2ZIRA

Crystal structure of rat protein farnesyltransferase complexed with a benzofuran inhibitor and fpp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase subunit alpha
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 122
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zirA00
1TNBA 1LTXA 1O1TA 3C72A 1N4SA 1JCSA 3SFXA 2H6GA 3Q78A 3Q7FA 3Q75A 4LNGA 3DSXA 1DCEA 4GTRA 4GTTA 3Q73A 3DRAA 4MBGA 1LD8A 1KZPA 3DPYA 4GTQA 1TN6A 3DSUA 2IEJA 1SA5A 3DSVA 3HXFA 1SA4A 3EUVA 3HXCA 2ZISA 1S64A 1TN7A 1X81A 3KSLA 4GTSA 3HXBA 3SFYA 1QBQA 2ZIRA 1N4RA 2F0YA 2R2LA 1N4QA 1TN8A 1JCRA 1MZCA 1TNOA 2H6FA 1KZOA 1FPPA 3PZ4A 1NI1A 4GTVA 4GTPA 1JCQA 2BEDA 1N94A 4YDEA 4YDOA 1S63A 3E34A 3PZ3A 1NL4A 4EHMA 3HXDA 3E30A 3KSQA 3PZ1A 4L9PA 4GTMA 1O1SA 3HXEA 1O1RA 3Q7AA 3E37A 1N9AA 2H6IA 1FT1A 3DSTA 4GTOA 1N95A 1TNZA 1TNUA 3DSSA 3Q79A 1D8DA 4LNBA 1LD7A 1D8EA 1FT2A 1O5MA 2H6HA 3E33A 3DSWA 3E32A 3EU5A 3PZ2A 1N4PA 1TNYA
chains in the Genus database with same CATH superfamily
4RG9A 3FUFA 2LO6A 3CHRA 1N4SA 2XPZA 3U64A 2H6GA 3FUEA 5EIDA 3SFZA 2IONA 4PH4B 3DSXA 1IYGA 5ENPD 4C0MA 3UKRG 4B89A 3ZYMA 2WMOA 3AG3E 1HS6A 5CCMA 3ZYKA 4DK5A 1EPUA 2J9QA 1HO8A 4XE0A 1Z3XA 3CVQA 1SA4A 4CEMA 2XCCA 1QBQA 2ZIRA 2IO3C 4HFGA 3U3WA 5ANRA 2R05A 1UN8A 5LCWC 3GW4A 2PM6A 3DXMG 4E6HA 3PZ4A 2F37A 2Y3AA 2BEDA 2DBAA 1ZU2A 3TWSA 3ABLE 4N2QA 1OCCE 3E34A 2GRPB 2QYUA 4J8FA 4BEPA 2WXFA 4HRMB 2WXHA 4V3IA 2FEZA 5G04C 3SNXA 1Y6IA 4EZJA 1INZA 2WVIA 5CMWA 4CDNA 3DWLG 1IHBA 4BSXA 2BF0X 3HHMA 4MKTA 2QY7A 1NP7A 1Q2ZA 3UIOC 4N5CA 2MOWA 2FULA 2WXGA 3RJVA 3PE4A 3P2BA 5ANLA 3ZRHA 5JHAA 5KJLA 1HH8A 2OEVA 5CCLA 4JC8A 3NAWA 2IU1A 2IOLA 4ANUA 5BT1A 4GYOA 4JB8P 5T8IA 4KBQA 3KEAA 1N0QA 4NACA 3EU9A 1Z3YA 3TXNA 3OAWA 4L2LA 3KD7A 4J8DA 3ZHEA 2LSUA 3D9NA 3CEQA 3NOCD 3LVQE 2WXLA 3AU5A 4I17A 4K03A 3P1UA 5FZQA 3RRUA 4GMLA 1OCRE 3MKRA 4JHRA 3JUEA 4IN3B 3T5VA 3AAAC 1WDYA 2YHCA 1OWMA 5FWQA 1TNOA 4ABNA 2X6JA 3SI5A 2R5SA 3ZUVB 5FZSA 2CFZA 3D9PA 3ASFA 4YDEA 1S63A 3D9IA 4EHMA 4U04A 1E7UA 3T5XA 2ETCA 4JEHA 4BTBA 4E85A 4FA6A 3S7JA 4KMOA 1OWPA 1UG3A 2H6IA 3DSTA 4NIKA 5AJDA 5EKQD 4U07A 2V0PA 2J09A 1D8DA 2I1KA 3ZYQA 4BTAA 5D0OD 2FI7A 2ILRA 4AXHA 3TWQA 2CHZA 3TL5A 1SZ9A 3ULQA 5H7PA 1HF8A 2A5UA 4K5BA 1DCEA 4GTRA 4N5QA 3VLEA 5KJKA 3C3QA 2LAIA 3U9WA 3UQ3A 2DCPA 2VTBB 2HE0A 2LXMA 4WWNA 1YA0A 4Z68A 1K1AA 2KCLA 5EYLA 4PDXA 3KSLA 4Y6WA 5HKPA 1H19A 2QC9A 3FUIA 4U8HA 2XEEA 1B89A 4I1MA 3AG1E 5BW8C 3D9LA 3QNKA 3FH8A 4EZLA 3VTXA 4A1SA 3R7QA 2JLBA 4FADA 5KNHD 3MJWA 5IY5E 3QKYA 4UWFA 5AIJA 2X6FA 5EYPF 2XS1A 3FEYA 1DNPA 3HDXA 3NZUA 4GCNA 4DX7D 2GW1A 4HI8A 1EF1C 5A6CA 3B7TA 2V4HC 5HS0A 4GU5A 4CRWA 4GMJA 4XZ4A 5FQ8A 3MZLB 3LPZA 4BX8A 3E33A 3FP3A 3DSWA 1U3DA 3KS2A 2HR2A 3JCKC 3C72A 1E96B 3FUJA 3QARA 3Q78A 3TGOA 3R9MA 3PREA 4F7AA 2EIKE 3FTXA 2PM7A 4H7XA 1XGWA 4OYSA 3L16A 3B7UX 3OXLA 4WNDA 5EX0A 1LF8A 1JUQA 4CDMA 4NQ0A 4K0RA 4YDWA 2AXZA 4R7LA 4GYWA 3ZW3A 2Q7FA 1HX8A 4UI9J 4I1AA 3CLJA 2F8YA 3VTYA 3CQGB 4G8LA 2PNNA 3D9KA 3Q5MA 1N52A 4HLLA 4GTVA 1FCHA 4IRUA 4GTPA 4CT4A 4GMRA 3FU6A 4WUYA 1U2VG 2R59A 2KZTB 4YDOA 2P9IG 4UWLA 3EHMA 1ZB1A 4AY6A 1NL4A 2GRMA 4N3CA 3PUKA 3UI2A 2KC7A 1EDUA 2GRNB 3ZN3A 3SO8A 5KJMA 3CKCA 4ATZD 4RG6A 3FWVA 5LFAA 