 4FN5A 3FHTA 2EFHB 2RGGA 2V9PA 2G3YA 2XNDD 2XOKA 2AD5A 4B33A 2ASEA 2DYKA 3R7WA 3ZZUA 1HE1C 3EA0A 4B73A 3CF0A 1XZQA 2H17A 2DB3A 4LBZA 2CXXA 2VP5A 1UBCA 3KJGA 4PR0A 5DHAA 4Z1MD 3F5FA 5KU1A 2B7BA 3AP3A 3PG5A 2GK7A 2ZSDA 1OB5A 2IS4A 1PLKA 1XEXA 3LVRE 4ABYA 2BBWA 4QG7A 2B21A 2C95A 4V0MA 3R8FA 2RGAA 2AD1A 4DLRA 4Q4HA 3CRRA 1K8RA 1OF1A 2GWHA 4PSAA 1DAFA 4QXAA 5CDFE 4CVNA 2JEOA 2ZRFA 2F43A 5FL3A 3RWMB 4R9UC 4BQSA 1R2QA 2REOA 1KO5A 1JEEA 5JSZB 1LFDB 2CBZA 3KKQA 1KO7A 2OLJA 3NC0C 4FMDF 5SZIA 3THXB 3QXSA 1DPFA 4V0LA 2IYUA 1OKKA 3FMPB 1T6NA 4L8GA 4DDVA 3RDPA 1EX7A 1OLOA 1M2OB 2W2XA 3CNNA 5F9HA 1Z6XA 2G0TA 1QHXA 3EW9A 4I1VA 4URYR 3UKDA 2ZRIA 4PFSA 3HU2A 2R65A 2IS2A 5JZVA 1KDRA 4IRUB 2OFXA 1XCMA 4MYUA 1NVVQ 4A0FA 4LBYA 4M8NE 2XZOA 1WQ1R 1GKIA 4BLPA 4LJ5A 1G3RA 3W5IA 3WMGA 3EPKA 4D4MA 3PXGA 3KQHA 2YINC 4JKIA 4TYWA 2ODWA 3QG5A 4RCZA 2QBYB 2DBYA 3NC1C 2UZ3A 2YOHA 4V0OA 5FPYA 3NH9A 4P31A 1C1YA 4NYJR 1KYIA 2Z4SA 3AF2A 3IEVA 3FHOA 4EJSB 4DDWA 4MDFA 5DHFA 4M21A 4C0AC 2IX3A 5G3YA 1AJEA 3VKGA 4TTRA 5EXXA 4DSNA 1JALA 5DI9A 4B3GA 1BH2A 5J4VA 1KAOA 5B58C 1XWIA 4NCIA 3U3KA 5FR2A 1W4CA 3CPJB 4IXNA 2XXAB 4BGDA 5JI3E 2OXCA 3M6AA 4NE2A 4JLBA 4XVRA 2WICA 3WHLA 2WMOB 4GSYA 4WZ6A 5K8IA 5GADl 4QGHA 2ZJBA 3ZLJA 3GEIA 3MWJA 1UFQA 3DDCA 1FFHA 3HDTA 4MRNA 2AN9A 2EVWX 5DIFA 2XB4A 3BH7A 4OQLA 1IJEA 4YXWA 3UK6A 4NP6A 4PHTA 3NBZC 1JR6A 1WDTA 1R8QA 4PC7A 4Q7KA 4X8MA 4AI6A 2ZYTX 1JNYA 1W1WA 2H57A 4LWZA 3KKMA 4C0QC 4DC9A 2QP4A 4YLGA 2E87A 1Z0IA 2IYWA 4A0RA 3QNUA 1HH4A 3QF4A 4TMKA 3PEUA 5A5GA 2JJ1D 4KFRA 1F60A 1RKBA 2CL0X 2ZTSA 4QM6A 4XJXA 2FA9A 1WA5A 2ZRLA 5C4GB 2Z83A 2PL3A 2CHQA 1G5TA 2P65A 2ZI9A 3LH5A 2V6JA 1UKEA 3ASYA 2JIZA 2IYQA 2P3SA 2WOJA 4L9SA 1NKTA 1YR7A 2FNAA 3K8YA 4HAZA 3WNDA 3B5JA 1P7CA 3U44A 5HPYB 3B8HA 4MYHA 2H18A 1XBTA 1F2UB 3L43A 4B2IA 1IN7A 2IC5A 5FR1A 2WWXA 2EFCB 3KFXA 2AHOA 2IA5A 4ARZB 2IYLD 1EFRD 5FOVA 1E1QA 5KPDA 4M1OA 3EARA 1AN0A 3NHBA 3VR4A 5C1BA 1YZGA 2KBFA 3U4QA 1VIAA 2IF0A 3ZZ0A 1DAHA 2BM1A 2F1RA 2YWEA 2QAJA 3EA5A 5LD2C 4LI0A 3V4FA 2PT5A 5LBIA 4MITA 2ZUBA 3U3JA 5L3QB 3B7GA 3KKOA 1I4DD 4FMCB 3U3RA 2FMXA 3A4MA 3BWDD 2RGXA 4Q9JA 4RZXA 3W8RA 3A58B 3VR2A 3FGNA 4HLDA 3LRPA 1MRSA 4B3CA 4QRHA 1Z0FA 3TW4A 4CEJA 2O8EB 4URWR 3WBJA 4BEBA 3TQFA 4HUTA 1KO8A 1A2BA 1AKYA 3EZ7A 3TH5A 2IHYA 2O8BA 5FPKA 3KJHA 1U81A 3THOA 3K9LA 4PANA 2CHVA 2GHIA 3KKPA 2ZYWX 4LJ9A 4WOPA 4DSOA 1XCPA 2JAQA 4I4LA 1MABB 2ZR7A 3F3YA 3LO5A 4Q1FA 4P3YA 1E9EA 1TF2A 3OEED 2ANBA 1IBRA 2G77B 2ZJAA 4L5BA 4B48A 1HQCA 3P27A 3MRSA 3SDZA 4RD6A 4MRVA 1Z3IX 1DS6A 1II0A 4OL0A 1XMJA 4TYNA 4IDPA 1PVOA 1T0JB 1IXSB 2OSBA 4LY6A 3KQNA 4ITRC 1G7TA 4RFSA 3B1YA 3K9GA 5CM8B 3T35A 1SVIA 4E09A 5JFGA 3ADCA 1JBKA 2ORVA 2V1XA 3M0EA 1KHTA 5CK5A 3SNHA 2O8CB 1XTIA 2WSSA 3CF2A 1FMLA 1J70A 1JQLB 1II8A 3KFVA 1IY2A 3RS5A 4QBGB 1G5RA 5EE5B 4OHVA 1MO3A 4JLNA 2IWRA 1GITA 4C0SA 2KWIA 3QKRB 2GVDC 4RD4A 4FCTA 2H7VA 5J5CA 1X8JA 2R6CA 3QKSB 1YE8A 4OJQA 4Q1EA 3TQCA 1R0ZA 2QSZA 4DJTA 2WWGA 1RYHA 3FMOB 3NTUA 4BLTA 2YOGA 3WYFA 1E9DA 2FEOA 1LF5A 4MRSA 1NG9A 4NU0A 1N6HA 1N6LA 2FZLA 4CIDA 4RSGA 4I1SA 1X1SA 4YONB 1NY5A 4PAMA 3UWOA 3UXMA 2QPTA 4A92A 3DM9B 4OHWA 1XJ0A 3W3ZB 3I8XA 1MT0A 3H0KA 2QP3A 4QBIA 3B1WA 1ZIPA 1XB2A 2NO9A 1CULC 4XSHA 3IPXA 2X77A 2F9LA 2BEKA 1Q22A 3SQXA 3B78A 1TMKA 2ODBA 3CRMA 4IEEA 1XP8A 4ZO4A 3U7GA 4NCHA 4R2IA 4F7WA 4IFEA 3OHMA 4PC2A 4JLDA 2DR3A 4O3MA 1LF0A 3CR8A 3IQWA 2XTNA 1E4YA 1KAGA 3I3SR 1ETUA 4K81B 4KSBA 1FX0B 2QAGB 4ASUD 4WXPA 2I4IA 4HYYA 1Y63A 3UATA 3REFA 3R20A 4ZIRA 1E79D 1E2PA 1IAQA 1EK0A 2ZU0C 5HTKA 1OIVA 5FTLA 2FGKA 1HT2E 1XZPA 5ELXA 2D7DA 1P2VA 2AWNA 3LX8A 2CCKA 2DCUA 4O2LA 5FTMA 2EWVA 1E2DA 1Q20A 3HPQA 4A2PA 3OE7A 1M6NA 1OIWA 3UPUA 1J2JA 1UKYA 1R7RA 3OF5A 5FBLB 2JLZA 4RZ2A 2V7QA 5L3SA 1N3BA 3AVPA 1PV4A 1Z5ZA 2WKRA 3H86A 3KJEA 4NH0A 3R7WB 5DN6A 5IT5A 3ICQB 3AB3A 1T91A 1KZ7B 4JT2A 2C04A 2ODEA 5FOTA 5AUQA 3BRWD 1Z29A 1RE0A 1F6BA 3VMFA 1ZMXA 3AF1A 3VQTA 1XEXB 4BZXA 3QIAA 3R9IA 6Q21A 4URXR 2IT1A 3GLIB 4BFUA 3NHAA 4HB2A 4M53A 3K53A 5JJIA 4LYHA 4Z8YA 4Q4HB 5IK2A 3O47A 1I2DA 1E4VA 1E2IA 1VMAA 4QHYA 1NLFA 2AFHE 3M1IA 4HATA 5KNBA 4WZAE 2PH1A 3Q5DA 3QPVA 2V3CC 5GVSA 2W6JD 4CYMA 2ECKA 2YZ2A 5TXGA 1NVWQ 3A4LA 2GRJA 1KSFX 2KBEA 4A8JC 3DZDA 1JR3D 3BOSA 2A5YB 3CR7A 2J45A 4L15A 2OBLA 5CJ2A 1E9CA 3UMRA 1GSIA 2VPPA 1ZCBA 4JVMA 3TBKA 3IQXA 1MR3F 1UKZA 3E70C 3V00A 5EJEA 1TEVA 3HU3A 5CK4A 5GJCA 2O8FB 1W4AA 2JLQA 5DNYB 1PLJA 3U7HB 3PUXA 1Q21A 5BXQC 4KLZA 1NI3A 2YHSA 1E0AA 2VP9A 3OZXA 4C4PA 2OM2A 3LLMA 4A9AA 1MV5A 3BFXA 3CNOA 4OI4A 4D81A 4EAQA 5BN3A 3LLUA 4DLZA 3MGCA 3E5HA 3PQCA 3QBTA 1UM8A 3HYTA 2XSZD 3LX5A 1G8HA 2ZS7A 3FKSD 5K8UA 4WVFA 3ZQ6A 1XPOA 5CIWA 1EWQA 2KE5A 4NYMQ 1CU1A 4N1AA 1NP6A 2F55A 1G7SA 1XFAA 1KDTA 1KMHA 2YV5A 1T5IA 1NJGA 4QFMA 2BWJA 4GMDA 2Q9BA 1OFHA 3L8ZA 4TQAA 2EFDB 4Z1MA 2QRNA 4F91B 1WP9A 