2ZIUB

Crystal structure of the mus81-eme1 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
322
structure length
258
Chain Sequence
ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 73
structure length 258
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziuB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ziuB01
2JNWA 4BXOA 1J25A 4M6WB 1J24A 2ZIUA 1J23A 1J22A 4P0QA 4P0PB 2BGWA 2JPDA 2ZIXA 2ZIWB 2ZIVA 4BXOB 2ZIUB 4P0QB 2A1IA 4M6WA 2M9MA 2ZIXB 2ZIVB 4P0PA 2BHNA 2ZIWA
chains in the Genus database with same CATH superfamily
3ZY2A 5CT8A 1GO2A 5L3SB 1AZSC 1KL7A 3LSYA 4WZBB 5AVQA 4IXTA 3PD7A 8ICTA 2NXNA 2RH9B 3DT9A 1XSLA 4TTQA 3VPAA 4QU5A 3NT2A 1TO1E 4NKRA 3G68A 4X41A 1P5HA 4MA4A 2R6GA 4G84A 1IULA 1CS0B 4PQFA 1KDZA 3W8NA 4FTWA 1KMHB 4EQZA 3PGKA 1IG3A 1QRTA 1B8UA 1J8VA 1QIFA 2GCGA 1NNI1 1NG1A 3U5TA 5AKYA 1IONA 3QVJA 3VC1A 2ZAYA 4QG3A 1DIGA 3K73O 5AVYA 1URJA 2GEVA 1K5DA 4MDEA 4PLWA 3IKLA 2FOXA 5DP2A 4KPFC 4N6OA 4KGXA 3SFVA 5AKGA 3D43A 4LJAA 4DQVA 1O0BA 5LWQA 1YDMA 1QOPB 2HTFA 4HDAA 3THXA 4EKYA 1KRXA 1SVIA 4ABYA 2Z5GA 4ZI2A 1JHOA 4LDPA 2QAGB 2ODWA 2Q8QA 4TXMA 3EZXA 1KK2A 1QQAA 5KFAA 4HF7A 1U0GA 3AYXB 3O93A 4I1PA 4F5WA 4UTXA 4BVEA 2AL7A 3AEQA 2HSDA 2OV8A 4B4DA 3UQZA 5DTJA 5G0TA 3Q6MA 1NW8A 1E1QD 1DPFA 3ILXA 4FUTA 1YVRA 2NOAA 3HXMA 2DHCA 2PKRA 4F50A 4MRMA 1NDHA 2RKWA 3A6EA 1J21A 1Z6XA 3G1UA 3W1EA 1MO4A 2XWBF 4NTZA 3RRGA 5LQRA 1R6AA 1FXUA 3HVIA 1AUXA 5MDHA 2W9AA 5GJCA 4K6GA 4E0DA 1SIJA 1U0HC 2HIGA 3GMIA 1WR8A 4BZWA 1X7WA 1Y42X 1QOQB 4BYGA 1E2JA 1X7XB 3RFXA 1NSTA 4AN1A 5HS4A 1A0OA 1PBTA 4GVLA 1Z73A 4HDKA 4FSHA 2HBZA 4BNFA 1MJ5A 4I6JA 4MR8B 2O0KA 4PLHA 4AF8A 1TZMA 4RF4A 2JHPA 4CT5A 1Y4DE 2HF2A 4OB8A 3SU8A 3IQEA 1HNZB 2YYZA 2E4WA 1QFSA 4MQ5A 3AG5A 2HIMA 1WLSA 2C78A 4ED7A 