2ZIRA

Crystal structure of rat protein farnesyltransferase complexed with a benzofuran inhibitor and fpp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase subunit alpha
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zirA00
4GTOA 1QBQA 4GTQA 1TNZA 3DSWA 2BEDA 1D8EA 1X81A 3E32A 4GTRA 1N4SA 1N4QA 3Q79A 2H6IA 4GTTA 4YDOA 4GTSA 3Q7AA 1SA4A 2F0YA 3HXFA 1FPPA 3SFYA 1S63A 3PZ1A 1TNYA 3PZ2A 1DCEA 1TN7A 3DPYA 1NL4A 1TNBA 3E37A 1JCRA 1O1RA 4GTVA 4LNGA 3HXCA 1LD8A 1TNUA 1JCSA 1LD7A 1TN8A 3EUVA 3PZ3A 1MZCA 1N4PA 1O5MA 4EHMA 3DSVA 2R2LA 3Q73A 4LNBA 2H6HA 3KSLA 2IEJA 1TNOA 1N4RA 3EU5A 3DSXA 2H6GA 1FT1A 3C72A 1KZPA 1O1SA 3DSUA 1S64A 1N95A 3HXDA 3E33A 3DSTA 1JCQA 1NI1A 3SFXA 4YDEA 3Q7FA 3E34A 3PZ4A 1N9AA 4GTPA 1LTXA 3DRAA 4GTMA 1SA5A 1KZOA 3KSQA 3Q75A 1D8DA 4L9PA 1N94A 2H6FA 3HXBA 1FT2A 3Q78A 2ZIRA 4MBGA 3HXEA 1O1TA 1TN6A 2ZISA 3DSSA 3E30A
chains in the Genus database with same CATH superfamily
1UG3A 3DSWA 5JJ6A 3UIPC 3R7RA 2WXNA 3AU4A 3D9OA 5BW8C 4EZKA 4AM9A 4KBQA 4Q94A 2FI7A 3PE4A 3N71A 1O1RA 4JB8P 4TV3A 1U3CA 2KCKA 4B0ZA 4LNGA 2KZTA 5J08A 1HH8A 5G2NA 1LD7A 1HXIA 4AV7A 5KJNA 2RKKA 4HLLA 4ANXA 2PM6A 3QB2A 2HO1A 5HQ8A 2HM8A 3PNTB 2H6HA 3TXNA 3IBEA 1UJJA 1H6OA 1L5JA 4WNEA 3RRNB 4U8HA 1UN8A 2ZXWE 2DZNA 4P29A 1JCQA 5AQAA 4FLHA 3ZW3A 3PZDA 3T8KA 3ASNE 3AG1E 3J5PA 3QWWA 2P9KG 3T5VA 3DPDA 4TUUA 1MJ0A 2KATA 2YNQA 3EHQA 4WWNA 4GZDA 4KXKB 3ABKE 2ZIRA 2J49A 1NFIE 2XPIA 3UIOC 3IEGA 3AG4E 5ENNA 3SFZA 4U0ZA 4JC8A 1E8XA 2P9IG 4BFRA 4N5QA 1MYOA 3Q79A 4H7XA 4YDOA 1V54E 3JXJA 3Q7AA 1JUQA 3LDZA 2EIME 1NZNA 3EHMA 1S63A 3QK0A 4ILHB 2RFMA 1TYQG 1OWMA 2C0LA 1LF8A 1OWOA 4N5CA 4J0UA 3CHOA 4OYSA 4RG6A 3SBTB 2A5UA 3QNKA 4ANUA 4WNDA 3I4RB 2HYZA 3C5RA 4KZCA 3P2BA 1UN9A 3TAXA 3CVVA 3CK7A 2P9LG 4XI9A 5JJ7A 5E76A 4B94A 1WY6A 2R59A 3QC1A 3W9FA 2WQ7A 5E75A 4ANWA 2YHEA 2P9UG 5D66A 4AY5A 5DIZA 2YHCA 3L08A 5KJMA 3UMVA 3U3WA 4N2QA 4DI3A 2J4DA 4JW1A 4GYWA 2H6FA 1PY1A 2GRQB 4PS3A 2WQHA 5FZSA 4EBAA 5D2MC 2WXIA 1EF1C 1BU9A 4GTOA 4XIFA 1P5QA 4HQDA 3UM0A 1OCZE 3CV0A 3E32A 4KVMA 1DNPA 2AW6A 2NXPA 4K03A 1OUVA 3EU9A 4CRWA 4BERA 2BKKB 2CFZA 3S7FA 3PZ1A 5ANRA 2X38A 1Y6IA 3OTNA 5EYLA 4C48B 4ME2A 3ASFA 1H2VC 1QYMA 2LXLA 4GB9A 5ENPD 4OVVA 2RD0A 4DLOA 5ANLA 3ML9A 4MLPA 5CRVA 4HBDA 2VYIA 3RIBA 4K5CA 3LS8A 2IEJA 3MZLB 5BNWA 1TNOA 2L0TB 2YQ8A 3VLEA 3CHMA 5AENA 1SQMA 2ETCA 4F7AA 3TXMA 2XS8A 3FUIA 2ZGDA 1S0PA 3SFXA 1S70B 4EBAG 3PZ4A 3ZXPA 4TXPA 3IHYA 3CVLA 2JLBA 5FQ7A 3ASHA 4BT8A 4N3CA 4CT4A 2LUHA 5HRYA 2RG8A 2IO3C 2WXJA 1N94A 3OXLA 5JMND 3BG0B 1DC2A 2V4HC 3QWVA 5D0OD 4EECA 5EILA 2Y1LE 3DSSA 2X6HA 1Z3XA 4IULA 4DI4A 5KJLA 1YCSB 1PAQA 3U64A 1KPSB 4HORA 2GRPB 4ACLA 4EQFA 4TXQA 4E85A 2F0YA 3D9IA 5G05J 4XKBA 3BQOA 4G26A 1U2VG 5KWDA 4CDNA 4F1SA 3B7SA 2J9QA 2EIJE 5LCWJ 3JXIA 3B13A 3MCXA 3LKUA 4FJZA 1HO8A 3RU0A 4BX9A 2OEVA 4URKA 1JPLA 4G1TA 5EX0A 2I1KA 3FUMA 2L0IA 2VGEA 3APCA 4N3AA 4DX5D 4V3IA 5ENRD 1WM5A 2VGXB 4KVOA 3EIJA 4J8EA 3ZXSA 3B7BA 4QFVA 1O1SA 4HVBA 4WUYA 3QOUA 2XEVA 3S7JA 3ZU7B 2DZOA 4XZ4A 3ZNGA 2P58C 5BV0A 5BV1A 5DBKA 4YNDA 2B6CA 2PQNA 5BXOA 5CEAA 5D0QD 4HOSA 2P9PG 1E96B 3CHSA 2XPYA 2XEEA 3HG0D 3Q78A 4XE0A 3C3QA 2XZTG 3D9KA 3QARA 4L2LA 1TN6A 2KBXA 3LJ3A 5ARGA 