3QVVA 3BERA 4EUNA 1QHIA 1BMFD 3GJXC 2Z4RA 4KAXA 3KJIA 3C4JA 1QF9A 1J90A 2ZVQX 3TVDA 5IDVA 2W0MA 3C5HA 1QHSA 1D9XA 2A78A 3GP8A 3T1VA 3ZIAD 1NN0A 2MSEB 3W34A 1W5TA 2CK3A 1U94A 1U8YA 2D2FA 3P4YA 4D80A 3T5GA 1MH1A 1T3LA 1GRRA 2VP6A 2A30A 2TMKA 2J0SA 2KSQA 2NO6A 1JR3E 1U90A 4OHXA 2VHQA 2AKAB 2HCJB 3ND9A 4HLCA 4Q21A 2IUSA 2N46A 2QSYA 1AS3A 2ZJOA 3IBGA 1AM4D 3PENA 3WYAA 4DIDA 4EFLA 5B57C 4OI2A 1Q12A 3CPEA 1NBMA 3MWYW 5FOWA 2A5FA 4LHWA 2ORWA 3HU1A 3H84A 2CL7X 3E2IA 4HDOB 4KODA 4M1YA 5KPJA 3R9XA 3NIBA 3QG1A 3QF4B 4UXHA 3CLVA 2QM8A 1D9ZA 2FPMA 2R6FA 2FX3A 2YC4C 1AS0A 5C18A 4KVAA 3E1SA 3FMFA 4G01B 4G5QA 5GVRA 1Z07A 4W9MC 2QU8A 4PHHA 4F4IA 2WJIA 2NZJA 3CRVA 1ESMA 5JMTA 5JEDA 1DEKA 1OH8A 5G40A 4D0LB 2ZRCA 1JPJA 2GCPA 4YDHB 4M1KA 4S35A 3DPUA 5E95A 3QJYA 2I1QA 5EUMA 3GJ0A 1D5CA 4DUGD 2CVFA 3GJ6A 3HPRA 4B32A 1W44A 1E0JA 4B47A 1Z0DA 4DLWA 2E9SA 3U7FB 4DWJA 1H65A 3T1TA 4EIWA 1CXZA 4W7SA 2ZM5A 1WXQA 5KDLA 3QKTA 4MUBA 4TSFD 1OXUA 4F92B 1O3YA 3U4QB 4WXRA 3LBHA 2RCNA 4RZUA 1ZU5A 4D82A 1JECA 3UMFA 2O8EA 5H8WA 1M7BA 2AR7A 2YWHA 1OXTA 5ANRB 1KDOA 4Y0VA 4YMVA 1ZNWA 2OCYC 5F3WB 3A1VA 4NDZA 1SVMA 2OO7A 1UBGA 2A5GA 2B6HA 3Q85A 2XB2A 1VHLA 1NL3A 4GL2A 2CLSA 5EP3A 1Q0UA 4LJ4A 3LA6A 3QXXA 1II9A 4UNPA 4HB0A 1RFLA 4RD0A 1TU4A 3ADKA 5JCZA 1UEJA 2AXPA 4TQUS 3LXXA 1S3GA 1R0WA 5B30A 3N5CA 3RS7A 2W2TA 3OEHA 1QRAA 2FE4A 4AURA 4JYCA 2PT7A 1GKUB 4IDHA 4KU4A 3DOFA 3NBXX 5LPNA 1KI4A 2QY9A 2JJ1A 5F98A 5KSOA 1CF4A 4B43A 5H70A 2LCFA 4Q9HA 2R6DA 1E9BA 4URUR 3ZS9A 5HZHA 2QM7A 3SEAA 4F4CA 2JLYA 4PPQA 1S9HA 3R9WA 1PJRA 2KJQA 2O8CA 4D26A 4Y0AA 1VIYA 3CX7A 3ZVLA 2BDTA 3MWKA 3K0CC 2CE7A 1T8UA 1M74A 2FFAA 2YJTD 1E9AA 1YKSA 1ZJ6A 4AD8A 2HCBA 1ZD8A 5JS7A 3ICEA 3IHWA 3TUIC 3SE0A 4YC7A 5JBQA 4QGGA 4Q7MB 4IEIA 2V55B 4US1R 1XCGB 3ZD7A 3EIHA 1CRPA 1B0UA 2QEQA 2JDIA 3CBQA 5DLQC 1XJCA 4RFSB 3QKSA 1TQ2A 1W0JA 3U6BA 1JXOA 3PEYA 3K09C 3L0IB 3QKUA 2Q0HA 4HLQB 3KX2A 1W46A 2FSFA 2NG1A 2IW3A 4KV9A 1FQKA 5D3MA 1Z6GA 1II8B 5FL7D 1FP7A 4J0QA 4C0HA 4NTZA 3BFKA 1GVNB 3LVQE 4TMZA 2ZI3A 2JASA 1FPMA 5AJZA 2B92A 4URVR 3AM1A 3WRXC 2HJVA 2GILA 3TR5A 2QMUA 1K5DA 2C98A 1ZW6A 2ZITA 3ADDA 2MSDB 2PEZA 1BKDR 5EE9A 2OEPA 4N0EA 2ZYUX 1P3JA 5C2JB 1RPZA 1LW7A 3PIRA 4FW9A 4M9SA 3TIFA 3AVTA 3W3AA 3GJ5A 4PQRA 4PPNA 4Q1AA 1GL6A 2JJ2D 1NMYA 2GBLC 3SBDA 3DMNA 3KUCA 3F8TA 4AWXA 2QP9X 2RGNC 4G5SA 5M04A 3BIFA 3SYLA 2P5TB 1DBSA 2WWIA 1G16A 3N2EA 3GD7A 3K70D 2WWFA 1QHGA 1TL7C 1KI2A 4NKRA 3WRYC 1NN3A 3EASA 4LZZA 4V0KA 4ZCMA 1ZM7A 1Q1ZA 1KOFA 3AP2A 1N6KA 5FOSA 3ZZTA 1FP6A 2Q3FA 3KXIA 1GM5A 1UDXA 2J0QA 3WNCA 4CF7A 4NHOA 5EUQB 2BMJA 2O0HA 5BW8A 1OXSC 1M7GA 5SZHB 4KFUA 3PUZA 4UKDA 4OK6A 5KSPA 4ACAA 3QY0A 2AFIE 5J4YA 1KSJA 3ADBA 1P73A 2BBOA 5DO9A 4OK5A 4M1SA 4LK2A 1DVRA 2ZQ5A 2F6RA 3VR5A 1ZUHA 3CM0A 2OUKA 4DBLC 3TE6A 4JS0A 2VO1A 1HT1E 3O8CA 4B34A 4DB2A 2XZPA 1DADA 3DO6A 2ZRPA 4GOXA 2PZFA 3WXMA 4A2QA 1SHZA 2ONJA 3SJZA 4F93B 4HAWA 2QQEA 4LBVA 2F3RA 2QMEA 4CT5A 1CTQA 1GAJA 1KJWA 3I1FA 4YMTA 4GBMA 3GLIA 1V43A 3K0FA 1FMJA 821PA 5J4HA 1CP2A 1KSHA 1N0WA 2ZAMA 4C0BA 4ERNA 1U98A 5L3SB 4KHZA 1D8TA 2IF2A 5P21A 2O52A 1OYYA 1XF9A 2IXGA 3D8BA 4Q4JA 1XMSA 2Q21A 3W5JA 4LPKA 2ERXA 4I1OA 2ZI5A 4OHZA 1OH5A 5TY0A 3RS0A 4A36A 3B13B 1W48A 2OCAA 3AP1A 3VHXA 1ZYUA 4NCNA 3WBKA 3LXRA 2V54A 4TL9A 4PO1A 4V0NA 5AJXA 5CB6A 3TJZA 5FPTA 3X1YA 2ZIAA 4JL6A 5L3VA 1CLUA 3DZ8A 4RD1A 4UNQA 1TUIA 3PJRA 1QHHA 2Q9CA 1JQJC 1F2TB 3MCAA 2ZS9A 2O8FA 3T5DA 4AKIA 1PLLA 1E9FA 4B3FX 3IO5A 2IYVA 4HLUC 1MO6A 4KO8A 1NSFA 1VKJA 3BK7A 3SFVA 4YQFA 3AVYA 1SXJD 3LY5A 4ASUA 4DDTA 2W6ID 721PA 1AGRA 4TZ6A 4P32A 3TSOA 4ZCIA 1KI8A 2Q6TA 3HYRA 3FB4A 2IXFA 1A82A 4NL4H 3LQQA 4RZ3A 2BJVA 4B6EA 3EZ2A 1EFUA 4U7DA 4DT1A 3CO5A 2RKOA 3UMSA 1WF3A 1X1RA 2UKDA 3RRNA 2ZJYA 3PUVA 2CNWD 4Q03A 3GJ8A 4KBGA 5L3RA 1RRCA 2O8DA 1VCIA 1ANKA 1OB2A 1DELA 4GNKA 4E03A 1FW6A 1OFTA 1P60A 4RFVA 2NO1A 1PUIA 4LHZA 4Q4LA 3GFPA 5KOYA 1X3SA 3CX8A 1W2HA 2QN6A 2P5SA 1IXZA 4A6XA 3AVUA 1IM2A 1N25A 2FG5A 1KMHB 2JLSA 2OG2A 1T0HB 1YZLA 1N5LA 3A37A 4DCSA 1KTVA 1XXHE 4WAUA 4X8HA 2C9CA 3NH6A 3UIEA 2IHBA 1Z8FA 1A7JA 4C2TA 4L9WA 3NEYA 3OAAD 4BRUA 5L8VA 1PZNA 1U0HC 1QVRA 3BORA 3BXZA 3K70C 5LD2B 4PQYA 3QXCA 1DTSA 1E2FA 2DWOA 5CYPA 1ZIOA 2D62A 1Z0AA 4M1WA 3VU9B 4A82A 3GLHA 3TK1A 2WJVA 4IVQA 3A1SA 3CKLA 2JLRA 5FBVB 2ZETA 3AQ4A 4PC1A 1YJ5A 1NVVR 2FH5B 5KDDA 3GLGE 3TR0A 1SXJE 4B44A 1DAGA 1JR3A 3B60A 3EZFA 4LHVA 1MO4A 2PCJA 4F38A 2N1BA 4PHGA 2H16A 4G5OA 4LBWA 5EP4A 3B9QA 1YR6A 2FN4A 1GFIA 2QUZA 1GNRA 4MA4A 4XTRA 2AWOA 3T1OA 4EJSC 1MKYA 2ORIA 5FTJA 5BYKA 2A5DA 3P20A 1UBEA 4PPGA 1G4AE 4TLBA 5KNCA 1RRGA 5B2ZA 1NN1A 2PBRA 1H8ED 1S1MA 2X8AA 5EZ5A 5FBQB 1ZUIA 4BEJA 4P4TA 4KFSA 4ZI3A 3VAAA 2OILA 1BO6A 1R5BA 3SHFA 1T4GA 2WJJA 4M9QA 3ZYCA 1UADA 4ZDKA 4PAQA 3FKSA 5TB5A 1YU9A 3TAUA 4Q02A 1N2CE 1W4BA 2CCJA 3CB4A 4GZLA 4AY2A 4ZI2A 1W0KD 