1K7EB 4PR0A 8ADHA 4LY9A 2BSAA 4XA5A 1G18A 4IRMA 4LK3A 3UMCA 9ICAA 1RHUA 2CFCA 4KI0A 4L75A 3DO5A 4XUDA 5ALFA 3W3AA 3WHKA 5JRJA 3GVIA 1NLYA 3NTLA 1D4ZA 5HQJA 4D82A 1HY3A 3R7FA 3GHHA 3OZUA 2HLDA 4E2WA 5M34A 1C3LA 1FFHA 4G0WA 1LDBA 1Z2DA 5JAOA 2L18A 5JZBA 2QT0A 4ZFNA 1YOVB 3KV3O 5CCEA 1EDBA 3C6MA 4EBDA 2A19A 2HCTA 3DKKA 5GWXA 1EU1A 2F67A 2EANA 3TR6A 2VYFA 2EDUA 1F38A 3KJGA 2PUTA 4QIWC 2VEDA 3L7AA 4I27A 3M6AA 1ULTA 5LBUA 2I2FA 3FNBA 3FSRA 5CXSA 3L4EA 4DG5A 4C78A 4RUCA 3B1FA 4ZQFA 2ZSFA 1JI7A 4M86A 4OB6A 5J3JA 4F3OA 1IUOA 4G0VA 4PHEA 1KI3A 3LY9A 1B6TA 3JQAD 3ZLBA 2GBFA 3KSAC 4DOAA 1HRDA 4A1OA 2ATCA 4OM8A 3MNFA 4ED1A 2DH6A 1CWUA 1OCEA 1C41A 5T4EA 2O8CB 4RKFA 2E4UA 2GJ9A 2PUAA 4I2JA 5BUCA 4R4JA 1C8KA 3B7PA 4Q9JA 4LV8B 2PT9A 4K1LA 4F5RA 721PA 3O31A 2VRNA 3FTEA 3VO9A 1OXMA 4D6XA 2D0DA 2VPIA 3L1UA 4I2CA 4NCNA 2H5LA 3P2KA 3R41A 3KQNA 2WHPB 3QPWA 3Q7IA 2Z57A 4QXRA 3CE6A 4H0CA 1RBZA 4HPXB 2QTTA 1XA3A 1M2OA 1Q44A 1PVRA 3MD0A 4ZRMA 5ALYA 3FZYA 4GLLA 2HREA 2J6IA 3AERB 5EIAA 4C5BA 1QH8B 1P7PA 3D7SA 3EBOA 3QX8A 1CR6A 3M1AA 1JA1A 4JU9A 5CB4A 1LK0A 2ASJA 3QKSA 3DMTC 1UQTA 1NN0A 4DR1B 1JDUA 4UE3S 3QUQA 1MZPA 4NCHA 4JIMA 2YASA 4JLWA 2FWPA 3KALA 2HK6A 9ICIA 1QTMA 1QF9A 5TS2A 2IXDA 4M9SA 1QX3A 5KYWA 4C4ZA 4B9LA 1PE0A 1U7PA 3PZRA 5E6RB 3U1VA 4PGQA 4WHMA 3EWAA 1Z6TA 1I7QB 1BXKA 1XDSA 3R3UA 3IVCA 4N65A 3GNTA 4N3AA 1EWTA 3BWYA 3MLAA 2H1RA 4MQMA 2O3JA 1XCGB 1NZBA 1P8AA 2EQAA 2OP0A 3Q11A 3AO0B 2ROQA 2YMMA 3I3SR 2V55B 5FOWA 3TQTA 2PGXA 4LYFA 4NATA 2EJWA 4AKHA 2HU5A 2AG6A 2VQ3A 3KHUA 3CLUC 5SZJA 1KU0A 1U0SY 2VF4X 4CCSA 3KD3A 4HR7A 3AQFA 4IG4A 4RLSA 3LHFA 4F7WA 3ZD7A 4Q4DA 4IJVA 1CF4A 3Q8KA 2XRZA 1Q1EA 4DPLA 2ASVA 3GQVA 2XB9A 3ZIUA 5K3CA 1T8SA 1KO8A 4EBEA 2VATA 2C9MA 4C8LA 3E2IA 5K3FB 2NZVG 3LIPA 3GCGA 1KIFA 