1QQEA 4D10C 1RW2A 1KT0A 1N4SA 3BU8A 5CHEE 1SVXA 1IKND 2VGXA 4U07A 3U66A 1OWPA 4BETA 1ZB1A 5A6CA 3AS5A 3Q47B 3TG4A 3O4ZA 3CVQA 5AIJA 3QDNA 2V0PA 2WQ6A 5G05C 1B89A 2FBNA 4AXHA 3CIAA 3EUVA 4LG6A 3PS6A 1K1AA 3TWXA 4WWPA 2X6IA 3VLFA 4XI0A 3Q73A 4I2WA 5LCWC 1IHGA 3ZYQA 3FEXA 3UM2A 3FU5A 1FVHA 1N4RA 5G04J 2ETAA 3DSXA 4YVOA 2KM4A 4AY6A 5C1DA 3DEPA 2IFUA 1HF8A 5FZQA 3D9MA 3OXGA 4N3BA 4FJYA 1W3BA 3FULA 3ZVVA 2DWZA 3NZSA 1KZOA 3U9WA 3LEWA 3CVNA 2VSOE 4CCAA 4GU5A 3V2OA 3SO8A 1FT2A 5A23A 2AVPA 1Y8MA 2XGMA 1BI7B 3HYMB 1MX6A 3IKOB 3L13A 4LEUA 4L23A 3PDNA 3L16A 3SQVA 2QZAA 4GCNA 3BUAA 3UT8A 4UWKA 1XGWA 1SA4A 2I6HA 4CDMA 4Q69A 4DRXE 1H2UA 4JEUA 3AG3E 4G8LA 1D9SA 5AN8A 2IU1A 4MKTA 4G23A 2R17C 4ZFHA 4PS7A 5KBAA 1E8WA 1WAO1 2PZIA 5T3RA 2WM9A 5LX8A 5IY5E 1K3ZD 2XZDG 4J8YA 2EIKE 3C3OA 1MHQA 2QYJA 3FWVA 3APFA 4U0SA 4LUNU 2F37A 4GZ6A 5FIOA 1HG2A 3UPVA 3MKRA 4B8CB 5ENOD 5KNGA 3CVUA 3FEYA 5G04C 5C2YA 3ZHEB 4B93B 4UQYA 3UXGA 2V4LA 1EDUA 3UUXA 2OVBA 4KYOB 2PQRA 1OCRE 1A5EA 4A3TA 2IOSA 2JEKA 2ZU6B 1BI8B 1N11A 2KCVA 4UWGA 1A17A 3FTXA 1FPPA 4A1SA 2OEWA 3NBNB 4QQIA 4HS2A 1DCQA 1OWLA 2AXVA 3LJNA 4GTRA 3SNXA 2NC9A 1UW4B 2FF4A 2AWIA 3TWQA 2IJGX 5A7DB 3DPYA 3ZRHA 3VLDA 2UY1B 4U0UA 4EZLA 3FUEA 3Q9NC 3FUHA 2DCPA 3ZHEA 4AP2A 3AS8A 4FA6A 4I1OB 5EN5D 4XX5A 4RLYA 3FU6A 2GRRB 4N2SA 3I4GA 2KXPC 2WXKA 3DSTA 2OVFA 5LP0A 3E34A 3Q49B 3FUJA 1N9AA 2XS1A 5CMYA 3RRUA 2CHZA 3FHEA 3JUIA 4W9RA 5FWQA 3TWSA 2VTBB 4LRZA 2EINE 2UY1A 3ULQA 4I6GA 2XGOA 3S7BA 4CGWA 1H19A 4JEHA 3D9NA 3LY7A 2XCCA 3NOGD 3EDTB 2F8YA 4BTAA 4K5BA 3DBSA 3QWPA 3SZ7A 3S2AA 2Y0BG 3I3NA 2BF0X 3DEOA 2LXMA 5AAOA 3CKBA 4CEMA 3J5QB 3SI5A 4HOQA 4M3OA 3CHQA 5BUZA 3SBSA 3D9JA 1ELRA 1NA0A 1OCOE 4PUCA 1E90A 2L6JA 3L17A 3UKUG 4EHMA 3LVQE 3DSVA 3QJZA 2OOEA 2VTBA 5CBOA 2GRNB 1UOHA 3ZYLA 4J6IA 3UTMA 4GYYA 4G2VA 3TL5A 4HNAD 3T9KA 1H0AA 3CVYA 1ELKA 4JHRA 3UINC 2WMNA 1FVFA 2WXPA 4YVQC 2PL2A 3UI2A 4U7EB 4FP7A 4CT0A 5FQ6A 4GA1A 4GZ3A 3FTZA 3LXUX 3MGBA 3B95A 1JWGA 4NQ0A 2WXFA 5CCMA 3MX3A 4TUMA 2GW1A 1N4QA 3HIZA 1Z6TA 3PUJA 3FUNA 3C98A 4RG9A 3CQCB 4HOUA 4UI9J 1WG0A 3E37A 4EZJA 3KS2A 3Q5MA 2ZGGA 4RSYA 3PUKA 4YDWA 4MRUA 1JCSA 3DXMG 2XHEA 1X5BA 4BY6A 2WXGA 1N4PA 1N0RA 2CFUA 2BUGA 2R2LA 3I5PA 4J7WA 5EDSA 3QKYA 4NURA 3GW4A 3CR3A 3KAEA 4OAVB 4HRLA 1E8YA 1FT1A 3SF4A 4GMLA 3FFLA 4L2YA 4I6EA 4CGVA 3PVLA 5B1AE 3NOCD 2DVWA 3JQ0A 3W9GA 1IYGA 5KJKA 2IQCA 3UT4A 2FO1E 4AIFA 5AARA 2BTDA 3ABLE 3RO2A 4L1BA 3NQPA 2R02A 3UM3A 2L9BA 5FQ4A 3CVWA 1MQSA 2LSUA 3NAWA 3MA5A 3R9MA 1D8DA 4AVXA 4FHKA 2I1JA 5FJYA 2WXQA 2E2EA 3ZN3A 4MBGA 3WXXA 4H7YA 2EILE 3HXEA 5JHAA 4N39A 3PEUB 5EIDA 5AJDA 1X81A 3K9IA 4GA2A 3DWLG 3LY9A 1V55E 4HRNA 4DK5A 4GTTA 2J8SD 5H7PA 4F3VA 1YA0A 1Q2ZA 3CVPA 2WXOA 2ONDA 4WWOA 3JQ1A 3PZ2A 3CLJA 2AJAA 3OAWA 4FLBA 3EHNA 3OXFA 2V8SE 1NL4A 3B7UX 1H2TC 1TJCA 1AP7A 5EKQD 2MRIA 2IO2C 3PH0C 4NACA 4UI9C 1ZU2A 3FTUA 3PZ3A 3CK9A 4GZ5A 1ZBPA 4U8VD 4HOTA 4BESA 2Y69E 2CG3A 3ONKA 4Q96A 3PREA 2Y4TA 3F6QA 5KNHD 1Z3YA 4KZ0A 2IF4A 3AJIA 4R7LA 4DX6D 4LERA 4ILIA 4FHJA 3CSFA 3LY8A 3Q7FA 5BXUA 3D3MA 4KMOA 5CEDB 3ZUVB 3QAQA 4G11A 1XNFA 4GTMA 5CERB 4JVSA 4UI9K 4DLQA 1BPOA 2J07A 3SHFA 3R9AB 5J90A 1PC2A 4O60A 3TJPA 4Z68A 4GPKA 2CHXA 3L54A 4GTQA 3RRMB 