3VR6A 1D2EA 2WHXA 4PO8A 3RABA 1RW4A 2R9VA 1VPLA 4TMWA 4AG6A 1COWA 3PVSA 2ODNA 3K09A 2GCNA 4GOJA 2RAPA 1BMFA 4DLSA 4EFNA 4ZKEA 2QENA 5J47A 3PUYA 2ZR9A 3C8UA 2ZJ8A 1NMZA 3OFND 1VYTA 2VF7A 3D3QA 4DLYA 3PEWA 1HY3A 4JT4A 1NNEA 4YDSA 4C0JA 5TVKA 1Q3TA 4FMDB 3SQWA 1LVGA 2CCGA 2ZE6A 2JATA 2PMDA 3MMPA 2R2AA 2VA8A 2VTKA 4MH0R 4POAA 2J5XA 1SXJC 3V9PA 1VCMA 2BBTA 1QBKC 3NEJA 4HAUA 2C8VA 4IFBA 4PZYA 1KKLA 1P9WA 4LDJA 2ZI7A 1EXMA 2QTHA 3RS2A 1CIPA 2NO0A 2QA5A 2QE7D 1DAEA 2QROA 2BBSA 2MSCB 1ODFA 2D4HA 1M34E 4PPFA 1OE0A 3DKPA 3FKQA 1SHKA 2W83A 1LS6A 4NZYA 3LBNA 3TUJC 3K1JA 2PX3A 4LYAA 4JL5A 4Q4AA 4LV8B 4UNSA 2HJGA 4K46A 4TL8A 1GILA 4Q1CA 1TQ6A 4TLAA 1Z06A 1KI9A 3TVTA 1UF9A 2OHFA 2H8KA 4TSFA 3U2QA 2WV9A 3NWJA 2IYXA 2VH5R 4IXMA 4HAVA 1VHTA 5D3MB 4BE7B 4TTPA 2XOKD 3I92A 4E07A 4G5RA 1AA9A 5KHOC 3AKCA 3PCRB 3O8DA 1P62B 4Q5IA 1OXXK 1E2EA 4OBEA 1SVLA 1VCOA 1FNNA 1UKVY 4AYTA 3IKJA 1SKYE 4GI7A 2ZUCA 3OIWA 4JLOA 1VECA 4GRAA 3SHWA 2HYIC 3FFAA 1P5ZB 1YZUA 1YZTA 1Z08A 5AUOB 3PITA 3A36A 3QF7A 3RAPR 1DARA 4LV6A 2FFBA 3CRW1 1G3UA 3BAFA 4QJ3A 2PZGA 1L2TA 2GJ9A 5K8LA 1CJMA 2PMKA 2H5EA 3FE2A 3LAWA 3EPLA 4C7OA 2VHUA 3LNCA 2O0KA 2ZRJA 4Z54A 4B3DA 1E0SA 1WMSA 2Q3HA 2RB4A 4NMMA 4TLDA 1C9KA 1I4TD 1FZQA 1SVKA 3U60B 2V6IA 3RS3A 3OIVA 2ZEJA 3TRFA 5DGXA 3F0TA 5KSYA 4QGAA 1YZKA 1DG3A 4LC1A 4PO9A 3W8NA 2QNRA 2NMVA 2XEXA 4A8JB 1T3SA 1Q1QA 2GCOA 2GJAA 3AKDA 4XD7D 1W36B 4Q48A 2AKYA 1SVWA 4BUJA 3A1UA 4KFTA 2H1LA 5CLQA 1EX6A 1FL9A 2YVUA 4LRWA 3CZPA 3CPHA 2OBMA 2OFOA 2GXAA 2ZRNA 1R0YA 4G1UC 3D6TB 3JVVA 5FL7A 2MMCA 1QG4A 2C99A 2VBCA 3ZDQA 2X19A 1GZSA 1ZM4A 2EFEB 1M8PA 1XX6A 1KK1A 1T9HA 3QPWA 4V0ME 2J7PD 1OIXA 1CJKC 2HXSA 3H2YA 3Q9LA 3UANA 2GNOA 2D74A 2FPKA 1GG2A 1GKYA 1XU4A 4CW7A 3GFOA 3K0FB 5HKKD 2PJRA 1XMVA 2BMDA 3REGA 4KVGA 5FOXA 4AKHA 2R44A 4H1VA 3GJ4A 5FFMA 1ZBDA 1AKEA 1XJQA 2VRWA 4Q4JB 4DRZA 1F2TA 3I5XA 1IONA 2ZROA 3AVVA 3AH8A 1UEIA 2Z5FA 4JJZA 1A1VA 3AGPA 3B85A 4D0GA 2JJ2A 1TTTA 1NRJB 5H68A 5CDFA 4E22A 2J0UA 1G4UR 3GLFE 2MMGA 2QAGC 3VHLB 1X86B 4NCKA 5AUPB 2XZLA 2NPFA 1T3HA 2IS1A 1YR9A 2NGRA 1HQYE 3WNBA 4MKFA 1QHHB 4TTQA 4JLAA 2C9OA 1XD2B 2CMKA 2HUPA 4G5GA 2ZU6A 3L82B 2FWRA 2GDJA 3C41J 1QHYA 3T06B 1P2SA 2LKDA 5CYOA 2WBLC 2G88A 2OFWA 4OJKA 4AKGA 4IDOA 2ZRGA 2W00A 3TKLA 3THYA 4C0KA 3I61A 4ZCLA 1G64A 5FPHA 3MUFA 2BV3A 4JKYA 4R98A 3TW8B 4XIGS 2GF9A 1UBFA 121PA 1E1RD 2WIAA 3LBIA 3VNVA 1L8QA 2QMHA 5EQTA 1ZNYA 3RNLA 4FWIB 5TMPA 3AVOA 3KB1A 1LB1B 1XD9A 4DT1B 2ZUDA 4ESVA 2XNDA 5E7MA 5KDOA 3FPAA 2AK3A 1Z6AA 3AUYA 3OIUA 3FYHA 3FVQA 3U6KA 4LGMA 3ZH9B 2P6RA 1NLYA 4TL6A 2HT1A 4UJ5A 3SOPA 2O8DB 4DLUA 4I81A 2GEVA 3BB4A 1P75A 2DY1A 4ZKDA 5AR1A 1G3QA 4ZDWA 2XNSA 5AJYA 5CM9C 1S0UA 4LC0A 1E69A 3FHCB 3QXHA 4TYQA 3CH4B 1ZVQA 3VU9A 5A0FA 4JVLA 1E9RA 1G9XA 1O87A 4JBYA 4OQFA 5FBWB 5EP2A 2C03A 1ZD1A 3L0SA 4LYFA 1BS1A 2G1JA 2CVHA 2HDNB 1IN8A 4LOAA 3SYKA 4XTCS 3T15A 4DB4A 3CW2A 4UJ3A 3EG5A 1XTSA 1F48A 4LX0A 4DLXA 5JHHB 4ZDIA 4BZQA 2XX3A 4QHSA 3GLHB 2QORA 5G41A 2F7SA 3P32A 1ZCAA 2JLWA 1KSGA 2AXNA 2DFNA 1KNQA 3EZ9A 4Q19A 2V8OA 3KTAA 4IOKA 4KLNA 4HEJA 1BIFA 2OCBA 3FTQA 4H1UA 4MKGA 2Z0MA 4LJAA 3RS4A 3GJ7A 2NO7A 4A2WA 1W47A 3SJAA 5BYJA 3GLGA 1ZNZA 1PUJA 5JJLA 3GQBA 1HTWA 1OH7A 2ZRKA 4MQBA 4NYMR 4DVGA 4O2RA 2RHMA 3IILA 1KY2A 2GEUA 2J3EA 1P9NA 2C5LA 4IOJA 1I4LD 2CNWA 2R62A 4I99A 1ZM2A 2QRZA 3AVQA 2JLUA 2WSSD 5SZJA 4OKSA 2PX0A 2FF7A 1KI6B 3P1JA 1DG1G 1U99A 2KI5A 1CJTC 2O0JA 5FUYA 4DLVA 2GZDA 3Q3JB 5J40A 5A4JA 3GPLA 3C5CA 4XSGA 3ZVMA 2ZAOA 1E2HA 1BOFA 1N5JA 2GETA 3ETLA 3Q7QA 2WWWA 1G17A 1RZ3A 1QVAA 3CRQA 4BPBA 2IUTA 2JLVA 1TF7A 1W49A 4X8OA 3PEVA 2ZREA 2C2HA 3L0PA 2V1UA 1Q44A 4XWAA 3BFVA 1S96A 5BN4A 2PLFA 2JLXA 2NOAA 5SZKB 2GJ8A 3OAAA 4PQFA 2GA8A 2VSOA 4HAXA 3WP0A 1ONBA 4HUQB 3N70A 3CNLA 4DZZA 3V4RA 4A0GA 1NIPA 1CJUC 2YWFA 4B76A 2FPLA 1R0XA 2GJSA 3K9NA 1Z6YA 1SULA 1GRNA 2IYTA 1E99A 3MFYA 2BM0A 3BH6A 1A4RA 3KUDA 4EDHA 4JMPA 4BLSA 3O8BA 1IN4A 3NXSA 2VSFA 2GVZC 3D7MA 4PTLA 1N5KA 5TARA 1ZD9A 3AVXA 1N6OA 4DCVA 3SN6A 4JLKA 3TAHA 2PCLA 1T5LA 3VX4A 4AKEA 4QJ5A 5JEEA 3I5YA 2OXRA 1DAKA 1JXMA 4FIDA 1E2NA 4US2R 4FI3C 1VG1A 2IYZA 1US8A 2R6AA 4P4SB 2GAOA 1EFRA 3BD9A 5JCPA 4TT3D 2FV8A 4TMTA 3W6PA 4N0DA 1SZPA 1H8EA 4CDGA 4DEXA 4KBFA 4GT1A 1TAGA 1FQJA 4Q01A 4QC2A 3VKWA 3BH0A 1KY3A 1AGPA 2FJUA 4QL3A 1IOZA 2F3TA 4Q4AB 2QTVB 3K0EA 1D6JA 5AWFC 4HZIA 1X8KA 1MO5A 4AYXA 4DEYA 2EYQA 2WKPA 2CLCX 4BFZA 4X8LA 2ERYA 1B23P 1FTSA 2EU8A 3DL0A 4PC6A 4TMXA 4II7A 3NDBB 4QBFA 1TQDA 5BN5A 5HZKA 3W6NA 3A1WA 5AJVB 2WAXA 2RGCA 3EPHA 1AK2A 4GP7A 3OFNA 5FTNA 4WW0A 4ZPXA 1J8YF 1S2MA 1XDBA 1OYWA 2VSXA 1XNJA 1VTKA 4GPTA 4EKDA 3W9YA 4LV5B 1VYVA 5GJBA 2LKCA 2QGZA 2ZI4A 4TQ9A 3EC2A 4FMBB 4B2LA 1YHNA 3OEEA 4W5JA 4G0NA 2DHRA 1QDEA 2JA1A 3OESA 3QPUA 1XTQA 3A8TA 3EIQA 4E5UA 2ZI6A 2YNMA 4YMWA 2DFTA 1KO4A 4DCUA 4HB3A 1CS4C 4DSTA 5CITA 1IJFA 