2DOKA 4YP7A 1ML3A 1CQIA 2XMDA 4FKMA 3WDSA 1DO8A 1SHZA 1QF7A 2SICE 4O3MA 2A4KA 3A0RB 3ZJTA 2AJQA 1XNHA 4O2AA 1XZCA 3B1WA 3DBLB 3BHNA 3UJ8A 4L85A 1ZI9A 3F7MA 3RM3A 3BIFA 2BJHA 4QM7A 2LBPA 4W5JA 5KOHA 2B9EA 1IY0A 3ITEA 2H4FA 1XCMA 5IKPA 3ELDA 1A9ZA 2DR2A 1I6KA 4G09A 3H11B 4QZAA 1CCWA 1HTBA 1XP5A 1Y8AA 4MYSA 3TOXA 1UBSB 2H4YA 1NVXQ 2R65A 3VR3A 1IJEA 5FORA 3KT6A 3DTTA 4HNRA 1JT9A 1J7KA 5CJ7A 4O3RA 2GR9A 4HWOA 4EHDA 1P1CA 3WG9A 2YY6A 2R11A 1KZ9A 3K5HA 3RR7A 3KKEA 5KVQA 3FHJA 3ZQJA 4ZQHA 4OO1J 3FOCA 4QXMA 5ALRA 4O29A 1NW4A 2HBYA 4PHHA 3M6WA 3Q40A 3CX7A 2PXHA 4L57A 2CDAA 5FV4A 4KRYA 3NS7A 1IZZA 1Z7BA 3H3JA 1C30A 4F7DA 1V45E 4BNXA 4UHKA 2FR0A 3CB2A 4J9NA 4CM3A 2W6PA 5BXQC 3E0QA 4K86A 5C1IA 2P2NA 1OKKA 1YR3A 1GTG1 1I2ZA 3O91A 3L4BC 2HJSA 5CD9A 4ZWNA 5FRDA 4ZA2A 1E69A 4DNFA 2WW8A 3HJHA 3WNCA 2OGWA 4XUEA 1K6MA 3OKFA 1M1YB 2DLCX 4MUMA 1TK3A 3DQZA 3A4VA 3HABA 2RGGA 5LYJB 3EZLA 3FMPB 3IC5A 3RUDA 3M2TA 4AJIA 1G63A 1DKQA 2VYVD 3GLTA 1SV0C 2MR5A 3BA1A 3LOUA 8ICNA 1USWA 8ICEA 1MH1A 5J0UA 3ACCA 3MT9A 2IY9A 5BVHB 1QG2A 4O0MA 2MTBA 4KJZA 4QJIA 4J9QA 4AJHA 1AHHA 4R51A 1COWD 4EJSA 1TCUA 2JIZD 4MCIA 4M88A 2D0IA 4DDVA 1E3IA 4DLWA 4DS5A 4ND1A 4RPIA 5M29A 2Q49A 3X1ZA 2FZLA 3W77A 1MXHA 1S01A 3KIPA 1E3JA 3H0KA 3SC2B 1NC3A 2PQMA 1A5SB 3PSIA 3OA0A 4RLQA 2E6UX 3EHDA 2VTBB 4P0PB 4DBZA 4QVGA 2Q5FA 3IQFA 1MA0A 1RU3A 2CXPA 4I4TB 2O7QA 3BTUA 3IMCA 2C28A 2DE0X 5EHQA 4XB2A 4P3NA 1HTTA 4AMBA 2I6SA 3DC2A 4HMPA 2I9PA 4R7ZA 4BDPA 4KLLA 3NLLA 3TQOA 2RGAA 2YDXA 4PQRA 3UTDA 2BFNA 4YRNA 3JR3A 4BQNA 1WCYA 4EZEA 3H1FA 1WULS 1XI2A 4BP8A 3JPNA 4ZAZA 1D9XA 4H0FA 2J3EA 1E5LA 1RYRA 1C8VB 3RGGA 2X86A 4IIXA 4XRGA 3DONA 4QUIA 3ZJVA 1P3JA 1G5QA 4I1YA 4COOA 4TTJA 2BPFA 5DNCA 1E4YA 1RAHA 4JWNA 1T4CA 5BQ5A 2ASEA 3HBMA 2VDLB 2YX1A 1U0LA 4PY2A 