4J6IA 5JJTA 2R17C 1UJJA 3UM2A 3NB2A 2XGSA 1TJCA 5LX8A 3AJIA 1V55E 3HRAA 3Q7FA 4IULA 2UY1A 2RG8A 4CYMD 4GYYA 4A63B 4HORA 3L82A 1YMPA 2P9UG 3UPVA 2J8SD 3K9IA 4X8QA 5CBNA 1MJ0A 2XRZA 2CHWA 1XNFA 3DRAA 3R7RA 3UIPC 4QQIA 3TG5A 4HBDA 3UT7A 4U63A 2XZDG 3HXCA 3V30A 2GRQB 4TUMA 5LOZA 3L6AA 3SY2A 3V31A 3UXGA 2F0YA 3PVLA 3CHMA 1TN8A 2L9BA 2VGXB 2DYSE 5G05J 2WMNA 2MYOA 4HOUA 4GPMA 4HLEA 1HU3A 4JD2G 4B0ZA 4O60A 3CK7A 3FTVA 4GZ5A 5G55A 4EPZA 4A55A 1H2VC 4WAFA 3GZ2A 2I6HA 2WXQA 4U0ZA 3LYAA 4J8YA 4LNBA 2WXPA 1QQEA 4G2VA 3FH7A 3F6QA 1WY6A 3QK0A 3UINC 3ENEA 3FY4A 3EU5A 2AJAA 1N4PA 3ABKE 3FUMA 3CVXA 4HRLA 5AARA 1NZNA 5HI7A 1JCSA 1HXIA 1AWCB 4FP7A 3CHPA 1SZAA 4JHJA 3FU0A 3Q75A 2J4DA 3Q73A 3I4GA 4BY6A 4UQZA 2DWZA 5CECB 1RW2A 4YDYA 1SW6A 1OWOA 1IXVA 2XHEA 3IHYA 3CSTA 3UMVA 1QNFA 5T3RA 3ZYLA 3MV3B 1N4RA 3CVPA 3PS6A 1N4QA 2RFAA 1JCRA 3NOGD 2XCBA 4I2ZA 4RQIA 1MZCA 2PQRA 5AENA 1KZOA 4GA1A 4L2YA 3CVYA 3FFLA 2F8XK 1JPLA 4EQFA 3B95A 4HRNA 4U96D 3PEUB 3ASHA 5AQ9A 3EHNA 4WWPA 3ZNGA 4AIFA 3LDZA 2VGEA 3CVLA 5JA4D 2RD0A 4GTOA 3ZGQA 3ML9A 1TNZA 4OAUC 3WG7E 3V79K 1RZ4A 1TEZA 5EN5D 3Q9UC 4IYPA 1O5MA 4UUCA 2XGMA 4JPSA 3RAUA 1TNBA 1LTXA 3TJPA 3JYSA 4TRQA 2J08A 2P58C 4U0UA 2ONDA 3FUNA 4DLQA 4DX2A 5FINA 4O6FA 3IHVA 3CHSA 5ENRD 4FJZA 3ASGA 4GZCA 5JMND 4I43A 4ANVA 4G24A 1OCZE 3CQCB 3T8MA 4LCTA 2RKKA 3BG0B 2XZTG 3SFYA 3LKUA 3MKQB 2A5EA 4AY5A 2E0IA 2LUHA 4U95D 3LY9A 2OEWA 2CG2A 1JWFA 4HQDA 2IO2C 2RFMA 1HFAA 3CR3A 3NQPA 5AQBA 1N94A 3ASDA 2V4LA 2L0IA 3FUKA 1S0PA 4JEUA 3FTYA 5FZRA 4GTMA 4UQXA 4AP2A 3DBSA 3PNTB 2QZAA 3UM1A 4L23A 4DLOA 4U8VD 3SBTB 1TNUA 3CIAA 3ONLA 3ZKJA 3G2WA 4C9BB 5B1AE 1ELRA 4ANXA 4LERA 2XPYA 3FTWA 1JWGA 3PZ2A 1MHQA 3ZIMA 1W3BA 4F1PA 5AJLA 1E8ZA 3WXXA 3CSFA 3B7RL 3JQ0A 3CHQA 4HI9A 4KVMA 1IQUA 5CMYA 1OT8A 2GROB 4WNEA 5E76A 2AWIA 3E4BA 5KBAA 4DX6D 1G3NB 4ILHB 4N2SA 4HS2A 5DBKA 3CV0A 3FULA 3CK8A 3SQVA 5M72A 2BUGA 3Q4AB 4J8SA 1MX2A 1N54A 2Y69E 2GRRB 1H2TC 5BV1A 4DJAA 3JXIA 4TXPA 2Y4UA 5EILA 4BT8A 3EIJA 5AN8A 3CHOA 2WM9A 1UOHA 2DYRE 3S2AA 4D10C 4F3VA 1BI7B 5BV0A 3PZ3A 4U8YD 3QWWA 3QJZA 4UI9K 2NSZA 1YYHA 4UI9C 3B7SA 4OVUA 2WXNA 3PRZA 3O48A 1LD7A 4TUUA 3D9HA 2H6HA 4AV7A 4PS7A 2VTBA 5EX3A 5BXOA 3EDTB 2DVWA 1ZBPA 5AAOA 4APFA 4F1SA 3SFXA 3ZU7B 5J90A 4APOA 4XI9A 3FTUA 2WQHA 1PAQA 4EZKA 2J49A 4YVQC 2L6JA 4ZHBA 4RSYA 4WNGA 4TV3A 3QAQA 2EIME 4B8AA 3TWWA 4FHJA 1HG5A 3RSEG 3PE3A 1E90A 2L6BA 2XS8A 3OTNA 4LNUD 4J7WA 3SF4A 1H6OA 3UUXA 4O1OA 4BERA 3RO2A 1E8YA 4CDRA 5EIBE 5KJNA 1FPPA 4Q96A 3MA5A 3ABME 3ZXPA 5AYWD 2XRYA 3TWXA 3UT4A 3LJ3A 2GRLA 2WXKA 3Q7AA 1NA3A 4AM9A 4JL0A 4GB9A 5FIOA 5CBOA 3ZEFA 5G05C 4G1TA 4ILGA 5JJ6A 3RK6A 2HYZA 2NC9A 1WG0A 2WQ7A 2HM8A 4HVBA 2X3MA 4NRHB 3LCAA 1E7VA 3EIQC 3IBEA 4GZ3A 5EDSA 2X38A 3Q47B 1PC2A 4GA2A 4RVBA 3QWPA 5C1DA 5ENQD 3LXUX 4YNDA 4GTTA 1Y8MA 1IQRA 2XPIA 2J4BA 4G23A 1BPOA 3ESLA 3FDHA 2LXLA 1KZPA 1OCOE 2JEKA 4A3TA 3DEPA 3DSVA 2DZNA 3C98A 2ZISA 4M3OA 5AQ7A 2DIWA 2ETBA 4I2WA 2X6IA 2CFUA 4BETA 1OXJA 2CG3A 2EINE 4XKBA 5CRVA 3APFA 3D9JA 5ENNA 3S7FA 2YHEA 3S7BA 3G2UA 3HVEA 1TJFA 3RIBA 3UT8A 5HRYA 2UWJG 1SQMA 4RLYA 2VSXE 3E30A 1UJKA 3EHRA 2MRIA 4H7YA 4JXTA 1SVXA 4XX5A 3HXEA 4CZ2D 1QZ2A 2L0TB 2GGFA 3Q79A 2ETAA 1N0RA 3AG4E 4JA9A 