5FTKA 2QT0A 2P0EA 2R8RA 1GL7A 4JZKA 3B82A 4A8JA 2OAP1 4I1UA 3T61A 3PUWA 4BLQA 2PZEA 2WMNB 4C7OB 2J46A 3FWYA 1IXRC 2GZHA 3EX7C 3NDPA 2BOVA 2HLDD 4M22A 5JECA 5JWRA 4JLPA 3MSXA 4AYWA 2ZANA 5B64A 1FTNA 3TSZA 1TEXA 4MRRA 2QG6A 1VG8A 4A6PA 1SVSA 3GMTA 2JCSA 4EPTA 5TDHA 4TMVA 2ZRHA 2WAYA 1G7CA 2IWHA 2GCOB 1ZP6A 3U61B 5H1YA 5D3QA 1C4OA 2Y8EA 4NYJQ 3X1ZA 1ESNA 4IVPA 1X6VA 4TYYA 1S4QA 1G19A 2ZRDA 3QI2A 4IJMA 2QQ0A 4FD2A 2YKGA 4FMCF 2Z6VA 3EIEA 1DAIA 1EFTA 1XEWY 1E2MA 1KNXA 3EWAA 3RYTC 4B6FA 1OV4A 4Z8XA 5JJKA 4A0HA 1OPXA 1L4UA 1QHNA 3RRYA 2GEDA 1XTJA 4NYIR 1G5PA 1W5SA 4UNRA 1GNPA 2BJWA 2CK3D 3KXLA 3X2SA 1XD2A 4FCWA 2OAQ1 1N0UA 1LTQA 3O8RA 1VG9B 1NF3A 2KB0A 4CRWB 2B7CA 3ASZA 1E96A 1AZSC 1GWNA 3AGQA 5JWHA 2A2ZA 3KQLA 2VL7A 2GJKA 2VF8A 2ZJ5A 3N2IA 5EP1A 2REXB 3SJCA 2J0UB 2NZ8A 3B2EA 2Z43A 3QUSA 3UG6A 1Z6TA 3AF3A 1NBMD 1ZINA 3I62A 4Q1BA 2WPDD 1U9IC 4UQOA 2BEJA 2WOOA 3K70B 4NPHA 4HDCA 3H4MA 1TX4B 1OFIA 3GLFA 3VFDA 4ZV4A 1NJFA 1QG2A 4PC3A 2P6UA 1E79A 1HUQA 1TQ4A 4R7ZA 5KNDA 2IYYA 1IN6A 1TADA 1G8GA 1P4SA 4EQ6A 5IHPA 1E32A 4OK3A 1TPZA 3DEFA 3W90A 2C77A 3THYB 3I4LA 5KYKA 1XTRA 2E1RA 3HR7A 4D25A 3RLFA 3A6PC 4XD7A 2ANCA 3I32A 3AF0A 3TNFA 1AIPA 2SHKA 2WJGA 3TUZC 4S2EA 2YWGA 4JVNA 1AQUA 1KZGB 2CJWB 4GMXA 1YQTA 3G82C 2PEYA 4BFWA 1CR4A 4FCVA 3SU8A 3MJHA 3SJBA 4BASA 1RRPA 2JJ8A 4PSVA 4ZDJA 4A15A 3LDAA 1XMIA 4HAYA 2J7PA 1N6NA 4M4SA 3RVBA 4DCNA 2W2VA 4C9BA 3TLXA 4XWKA 4KYUA 5EZ6B 5JS8A 3IO3A 3LWNA 5HKKA 2VEDA 2QMOA 1G8FA 1W7AA 4MGYR 4BFTA 4V02A 2JGNA 1OHHD 4HZUA 4AK9A 5KUTA 4O25A 4JBWA 3RSLA 3CWQA 3LW8A 1VG0B 1GOTA 4GDFA 1AQYA 1IY0A 3A4NA 1NBME 2HT6A 2F1JA 1TF5A 2W6JA 4V03A 3IIMA 3B6EA 2WKQA 4C3ZA 1EG7A 2GZAA 1XXHB 3ONWA 4UXIA 2WSMA 3Q7PA 2ZYVX 1KI1A 3OEHD 2R6GA 3K0AA 2RGBA 3GFTA 4KI0A 1MRNA 1RVDA 3G0HA 3SBEA 2OT3B 2IK8A 3ECCA 4XOIA 1KO1A 1H8HD 5DI3B 4AC9A 1KK0A 3ZVNA 3K9HA 3KTAB 3RC3A 4YMUA 1AS2A 2J1LA 4JLVA 3NG1A 2VP0A 4U02A 4B3XA 4IDNA 5C4MA 1Z22A 4GFDA 4FWTA 1KI6A 1UJ2A 2XJ4A 5E7JA 4NCJA 4CEHB 4RVCA 1Z83A 3GLGB 1SXJB 2IEZA 3K0CA 2XSZA 1Z0JA 3C16C 4TZ0A 4BWYA 5FBRB 5C46F 1E1RA 1SGWA 3DHWC 3X1WA 1HA3A 1U0LA 1X8LA 1S1CA 4PSKA 1OXVA 4N3NA 2JDID 1W4RA 1G8PA 4QOSA 4UXJA 3CX6A 1W0JD 3HJNA 3U3OA 4IKEA 1E9SA 1OSNA 3BB1A 4OYHA 5KO2A 1KJYA 5LB4A 1P6XA 3HP1A 4M1TA 2VIIA 2F1IA 4US0R 1E2LA 2QL6A 4HUQA 1V5WA 2Q3MA 3S1AA 4DDUA 4TLEA 3ZIAA 2G9NA 1YZNA 4ON9A 2ZJ2A 5FUWA 5E4FA 1JB1A 4MDEA 4R2HA 3IPYA 3ZJYA 3IEUA 5CJPA 4MUAA 2BMEA 1WBDA 5HE9A 4XVQA 1F5NA 3A1TA 3KL4A 4W5WA 1LS1A 1WRBA 2FOLA 3BC1A 3LFUA 3MAAC 5LB2A 3PFIA 4MKIA 5TV2A 4M9ZA 3EC1A 4AG5A 2C78A 3GEHA 3SZRA 5DYIA 2GBLA 3SS8A 2B8WA 2N42A 2RGNA 1NN5A 1K6MA 5DYGA 3WMFA 5EXPA 3T34A 1YZQA 3BS4A 5UKDA 3VX3A 2BKEA 2OBNA 2EQBA 4G3XA 4P4SA 2FFQA 4D4JA 2OV2A 1G21E 2NIPA 3I72A 2BHRA 2IUUA 4LHXA 4MYTA 4EPYA 2I1VB 1LY1A 2A3RA 2OESA 4NONA 1WB9A 3CIOA 1IY1A 3DVLA 3QVUA 4WIAA 4JSYA 1JJ7A 1G6HA 1J7KA 4QGFA 4DUGA 2ZSAA 2EWWA 3GJ3A 3ZQJA 1UDWA 1W36D 3HWSA 1US8B 1E2QA 2GF0A 3VNUA 4IOLA 1N0VC 3CH5A 3KZ1E 2ZRAA 2ATVA 1ZNXA 3EZ6A 4HI0E 4MGKR 2J59A 4OQMA 5JRZA 1BYIA 1P2TA 2VHCA 5FI0B 3JZMA 3GEEA 2IXEA 1G3IA 3AV0B 1YRBA 3SC3A 2L0XA 3UWKA 4DXAA 1ZM9A 2CLDX 3L8YA 5CB8A 2WJHA 4QM7A 1XPRA 2CE2X 4JL8A 4CEIA 2CEAA 4RCYA 5EE0A 2HF8A 2ZE5A 2RMKA 3THWA 3U5ZB 2WWHA 2CDNA 4JLMA 3IDQA 1NLZA 2H92A 1AZTA 3BB3A 1NY6A 5DISB 2DWQA 1MOZA 1RJ9A 2GTPA 3CZQA 2OZEA 3KDSE 2EFGA 8OHMA 4UNNA 1E0KA 2AK2A 1GNQA 2F1HA 4CZ2A 1JI0A 1GUAA 2VHTA 3J81k 3JVUA 3P26A 4B75A 1LNZA 1OKKD 1CR0A 1Z2AA 2WJYA 2GXUA 4GZMA 4KJZA 2AL7A 2FSHA 4K8OA 1Z0KA 3CUEF 4LSGA 4TLCA 3IIKA 3KQKA 2OE2A 2G1KA 5E3HA 2PJZA 3SI7A 1S8FA 1SKYB 3C15C 2HXYA 4FINA 4LHYA 4Q47A 1YRAA 2QI9C 2FSGA 4XH9B 1ZC3A 1KI7A 4JVSB 3BBPA 4LJYA 4QBHA 3EPJA 3PV0A 2J87A 421PA 1EESA 4HLUA 2ZSEA 5FUVA 5KSZA 2D2EA 1P9RA 1E3MA 3LV8A 3QENA 4P0TA 1IN5A 1U9IA 4U00A 5IRCD 3NKVA 4D4KA 2W0SA 3AKEA 4TT3A 1D2NA 1ELOA 4EPRA 5DE3A 1HE8B 1KJZA 1JJVA 3NBYC 2HV8A 5FI1B 1WBBA 1E94E 1CRQA 1W2GA 2BCGY 2NPIA 1JAIA 2GAAA 3RSOA 2FZ4A 4C0LA 3GLIE 1Z28A 2J41A 1RYFA 2OCPA 1GP2A 1GTVA 3IGFA 2A7QA 2CHGA 2F9MA 1Y3AA 3KXKA 1KI3A 3IBYA 4Q7JB 4U5XA 3QSYA 2BC9A 1XD8A 3G5UA 4PXAA 3T1QA 1OH6A 2ZS8A 5GJVC 4BLRA 4B74A 5LDDC 2ZXUA 1R10A 1M1YE 2RH5A 1R8SA 4DCTA 2IEYA 5JI2E 1HEIA 4RKEA 2IYRA 4PZLA 3SR0A 4YXWD 2G83A 3KKNA 4B71A 4NBSA 5JSZA 3X1DA 2G6BA 3B1XA 221PA 5FPSA 4RD3A 2FSIA 3THXA 5EXTA 2FU5C 4IDQA 1E2KA 1RRFA 4LJ7A 4OQNA 1N6IA 2ZRMA 4L4UA 3X1XA 5FUXA 1Q1EA 4KITB 5J4KA 1NSTA 3WYGA 4DHEA 1WE2A 3LQRA 2F43B 1YVDA 4PHFA 1P61B 4M0LA 2XGJA 2YOFA 3HR8A 2JIZD 1E2GA 5HE8A 2BKUA 3ZGXA 1ZU4A 1UAAA 1W36C 4LPSA 3NBFA 2QBYA 5IF9A 4M9XA 2WIBA 1HV8A 4Z51A 2K5UA 2XTMA 5HCIA 3MG9A 2X1VA 1G291 1GRQA 4D6PA 1YR8A 2BVNA 4HSEA 5AJWA 1A2KC 2RGDA 5G3ZA 3GLFB 1CBUA 2HLDA 2ONKA 2CL6X 3QEOA 5DH9A 2WWYA 2CJWA 4EJSA 4IHQA 4P33A 1D2MA 4RD2A 3FDIA 4Q00A 2ATXA 3SYNA 