1H93A 3AP3A 1YCFA 2R62A 4JX8A 1VFNA 2PAAA 2B4YA 3EXHC 5K2OA 1LW6E 3OFNA 3P9YA 5JZVA 3BOSA 5JDCA 1N6NA 3ITKA 2LGJA 4MXDA 4XDZA 2O5EA 1QWOA 4QASA 3GNSA 4C76A 1JALA 4YRSA 1ISHA 5B4UA 2Z0MA 1TVKA 5FNVA 2X42A 4JQSA 5KAIU 4DA9A 3F97A 5EIBD 2HHUA 1FB5A 1ORWA 3KE9A 4Q00A 3VOAA 1LQUA 2DQZA 2RG1A 4GR5A 4YRZA 2ZYUX 3DBVO 3UXEA 5H68A 1M1YE 2BEVB 2J08A 3BIJA 4E51A 2HA7A 4MJXA 4YAUA 3NU1A 4ZI7F 2CB0A 2BN4A 4A8PA 3K71B 2WV9A 1YHZA 1JEQB 3L84A 3T6KA 2OZPA 4HAIA 4ELUA 3GAFA 1SAYA 2IGBA 2JCVA 2XMSA 1KAMA 3OSUA 4QRIA 4R66A 4BWYA 1WCV1 2YRFA 2FHSA 2I7XA 1KP3A 4IYRA 3F3KA 3C8DA 3IFSA 4ASUA 4P1ZA 1L5UA 3WXBA 2WIKA 2CLCX 1XMIA 2NSLA 4RZIA 2PA0A 1E2KA 4RDXA 2BL4A 1ZM7A 5BNFA 3ID6C 4FS1A 4MGIR 1Y7TA 3AUTA 4Q39A 3GEBA 4RNMA 1ECFA 1F3OA 3JQQA 2E49A 1F8FA 1HGXA 2WM3A 4J9RA 2GPTA 2PSSA 3LPMA 2FWJA 2ZWOA 3WOVA 2OFOA 2Q9AA 1X9GA 3BB1A 1IDOA 1EIZA 4D9FA 4BLRA 3WWOA 4TOIA 2KICA 3BS7A 3M83A 5PGMA 1LTQA 5CIYA 3P26A 1EA5A 2VH5R 3WLIA 4UAWA 2DULA 1DRKA 2XD9A 1F44A 1L4MA 1YCHA 3SIPA 2ZJBA 1MQ8B 4MQFB 4Y0VA 1AS2A 2C59A 4UAZA 1H94A 3NANA 3PDUA 4F9TA 3H75A 2P2DA 4XYBA 2RHWA 3V7FA 4M9ZA 3A6HA 3AN1A 2H2AA 3MOIA 1DDGA 4D0LB 1OB5A 3W2IA 5FCDA 4KHZA 5A7HA 2HUPA 2RI6A 1KDYA 1U2QA 5KFUA 3DPUA 3PC8A 5KNBD 5BNTA 4B2YA 4H3SA 1MABB 3GUYA 3HADA 3WLAA 5M04A 2WAMA 5BNIA 4WLOA 2D3WA 2BMDA 3ABZA 3STUA 2VL7A 2ZVQX 2JHCA 1L3SA 1F1JA 1WD5A 4DZZA 4XKJA 1RKXA 3V6MA 2P2SA 3UV7A 3C1UA 1BDMA 4DXAA 3B7GA 4B33A 4O0LA 2LCIA 3OQPA 5BN4A 2OLJA 5DQIA 2VBFA 5BW8A 3K0HA 4GXKA 4GM0A 4OTZA 4HYYA 3QEMA 1RHKA 4YVZA 1YAJA 3NHSA 1BGXT 2YFKA 1VIYA 2VZEA 5ITSA 4IHJB 1K1EA 4OYHA 2RBEA 1CRWG 4NPAA 3HXPA 3E4DA 5BSHA 1R5BA 3TLEA 1G9SA 1UBFA 1BCSA 4DKXA 3FOAA 3H8WA 5DKFA 4BO6A 4PO8A 4H6WA 4FINA 2NO0A 1N5JA 2VNAA 4MW2A 2AKAB 4LECA 1SU7A 5KHLB 3CSUA 3H6GA 1X92A 