3IV0A 2X6FA 2P2CP 1Z5SC 2R05A 1INZA 4HB5A 3ZPJA 3ONLA 4I1AA 3C3RA 4HI9A 5FT9A 1DCEA 2EQXA 3AAAC 4BT9A 4IRUA 4ABNA 3G2VA 2WXHA 1LD8A 3NB2A 4JA7A 4UUCA 3TWUA 4BX8A 3UT7A 4GCOA 1H6PA 4AJWA 2QY7A 4IN3B 3RSEG 3UQ3A 4UQZA 3KSLA 3VTYA 2KC7A 4AEZC 5M72A 3C72A 2AXUA 2I2OA 4JD2G 4NRHB 1QNFA 3AG2E 3CGHA 4TXRA 4OAUC 4JXTA 2M63A 3L9TA 4GTPA 1LTXA 3WG7E 3L22A 3JUEA 2VJ8A 3FP3A 4Y6WA 3ENEA 3ZIMA 4DX7D 3HHMA 4CYMD 2MOWA 4RQIA 2CHWA 4LNUD 3ISMC 4L9PA 4M7CA 4CZ2D 3DXKG 3FTVA 3MV2B 4O1PA 2QYUA 3D9PA 4BEPA 4FADA 4K5AB 4F1PA 4I17A 1YMPA 1TNZA 2HR2A 4DUIA 5CMWA 1BLXB 3VTXA 3GZ2A 3U4TA 3FUKA 3HXFA 2VSNA 3EHRA 5ITZF 1JCRA 4GTVA 1SZ9A 2FEZA 3CHPA 1TJFA 3G2SA 3KEZA 3TWRA 4I9CA 1MZCA 2MHKA 2FULA 4E6HA 2WPVA 2ETBA 1FCHA 2R5SA 4XKCA 4YDYA 2Q7FA 2JABA 3CK8A 5ENSD 4A55A 4HRMB 3FDHA 1K8KG 4EPZA 5T8IA 1KZPA 1KT1A 2FO7A 3HXDA 5CCLA 3E33A 4G8KA 4BTBA 2VQ2A 4G25A 3MKQB 4PS8A 3NF1A 1BD8A 1JWFA 4HI8A 5BT1A 3HVEB 4MS6A 4CDRA 2IONA 1IQRA 4GMJA 2V5FA 3PEVB 1ELWA 3KSQA 4U96D 5AQ9A 5FQ8A 5KCMA 5EX3A 3LYAA 4AOFA 3HXBA 3ESKA 3O48A 5FTPA 2E0IA 4BWRA 4A3VA 2PM7A 5B3SE 2ZISA 3G2TA 3SGHA 3TG5A 2LAHA 2BEDA 1D8EA 3ZYKA 4NIKA 2MYOA 4I2ZA 3RKVA 2GROB 2A4ZA 4C0EA 4JZYA 3V79K 4WNGA 5EYPF 4XEIG 4BSXA 4OVUA 5BPPA 5EIBE 4ATGA 1TN7A 4U04A 4GMRA 5HKPA 3TWVA 1TNBA 3NZUA 4JL0A 3MKQA 3G2WA 3HXCA 3HVEA 3IHVA 2OV8A 1TNUA 3T5XA 5JJTA 3BG1B 3RAUA 2VSYA 1OWNA 1O5MA 3FU0A 3D9HA 4O6FA 2XGSA 4DX2A 3CEQA 4APFA 1NP7A 3FH8A 2H6GA 2Y3AA 2J4BA 2C0MA 3TGOA 1E8ZA 3CKCA 2WMOA 1E7UA 5ENTD 1OCCE 3CQGB 4DX1A 2PNNA 1NI1A 2WXMA 3JCKC 5HS0A 5AQBA 2P9NG 3L6AA 1OXJA 3DRAA 3X2QE 4I43A 5AJLA 5LOZA 4ATZD 4ZHBA 3JYSA 3FTWA 4JA9A 4I6JA 4X8QA 3ASGA 4GPMA 5ENQD 1G3NB 2LO6A 1O1TA 2BKGA 2Y4UA 5AYWD 2RFAA 1IXVA 2DYRE 5AQ7A 1EYHA 2XCBA 3T8MA 1H6KA 2L6BA 3ESLA 4L7TA 3V31A 4B89A 3FTYA 1TNYA 2WB2A 3GZ1A 3CHRA 4ILGA 2NSZA 1HZ4A 3ULYA 3FY4A 2WXRA 3R7QA 1NA3A 2ILRA 3FH7A 4UWHA 3LVRE 2WXLA 3MEKA 3EIQC 3FU3A 4DJAA 1N52A 1IQUA 4J8SA 4I9EA 5CECB 4KT6B 3EU5A 1TEZA 2R03A 1KLXA 3DSUA 3FUDA 2XQ0A 1QZ2A 1S64A 3MJWA 3MYVA 4WAFA 4B8AA 3ASOE 2UWJG 3HDXA 1E7VA 3G2UA 4JHJA 2LNIA 3UM1A 2LAIA 4GAAA 3URZA 3L82A 1MX4A 2B0OE 2WVIA 4BSZB 3RO3A 3ZGQA 3KEAA 4Y6CA 5T4YA 2XRYA 3UX4A 3PE3A 4UWLA 5FINA 3E30A 2XEHA 1QBQA 5ARFA 5G55A 2DBAA 3FUFA 2OCCE 2QFCA 4FC8A 3ABME 5FZRA 3GZSA 2C2LA 3TWWA 3SFYA 5JA4D 4LSZE 4C0MA 3HRAA 3TWTA 1YYHA 3RK6A 2NYJA 4U63A 3Q4AB 4GA0A 4UQXA 5CBNA 3ZFWA 1MX2A 5B1BE 2F8XK 5LFAA 1DVPA 1TN8A 1SW6A 4HLEA 2VGYA 1HX8A 1VDYA 4DPRA 3PNLB 3GYZA 4F53A 1N54A 4G24A 1OY3D 4U95D 2J08A 3B7RL 2XPZA 2KCLA 3B7TA 4UWFA 4JHKA 2P9SG 4J8FA 1N0QA 2J09A 3ZEFA 4ACKA 4APOA 3CSTA 1SA5A 2I9CA 3SD5A 2IOLA 3RJVA 3Q75A 4F6RD 3V30A 1K1BA 2QC9A 3APDA 3Q9UC 1WDYA 1HE8A 3PRZA 4TRQA 3FH5A 3BEEA 1SZAA 2X6JA 4J8DA 2X6KA 3Q15A 4A63B 2IY0C 3UKRG 1HFAA 2LSVA 4RVBA 2V5QC 2GRMA 4ANVA 2H6IA 3D9LA 4GTSA 4I1MA 3KD7A 3AS4A 2DYSE 4A1GA 1TR4A 3ML8A 5JHBA 3MV3B 1OT8A 4GYOA 3ZKJA 4WNFA 3V2XA 1RZ4A 1AWCB 3S7DA 2DIWA 2GRLA 3ULEG 2CG2A 3LCAA 4HXIA 4PDXA 1U3DA 1GW6A 4FULA 4JPSA 4FU3A 3E4BA 4LNBA 2X3MA 1HG5A 4IYPA 4U8YD 4HFGA 4K0RA 2VSXE 3EJNA 3SY2A 4PH4B 1N95A 3IXEA 5CRUA 1EPUA 5HI7A 3AU5A 4YDEA 3FTSA 1UJKA 2KZTB 4C9BB 2YINA 3CVXA 1HU3A 4GZCA 2AXZA 3ASDA 2XRZA 4O1OA 2A5EA 2GGFA 1HS6A 3P1UA 2XENA 3ZYMA 2HE0A 3LPZA 1IHBA 4LCTA