4EQ6B 1E1QD 3FFBA 3BGWA 1JEDA 4EPWA 1XEFA 3IIJA 2WM9B 3QQ5A 1G18A 2RHDA 2C96A 3VTKA 3RANA 3QXJA 2XXAA 2REBA 1G7RA 1P2UA 3CF6R 1R4AA 3EAQA 3WMEA 3L0OA 1E2JA 3W6OA 2P2LA 3H1TA 2IYSA 1N6RA 2D3WA 4QJ4A 1M7HA 1IQPA 2RGEA 1N6PA 3VR3A 1ZAKA 3AUXA 4BFSA 1L7VC 5F2EA 3B9PA 3VKHA 1COWD 3LD9A 1U8ZA 4DKXA 1R6BX 3CONA 4P4UA 4F4JA 1XXHA 3SFZA 4QNRA 1E98A 2DWPA 3GLHE 3P4XA 4BZPA 3WY9A 1U2RA 2IL1A 4HZUB 4LYJA 3OIYA 3K0SA 3TMKA 4RKFA 1GDDA 2ZR0A 2XJ9A 3JZAA 4MYCA 4RY2A 4URZR 4OI0A 1SKQA 5FH9A 5DI3A 1DAMA 4QHTA 2UVQA 1ZM3A 1K5GA 1FUUA 2O5VA 4TN1A 2D7CA 3M4YA 4CEHA 5E7IA 1TUEA 2V4ZA 2EYUA 2WPDA 1FUKA 1SXJA 4ILEA 1XTKA 2AX4A 3K0AB 1G8YA 2W6IA 1NIJA 5AUNB 1F2UA 3MJRA 4TYPA 1KKMA 3PR1A 2WTUA 2GXQA 3IUYA 4Q7LA 2NQ2C 2A9KA 2FDCA 4EPVA 4W5HA 2YC2C 4ARZA 3ZD6A 4JIMA 2NTYC 3I8SA 3QEJA 4B2PA 4CEJB 1S3SA 2P67A 3R8CA 1EWRA 1XPUA 3CWZA 4DIEA 4D2IA 3WP1B 4XVUA 2VHJA 3MWLA 4TL7A 5F9FA 1CR2A 3IHLA 3VR1A 1J8MF 3U44B 2IS6A 2FGJA 4JJKA 1SQ5A 4IW3B 1TNDA 1Q3HA 1U8AA 3Q5EA 5L3QA 2IBMA 4KYIB 3DM5A 3RC8A 3AKYA 4JLJA 4B35A 2GESA 3LW7A 2I3BA 5CIQA 4OQXA 3RHFA 3GCGA 4LJ8A 1R5OA 2VLIA 2J7KA 1CJVC 2XITA 5HCNA 3RRZA 4EPXA 4MRPA 4WZBE 2QGNA 4HB4A 4OI1A 1KDPA 1LV7A 1NVUQ 2GKSA 3B1VA 4Q18A 4BFXA 1G3MA 3AVWA 4JYBA 1HURA 4TWZA 3S1AB 1OFUX 2Q9AA 2GK6A 1Q57A 1A5TA 2ZVPX 3MD0A 3T12A 4D4LA 4D0NA 5K8TA 1Z47A 2EW1A 4CGZA 5FOUA 4OHYA 1L4YA 1OHHA 2ZSFA 3ZS8A 2X2EA 2QTFA 4RJLA 1ZRHA 1UPTA 4XWOA 3KB2A 4IOMA 1VDZA 2ZSBA 1CKEA 1G20E 1R5NA 5EE1A 1JAHA 1OT3A 1NMXA 4ACBA 2HYDA 1MABA 1Q1BA 5DSZA 4C2UA 3DOEA
chains in the Genus database with same CATH superfamily
4A0QA 3BILA 2HWKA 1NG1A 4HNVA 3IP6A 1ZH4A 5IEJA 2HEIA 4R5HA 4MKXA 1LWOA 2OENG 3T0GA 3C3PA 3C6ZA 1S9DA 2C9YA 1T4CA 3B3FA 1P18A 3QPAA 3QVLA 1T5TA 1ES9A 3Q8XB 2HMYB 4GRDA 3JQ6A 3OQOA 1Z63A 2JH3A 3HS3A 2G1AA 4B6GA 3MLEA 2VDPB 4PFQA 1QZXA 4EL0A 1N2BA 3SWWA 3F97A 2J0VA 1QMGA 4R9NA 4BLOA 1DI0A 3R44A 3C0KA 1VCNA 4RTSA 3FNGA 1EVIA 2BN4A 1KVQA 3W5VA 2BFWA 1T1SA 4MWBA 2W58A 4ZQCB 3ZVRA 1O0CA 1KGDA 2V7TA 3B6KA 1J2YA 2R0QC 4G67A 1NWCA 1XDSA 3IV7A 4PGFA 3RIYA 3NHFA 3FZYA 1I51A 3PCXA 4JEIA 3HEMA 1G1MA 2V7QD 3DFKA 4L16A 4YT8A 1DCFA 4TTIA 1ZUNB 3JU3A 4Q1DA 5F2KA 4QARA 1K98A 5TT0A 3RF6A 1YKFA 5ALRA 1HL3A 3USCS 4DWVA 3F9RA 2BEVA 1THZA 3VHQA 4CKEA 4CKZA 4WN9A 1RC8A 1VYUA 1N5IA 5BUSA 1R9JA 1FYWA 3I6IA 3NAMA 2WM8A 3DZFA 4YMSA 4Z7QB 2O1SA 4L57A 4X93A 1NI5A 3BXHA 1PEYA 1T8TA 4H9GA 3WHKA 3V4VB 5JU6A 3HA7A 1FYFA 2X0RA 4OHFA 4PBSA 4EFMA 4GI5A 1IHPA 5JRJA 3THWB 3I73A 4FX5A 4HNRA 1NVXQ 4Q66C 4QULA 1SOMA 3VPFA 1M1NB 5IK2D 4FFSA 1NULA 1EYZA 1QR6A 2ZE8A 1Z2CA 4TTTS 3IAAA 2UVPA 1VHJA 2GBCA 2UZIR 1ZUD1 5LQSA 1JQKA 4M1MA 2UZ1A 3SP1A 5HRUA 2AYYA 2I0FA 2X2FA 2QF7A 2Y1OA 3ZD9A 4NX2A 3JQ7B 4JH0A 1DOAA 3RTBA 4DV6B 2O1XA 1PN3A 3L7YA 4GOOD 4MJ3A 4XCQA 2YHIA 4BECA 4PAOA 1UXOA 5GGXA 2I5PO 4AIIA 2A5JA 3T7TA 2R5WA 3GGPA 3OJCA 2WLTA 3WFJA 2Q4DA 2ZPTX 3ORSA 2O0MA 4M0KA 1OBOA 4N0MA 1A7KA 3CCBA 3QBVA 3USES 4BNGA 3HYLA 3SKYA 4BO7A 5ADWA 4CM3A 4OUDB 5B36A 3ZJUA 4AO6A 1T8PA 4LMRA 1B6RA 3H5IA 1IHUA 3CXRA 2HSDA 4J2HA 4G4JA 5CLLA 5K3EA 3K30A 3A26A 5G53C 1GZ4A 1K3TA 3EDMA 4FB5A 3HADA 1OJLA 2N1MA 2OLKA 2ZYIA 1W1IA 1E1CA 3ONEA 5EFZA 1GL9B 5KTKA 4KR7A 2DRIA 3K5HA 1XEWX 4HWPA 1IBMB 1DGQA 2GN1A 1JLSA 2JLBA 2QPOA 4PLWA 1L5HA 5B6JA 4RY0A 4J0FA 5KMGA 1SQ6A 3K32A 1XWFA 4BFYA 1XIVA 1WU8A 2ILTA 2PXXA 3FLEA 1ZC4A 5J1TB 4Q24A 4FYYA 1KYQA 5LYJF 5J2TB 4OLBA 1KIMA 4MRMB 2ODAA 1Q16A 3N86A 5HOQA 1X7GA 2ZB7A 3ZDCA 4AAYA 5ALHA 1WAMA 3VZPA 1HSZA 1D1SA 2HN9A 3TIXB 2V9PA 1NF2A 2BZ0A 1P6QA 2XNDD 4IV0A 4URHA 2I2CA 3SFTA 2DYKA 3T0FA 3DGEC 5E9AA 3WXBA 3ZZUA 4B73A 2HR1A 5H4HA 2OVBA 4Z1MD 1KY4A 4I4TA 2YVLA 1ZA2A 2LTAA 1Y3BE 3PG5A 2IV2X 4MUEA 3CVJA 4UW9A 4ISBA 1QJ4A 2OAGA 3S5JA 1FMFA 4B31A 1C3JA 4PN7A 4ZO6A 2BBWA 4JLSA 2C7QA 4OG2A 2C95A 1VE1A 3MBOA 2C2OA 2AD1A 1Z5UA 1SUSA 2XHEA 13PKA 3BSWA 3OO1A 4EGFA 3HMQA 3JASB 4XUDA 4E4RA 2Q1SA 2GWHA 3BXEA 1DAFA 3NBQA 3OCCA 4PSAA 2GM9A 4UVHA 2ZRFA 3AHJA 1PD1A 3RWMB 2Q45A 3N8HA 2JLCA 4W1RA 4ES6A 5JSZB 3VU1A 5BPHA 1THMA 3L40A 1B6GA 2YWCA 2CBZA 5HQ3B 4RIEA 4Z4GA 5EWLA 2PSDA 1DPFA 2PX4A 4R83A 1L7MA 1GG8A 3EOAI 4CODB 1FBNA 1KJNA 4L8GA 1XAJA 3MJVA 4UASA 1EX7A 1NI4B 1OLOA 1L4BA 1HE3A 4W1PA 4ALJA 2G0TA 3EW9A 2ZRIA 2H0QA 2AZ4A 2V5UA 4MNTA 3RQIA 2QTNA 4TM8A 4F4UA 4RA9B 5BV0A 5E6UB 3TLGA 2RE8A 2X0JA 3FRIA 1TLFA 3CUVA 1K08A 3GLVA 3K6RA 3W04A 1W35A 3HFRA 5ALXA 2Y1FA 1I1QB 3FVTA 3TTTA 2YINC 4TYWA 4MS3B 2QBYB 4NICA 3KE9A 4B3SB 1DKPA 3PPYA 4MIYA 4MQLA 4QUKA 2JW5A 3DMTC 3WMRA 5JBIA 3P9ZA 1ZVKA 3LPLA 4V0OA 2VOEA 1XC7A 4P31A 1C1YA 4XM1A 4CNBA 1NTRA 1QGOA 1LI7A 2Z4SA 4NYJR 1FJXA 4KH1A 2Z6AA 3FHOA 2HZ7A 4LJSA 4MDFA 5DHFA 4L6CA 4M21A 4CMCA 4RELA 2IX3A 5G3YA 4IJVA 3PJGA 1AJEA 1RBMA 1R15A 3GELA 5KTPA 5DI9A 4OH1A 5ES4B 1DLJA 1XWIA 3VR4H 1EFPA 3L7JA 3CPJB 1WO8A 1NBEA 5CX4A 5I9SA 4BGDA 4CL3A 