3SGHA 5B1BE 4G8KA 2HO1A 4UQYA 3OXFA 3CK9A 5ENTD 3FU5A 1K1BA 3DXKG 3L22A 5KCMA 4GA0A 2WQ6A 3V2XA 1E8WA 2P9SG 4LNGA 2IY0C 4FHKA 2VGXA 2WXRA 3AS4A 3ESKA 3FUHA 1K3ZD 3PZDA 4DPRA 3JXJA 5ENSD 1MQSA 1EYHA 3UKUG 4LG6A 4HB5A 2ZGGA 4AEZC 4KT6B 4G25A 3L13A 4HOSA 3MX3A 2JABA 3MEKA 3PEVB 2EILE 2WB2A 4AOFA 3PH0C 1A17A 5HQ8A 4ZFHA 3TWVA 2VSYA 3X2QE 3U4TA 3NZSA 2VGYA 3GZSA 4F6RD 2B0OE 4WNFA 2Y1LE 4KYOB 4LEUA 4AVXA 4FJYA 5B3SE 2V8SE 4L9PA 4B93B 2XENA 3RKVA 4J0UA 1HZ4A 4U0SA 1QYMA 5CEAA 1H2UA 4MLPA 2LAHA 3NBNB 4UWKA 1KLXA 3ZXSA 2EQXA 3E32A 4BFRA 4I9EA 3TAXA 4K5AB 3LEWA 3LY8A 5AQAA 3ULYA 4PUCA 3QB2A 5ARGA 2I9CA 3L9TA 2IF4A 3APDA 2B6CA 3JUIA 3GZ1A 3UM0A 4EBAG 4JW1A 2X6KA 4GZDA 1TN6A 3DSUA 4HNAD 5LP0A 4BX9A 5CRUA 3I4RB 3SHFA 4I6GA 3HXBA 3LJNA 5J08A 4ATGA 3N71A 4WWOA 1H0AA 3FUDA 2Y0BG 3RRMB 3C3OA 3ISMC 3BU8A 3ZHEB 4TXQA 5D66A 1Z5SC 1BLXB 1FVFA 1JCQA 3ASOE 4C48B 3G2TA 1E8XA 2VYIA 4UWHA 1OWLA 4BT9A 4GZ6A 2LNIA 4C0EA 4JVSA 4PS8A 4M7CA 3ZVVA 2WXJA 4FLHA 3G2SA 3LY7A 5A7DB 4I6JA 3I5PA 1N95A 4KZCA 2VSNA 1P5QA 3FEXA 2V5QC 2NXPA 4A1GA 1D8EA 1TYQG 2FBNA 2YQ8A 3O4ZA 2P9KG 3AG2E 3APCA 4L1BA 2CHXA 4W9RA 5FTPA 3U66A 5JJ7A 3ZFWA 4DX1A 3LS8A 4U7EB 3VLFA 2WPVA 1FVHA 4CT0A 3MKQA 5LCWJ 2Y4TA 3FTSA 2KXPC 4FU3A 5E75A 2ZGDA 5BPPA 5C2YA 4I6EA 3R9AB 2YINA 2ZXWE 1YCSB 3LVRE 3BEEA 1SA5A 3J5PA 2KATA 1V54E 2C2LA 4K5CA 1S64A 4GTSA 3L54A 5FQ4A 2KCKA 4N3BA 5G04J 4FC8A 2DZOA 5T4YA 1TR4A 3C3RA 2BKGA 4B8CB 5BUZA 1MX4A 3D3MA 2H6FA 3FHEA 3L17A 2IOSA 2OVBA 3TWRA 2FF4A 2OCCE 4Q94A 4GCOA 2AW6A 3TWUA 3TG4A 1D9SA 3PZ1A 3J5QB 4GAAA 3B13A 1OY3D 1OWNA 3BUAA 3MGBA 3E37A 1N9AA 4ANWA 5DIZA 1FT1A 3QOUA 2J07A 5BNWA 4KZ0A 3DSSA 1WAO1 1BI8B 3D9MA 4Y6CA 1FT2A 3EHQA 3JQ1A 4P29A 3UM3A 1ELKA 2BKKB 3TXMA 2PZIA 1O1TA 3QC1A 5ENOD 3IKOB 4ACLA 4DX5D 4G11A 3S7DA 4A3VA 3FH5A 4KVOA 5CEDB 1OUVA 2VSOE 2NYJA 1DVPA 3GYZA 4MBGA 4FLBA 2X6HA 3BG1B 1S70B 2IEJA 3DEOA 3SBSA 2ZU6B 4N3AA 1HE8A 2VQ2A 5G2NA 4BSZB 4F53A 1TN7A 2BTDA 4NURA 3G2VA 3EJNA 3CVWA 2R2LA 3CVUA 4OAVB 3IXEA 4XKCA 4QFVA 2KM4A 1NI1A 4DUIA 2V5FA 4J8EA 1BU9A 3MCXA 1DCQA 2WXIA 5FT9A 1A5EA 5ARFA 2AVPA 3KSQA 2MHKA 2R02A 1O1SA 2C0MA 4ILIA 3FU3A 4L7TA 3CGHA 1KT0A 4MS6A 1BD8A 5FQ7A 5ITZF 3CVNA 5KWDA 2P9NG 2I1JA 3OXGA 3CVVA 4G26A 3RU0A 4CGVA 3Q15A 4O1PA 1H6PA 3HIZA 3T9KA 5BXUA 4EECA 5CHEE 5JHBA 3T8KA 2P2CP 1NFIE 4LSZE 4CGWA 1X5BA 4I9CA 3HYMB 1VDYA 3B7BA 2EIJE 3AU4A 2IJGX 1UW4B 2XEHA 2UY1B 1WM5A 5D0QD 4Q69A 4I1OB 4BWRA 4DRXE 3HXFA 3SZ7A 1PY1A 3ULEG 3EUVA 1UN9A 2M63A 1X81A 2XQ0A 2FO1E 1N11A 1H6KA 1DC2A 2KBXA 4UWGA 2OV8A 4XEIG 4TXRA 4AJWA 3Q49B 1MYOA 3HVEB 2KZTA 2C0LA 4HOTA 1HG2A 4GPKA 3AS8A 4LUNU 2KCVA 1GW6A 2AXUA 1ELWA 3L08A 4N39A 1MX6A 2WXOA 1O1RA 1KPSB 4HXIA 3V2OA 3PDNA 2OOEA 3BQOA 3C5RA 2XEVA 1L5JA 1Z6TA 2VJ8A 3MYVA 4EBAA 4LRZA 3ML8A 4CCAA 2E2EA 2IFUA 3KAEA 3NF1A 2PQNA 2QFCA 3QWVA 2QYJA 3TWTA 1U3CA 5KNGA 2P9LG 4ME2A 3ONKA 1IKND 3RRNB 2P9PG 4JHKA 1IHGA 1K8KG 4DI3A 5FJYA 4ACKA 4BESA 4XIFA 4JZYA 1NA0A 3IEGA 3IV0A 3FTZA 1LD8A 3ZPJA 3UX4A 3W9FA 3DPYA 4GTQA 3W9GA 3DPDA 4OVVA 4URKA 4JA7A 3SD5A 3ASNE 3QDNA 2R03A 3Q9NC 2FO7A 4MRUA 5A23A 4B94A 3PUJA 5D2MC 2PL2A 2XGOA 5CERB 4FULA 4HOQA 3AS5A 2WXMA 5FQ6A 2OVFA 3UTMA 2AXVA 3MV2B 3HXDA 3I3NA 1AP7A 2A4ZA 3D9OA 1KT1A 4KXKB 3URZA 3CKBA 2I2OA 2YNQA 3KEZA 3VLDA 2IQCA 4DI4A 4YVOA 4PS3A 3RO3A 3PNLB 3HG0D 4XI0A 1TNYA 2LSVA