chains in the Genus database with same CATH topology
4GTOA 1QBQA 4GTQA 1TNZA 3DSWA 2BEDA 1D8EA 1X81A 3E32A 4GTRA 1N4SA 1N4QA 3Q79A 2H6IA 4GTTA 4YDOA 4GTSA 3Q7AA 1SA4A 2F0YA 3HXFA 1FPPA 3SFYA 1S63A 3PZ1A 1TNYA 3PZ2A 1DCEA 1TN7A 3DPYA 1NL4A 1TNBA 3E37A 1JCRA 1O1RA 4GTVA 4LNGA 3HXCA 1LD8A 1TNUA 1JCSA 1LD7A 1TN8A 3EUVA 3PZ3A 1MZCA 1N4PA 1O5MA 4EHMA 3DSVA 2R2LA 3Q73A 4LNBA 2H6HA 3KSLA 2IEJA 1TNOA 1N4RA 3EU5A 3DSXA 2H6GA 1FT1A 3C72A 1KZPA 1O1SA 3DSUA 1S64A 1N95A 3HXDA 3E33A 3DSTA 1JCQA 1NI1A 3SFXA 4YDEA 3Q7FA 3E34A 3PZ4A 1N9AA 4GTPA 1LTXA 3DRAA 4GTMA 1SA5A 1KZOA 3KSQA 3Q75A 1D8DA 4L9PA 1N94A 2H6FA 3HXBA 1FT2A 3Q78A 2ZIRA 4MBGA 3HXEA 1O1TA 1TN6A 2ZISA 3DSSA 3E30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTO A;  1QBQ A;  4GTQ A;  1TNZ A;  3DSW A;  2BED A;  1D8E A;  1X81 A;  3E32 A;  4GTR A;  1N4S A;  1N4Q A;  3Q79 A;  2H6I A;  4GTT A;  4YDO A;  4GTS A;  3Q7A A;  1SA4 A;  2F0Y A;  3HXF A;  1FPP A;  3SFY A;  1S63 A;  3PZ1 A;  1TNY A;  3PZ2 A;  1DCE A;  1TN7 A;  3DPY A;  1NL4 A;  1TNB A;  3E37 A;  1JCR A;  1O1R A;  4GTV A;  4LNG A;  3HXC A;  1LD8 A;  1TNU A;  1JCS A;  1LD7 A;  1TN8 A;  3EUV A;  3PZ3 A;  1MZC A;  1N4P A;  1O5M A;  4EHM A;  3DSV A;  2R2L A;  3Q73 A;  4LNB A;  2H6H A;  3KSL A;  2IEJ A;  1TNO A;  1N4R A;  3EU5 A;  3DSX A;  2H6G A;  1FT1 A;  3C72 A;  1KZP A;  1O1S A;  3DSU A;  1S64 A;  1N95 A;  3HXD A;  3E33 A;  3DST A;  1JCQ A;  1NI1 A;  3SFX A;  4YDE A;  3Q7F A;  3E34 A;  3PZ4 A;  1N9A A;  4GTP A;  1LTX A;  3DRA A;  4GTM A;  1SA5 A;  1KZO A;  3KSQ A;  3Q75 A;  1D8D A;  4L9P A;  1N94 A;  2H6F A;  3HXB A;  1FT2 A;  3Q78 A;  2ZIR A;  4MBG A;  3HXE A;  1O1T A;  1TN6 A;  2ZIS A;  3DSS A;  3E30 A; 
#chains in the Genus database with same CATH topology
 1UG3 A;  3DSW A;  5JJ6 A;  3UIP C;  3R7R A;  2WXN A;  3AU4 A;  3D9O A;  5BW8 C;  4EZK A;  4AM9 A;  4KBQ A;  4Q94 A;  2FI7 A;  3PE4 A;  3N71 A;  1O1R A;  4JB8 P;  4TV3 A;  1U3C A;  2KCK A;  4B0Z A;  4LNG A;  2KZT A;  5J08 A;  1HH8 A;  5G2N A;  1LD7 A;  1HXI A;  4AV7 A;  5KJN A;  2RKK A;  4HLL A;  4ANX A;  2PM6 A;  3QB2 A;  2HO1 A;  5HQ8 A;  2HM8 A;  3PNT B;  2H6H A;  3TXN A;  3IBE A;  1UJJ A;  1H6O A;  1L5J A;  4WNE A;  3RRN B;  4U8H A;  1UN8 A;  2ZXW E;  2DZN A;  4P29 A;  1JCQ A;  5AQA A;  4FLH A;  3ZW3 A;  3PZD A;  3T8K A;  3ASN E;  3AG1 E;  3J5P A;  3QWW A;  2P9K G;  3T5V A;  3DPD A;  4TUU A;  1MJ0 A;  2KAT A;  2YNQ A;  3EHQ A;  4WWN A;  4GZD A;  4KXK B;  3ABK E;  2ZIR A;  2J49 A;  1NFI E;  2XPI A;  3UIO C;  3IEG A;  3AG4 E;  5ENN A;  3SFZ A;  4U0Z A;  4JC8 A;  1E8X A;  2P9I G;  4BFR A;  4N5Q A;  1MYO A;  3Q79 A;  4H7X A;  4YDO A;  1V54 E;  3JXJ A;  3Q7A A;  1JUQ A;  3LDZ A;  2EIM E;  1NZN A;  3EHM A;  1S63 A;  3QK0 A;  4ILH B;  2RFM A;  1TYQ G;  1OWM A;  2C0L A;  1LF8 A;  1OWO A;  4N5C A;  4J0U A;  3CHO A;  4OYS A;  4RG6 A;  3SBT B;  2A5U A;  3QNK A;  4ANU A;  4WND A;  3I4R B;  2HYZ A;  3C5R A;  4KZC A;  3P2B A;  1UN9 A;  3TAX A;  3CVV A;  3CK7 A;  2P9L G;  4XI9 A;  5JJ7 A;  5E76 A;  4B94 A;  1WY6 A;  2R59 A;  3QC1 A;  3W9F A;  2WQ7 A;  5E75 A;  4ANW A;  2YHE A;  2P9U G;  5D66 