2BPGA 5HKLA 5DGAA 3VH4A 3C15C 3ND5A 4F6CA 2VDRB 1P3Y1 2WT9A 4MWOA 5TQ0B 1CUBA 4JLMA 4G9GA 2PY6A 5E3JA 3PFBA 3QLJA 4FONA 2HLNA 1QUEA 4WA8A 4V1CA 2R8BA 1HIWA 1UA0A 3N8HA 1XRLA 2QT1A 4H3VA 4LW8A 2EARA 3WK5A 1XLWA 4N5IX 1GUDA 1C1DA 3AR8A 4DCGA 3DLTA 5TF0A 2F1OA 2FKAA 3Q8PB 1NVVQ 2GFQA 2PRSA 2IFTA 3LG2A 4WE3A 3OQVA 1HT3A 1N5LA 3BRWD 5E4FA 2BFPA 1XDDA 1PD1A 5ILQA 4LMPA 1IMOA 3D6VA 2AU0A 1QQ7A 4LQ4A 3LNTA 3OY2A 5FADA 1KNXA 3BORA 4HQOA 1Y4ZA 1V26A 3SYMA 2AHOA 4AS3A 2JJQA 4RLHA 1U63A 2I3GA 3C70A 3F6SA 4DY4A 4PRKA 4Q3KA 3LDUA 1OX4B 1XEXA 3TB6A 1NVFA 2BGGA 3RV4A 1T9CA 2AI1A 4M1YA 4KO4S 5C1OA 2DU8A 2PGDA 3TCXB 3CZPA 2YS6A 3WWDA 2Q5IA 5KQSA 4UEOA 1UBCA 1ZXLA 1JHRA 2W58A 4TZ6A 3DE5X 1TQ6A 4RHFA 2HVHA 1SVMA 4ECVA 1WEKA 4FFBA 1J0EA 1Y3IA 2QMZA 3QVGA 2VKTA 1GQFA 1OI4A 3KU4A 2EZZA 3IA2A 1RWXA 5JCXA 1S2NA 1YQQA 2MINB 3MS2A 2QB0B 2X0EA 1H3NA 1FUIA 1P9LA 4KWCA 5IKMA 3RHFA 5D4BA 3R0VA 3OM9A 3AL0B 2CK3D 1UJNA 1T4BA 2OV2A 3BMCA 1NGSA 4W5TA 2VPZA 1P75A 2XQKA 2HMXA 2FH5B 1HE4A 1QGED 3PHIA 3STTA 3N7TA 2R6AA 1R0LA 1Q17A 4XVCA 1RJDA 2DETA 3GGCA 2EBFX 5K3AA 3L1JA 3GQBA 3KJQA 4C21A 3GPIA 5H3LA 2LTAA 3OJFA 4LWZA 2N9UA 4UBCA 1JIJA 4IJKA 3TX2A 2OFWA 4MUBA 4JJ7A 2BR4A 1E2MA 5LOVF 1SQ0A 4I81A 2YJGA 4WKBA 1BE8A 3G2JA 2JBAB 3V9PA 1BCRB 1CQZA 1NK6A 4EF6A 1VSBA 4ZJUA 2PUWA 5FEMA 2V7GA 5JAQA 1AUPA 2P2GA 5EUQB 2QVZX 1Z6ZA 5IS2A 1VJRA 2JHAA 4ZQEA 1QE0A 1JJFA 1KAEA 3SENA 2IPLA 2O07A 4KWHA 4EA7A 4JOSA 4DJJA 3WOHA 1L8LA 3CF2A 3MHPA 1UBEA 3KR9A 4XW2A 3C98A 3PXBA 2KJQA 4B79A 2F3NA 1NJZA 4YRGA 2C77A 4DBVO 4UCWA 3ZWYA 1MRSA 2IC5A 3SI8A 3T5LA 3GJYA 5HW0A 3AQIA 2OQRA 1S0MA 4NX2A 1G64A 1U2ZA 1EVIA 3L8DA 1PTKA 3LQ2A 1U4SA 3NDJA 1ZITA 1TAMA 3KV1A 3RYIA 4I1OA 1BNPA 1W34A 3HCNA 2C8KA 4I1UA 3OLQA 2GK4A 5A9SB 1MKYA 3H05A 2D4HA 2IWRA 