chains in the Genus database with same CATH topology
1TNBA 1LTXA 1O1TA 3C72A 1N4SA 1JCSA 3SFXA 2H6GA 3Q78A 3Q7FA 3Q75A 4LNGA 3DSXA 1DCEA 4GTRA 4GTTA 3Q73A 3DRAA 4MBGA 1LD8A 1KZPA 3DPYA 4GTQA 1TN6A 3DSUA 2IEJA 1SA5A 3DSVA 3HXFA 1SA4A 3EUVA 3HXCA 2ZISA 1S64A 1TN7A 1X81A 3KSLA 4GTSA 3HXBA 3SFYA 1QBQA 2ZIRA 1N4RA 2F0YA 2R2LA 1N4QA 1TN8A 1JCRA 1MZCA 1TNOA 2H6FA 1KZOA 1FPPA 3PZ4A 1NI1A 4GTVA 4GTPA 1JCQA 2BEDA 1N94A 4YDEA 4YDOA 1S63A 3E34A 3PZ3A 1NL4A 4EHMA 3HXDA 3E30A 3KSQA 3PZ1A 4L9PA 4GTMA 1O1SA 3HXEA 1O1RA 3Q7AA 3E37A 1N9AA 2H6IA 1FT1A 3DSTA 4GTOA 1N95A 1TNZA 1TNUA 3DSSA 3Q79A 1D8DA 4LNBA 1LD7A 1D8EA 1FT2A 1O5MA 2H6HA 3E33A 3DSWA 3E32A 3EU5A 3PZ2A 1N4PA 1TNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNB A;  1LTX A;  1O1T A;  3C72 A;  1N4S A;  1JCS A;  3SFX A;  2H6G A;  3Q78 A;  3Q7F A;  3Q75 A;  4LNG A;  3DSX A;  1DCE A;  4GTR A;  4GTT A;  3Q73 A;  3DRA A;  4MBG A;  1LD8 A;  1KZP A;  3DPY A;  4GTQ A;  1TN6 A;  3DSU A;  2IEJ A;  1SA5 A;  3DSV A;  3HXF A;  1SA4 A;  3EUV A;  3HXC A;  2ZIS A;  1S64 A;  1TN7 A;  1X81 A;  3KSL A;  4GTS A;  3HXB A;  3SFY A;  1QBQ A;  2ZIR A;  1N4R A;  2F0Y A;  2R2L A;  1N4Q A;  1TN8 A;  1JCR A;  1MZC A;  1TNO A;  2H6F A;  1KZO A;  1FPP A;  3PZ4 A;  1NI1 A;  4GTV A;  4GTP A;  1JCQ A;  2BED A;  1N94 A;  4YDE A;  4YDO A;  1S63 A;  3E34 A;  3PZ3 A;  1NL4 A;  4EHM A;  3HXD A;  3E30 A;  3KSQ A;  3PZ1 A;  4L9P A;  4GTM A;  1O1S A;  3HXE A;  1O1R A;  3Q7A A;  3E37 A;  1N9A A;  2H6I A;  1FT1 A;  3DST A;  4GTO A;  1N95 A;  1TNZ A;  1TNU A;  3DSS A;  3Q79 A;  1D8D A;  4LNB A;  1LD7 A;  1D8E A;  1FT2 A;  1O5M A;  2H6H A;  3E33 A;  3DSW A;  3E32 A;  3EU5 A;  3PZ2 A;  1N4P A;  1TNY A; 
#chains in the Genus database with same CATH topology
 4RG9 A;  3FUF A;  2LO6 A;  3CHR A;  1N4S A;  2XPZ A;  3U64 A;  2H6G A;  3FUE A;  5EID A;  3SFZ A;  2ION A;  4PH4 B;  3DSX A;  1IYG A;  5ENP D;  4C0M A;  3UKR G;  4B89 A;  3ZYM A;  2WMO A;  3AG3 E;  1HS6 A;  5CCM A;  3ZYK A;  4DK5 A;  1EPU A;  2J9Q A;  1HO8 A;  4XE0 A;  1Z3X A;  3CVQ A;  1SA4 A;  4CEM A;  2XCC A;  1QBQ A;  2ZIR A;  2IO3 C;  4HFG A;  3U3W A;  5ANR A;  2R05 A;  1UN8 A;  5LCW C;  3GW4 A;  2PM6 A;  3DXM G;  4E6H A;  3PZ4 A;  2F37 A;  2Y3A A;  2BED A;  2DBA A;  1ZU2 A;  3TWS A;  3ABL E;  4N2Q A;  1OCC E;  3E34 A;  2GRP B;  2QYU A;  4J8F A;  4BEP A;  2WXF A;  4HRM B;  2WXH A;  4V3I A;  2FEZ A;  5G04 C;  3SNX A;  1Y6I A;  4EZJ A;  1INZ A;  2WVI A;  5CMW A;  4CDN A;  3DWL G;  1IHB A;  4BSX A;  2BF0 X;  3HHM A;  4MKT A;  2QY7 A;  1NP7 A;  1Q2Z A;  3UIO C;  4N5C A;  2MOW A;  2FUL A;  2WXG A;  3RJV A;  3PE4 A;  3P2B A;  5ANL A;  3ZRH A;  5JHA A;  5KJL A;  1HH8 A;  2OEV A;  5CCL A;  4JC8 A;  3NAW A;  2IU1 A;  2IOL A;  4ANU A;  5BT1 A;  4GYO A;  4JB8 P;  5T8I A;  4KBQ A;  3KEA A;  1N0Q A;  4NAC A;  3EU9 A;  1Z3Y A;  3TXN A;  3OAW A;  4L2L A;  3KD7 A;  4J8D A;  3ZHE A;  2LSU A;  3D9N A;  3CEQ A;  3NOC D;  3LVQ E;  2WXL A;  3AU5 A;  4I17 A;  4K03 A;  3P1U A;  5FZQ A;  3RRU A;  4GML A;  1OCR E;  3MKR A;  4JHR A;  3JUE A;  4IN3 B;  3T5V A;  3AAA C;  1WDY