A;  4AY5 A;  5DIZ A;  2YHC A;  3L08 A;  5KJM A;  3UMV A;  3U3W A;  4N2Q A;  4DI3 A;  2J4D A;  4JW1 A;  4GYW A;  2H6F A;  1PY1 A;  2GRQ B;  4PS3 A;  2WQH A;  5FZS A;  4EBA A;  5D2M C;  2WXI A;  1EF1 C;  1BU9 A;  4GTO A;  4XIF A;  1P5Q A;  4HQD A;  3UM0 A;  1OCZ E;  3CV0 A;  3E32 A;  4KVM A;  1DNP A;  2AW6 A;  2NXP A;  4K03 A;  1OUV A;  3EU9 A;  4CRW A;  4BER A;  2BKK B;  2CFZ A;  3S7F A;  3PZ1 A;  5ANR A;  2X38 A;  1Y6I A;  3OTN A;  5EYL A;  4C48 B;  4ME2 A;  3ASF A;  1H2V C;  1QYM A;  2LXL A;  4GB9 A;  5ENP D;  4OVV A;  2RD0 A;  4DLO A;  5ANL A;  3ML9 A;  4MLP A;  5CRV A;  4HBD A;  2VYI A;  3RIB A;  4K5C A;  3LS8 A;  2IEJ A;  3MZL B;  5BNW A;  1TNO A;  2L0T B;  2YQ8 A;  3VLE A;  3CHM A;  5AEN A;  1SQM A;  2ETC A;  4F7A A;  3TXM A;  2XS8 A;  3FUI A;  2ZGD A;  1S0P A;  3SFX A;  1S70 B;  4EBA G;  3PZ4 A;  3ZXP A;  4TXP A;  3IHY A;  3CVL A;  2JLB A;  5FQ7 A;  3ASH A;  4BT8 A;  4N3C A;  4CT4 A;  2LUH A;  5HRY A;  2RG8 A;  2IO3 C;  2WXJ A;  1N94 A;  3OXL A;  5JMN D;  3BG0 B;  1DC2 A;  2V4H C;  3QWV A;  5D0O D;  4EEC A;  5EIL A;  2Y1L E;  3DSS A;  2X6H A;  1Z3X A;  4IUL A;  4DI4 A;  5KJL A;  1YCS B;  1PAQ A;  3U64 A;  1KPS B;  4HOR A;  2GRP B;  4ACL A;  4EQF A;  4TXQ A;  4E85 A;  2F0Y A;  3D9I A;  5G05 J;  4XKB A;  3BQO A;  4G26 A;  1U2V G;  5KWD A;  4CDN A;  4F1S A;  3B7S A;  2J9Q A;  2EIJ E;  5LCW J;  3JXI A;  3B13 A;  3MCX A;  3LKU A;  4FJZ A;  1HO8 A;  3RU0 A;  4BX9 A;  2OEV A;  4URK A;  1JPL A;  4G1T A;  5EX0 A;  2I1K A;  3FUM A;  2L0I A;  2VGE A;  3APC A;  4N3A A;  4DX5 D;  4V3I A;  5ENR D;  1WM5 A;  2VGX B;  4KVO A;  3EIJ A;  4J8E A;  3ZXS A;  3B7B A;  4QFV A;  1O1S A;  4HVB A;  4WUY A;  3QOU A;  2XEV A;  3S7J A;  3ZU7 B;  2DZO A;  4XZ4 A;  3ZNG A;  2P58 C;  5BV0 A;  5BV1 A;  5DBK A;  4YND A;  2B6C A;  2PQN A;  5BXO A;  5CEA A;  5D0Q D;  4HOS A;  2P9P G;  1E96 B;  3CHS A;  2XPY A;  2XEE A;  3HG0 D;  3Q78 A;  4XE0 A;  3C3Q A;  2XZT G;  3D9K A;  3QAR A;  4L2L A;  1TN6 A;  2KBX A;  3LJ3 A;  5ARG A;  1QQE A;  4D10 C;  1RW2 A;  1KT0 A;  1N4S A;  3BU8 A;  5CHE E;  1SVX A;  1IKN D;  2VGX A;  4U07 A;  3U66 A;  1OWP A;  4BET A;  1ZB1 A;  5A6C A;  3AS5 A;  3Q47 B;  3TG4 A;  3O4Z A;  3CVQ A;  5AIJ A;  3QDN A;  2V0P A;  2WQ6 A;  5G05 C;  1B89 A;  2FBN A;  4AXH A;  3CIA A;  3EUV A;  4LG6 A;  3PS6 A;  1K1A A;  3TWX A;  4WWP A;  2X6I A;  3VLF A;  4XI0 A;  3Q73 A;  4I2W A;  5LCW C;  1IHG A;  3ZYQ A;  3FEX A;  3UM2 A;  3FU5 A;  1FVH A;  1N4R A;  5G04 J;  2ETA A;  3DSX A;  4YVO A;  2KM4 A;  4AY6 A;  5C1D A;  3DEP A;  2IFU A;  1HF8 A;  5FZQ A;  3D9M A;  3OXG A;  4N3B A;  4FJY A;  1W3B A;  3FUL A;  3ZVV A;  2DWZ A;  3NZS A;  1KZO A;  3U9W A;  3LEW A;  3CVN A;  2VSO E;  4CCA A;  4GU5 A;  3V2O A;  3SO8 A;  1FT2 A;  5A23 A;  2AVP A;  1Y8M A;  2XGM A;  1BI7 B;  3HYM B;  1MX6 A;  3IKO B;  3L13 A;  4LEU A;  4L23 A;  3PDN A;  3L16 A;  3SQV A;  2QZA A;  4GCN A;  3BUA A;  3UT8 A;  4UWK A;  1XGW A;  1SA4 A;  2I6H A;  4CDM A;  4Q69 A;  4DRX E;  1H2U A;  4JEU A;  3AG3 E;  4G8L A;  1D9S A;  5AN8 A;  2IU1 A;  4MKT A;  4G23 A;  2R17 C;  4ZFH A;  4PS7 A;  5KBA A;  1E8W A;  1WAO 1;  2PZI A;  5T3R A;  2WM9 A;  5LX8 A;  5IY5 E;  1K3Z D;  2XZD