1PJ4A 3V1TC 5AMXA 1SUPA 2JZNA 4JLBA 4BWFB 1GKLA 2VT2A 4A73A 3P9SA 4F2GA 1NF9A 3HDQA 4FKMA 4GEKA 3M6UA 4WZ6A 5K8IA 4PLYA 4QGHA 2ZJBA 3W78A 2WJAA 3MWJA 4ND4A 4NOLA 3UCFA 4EO7A 3HO8A 3HDTA 5KIAA 2EVWX 4EF4A 2XWQA 2XB4A 3Q11A 4ER5A 3BH7A 1IJEA 4Y6QA 2HU8A 1EWVA 1HRDA 5IAKA 3CBGA 1I3LA 5B58T 1H85A 1X13A 5F3DA 1WDTA 1B6SA 1ZCJA 4LW8A 4Q7KA 4E5NA 3M1YA 1YB4A 2JFZA 1KEEA 3J7AC 2XOEA 1W1WA 3QBEA 1Q92A 3KKMA 4C0QC 4QYSA 4DVJA 4CQJA 3DBRA 2V7EA 1E4OA 2V4UA 4CN8A 4YRKA 5CBPB 2SKCA 3EMKA 1A0OA 2YS7A 3QF4A 3QNUA 2PLWA 4H15A 4KFRA 3LE8A 3WKEA 5LP1A 1ZOPA 1FFEA 4XJXA 1W30A 1FF9A 3DMRA 1WA5A 1Z7GA 1FDRA 2ZRLA 3DE1X 2GLUA 1QBGA 1WWKA 2Z83A 4UU8A 1KYVA 1UKEA 1UQRA 2RHRA 4RQUA 3CKMA 3UH0A 4UTNA 4EW3A 4DMHA 3K8YA 1UAYA 4N0PA 1P7CA 3U44A 1BOOA 2QK4A 3NATA 3IKLA 4MYHA 1D7OA 1M10A 1YQEA 3JARB 2ZWIA 2IC5A 5FB3A 4ANFA 4FTWA 3MQ2A 2DPYA 2NXJA 1Q14A 4G0OA 2EFCB 3EGWA 4OQQA 2AHOA 3B1JA 2IA5A 4TWRA 1E3SA 1EFRD 1WDLA 4NEGA 5JCOA 1Z6QA 2BLLA 1SC6A 2HJRA 4QWMA 1HMYA 1DQYA 1P9OA 1WXIA 5C1BA 1YZGA 2KBFA 2J6CA 4L78A 1VKOA 1PR4A 2F1RA 2HHLA 1KE1A 4BX9A 3MPUA 3EA5A 5LD2C 2E4UA 4N5MA 1Y1PA 2C59A 2OPBA 3LL7A 3WRWA 1IJKA 4LI0A 5T5QA 2RHLA 3V4FA 5LBIA 5AESA 3D4NA 4UE2A 4GKJB 3B7PA 3WDMA 4CI0B 5L4NA 2CV0A 1N8NA 1X38A 4JJ8A 4YAIA 4JUBA 1I4DD 4FMCB 1G5IA 4ZHSA 1GT6A 3E22B 3QTTA 1NBIA 2C29D 4P82A 3LUAA 4F11A 4DREA 1M6HA 2HMUA 3TZHA 2A1UA 3PTLA 4BU0A 4FIZA 1LSSA 3FROA 1UBKS 1R27A 3I0NA 4L6AA 1X7ZA 2XCTB 4QUJA 4RV9A 1V7PC 3IQDB 2XIQA 4QRHA 2O8EB 5DLYA 2JFOA 1A5SB 1RAEA 4LISA 2G4CA 3TQFA 1CUUA 2XY4A 1A2BA 1AKYA 4I4NA 5JAOA 2CVPA 3FOEC 5T3YA 1WMEA 1PX0A 3RVNA 1PJLA 3KJHA 1KDZA 3THOA 3G6KA 4GMGA 3ZGYA 1JT9A 3KKPA 4LJ9A 4DSOA 4B09A 4EGAA 1X1CA 2XAAA 4I4LA 1WXWA 2PWYA 5H9WA 1K4YA 5KREA 1B15A 1YVEI 2NU7A 4P3YA 1E9EA 2IIVA 2G77B 4OAOA 3MUNA 3H5NA 3P27A 1VMDA 3DDOA 1Z3IX 1UKBA 1U7OA 1B2RA 2YN2A 3K5PA 1XMJA 5CVDA 5DBOA 2IYEA 1PVOA 3LSTA 4K3UA 4LY6A 5EGSA 1PQWA 3DHYA 4AECA 1GGFA 1R6VA 5J2UF 1FY2A 3RYHB 5CLJA 2R00A 4FBGA 3T35A 1K27A 5JFGA 3ADCA 1JBKA 3FCOA 5KVQA 2V1XA 3OOJA 4RVOA 1BDHA 5CK5A 1W9MA 3TQOA 1YMUA 1XTIA 3RAGA 1TAQA 3OUUA 1J70A 1YL5A 3RAEC 3SM9A 1WDMA 1GO2A 4N01A 1UDAA 2G70A 4HNSA 1XJ5A 1G21B 2X2OA 2C2GA 3U9SA 1DBVO 1Y5LA 3KT8A 3MS7A 4MGHA 4FT2A 1GITA 4CF4A 2QUJA 5JC1A 3NGMA 5HVNA 5IBCA 4OLAA 2H7VA 2GKOA 2J32A 5HQJA 3ZWKA 1L7BA 2B8NA 2Q8NA 4OJQA 1OBHA 2VKTA 3PQFA 1L5NA 3SEFA 1TTHA 4CCSA 1XHFA 4D02A 3EVEA 2QSZA 5KYTA 4WCVA 2GPYA 4DJTA 4R0VA 5DU2A 1RYHA 4BLTA 2PIDA 4NMWA 2YOGA 3SJ7A 1E9DA 3P9IA 2FEOA 1TVMA 1LF5A 4QUEA 2Z8YM 3EZGA 4DG5A 8MHTA 4NU0A 1N6LA 2FZLA 5IT4A 1M2VB 4R2WA 4CIDA 4S12A 3DE2X 2C82A 3I2FA 2DHEA 3TZEA 1X1SA 4RJIA 1NY5A 1Z25A 4YONB 3O4RA 4BGIA 5BOSA 3UXMA 2B0CA 2RHHA 4UHKA 4KHPB 4OHWA 2C2ZA 2CFIA 1ZKMA 3HEAA 1XJ0A 1X9IA 3AC0A 3KQVA 3L6UA 1MT0A 3MTEA 2WYWA 4QBIA 4LOKA 3VZDA 1EG2A 4IJQA 1XB2A 2PYZA 4ZVSA 4XSHA 3S2YA 1Y1QA 2PTGA 3SDSA 3PGXA 4C43A 1N77A 2X77A 3D7NA 2F9LA 5GIOE 3CRMA 3WIDA 1XP8A 3ITNA 3OHMA 5KB3A 3L7AA 4JLDA 1CHDA 4XQCA 3H9JA 1LF0A 3QEKA 3IQWA 2XTNA 2QTCA 2PU7A 4Q9DA 1LBHA 2XMQA 4K81B 3VMMA 4YRNA 4QDKA 2JGRA 5IH3A 2TS1A 1V45E 2QAGB 3FDZA 4KSBA 1YJCA 5T57A 4BNKA 4E7OA 1Y7PA 4IFIA 2I4IA 2XMPA 3C3CA 4C04A 4XRGA 1ILEA 1A7AA 4KXMA 3TSCA 3R20A 3OHPA 1IAQA 4L0QA 4RTNA 2PT6A 1FU7A 2WG2A 4O5AA 4B6SA 3RSGA 1L4FA 1IU9A 1J9GA 2R4UA 4UFNA 2CCKA 4O2LA 1LRLA 3UWSA 1Y4UA 5IWCA 2EWVA 3G9QA 1E2DA 3GDWA 5JPCA 2C8JA 1QCYA 2OHIA 2X22A 4A2PA 3ZE2B 3ZZ1A 1SCBA 4LSZA 1OIWA 3L6RA 2RD2A 5E8RA 3PJDA 3VC2A 2PBZA 4RORA 1EEXB 3UPUA 1SBQA 1UKYA 3VVLA 2BGWA 1IZ7A 2LXNA 4NQRA 3D8RA 4FP9A 5FBLB 4RZ2A 2HZBA 3ZNOA 4ZHQF 2Q4RA 3AVPA 4ZQHA 2KLHA 1JQBA 2XF8A 3ROXA 1Z5ZA 2ZIVB 3FW1A 1YASA 2JHGA 3F90A 3DA8A 3KJEA 3JQFA 3R7WB 3SLGA 3ICQB 5FV4A 2VKQA 4MW5A 1P4AA 3O4HA 4E6PA 1GZUA 2AF4C 2ODEA 3BSYA 5IKXA 3WTCA 4M76B 2VWHA 1N5DA 1XVUA 1ZN8A 1K06A 2D1QA 1RADA 1T8WA 2ACVA 2W71A 4LAFA 5AK6A 1XEXB 1GGEA 6Q21A 5I5GA 4AS1A 4HWTA 3NHAA 3UFBA 2W2OA 3K53A 3V5NA 5JJIA 3EF0A 4LYHA 4JQCA 4Q4HB 3N74A 3O91A 1XNQB 4JR2A 1E4VA 1E2IA 5I51A 4BJ6A 1IIRA 4QHYA 1HFEL 2B7LA 3FYTA 2E6KA 2FZEA 3G3EA 1O96B 4WJLA 5AK4A 2X0FA 1SQGA 1HBJA 4XWGA 2NZXA 5DEIA 2BFOA 2VYNA 4CYMA 5FQNA 2E21A 2XKAA 1NVWQ 5U4QA 1KSFX 2LPMA 2X9LA 5EJ2A 2OXFA 3VSDA 5ALVA 2OGUA 3QUBA 3ZHSA 2HSZA 2A5YB 2WSIA 4CL0A 4UKDA 1HYEA 1KFJB 3H3FA 1NQVA 2OBLA 4GI2A 4AJ4A 1AURA 2RI1A 3COWA 1A69A 4GLBA 3IQXA 4JVMA 5JSYA 1YJQA 4AKTA 4Z4HA 3KKEA 3KZOA 3E70C 4W7IA 1GGKA 3DZBA 3KELA 3LWBA 1NAIA 3NORA 5COAA 5GJCA 1IPEA 2OUIA 4FGSA 5DNYB 2F4NA 2IOFK 2OFPA 3R4CA 3EVAA 1FUEA 4UU7A 4C4SA 1NI3A 3OZXA 4WJZA 3VZSA 2BFAA 3KC2A 4HDKA 3B6MA 5BRJA 3TFQA 5BN3A 5KSWB 4UFPA 3PQCA 1UM8A 2MSLA 4DUPA 2P9GA 4YUXA 2CLEB 1FNBA 4IUYA 4XYEA 1KJQA 1FSFA 4FDUA 4QE3A 2EJCA 4AJIA 1EWQA 1DWUA 3ORQA 4OGKA 1XQ9A 2QPLA 2RDMA 3E35A 3IAEA 3ZBQA 2F55A 1S2GA 1KDTA 4X3CA 1Z68A 