A;  2YHC A;  1OWM A;  5FWQ A;  1TNO A;  4ABN A;  2X6J A;  3SI5 A;  2R5S A;  3ZUV B;  5FZS A;  2CFZ A;  3D9P A;  3ASF A;  4YDE A;  1S63 A;  3D9I A;  4EHM A;  4U04 A;  1E7U A;  3T5X A;  2ETC A;  4JEH A;  4BTB A;  4E85 A;  4FA6 A;  3S7J A;  4KMO A;  1OWP A;  1UG3 A;  2H6I A;  3DST A;  4NIK A;  5AJD A;  5EKQ D;  4U07 A;  2V0P A;  2J09 A;  1D8D A;  2I1K A;  3ZYQ A;  4BTA A;  5D0O D;  2FI7 A;  2ILR A;  4AXH A;  3TWQ A;  2CHZ A;  3TL5 A;  1SZ9 A;  3ULQ A;  5H7P A;  1HF8 A;  2A5U A;  4K5B A;  1DCE A;  4GTR A;  4N5Q A;  3VLE A;  5KJK A;  3C3Q A;  2LAI A;  3U9W A;  3UQ3 A;  2DCP A;  2VTB B;  2HE0 A;  2LXM A;  4WWN A;  1YA0 A;  4Z68 A;  1K1A A;  2KCL A;  5EYL A;  4PDX A;  3KSL A;  4Y6W A;  5HKP A;  1H19 A;  2QC9 A;  3FUI A;  4U8H A;  2XEE A;  1B89 A;  4I1M A;  3AG1 E;  5BW8 C;  3D9L A;  3QNK A;  3FH8 A;  4EZL A;  3VTX A;  4A1S A;  3R7Q A;  2JLB A;  4FAD A;  5KNH D;  3MJW A;  5IY5 E;  3QKY A;  4UWF A;  5AIJ A;  2X6F A;  5EYP F;  2XS1 A;  3FEY A;  1DNP A;  3HDX A;  3NZU A;  4GCN A;  4DX7 D;  2GW1 A;  4HI8 A;  1EF1 C;  5A6C A;  3B7T A;  2V4H C;  5HS0 A;  4GU5 A;  4CRW A;  4GMJ A;  4XZ4 A;  5FQ8 A;  3MZL B;  3LPZ A;  4BX8 A;  3E33 A;  3FP3 A;  3DSW A;  1U3D A;  3KS2 A;  2HR2 A;  3JCK C;  3C72 A;  1E96 B;  3FUJ A;  3QAR A;  3Q78 A;  3TGO A;  3R9M A;  3PRE A;  4F7A A;  2EIK E;  3FTX A;  2PM7 A;  4H7X A;  1XGW A;  4OYS A;  3L16 A;  3B7U X;  3OXL A;  4WND A;  5EX0 A;  1LF8 A;  1JUQ A;  4CDM A;  4NQ0 A;  4K0R A;  4YDW A;  2AXZ A;  4R7L A;  4GYW A;  3ZW3 A;  2Q7F A;  1HX8 A;  4UI9 J;  4I1A A;  3CLJ A;  2F8Y A;  3VTY A;  3CQG B;  4G8L A;  2PNN A;  3D9K A;  3Q5M A;  1N52 A;  4HLL A;  4GTV A;  1FCH A;  4IRU A;  4GTP A;  4CT4 A;  4GMR A;  3FU6 A;  4WUY A;  1U2V G;  2R59 A;  2KZT B;  4YDO A;  2P9I G;  4UWL A;  3EHM A;  1ZB1 A;  4AY6 A;  1NL4 A;  2GRM A;  4N3C A;  3PUK A;  3UI2 A;  2KC7 A;  1EDU A;  2GRN B;  3ZN3 A;  3SO8 A;  5KJM A;  3CKC A;  4ATZ D;  4RG6 A;  3FWV A;  5LFA A;  4J6I A;  5JJT A;  2R17 C;  1UJJ A;  3UM2 A;  3NB2 A;  2XGS A;  1TJC A;  5LX8 A;  3AJI A;  1V55 E;  3HRA A;  3Q7F A;  4IUL A;  2UY1 A;  2RG8 A;  4CYM D;  4GYY A;  4A63 B;  4HOR A;  3L82 A;  1YMP A;  2P9U G;  3UPV A;  2J8S D;  3K9I A;  4X8Q A;  5CBN A;  1MJ0 A;  2XRZ A;  2CHW A;  1XNF A;  3DRA A;  3R7R A;  3UIP C;  4QQI A;  3TG5 A;  4HBD A;  3UT7 A;  4U63 A;  2XZD G;  3HXC A;  3V30 A;  2GRQ B;  4TUM A;  5LOZ A;  3L6A A;  3SY2 A;  3V31 A;  3UXG A;  2F0Y A;  3PVL A;  3CHM A;  1TN8 A;  2L9B A;  2VGX B;  2DYS E;  5G05 J;  2WMN A;  2MYO A;  4HOU A;  4GPM A;  4HLE A;  1HU3 A;  4JD2 G;  4B0Z A;  4O60 A;  3CK7 A;  3FTV A;  4GZ5 A;  5G55 A;  4EPZ A;  4A55 A;  1H2V C;  4WAF A;  3GZ2 A;  2I6H A;  2WXQ A;  4U0Z A;  3LYA A;  4J8Y A;  4LNB A;  2WXP A;  1QQE A;  4G2V A;  3FH7 A;  3F6Q A;  1WY6 A;  3QK0 A;  3UIN C;  3ENE A;  3FY4 A;  3EU5 A;  2AJA A;  1N4P A;  3ABK E;  3FUM A;  3CVX A;  4HRL A;  5AAR A;  1NZN A;  5HI7 A;  1JCS A;  1HXI A;  1AWC B;  4FP7 A;  3CHP A;  1SZA A;  4JHJ A;  3FU0 A;  3Q75 A;  2J4D A;  3Q73 A;  3I4G A;  4BY6 A;  4UQZ A;  2DWZ A;  5CEC B;  1RW2 A;  4YDY A;  1SW6 A;  1OWO A;  1IXV A;  2XHE A;  3IHY A;  3CST A;  3UMV A;  1QNF A;  5T3R A;  3ZYL A;  3MV3 B;  