G;  4J8Y A;  2EIK E;  3C3O A;  1MHQ A;  2QYJ A;  3FWV A;  3APF A;  4U0S A;  4LUN U;  2F37 A;  4GZ6 A;  5FIO A;  1HG2 A;  3UPV A;  3MKR A;  4B8C B;  5ENO D;  5KNG A;  3CVU A;  3FEY A;  5G04 C;  5C2Y A;  3ZHE B;  4B93 B;  4UQY A;  3UXG A;  2V4L A;  1EDU A;  3UUX A;  2OVB A;  4KYO B;  2PQR A;  1OCR E;  1A5E A;  4A3T A;  2IOS A;  2JEK A;  2ZU6 B;  1BI8 B;  1N11 A;  2KCV A;  4UWG A;  1A17 A;  3FTX A;  1FPP A;  4A1S A;  2OEW A;  3NBN B;  4QQI A;  4HS2 A;  1DCQ A;  1OWL A;  2AXV A;  3LJN A;  4GTR A;  3SNX A;  2NC9 A;  1UW4 B;  2FF4 A;  2AWI A;  3TWQ A;  2IJG X;  5A7D B;  3DPY A;  3ZRH A;  3VLD A;  2UY1 B;  4U0U A;  4EZL A;  3FUE A;  3Q9N C;  3FUH A;  2DCP A;  3ZHE A;  4AP2 A;  3AS8 A;  4FA6 A;  4I1O B;  5EN5 D;  4XX5 A;  4RLY A;  3FU6 A;  2GRR B;  4N2S A;  3I4G A;  2KXP C;  2WXK A;  3DST A;  2OVF A;  5LP0 A;  3E34 A;  3Q49 B;  3FUJ A;  1N9A A;  2XS1 A;  5CMY A;  3RRU A;  2CHZ A;  3FHE A;  3JUI A;  4W9R A;  5FWQ A;  3TWS A;  2VTB B;  4LRZ A;  2EIN E;  2UY1 A;  3ULQ A;  4I6G A;  2XGO A;  3S7B A;  4CGW A;  1H19 A;  4JEH A;  3D9N A;  3LY7 A;  2XCC A;  3NOG D;  3EDT B;  2F8Y A;  4BTA A;  4K5B A;  3DBS A;  3QWP A;  3SZ7 A;  3S2A A;  2Y0B G;  3I3N A;  2BF0 X;  3DEO A;  2LXM A;  5AAO A;  3CKB A;  4CEM A;  3J5Q B;  3SI5 A;  4HOQ A;  4M3O A;  3CHQ A;  5BUZ A;  3SBS A;  3D9J A;  1ELR A;  1NA0 A;  1OCO E;  4PUC A;  1E90 A;  2L6J A;  3L17 A;  3UKU G;  4EHM A;  3LVQ E;  3DSV A;  3QJZ A;  2OOE A;  2VTB A;  5CBO A;  2GRN B;  1UOH A;  3ZYL A;  4J6I A;  3UTM A;  4GYY A;  4G2V A;  3TL5 A;  4HNA D;  3T9K A;  1H0A A;  3CVY A;  1ELK A;  4JHR A;  3UIN C;  2WMN A;  1FVF A;  2WXP A;  4YVQ C;  2PL2 A;  3UI2 A;  4U7E B;  4FP7 A;  4CT0 A;  5FQ6 A;  4GA1 A;  4GZ3 A;  3FTZ A;  3LXU X;  3MGB A;  3B95 A;  1JWG A;  4NQ0 A;  2WXF A;  5CCM A;  3MX3 A;  4TUM A;  2GW1 A;  1N4Q A;  3HIZ A;  1Z6T A;  3PUJ A;  3FUN A;  3C98 A;  4RG9 A;  3CQC B;  4HOU A;  4UI9 J;  1WG0 A;  3E37 A;  4EZJ A;  3KS2 A;  3Q5M A;  2ZGG A;  4RSY A;  3PUK A;  4YDW A;  4MRU A;  1JCS A;  3DXM G;  2XHE A;  1X5B A;  4BY6 A;  2WXG A;  1N4P A;  1N0R A;  2CFU A;  2BUG A;  2R2L A;  3I5P A;  4J7W A;  5EDS A;  3QKY A;  4NUR A;  3GW4 A;  3CR3 A;  3KAE A;  4OAV B;  4HRL A;  1E8Y A;  1FT1 A;  3SF4 A;  4GML A;  3FFL A;  4L2Y A;  4I6E A;  4CGV A;  3PVL A;  5B1A E;  3NOC D;  2DVW A;  3JQ0 A;  3W9G A;  1IYG A;  5KJK A;  2IQC A;  3UT4 A;  2FO1 E;  4AIF A;  5AAR A;  2BTD A;  3ABL E;  3RO2 A;  4L1B A;  3NQP A;  2R02 A;  3UM3 A;  2L9B A;  5FQ4 A;  3CVW A;  1MQS A;  2LSU A;  3NAW A;  3MA5 A;  3R9M A;  1D8D A;  4AVX A;  4FHK A;  2I1J A;  5FJY A;  2WXQ A;  2E2E A;  3ZN3 A;  4MBG A;  3WXX A;  4H7Y A;  2EIL E;  3HXE A;  5JHA A;  4N39 A;  3PEU B;  5EID A;  5AJD A;  1X81 A;  3K9I A;  4GA2 A;  3DWL G;  3LY9 A;  1V55 E;  4HRN A;  4DK5 A;  4GTT A;  2J8S D;  5H7P A;  4F3V A;  1YA0 A;  1Q2Z A;  3CVP A;  2WXO A;  2OND A;  4WWO A;  3JQ1 A;  3PZ2 A;  3CLJ A;  2AJA A;  3OAW A;  4FLB A;  3EHN A;  3OXF A;  2V8S E;  1NL4 A;  3B7U X;  1H2T C;  1TJC A;  1AP7 A;  5EKQ D;  2MRI A;  2IO2 C;  3PH0 C;  4NAC A;  4UI9 C;  1ZU2 A;  3FTU A;  3PZ3 A;  3CK9 A;  4GZ5 A;  1ZBP A;  4U8V D;  4HOT A;  4BES A;  2Y69 E;  2CG3 A;  