3LKVA 1EVQA 1X1BA 4BGEA 3AEUA 2Y1LA 3ECSA 4MW4A 4QFMA 3QIVA 4GMDA 3F6CA 2Q9BA 3L8ZA 2AMYA 4HR7A 4MX8A 3UA4A 2P9YA 5EMJA 5KVAA 5A6SA 1BMFD 3GJXC 1SCNE 3C4JA 1QF9A 1OV6A 1WUHS 1JJBA 3NHYA 5JH7A 1IL0A 1D9XA 1EUDB 3JATB 4WINA 4ZAWA 3U3XA 4JU9A 3ZIAD 3EEOA 2X41A 4OB7A 3W34A 4DR4B 3E6AA 3GWZA 1W5TA 3P4YA 4NJMB 3GH1A 1B93A 8LDHA 4QDXA 4K0KB 1MH1A 4N0QA 4XFKA 1GGHA 1PNOA 2XUJA 1U90A 3IP8A 2VHQA 2HCJB 1Q6ZA 1UWKA 2ID9A 1R4ZA 4FYWA 2IUSA 4UC0A 3RVJA 3DBLB 3W9SA 1HFKA 1YDEA 1LPSA 1JU4A 1UXIA 4OI2A 4BMYA 3CPEA 3SVZA 2A5FA 1P3DA 5KPJA 4KODA 3H84A 2CL7X 5THKA 3MHTA 3R9XA 5L53A 3OM0A 3NIBA 4HDAA 3QG1A 4UXHA 4X00A 5EYPB 1Z2DA 1R12A 4FQ5A 2EJVA 3E84A 3H18A 2FX3A 2PZBA 4H16A 3PPIA 5BMVF 5C18A 4WLOA 4G01B 4M55A 5F35A 4QOFA 4O59O 5BSRA 3PDWA 3ZIUA 1QIGA 3WAJA 4HTFA 2WF6A 5CLGA 3CRVA 5AHOA 5JEDA 3WDLA 4AM8A 1OH8A 2I3ZA 4FDAA 1BEUB 2GBPA 2ZRCA 1X7WB 1P0QA 2GCPA 1GAXA 1YOVB 4CN9A 2C4WA 1UMBB 3DPUA 4BAGA 3AB7A 3QJYA 2RC5A 1ZJ5A 4PNHA 4CMIA 1D5CA 2MR6A 2VQEB 3HPRA 2CLFB 1WY5A 3DBHB 2EW8A 5FKJA 3BIWA 4DLWA 2E9SA 3VXKA 4DWJA 2VK2A 3G7SA 4PCVA 1JFTA 1NC3A 3I0MA 1WXQA 3ZCPA 4MUBA 4MW7A 4DIMA 4F92B 4JYPA 3IR5A 1A9SA 2CVZA 1TM5E 3D2BA 4FKZA 4KGVA 1E6KA 4WK2B 4B4VA 5I3CA 5IZCC 3CUUA 2ZTVA 4N41A 10MHA 4RZUA 1JEAA 1JECA 3GROA 1U2ZA 5K6AA 5H8WA 1AB5A 1AQ6A 2FVXA 2JBAA 2VHWA 1OXTA 3LCJA 1K5PA 3V2GA 1A8PA 2B1JA 3E2MA 4WSOA 1ZNWA 2H0RA 3AEXA 3CB2A 5F3WB 2Z9DA 2YRXA 3MTDA 2B6HA 4KGXA 4XYBA 2CLSA 5EP3A 1O6FA 4MW1A 3LA6A 3OPXA 3QXXA 4RL4A 4HB0A 1YB1A 4UNPA 3TNDA 2NSYA 1QSGA 2XMZA 4YMLA 5EPUA 5B7NA 4ZCPA 4RD0A 5TPZD 2DQKA 5C7OO 2R1UA 2BJHA 4NCAA 4AQ7A 4K9KA 5TPWA 1X39A 2AXPA 2JA2A 3LXXA 1PJCA 3M9LA 1S3GA 3GPIA 3PQ8A 2C1EA 5E3IA 3QYJA 4M0DA 2MSWA 2W2TA 3B6JA 3OEHA 2FE4A 2CFCA 2A67A 3QOXA 4RLQA 3DZCA 1CVRA 2CF5A 2XQVA 1RHMA 1IG3A 3GVPA 3IMKA 2KMLA 2JJ1A 4MO2A 5J59A 2FR8C 3GFSA 2I6FA 2HH9A 2P6PA 2ECFA 5F98A 1M54A 2G5CA 2XNHA 3NIDB 5E6RA 4M98A 3D5QA 1E9BA 5J43A 2VYVD 3Q3EA 2P2ZA 4X6XA 2XCQA 2J0EA 3QVMA 2GD2A 1MC5A 2N75A 1DSSG 3M6IA 4FNGA 4PPQA 5E0OA 4BFCA 4F4CA 2KJQA 5E8JA 2MCFA 3C3KA 3LUGA 1F4PA 4O4LF 3OZGA 2HK7A 1U4OA 2WHQA 3CKYA 4MYRA 2QD1A 4EZEA 4OKNA 4AD8A 3ZCQA 4F46A 3C4VA 1GZ7A 3HJFA 3IHWA 5FWAA 3GRVA 1CS0B 4FGJA 3OCVA 4LECA 5GP1A 3QFSA 4FZJA 3TUIC 1DOHA 5I5EA 1UM9A 1XYGA 1XCGB 3VC1A 3HO1A 3LDFA 1CRPA 3OTIA 2D8AA 4RFSB 1EM8A 2HJWA 1YDGA 2P1ZA 5KC9A 1GA1A 2H4JA 2FWMX 2ZAIA 3RVRA 5TGZA 4MHSA 3L0IB 1ODSA 3L7LA 3BGSA 4N54A 4CMHA 4LE0A 4KV9A 5D3MA 4YAEA 3VR5H 1II8B 4YGXB 3U7IA 5ITVA 3OQJA 1DJQA 2BE9A 3NVDA 1WQ4A 4EKNB 3HUDA 4E4YA 3DCJA 2ZB8A 3C7AA 3D43A 4K1LA 3WL3A 1USWA 3Q4GA 5FT9A 3I39X 2LD4A 2ECOA 2WJ4A 1W25A 1WKVA 4YV7A 5D5HA 2HJVA 3TR5A 5KTSA 5CD1A 1NUAA 1K5DA 5DHRA 4ZEWA 4GQIA 2PRSA 3HJAA 1BKDR 3PNLA 3HYNA 5EE9A 1HE4A 4GUAA 3BD8A 4N0EA 1YA8A 3JR7A 4ZCTA 4G24A 4GEGA 4KBYA 3K92A 3FPJA 1Y3DE 3PIRA 1TQHA 3DVRX 2J3HA 3W3AA 1CB0A 2UZ4A 4WECA 1WBJB 2QM3A 4PPNA 1GL6A 1PT6A 4CUJA 4B46A 3QLJA 1QO0A 4G8CA 5AKEA 5GZ6A 5TQ2A 4MA5A 5JAPA 2QP9X 2HHHB 3BIFA 3SYLA 4C3UA 3WK8A 1W4LA 1Y9DA 3NAGA 1EVJA 4H7KA 5F2OA 2JGKA 3NRJA 4QTXA 3GD7A 2WWFA 4F3YA 2Y1EA 2H4ZA 4ZI7F 1TL7C 1VE5A 2FW9A 4IHJB 2XLCA 1FMCA 1UIRA 4NKRA 3C7CB 1NN3A 3R0IA 4XEHA 5ERGB 2DWCA 2OZLB 1ZSVA 4KXVA 2XUAA 1PQYA 1KOFA 3WL7A 5HQTA 1ADGA 2DFPA 4FNOA 2WEKA 2Q3FA 5EIXA 1FP4A 1XLTC 3IKMB 4JITA 4JUIA 1WPQA 2YJZA 3WNCA 2J0QA 1SQ0A 4YS6A 2ZT8A 1AXEA 2O0HA 2RHCA 3D7KA 3GMIA 1M7GA 3CJRA 3CKKA 3NOQA 3PUZA 5EMKA 1M6VA 4ACAA 3G2HA 2AFIE 1HE2A 3HWWA 5M29A 2UV8A 1CRLA 2ZKLA 4M1SA 4R1PA 5SY6A 4HH4A 4JDUA 1NFQA 2JEYA 5JO9A 3KLPX 3EZYA 4DSZA 2F6RA 3GBSA 1ZUHA 1ZVJA 3CM0A 4DBLC 4CM1A 4ETIA 2R11A 3ZV4A 5ALTA 1JG6A 3KEMA 3WXMA 4IX9A 2ONJA 1TT5B 4E5PA 4L4ZA 1CYEA 4YHHB 1D1PA 1NZJA 1SHLA 2V7UA 3QZUA 4DHWA 2BTQB 4CT5A 4NWIA 4GBMA 4B45A 4B4OA 5C8YB 3DD5A 3QHAA 3NHSA 4RDHA 2PTHA 1N0WA 1SA0B 5DGIA 1D8TA 2ZQZA 4M37A 4XDGA 1XF9A 3D8BA 1P19A 2YZGA 3AF5A 4Q4JA 1MW8X 5C5DA 3MWFA 3EOBI 3ESZA 1QH1B 1ESZA 3WX0A 1YTUA 3BMOA 2ZI5A 1J0BA 1ZK0A 4WT7A 3D54D 1QGUB 3HDJA 3BL8A 4OHZA 3RIGA 1AGNA 4D9JA 1Z5OA 4UBNA 2B61A 3B13B 5LP6C 3NS7A 3WK5A 4CJXA 2V54A 4J16A 4WHMA 5ITWA 3LMKA 3CE9A 7REQB 3P2KA 2QZ9A 4MR7A 3X1YA 2FWPA 3K15A 1TCBA 3ED1A 2ZUVA 1YJBA 1DRVA 3DZ8A 1IRXA 1CEQA 3DP9A 5ALJA 1TECE 2Q9CA 1L1EA 2DTEA 3CEAA 3I83A 5BUCA 2O8FA 1ISHA 3WK7A 4CLXA 1I3KA 1S02A 3T3IA 5AW2A 3IO5A 1HORA 1JJIA 3TZLA 1VKJA 3E5MA 2EIHA 1BDBA 2P2NA 1NYTA 4RF2A 3LY5A 4ASUA 3FYDA 1AGRA 4P32A 5DOZA 3TSOA 1KI8A 2BDUA 2Q6TA 2PSJA 4ZCIA 2Q5FA 1M76A 2IXFA 1C4KA 3FB4A 3LGXA 3LQQA 2XMBA 3AETA 1PRYA 1ADBA 3D5TA 3NGXA 4O2AB 5AHXA 3ZBUA 5GWXA 1EFUA 4B6EA 1KTIA 1TJPB 1ZI8A 2RKOA 3AINA 1Z5GA 2ONZA 3P52A 2VNIA 3PHGA 2JGAA 4K9DA 3T9DA 1PX2A 4DFDA 1BWPA 4KBGA 5L3RA 1OGJA 3JWGA 2XUDA 4OGFA 2VBGA 1PZMA 1CUWA 5KVCA 4TRNA 1JXAA 3H8JA 1DELA 2F00A 4QGSA 1P60A 1PUIA 1RQGA 4D97A 3SMQA 5KOYA 4MVJD 3CX8A 3F7TA 4O4JB 1IXZA 2V0CA 3PHIA 5AVZA 1N25A 2P35A 2C0QA 2J4DA 3F3MA 3S2GA 3EF1A 4AZSA 1WX1A 2GFHA 2CF6A 1AKRA 1YCDA 1OX5A 4G81A 4QQKA 4WAUA 4X8HA 2X8LA 3BIXA 2OGWA 5ALUA 3UIEA 2BP7B 2H63A 4C2TA 3OEWA 4L9WA 2AN4A 3OAAD 2YASA 2Z1MA 1PZNA 3ETCA 5AXDA 1X1EA 4ZAYA 2K2WA 3PGMA 3BORA 1FLNA 1TA0A 4L85A 2W2NA 3H99A 4MGEA 16PKA 4IINA 1O8CA 2Y93A 3DLAA 1QIJA 3GCDA 2XCLA 3LPDA 5CYPA 1ADJA 3GLHA 2D0PB 3EMBA 2WSBA 3AJRA 4JROA 5DXFA 5JE8A 3SKVA 1PO7A 2I4MA 3OD1A 1QS0B 5AW5A 1ADCA 2WJ6A 4HGOA 3L1UA 3OFKA 1OREA 2VHZA 1R0CA 2QL9A 1P1IA 1HR0B 3SR4A 1ZQ1A 3EB9A 4LZPA 5KBYA 2OGZA 4B79A 1JR3A 1MO4A 2PCJA 3D2AA 3O38A 4PHGA 5JAIA 1RPNA 4JBGA 3VKFA 2YRWA 2JH8A 3L05A 4KIFA 2F1OA 3HKEB 2FN4A 1VB3A 3MCUA 3SAJA 2AN1A 3SNKA 1GNRA 4HOYA 2YYAA 5CB4F 5JISA 1GTZA 4EBFA 1MKYA 1GHTA 3RVMA 4ERXA 4MRAA 5FTJA 4DNOA 4BVHA 1JN0A 1Z62A 2F3UA 2JFFA 1J1ZA 1SNYA 2AYZA 2XUFA 3HB0A 4PPGA 4PIVA 1G4AE 4LRSB 4XJVA 4E94A 3ZW9A 4B4KA 3RYIB 2FVYA 5KNCA 2F67A 2TSYB 2E5WA 5REQB 2CD7A 4YUAA 1QU2A 4J07A 5EVJA 2QXTA 1XV5A 3SHFA 3OG9A 3IJ5A 2WJJA 5ALEA 4FDMA 3Q12A 2CZGA 1VPEA 2VK4A 3ZY6A 1YU9A 4QFCA 4YROA 5LC1A 3O7MA 4RVUA 1Y89A 5A06A 4AY2A 4ZI2A 4KXNA 5KYXA 2E0IA 3TLEA 4NZZA 2WHXA 1IVYA 4YQEA 4X20A 5LA6A 1RW4A 5T6MA 4AG6A 1EWYA 1G2QA 2YUTA 3HGTA 3K09A 3N58A 2GCNA 2BGGA 4GNRA 3CQ9A 3OOYA 4GOJA 3GZNA 4IMPA 1Q7GA 4DLSA 3ETEA 4LWQA 4HDRA 2AVDA 4UAJA 4DW8A 3P9NA 4XWTA 1JNXX 2FQQA 5EKUA 2QENA 5C31A 3UJHA 1Q1NA 5D01A 3WKBA 3WV4A 1TC2A 2O7NA 5D7BA 1ACJA 4F1KA 1YDMA 5LM3A 1DCMA 3FG9A 2V45A 1KHHA 3EDOA 3F5SA 4Y30A 4DLYA 2QU7A 3OU6A 4DG8A 2WJ3A 4OQ4A 3S44A 1FS5A 3PEWA 1T15A 1Y4ZA 4KPGA 4YDSA 1Y9EA 1E9VA 2QVGA 4R1NA 4B17A 1QOQB 4CHTA 2Z6UA 3SQWA 3ET5A 4CR8A 3BGVA 1MPTA 2E4XA 4GXTA 4AUNA 3ZXUB 3EULA 3RARA 3T99A 4DNPA 4IGAA 5AM4A 1ECFA 3JVIA 2PMDA 4I50A 4POAA 1ATZA 2R2AA 2VTKA 4MI9A 4J4BA 1SCAA 4WFJA 3TX6A 1R18A 5AOBA 4ALLA 1CDOA 4KR2A 1IQRA 1QBKC 1VLHA 2CB0A 2AUNA 1UIMA 4XRRA 1U9CA 2VK8A 3S5UA 3EQZA 2PWPA 2QTHA 3OPQA 1XG5A 4OOEA 4D44A 1CIPA 1PG5A 2NO0A 2L2QA 2AOTB 4UCXA 1QP0A 4F1WA 3K94A 3WO1A 1ODFA 2C42A 4MLDA 4E88A 4Z4QA 5JXJA 1BCSB 1OE0A 2BUCA 4LYDA 1JIIA 1HXHA 3ICOA 2VQ3A 1ZK2A 2V5VA 2A86A 1Y3HA 3H1EA 3N2GA 3QLVC 4M99A 2PR7A 2W83A 4GGMX 4Y6RA 1R4MB 3RE1A 3IPRA 3LBNA 5AJHA 3WRYA 3BAZA 4EX6A 2Q1TA 3GF4A 1UT8A 2L69A 5EG5A 4AUMA 3AJAA 3N53A 1YHZA 4UNSA 2HO5A 2DQSA 3NDIA 3PR3A 2E4YA 2RB5A 4TLAA 1TQ6A 5F12A 1Z06A 1T9GR 4EGQA 1F0YA 1I6KA 1Z17A 4M1ZA 3ABIA 3TVTA 2X0IA 1UF9A 4CU5A 2DJIA 4DPLA 2V0GA 1EE2A 1OAOC 1BW9B 3L4JA 1Z7EA 2WV9A 3NWJA 4C03A 1GGJA 4QIHA 4BE7B 1CUEA 4TTPA 3P4UA 3N2LA 1RP7A 2X9QA 4HWGA 4U8GA 4RMNA 2VF4X 5G1PA 4G5RA 3RG8A 4KXYA 4E07A 3R6WA 3GGDA 1H1TA 3ELDA 4YO7A 1AHPA 1JA0A 4BB6A 1P62B 1E2EA 5B1SA 1F8XA 3F6EX 5EKSA 1DKMA 4FGWA 1FFAA 5ELLA 4QT4A 4HVCA 4RDXA 2PVCA 3LQFA 1FRNA 1MX1A 4D56A 3EIOA 1SKYE 2PQ6A 4GI7A 3IJRA 5EIBD 3ZWBA 5HJ2A 1DJMA 2OBXA 1VJCA 2G82A 1AKMA 4YJGB 4YAOA 1YZTA 4X45A 3PITA 4E15A 4EI7A 2H2WA 3RUCA 1LJLA 3RAPR 4G8BA 5CDHA 3KKZA 1U2EA 2YHUA 1F4LA 3G0DA 3AB8A 4BL5A 1PG0A 3M6FA 1DARA 3FCXA 3FB1A 4LV6A 5FYQA 3EYAA 3EVFA 2C3UA 3OOSA 5AVXA 3WFZA 4QJ3A 9MHTA 3UQYS 1TFUA 3GLUA 5JVDF 4QRIA 4PRLA 4BBAA 2P2DA 4KGDA 1CJMA 2BGUA 4ZEOA 3LAWA 3KQWA 4PS0A 4JT8A 3A9VA 3JYHA 4Y1EA 5TMBA 3EPLA 1Y4AE 2NSLA 5I3ZA 1JR4A 4Z54A 1ESCA 1JZQA 1C7JA 1GQ2A 2FJPA 3F8SA 3OBIA 3T94A 4CKBB 3ORHA 4UOEA 1JQDA 5LIPA 5FLKA 1AUVA 1C9KA 4HRXA 1I4TD 4NJOA 3R23A 3U60B 3GW8A 3TRFA 2GLXA 3FNEA 1J22A 1PT5A 2BY4A 4M3NA 2PQ0A 5F52A 4QGAA 1JPVA 1YZKA 3QVXA 4LC1A 3W8NA 5DM70 2F3PA 2NYUA 1O1YA 2QNRA 4TUYF 4BCBA 2XEXA 4A8JB 2GCOA 3SSMA 1T1EA 1XMQB 2AKYA 4BUJA 3L6BA 2VUTA 4X6YA 4KFTA 1YC2A 2JHCA 2IOFA 5LL6P 4FX2A 2Z5LA 2YVUA 3HL4A 4N48A 4FOTA 3R3ZA 4K5QA 3UJCA 3D6TB 5H83A 3JVVA 3OE5A 5FL7A 1NBOA 2W6NA 4ZTUB 4C3OB 2VBCA 3NX4A 3OZCA 3K16A 3QV2A 3QVWA 3ZDQA 5A5DA 3IIEA 5K20A 2AQIA 4CL2A 1ADFA 1P7WA 2H4HA 2JGDB 2YR0A 3LYLA 3OZDA 4FS3A 4QYMA 4Y2YA 3LT4A 1D6MA 1M8PA 5FUQA 5ER9A 1XMOB 5JI3E 5DX1A 4V0ME 2J7PD 1NRXA 1CJKC 1OIXA 1SIOA 2OHOA 3H2YA 1ZN7A 2A8YA 3Q9LA 4RGVA 4V2UA 2PX2A 3ER8A 2Z08A 1GKYA 2W22A 1UBHS 4CW7A 3RIXA 5AXBA 1C3OA 1PP4A 3MXOA 2WD8A 4Y18A 3ICVA 1QYVA 2QVBA 1EX1A 4N7MA 5EJGA 1XL0A 2C9DA 1RKVA 2IP1A 2NZWA 3IUSA 2NTNA 2YRFA 3RHTA 3O8OA 3U7RA 5CA0B 2UYHA 2FE1A 4HL6A 1F2TA 1Q19A 4DRZA 2QX4A 1R0BA 4L4XA 3W2FA 3CVOA 3IP5A 1A1VA 2Z5FA 1Q1AA 4P84A 1UPUA 1NRJB 2Q07A 1QFYA 4YAKA 4UTZA 5K09A 4JI2B 4QU8A 1EUCB 3VHXB 3UAVA 5JD6A 3LLSA 1G4UR 2ATIA 4CTKA 3QU4A 3I76A 2Q8PA 2QRLA 2YS6A 1BC5A 1T4MA 3VHLB 4LXIA 3LC7O 4NCKA 5AUPB 2XZLA 5FA6A 3TINA 3KYCB 3DJYA 4JJ6A 4NZOA 1FDTA 2VTVA 1YR9A 4YR7A 1GPAA 3CUYA 1XD2B 2ZYRA 3KT0A 5AO9A 4NFSA 3ZU4A 2IOYA 4RQAA 3T06B 1QHYA 3AILA 1P2SA 2BTEA 5CYOA 4RXTA 3ZE7A 1X1DA 3DMFA 4OJKA 3L79A 1N2JA 1P4HA 1QXSA 3L8DA 1JH9A 3KPJA 4KQFA 4WZAB 1F5SA 3TNYA 3WO0A 3FF4A