1N4R A;  3CVP A;  3PS6 A;  1N4Q A;  2RFA A;  1JCR A;  3NOG D;  2XCB A;  4I2Z A;  4RQI A;  1MZC A;  2PQR A;  5AEN A;  1KZO A;  4GA1 A;  4L2Y A;  3CVY A;  3FFL A;  2F8X K;  1JPL A;  4EQF A;  3B95 A;  4HRN A;  4U96 D;  3PEU B;  3ASH A;  5AQ9 A;  3EHN A;  4WWP A;  3ZNG A;  4AIF A;  3LDZ A;  2VGE A;  3CVL A;  5JA4 D;  2RD0 A;  4GTO A;  3ZGQ A;  3ML9 A;  1TNZ A;  4OAU C;  3WG7 E;  3V79 K;  1RZ4 A;  1TEZ A;  5EN5 D;  3Q9U C;  4IYP A;  1O5M A;  4UUC A;  2XGM A;  4JPS A;  3RAU A;  1TNB A;  1LTX A;  3TJP A;  3JYS A;  4TRQ A;  2J08 A;  2P58 C;  4U0U A;  2OND A;  3FUN A;  4DLQ A;  4DX2 A;  5FIN A;  4O6F A;  3IHV A;  3CHS A;  5ENR D;  4FJZ A;  3ASG A;  4GZC A;  5JMN D;  4I43 A;  4ANV A;  4G24 A;  1OCZ E;  3CQC B;  3T8M A;  4LCT A;  2RKK A;  3BG0 B;  2XZT G;  3SFY A;  3LKU A;  3MKQ B;  2A5E A;  4AY5 A;  2E0I A;  2LUH A;  4U95 D;  3LY9 A;  2OEW A;  2CG2 A;  1JWF A;  4HQD A;  2IO2 C;  2RFM A;  1HFA A;  3CR3 A;  3NQP A;  5AQB A;  1N94 A;  3ASD A;  2V4L A;  2L0I A;  3FUK A;  1S0P A;  4JEU A;  3FTY A;  5FZR A;  4GTM A;  4UQX A;  4AP2 A;  3DBS A;  3PNT B;  2QZA A;  3UM1 A;  4L23 A;  4DLO A;  4U8V D;  3SBT B;  1TNU A;  3CIA A;  3ONL A;  3ZKJ A;  3G2W A;  4C9B B;  5B1A E;  1ELR A;  4ANX A;  4LER A;  2XPY A;  3FTW A;  1JWG A;  3PZ2 A;  1MHQ A;  3ZIM A;  1W3B A;  4F1P A;  5AJL A;  1E8Z A;  3WXX A;  3CSF A;  3B7R L;  3JQ0 A;  3CHQ A;  4HI9 A;  4KVM A;  1IQU A;  5CMY A;  1OT8 A;  2GRO B;  4WNE A;  5E76 A;  2AWI A;  3E4B A;  5KBA A;  4DX6 D;  1G3N B;  4ILH B;  4N2S A;  4HS2 A;  5DBK A;  3CV0 A;  3FUL A;  3CK8 A;  3SQV A;  5M72 A;  2BUG A;  3Q4A B;  4J8S A;  1MX2 A;  1N54 A;  2Y69 E;  2GRR B;  1H2T C;  5BV1 A;  4DJA A;  3JXI A;  4TXP A;  2Y4U A;  5EIL A;  4BT8 A;  3EIJ A;  5AN8 A;  3CHO A;  2WM9 A;  1UOH A;  2DYR E;  3S2A A;  4D10 C;  4F3V A;  1BI7 B;  5BV0 A;  3PZ3 A;  4U8Y D;  3QWW A;  3QJZ A;  4UI9 K;  2NSZ A;  1YYH A;  4UI9 C;  3B7S A;  4OVU A;  2WXN A;  3PRZ A;  3O48 A;  1LD7 A;  4TUU A;  3D9H A;  2H6H A;  4AV7 A;  4PS7 A;  2VTB A;  5EX3 A;  5BXO A;  3EDT B;  2DVW A;  1ZBP A;  5AAO A;  4APF A;  4F1S A;  3SFX A;  3ZU7 B;  5J90 A;  4APO A;  4XI9 A;  3FTU A;  2WQH A;  1PAQ A;  4EZK A;  2J49 A;  4YVQ C;  2L6J A;  4ZHB A;  4RSY A;  4WNG A;  4TV3 A;  3QAQ A;  2EIM E;  4B8A A;  3TWW A;  4FHJ A;  1HG5 A;  3RSE G;  3PE3 A;  1E90 A;  2L6B A;  2XS8 A;  3OTN A;  4LNU D;  4J7W A;  3SF4 A;  1H6O A;  3UUX A;  4O1O A;  4BER A;  3RO2 A;  1E8Y A;  4CDR A;  5EIB E;  5KJN A;  1FPP A;  4Q96 A;  3MA5 A;  3ABM E;  3ZXP A;  5AYW D;  2XRY A;  3TWX A;  3UT4 A;  3LJ3 A;  2GRL A;  2WXK A;  3Q7A A;  1NA3 A;  4AM9 A;  4JL0 A;  4GB9 A;  5FIO A;  5CBO A;  3ZEF A;  5G05 C;  4G1T A;  4ILG A;  5JJ6 A;  3RK6 A;  2HYZ A;  2NC9 A;  1WG0 A;  2WQ7 A;  2HM8 A;  4HVB A;  2X3M A;  4NRH B;  3LCA A;  1E7V A;  3EIQ C;  3IBE A;  4GZ3 A;  5EDS A;  2X38 A;  3Q47 B;  1PC2 A;  4GA2 A;  4RVB A;  3QWP A;  5C1D A;  5ENQ D;  3LXU X;  4YND A;  4GTT A;  1Y8M A;  1IQR A;  2XPI A;  2J4B A;  4G23 A;  1BPO A;  3ESL A;  3FDH A;  2LXL A;  1KZP A;  1OCO E;  2JEK A;  4A3T A;  3DEP A;  3DSV A;  2DZN A;  3C98 A;  2ZIS A;  4M3O A;  5AQ7 A;  2DIW A;  2ETB A;  4I2W A;  2X6I A;  2CFU A;  4BET A;  1OXJ A;  2CG3 A;  2EIN E;  4XKB A;  5CRV A;  3APF A;  3D9J A;  5ENN A;  3S7F A;  2YHE A;  3S7B A;  3G2U A;  3HVE A;  1TJF A;  3RIB A;  3UT8 A;  5HRY A;  2UWJ G;  1SQM A;  4RLY A;  2VSX E;  3E30 A;  1UJK A;  3EHR A;  2MRI A;  4H7Y A;  4JXT A;  1SVX A;  4XX5 A;  3HXE A;  4CZ2 D;  1QZ2 A;  2L0T B;  2GGF A;  3Q79 A;  2ETA A;  1N0R A;  3AG4 E;  4JA9 A;  3SGH A;  5B1B E;  4G8K A;  2HO1 A;  4UQY A;  3OXF A;  3CK9 A;  5ENT D;  3FU5 A;  1K1B A;  3DXK G;  3L22 A;  5KCM A;  4GA0 A;  2WQ6 A;  3V2X A;  1E8W A;  2P9S G;  4LNG A;  2IY0 C;  4FHK A;  2VGX A;  2WXR A;  3AS4 A;  3ESK A;  3FUH A;  1K3Z D;  3PZD A;  4DPR A;  3JXJ A;  5ENS D;  1MQS A;  1EYH A;  3UKU G;  4LG6 A;  4HB5 A;  2ZGG A;  4AEZ C;  4KT6 B;  4G25 A;  3L13 A;  4HOS A;  3MX3 A;  2JAB A;  3MEK A;  3PEV B;  2EIL E;  2WB2 A;  4AOF A;  3PH0 C;  1A17 A;  5HQ8 A;  4ZFH A;  3TWV A;  2VSY A;  3X2Q E;  3U4T A;  3NZS A;  2VGY A;  3GZS A;  4F6R D;  2B0O E;  4WNF A;  2Y1L E;  4KYO B;  4LEU A;  4AVX A;  4FJY A;  5B3S E;  2V8S E;  4L9P A;  4B93 B;  2XEN A;  3RKV A;  4J0U A;  1HZ4 A;  4U0S A;  1QYM A;  5CEA A;  1H2U A;  4MLP A;  2LAH A;  3NBN B;  4UWK A;  1KLX A;  3ZXS A;  2EQX A;  3E32 A;  4BFR A;  4I9E A;  3TAX A;  4K5A B;  3LEW A;  3LY8 A;  5AQA A;  3ULY A;  4PUC A;  3QB2 A;  5ARG A;  2I9C A;  3L9T A;  2IF4 A;  3APD A;  2B6C A;  3JUI A;  3GZ1 A;  3UM0 A;  4EBA G;  4JW1 A;  2X6K A;  4GZD A;  1TN6 A;  3DSU A;  4HNA D;  5LP0 A;  4BX9 A;  5CRU A;  3I4R B;  3SHF A;  4I6G A;  3HXB A;  3LJN A;  5J08 A;  4ATG A;  3N71 A;  4WWO A;  1H0A A;  3FUD A;  2Y0B G;  3RRM B;  3C3O A;  3ISM C;  3BU8 A;  3ZHE B;  4TXQ A;  5D66 A;  1Z5S C;  1BLX B;  1FVF A;  1JCQ A;  3ASO E;  4C48 B;  3G2T A;  1E8X A;  2VYI A;  4UWH A;  1OWL A;  4BT9 A;  4GZ6 A;  2LNI A;  4C0E A;  4JVS A;  4PS8 A;  4M7C A;  3ZVV A;  2WXJ A;  4FLH A;  3G2S A;  3LY7 A;  5A7D B;  4I6J A;  3I5P A;  1N95 A;  4KZC A;  2VSN A;  1P5Q A;  3FEX A;  2V5Q C;  2NXP A;  4A1G A;  1D8E A;  1TYQ G;  2FBN A;  2YQ8 A;  3O4Z A;  2P9K G;  3AG2 E;  3APC A;  4L1B A;  2CHX A;  4W9R A;  5FTP A;  3U66 A;  5JJ7 A;  3ZFW A;  4DX1 A;  3LS8 A;  4U7E B;  3VLF A;  2WPV A;  1FVH A;  4CT0 A;  3MKQ A;  5LCW J;  2Y4T A;  3FTS A;  2KXP C;  4FU3 A;  5E75 A;  2ZGD A;  5BPP A;  5C2Y A;  4I6E A;  3R9A B;  2YIN A;  2ZXW E;  1YCS B;  3LVR E;  3BEE A;  1SA5 A;  3J5P A;  2KAT A;  1V54 E;  2C2L A;  4K5C A;  1S64 A;  4GTS A;  3L54 A;  5FQ4 A;  2KCK A;  4N3B A;  5G04 J;  4FC8 A;  2DZO A;  5T4Y A;  1TR4 A;  3C3R A;  2BKG A;  4B8C B;  5BUZ A;  1MX4 A;  3D3M A;  2H6F A;  3FHE A;  3L17 A;  2IOS A;  2OVB A;  3TWR A;  2FF4 A;  2OCC E;  4Q94 A;  4GCO A;  2AW6 A;  3TWU A;  3TG4 A;  1D9S A;  3PZ1 A;  3J5Q B;  4GAA A;  3B13 A;  1OY3 D;  1OWN A;  3BUA A;  3MGB A;  3E37 A;  1N9A A;  4ANW A;  5DIZ A;  1FT1 A;  3QOU A;  2J07 A;  5BNW A;  4KZ0 A;  3DSS A;  1WAO 1;  1BI8 B;  3D9M A;  4Y6C A;  1FT2 A;  3EHQ A;  3JQ1 A;  4P29 A;  3UM3 A;  1ELK A;  2BKK B;  3TXM A;  2PZI A;  1O1T A;  3QC1 A;  5ENO D;  3IKO B;  4ACL A;  4DX5 D;  4G11 A;  3S7D A;  4A3V A;  3FH5 A;  4KVO A;  5CED B;  1OUV A;  2VSO E;  2NYJ A;  1DVP A;  3GYZ A;  4MBG A;  4FLB A;  2X6H A;  3BG1 B;  1S70 B;  2IEJ A;  3DEO A;  3SBS A;  