3ONK A;  4Q96 A;  3PRE A;  2Y4T A;  3F6Q A;  5KNH D;  1Z3Y A;  4KZ0 A;  2IF4 A;  3AJI A;  4R7L A;  4DX6 D;  4LER A;  4ILI A;  4FHJ A;  3CSF A;  3LY8 A;  3Q7F A;  5BXU A;  3D3M A;  4KMO A;  5CED B;  3ZUV B;  3QAQ A;  4G11 A;  1XNF A;  4GTM A;  5CER B;  4JVS A;  4UI9 K;  4DLQ A;  1BPO A;  2J07 A;  3SHF A;  3R9A B;  5J90 A;  1PC2 A;  4O60 A;  3TJP A;  4Z68 A;  4GPK A;  2CHX A;  3L54 A;  4GTQ A;  3RRM B;  3IV0 A;  2X6F A;  2P2C P;  1Z5S C;  2R05 A;  1INZ A;  4HB5 A;  3ZPJ A;  3ONL A;  4I1A A;  3C3R A;  4HI9 A;  5FT9 A;  1DCE A;  2EQX A;  3AAA C;  4BT9 A;  4IRU A;  4ABN A;  3G2V A;  2WXH A;  1LD8 A;  3NB2 A;  4JA7 A;  4UUC A;  3TWU A;  4BX8 A;  3UT7 A;  4GCO A;  1H6P A;  4AJW A;  2QY7 A;  4IN3 B;  3RSE G;  3UQ3 A;  4UQZ A;  3KSL A;  3VTY A;  2KC7 A;  4AEZ C;  5M72 A;  3C72 A;  2AXU A;  2I2O A;  4JD2 G;  4NRH B;  1QNF A;  3AG2 E;  3CGH A;  4TXR A;  4OAU C;  4JXT A;  2M63 A;  3L9T A;  4GTP A;  1LTX A;  3WG7 E;  3L22 A;  3JUE A;  2VJ8 A;  3FP3 A;  4Y6W A;  3ENE A;  3ZIM A;  4DX7 D;  3HHM A;  4CYM D;  2MOW A;  4RQI A;  2CHW A;  4LNU D;  3ISM C;  4L9P A;  4M7C A;  4CZ2 D;  3DXK G;  3FTV A;  3MV2 B;  4O1P A;  2QYU A;  3D9P A;  4BEP A;  4FAD A;  4K5A B;  4F1P A;  4I17 A;  1YMP A;  1TNZ A;  2HR2 A;  4DUI A;  5CMW A;  1BLX B;  3VTX A;  3GZ2 A;  3U4T A;  3FUK A;  3HXF A;  2VSN A;  3EHR A;  5ITZ F;  1JCR A;  4GTV A;  1SZ9 A;  2FEZ A;  3CHP A;  1TJF A;  3G2S A;  3KEZ A;  3TWR A;  4I9C A;  1MZC A;  2MHK A;  2FUL A;  4E6H A;  2WPV A;  2ETB A;  1FCH A;  2R5S A;  4XKC A;  4YDY A;  2Q7F A;  2JAB A;  3CK8 A;  5ENS D;  4A55 A;  4HRM B;  3FDH A;  1K8K G;  4EPZ A;  5T8I A;  1KZP A;  1KT1 A;  2FO7 A;  3HXD A;  5CCL A;  3E33 A;  4G8K A;  4BTB A;  2VQ2 A;  4G25 A;  3MKQ B;  4PS8 A;  3NF1 A;  1BD8 A;  1JWF A;  4HI8 A;  5BT1 A;  3HVE B;  4MS6 A;  4CDR A;  2ION A;  1IQR A;  4GMJ A;  2V5F A;  3PEV B;  1ELW A;  3KSQ A;  4U96 D;  5AQ9 A;  5FQ8 A;  5KCM A;  5EX3 A;  3LYA A;  4AOF A;  3HXB A;  3ESK A;  3O48 A;  5FTP A;  2E0I A;  4BWR A;  4A3V A;  2PM7 A;  5B3S E;  2ZIS A;  3G2T A;  3SGH A;  3TG5 A;  2LAH A;  2BED A;  1D8E A;  3ZYK A;  4NIK A;  2MYO A;  4I2Z A;  3RKV A;  2GRO B;  2A4Z A;  4C0E A;  4JZY A;  3V79 K;  4WNG A;  5EYP F;  4XEI G;  4BSX A;  4OVU A;  5BPP A;  5EIB E;  4ATG A;  1TN7 A;  4U04 A;  4GMR A;  5HKP A;  3TWV A;  1TNB A;  3NZU A;  4JL0 A;  3MKQ A;  3G2W A;  3HXC A;  3HVE A;  3IHV A;  2OV8 A;  1TNU A;  3T5X A;  5JJT A;  3BG1 B;  3RAU A;  2VSY A;  1OWN A;  1O5M A;  3FU0 A;  3D9H A;  4O6F A;  2XGS A;  4DX2 A;  3CEQ A;  4APF A;  1NP7 A;  3FH8 A;  2H6G A;  2Y3A A;  2J4B A;  2C0M A;  3TGO A;  1E8Z A;  3CKC A;  2WMO A;  1E7U A;  5ENT D;  1OCC E;  3CQG B;  4DX1 A;  2PNN A;  1NI1 A;  2WXM A;  3JCK C;  5HS0 A;  5AQB A;  2P9N G;  3L6A A;  1OXJ A;  3DRA A;  3X2Q E;  4I43 A;  5AJL A;  5LOZ A;  4ATZ D;  4ZHB A;  3JYS A;  3FTW A;  4JA9 A;  4I6J A;  4X8Q A;  3ASG A;  4GPM A;  5ENQ D;  1G3N B;  2LO6 A;  1O1T A;  2BKG A;  2Y4U A;  5AYW D;  2RFA A;  1IXV A;  2DYR E;  5AQ7 A;  1EYH A;  2XCB A;  3T8M A;  1H6K A;  2L6B A;  3ESL A;  4L7T A;  3V31 A;  4B89 A;  3FTY A;  1TNY A;  2WB2 A;  3GZ1 A;  3CHR A;  4ILG A;  2NSZ A;  1HZ4 A;  3ULY A;  3FY4 A;  2WXR A;  3R7Q A;  1NA3 A;  2ILR A;  3FH7 A;  4UWH A;  3LVR E;  2WXL A;  3MEK A;  3EIQ C;  3FU3 A;  4DJA A;  1N52 A;  1IQU A;  4J8S A;  4I9E A;  5CEC B;  4KT6 B;  3EU5 A;  1TEZ A;  2R03 A;  1KLX A;  3DSU A;  3FUD A;  2XQ0 A;  1QZ2 A;  1S64 A;  3MJW A;  3MYV A;  4WAF A;  4B8A A;  3ASO E;  2UWJ G;  3HDX A;  1E7V A;  3G2U A;  4JHJ A;  2LNI A;  3UM1 A;  2LAI A;  4GAA A;  3URZ A;  3L82 A;  1MX4 A;  2B0O E;  2WVI A;  4BSZ B;  3RO3 A;  3ZGQ A;  3KEA A;  4Y6C A;  5T4Y A;  2XRY A;  3UX4 A;  3PE3 A;  4UWL A;  5FIN A;  3E30 A;  2XEH A;  1QBQ A;  5ARF A;  5G55 A;  2DBA A;  3FUF A;  2OCC E;  2QFC A;  4FC8 A;  3ABM E;  5FZR A;  3GZS A;  2C2L A;  3TWW A;  3SFY A;  5JA4 D;  4LSZ E;  4C0M A;  3HRA A;  3TWT A;  1YYH A;  3RK6 A;  2NYJ A;  4U63 A;  3Q4A B;  4GA0 A;  4UQX A;  5CBN A;  3ZFW A;  1MX2 A;  5B1B E;  2F8X K;  5LFA A;  1DVP A;  1TN8 A;  1SW6 A;  4HLE A;  2VGY A;  1HX8 A;  1VDY A;  4DPR A;  3PNL B;  3GYZ A;  4F53 A;  1N54 A;  4G24 A;  1OY3 D;  4U95 D;  2J08 A;  3B7R L;  2XPZ A;  2KCL A;  3B7T A;  4UWF A;  4JHK A;  2P9S G;  4J8F A;  1N0Q A;  2J09 A;  3ZEF A;  4ACK A;  4APO A;  3CST A;  1SA5 A;  2I9C A;  3SD5 A;  2IOL A;  3RJV A;  3Q75 A;  4F6R D;  3V30 A;  1K1B A;  2QC9 A;  3APD A;  3Q9U C;  1WDY A;  1HE8 A;  3PRZ A;  4TRQ A;  3FH5 A;  3BEE A;  1SZA A;  2X6J A;  4J8D A;  2X6K A;  3Q15 A;  4A63 B;  2IY0 C;  3UKR G;  1HFA A;  2LSV A;  4RVB A;  2V5Q C;  2GRM A;  4ANV A;  2H6I A;  3D9L A;  4GTS A;  4I1M A;  3KD7 A;  3AS4 A;  2DYS E;  4A1G A;  1TR4 A;  3ML8 A;  5JHB A;  3MV3 B;  1OT8 A;  4GYO A;  3ZKJ A;  4WNF A;  3V2X A;  1RZ4 A;  1AWC B;  3S7D A;  2DIW A;  2GRL A;  3ULE G;  2CG2 A;  3LCA A;  4HXI A;  4PDX A;  1U3D A;  1GW6 A;  4FUL A;  4JPS A;  4FU3 A;  3E4B A;  4LNB A;  2X3M A;  1HG5 A;  4IYP A;  4U8Y D;  4HFG A;  4K0R A;  2VSX E;  3EJN A;  3SY2 A;  4PH4 B;  1N95 A;  3IXE A;  5CRU A;  1EPU A;  5HI7 A;  3AU5 A;  4YDE A;  3FTS A;  1UJK A;  2KZT B;  4C9B B;  2YIN A;  3CVX A;  1HU3 A;  4GZC A;  2AXZ A;  3ASD A;  2XRZ A;  4O1O A;  2A5E A;  2GGF A;  1HS6 A;  3P1U A;  2XEN A;  3ZYM A;  2HE0 A;  3LPZ A;  1IHB A;  4LCT A; 
#chains in the Genus database with same CATH homology
 4GTO A;  1QBQ A;  4GTQ A;  1TNZ A;  3DSW A;  2BED A;  1D8E A;  1X81 A;  3E32 A;  4GTR A;  1N4S A;  1N4Q A;  3Q79 A;  2H6I A;  4GTT A;  4YDO A;  4GTS A;  3Q7A A;  1SA4 A;  2F0Y A;  3HXF A;  1FPP A;  3SFY A;  1S63 A;  3PZ1 A;  1TNY A;  3PZ2 A;  1DCE A;  1TN7 A;  3DPY A;  1NL4 A;  1TNB A;  3E37 A;  1JCR A;  1O1R A;  4GTV A;  4LNG A;  3HXC A;  1LD8 A;  1TNU A;  1JCS A;  1LD7 A;  1TN8 A;  3EUV A;  3PZ3 A;  1MZC A;  1N4P A;  1O5M A;  4EHM A;  3DSV A;  2R2L A;  3Q73 A;  4LNB A;  2H6H A;  3KSL A;  2IEJ A;  1TNO A;  1N4R A;  3EU5 A;  3DSX A;  2H6G A;  1FT1 A;  3C72 A;  1KZP A;  1O1S A;  3DSU A;  1S64 A;  1N95 A;  3HXD A;  3E33 A;  3DST A;  1JCQ A;  1NI1 A;  3SFX A;  4YDE A;  3Q7F A;  3E34 A;  3PZ4 A;  1N9A A;  4GTP A;  1LTX A;  3DRA A;  4GTM A;  1SA5 A;  1KZO A;  3KSQ A;  3Q75 A;  1D8D A;  4L9P A;  1N94 A;  2H6F A;  3HXB A;  1FT2 A;  3Q78 A;  2ZIR A;  4MBG A;  3HXE A;  1O1T A;  1TN6 A;  2ZIS A;  3DSS A;  3E30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...