2ZU6 B;  4N3A A;  1HE8 A;  2VQ2 A;  5G2N A;  4BSZ B;  4F53 A;  1TN7 A;  2BTD A;  4NUR A;  3G2V A;  3EJN A;  3CVW A;  2R2L A;  3CVU A;  4OAV B;  3IXE A;  4XKC A;  4QFV A;  2KM4 A;  1NI1 A;  4DUI A;  2V5F A;  4J8E A;  1BU9 A;  3MCX A;  1DCQ A;  2WXI A;  5FT9 A;  1A5E A;  5ARF A;  2AVP A;  3KSQ A;  2MHK A;  2R02 A;  1O1S A;  2C0M A;  4ILI A;  3FU3 A;  4L7T A;  3CGH A;  1KT0 A;  4MS6 A;  1BD8 A;  5FQ7 A;  5ITZ F;  3CVN A;  5KWD A;  2P9N G;  2I1J A;  3OXG A;  3CVV A;  4G26 A;  3RU0 A;  4CGV A;  3Q15 A;  4O1P A;  1H6P A;  3HIZ A;  3T9K A;  5BXU A;  4EEC A;  5CHE E;  5JHB A;  3T8K A;  2P2C P;  1NFI E;  4LSZ E;  4CGW A;  1X5B A;  4I9C A;  3HYM B;  1VDY A;  3B7B A;  2EIJ E;  3AU4 A;  2IJG X;  1UW4 B;  2XEH A;  2UY1 B;  1WM5 A;  5D0Q D;  4Q69 A;  4I1O B;  4BWR A;  4DRX E;  3HXF A;  3SZ7 A;  1PY1 A;  3ULE G;  3EUV A;  1UN9 A;  2M63 A;  1X81 A;  2XQ0 A;  2FO1 E;  1N11 A;  1H6K A;  1DC2 A;  2KBX A;  4UWG A;  2OV8 A;  4XEI G;  4TXR A;  4AJW A;  3Q49 B;  1MYO A;  3HVE B;  2KZT A;  2C0L A;  4HOT A;  1HG2 A;  4GPK A;  3AS8 A;  4LUN U;  2KCV A;  1GW6 A;  2AXU A;  1ELW A;  3L08 A;  4N39 A;  1MX6 A;  2WXO A;  1O1R A;  1KPS B;  4HXI A;  3V2O A;  3PDN A;  2OOE A;  3BQO A;  3C5R A;  2XEV A;  1L5J A;  1Z6T A;  2VJ8 A;  3MYV A;  4EBA A;  4LRZ A;  3ML8 A;  4CCA A;  2E2E A;  2IFU A;  3KAE A;  3NF1 A;  2PQN A;  2QFC A;  3QWV A;  2QYJ A;  3TWT A;  1U3C A;  5KNG A;  2P9L G;  4ME2 A;  3ONK A;  1IKN D;  3RRN B;  2P9P G;  4JHK A;  1IHG A;  1K8K G;  4DI3 A;  5FJY A;  4ACK A;  4BES A;  4XIF A;  4JZY A;  1NA0 A;  3IEG A;  3IV0 A;  3FTZ A;  1LD8 A;  3ZPJ A;  3UX4 A;  3W9F A;  3DPY A;  4GTQ A;  3W9G A;  3DPD A;  4OVV A;  4URK A;  4JA7 A;  3SD5 A;  3ASN E;  3QDN A;  2R03 A;  3Q9N C;  2FO7 A;  4MRU A;  5A23 A;  4B94 A;  3PUJ A;  5D2M C;  2PL2 A;  2XGO A;  5CER B;  4FUL A;  4HOQ A;  3AS5 A;  2WXM A;  5FQ6 A;  2OVF A;  3UTM A;  2AXV A;  3MV2 B;  3HXD A;  3I3N A;  1AP7 A;  2A4Z A;  3D9O A;  1KT1 A;  4KXK B;  3URZ A;  3CKB A;  2I2O A;  2YNQ A;  3KEZ A;  3VLD A;  2IQC A;  4DI4 A;  4YVO A;  4PS3 A;  3RO3 A;  3PNL B;  3HG0 D;  4XI0 A;  1TNY A;  2LSV A; 
#chains in the Genus database with same CATH homology
 1TNB A;  1LTX A;  1O1T A;  3C72 A;  1N4S A;  1JCS A;  3SFX A;  2H6G A;  3Q78 A;  3Q7F A;  3Q75 A;  4LNG A;  3DSX A;  1DCE A;  4GTR A;  4GTT A;  3Q73 A;  3DRA A;  4MBG A;  1LD8 A;  1KZP A;  3DPY A;  4GTQ A;  1TN6 A;  3DSU A;  2IEJ A;  1SA5 A;  3DSV A;  3HXF A;  1SA4 A;  3EUV A;  3HXC A;  2ZIS A;  1S64 A;  1TN7 A;  1X81 A;  3KSL A;  4GTS A;  3HXB A;  3SFY A;  1QBQ A;  2ZIR A;  1N4R A;  2F0Y A;  2R2L A;  1N4Q A;  1TN8 A;  1JCR A;  1MZC A;  1TNO A;  2H6F A;  1KZO A;  1FPP A;  3PZ4 A;  1NI1 A;  4GTV A;  4GTP A;  1JCQ A;  2BED A;  1N94 A;  4YDE A;  4YDO A;  1S63 A;  3E34 A;  3PZ3 A;  1NL4 A;  4EHM A;  3HXD A;  3E30 A;  3KSQ A;  3PZ1 A;  4L9P A;  4GTM A;  1O1S A;  3HXE A;  1O1R A;  3Q7A A;  3E37 A;  1N9A A;  2H6I A;  1FT1 A;  3DST A;  4GTO A;  1N95 A;  1TNZ A;  1TNU A;  3DSS A;  3Q79 A;  1D8D A;  4LNB A;  1LD7 A;  1D8E A;  1FT2 A;  1O5M A;  2H6H A;  3E33 A;  3DSW A;  3E32 A;  3EU5 A;  3PZ2 A;  1N4P A;  1TNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...