3E05A 2XNKA 1ODSA 4R8KA 1DFHA 3WQRA 3U26A 3NIGB 4BJ1A 2IH4A 3D3WB 2ZREA 4BKMA 5CA1B 1JEYA 2YS7A 4F91B 1SCJA 2FZ4A 2QBYA 3C1TA 5AW2A 2KHQA 1PJZA 5TX7A 3RHTA 4KO2S 1F3LA 3IRVA 1BE0A 4HB2A 1VDMA 1UBUS 1YFZA 1ND6A 4YLEA 2OAEA 2BGIA 3GLRA 3KPJA 4R9VA 5ESWA 5CBPA 2HRBA 4AJ2A 2YC4C 5D5HA 2RGCA 2VA8A 3TPCA 4MI1A 4RKWA 4UBLA 3SJAA 2PKWA 5EJ9A 4NLKA 4DJEC 2CCJA 1GAEO 2P27A 4JKOA 3K72B 2H1FA 3ZBUA 3JQPA 1QSGA 4RTPA 3ZU2A 3ZY4A 4LHWA 1RKQA 5C0OE 1JHYA 3TOCA 4K7JA 3K5IA 4J76A 4BNDA 1TJ3A 4D44A 2VWQA 3THYA 1XC7A 1D03A 3EB9A 1J0XO 3JQDA 4KIWA 2JANA 1Z17A 4RFVA 1W0CA 1H6BA 4GSKA 5B3JC 4TYPA 1WY5A 3LK7A 2BP7A 3S1LA 1Z75A 2WA1A 4UPVA 1L7XA 2H59A 1OYVA 1NURA 4LCEA 2HNBA 2UAGA 1K0UA 4WZZA 3F7NA 4MP3A 1D8TA 4V0NA 2Y1FA 1Z5PA 1V8FA 1U48A 2EKBA 4D4LA 4X65B 2GN8A 2XYVA 1L6NA 5IF9A 2YIMA 1N2CB 4AULA 1I4WA 3U13A 2YWBA 5J9FA 3QMVA 2SKCA 3SHVA 2PKCA 3TMAA 1U0NA 5A3RA 4LSGA 2NPFA 4A2WA 1QV6A 2PS3A 1SVLA 4C3ZA 4K26A 4HYKA 3ORYA 1DB3A 1FDTA 5DYWA 3LS2A 3ZVMA 4I8IA 4P7KA 2BLNA 1WDWB 1XELA 4G1MB 2AD1A 3D3JA 4HGYA 4Q3CA 2O6HA 4B3XA 1VKJA 1JFTA 4RW0A 1YBMA 4DVGA 1Y5MA 4QBFA 2ZIVA 3I6ZA 3JQBC 4UMFA 5EVCA 5SV2A 1RRKA 4BMSA 5LQJA 4DMGA 3WQBA 4KODA 3B85A 5HK8A 2XZDA 2V97A 2A3VA 4HDRB 4QNMA 1QS0B 1EZ4A 5JS6A 1X19A 1T0JB 1DZIA 3ORSA 5J0WA 2PDAA 4N5LA 3SAHA 3PNOA 2ZBFA 2EZXA 5IH7A 3AL0C 3EJWA 2DUUA 1CXZA 1T8TA 3QXXA 1E58A 5DYNA 3BWMA 3ZZ1A 3CUVA 1I1QB 2XMZA 4U00A 3W5UA 4K9NA 2A5JA 3B1XA 4ID9A 4R1UA 1G20E 1J2NA 4RGQA 5K0GA 1CFJA 1P4AA 2R66A 1LLCA 4IVRA 3MBYA 4N3BA 4EI8A 1IBLB 4JI4B 1QGOA 1J09A 4M1ZA 3SS8A 4IXMA 4AXBA 2FR1A 4D42A 3IP5A 3W4KA 2QZ9A 3TINA 1FFAA 2RBGA 4UXHA 5B7PA 1E9EA 4B6SA 5IG2A 3DJFA 4Z3KA 2PD6A 3ETNA 1ZM4A 3RUIA 1PWXA 4FBTA 2FZ5A 1X6JA 3I4LA 4WKGA 4Q16A 2ID9A 3B2NA 1AH2A 4MW5A 4F11A 2XB6A 4YQWA 2R5FA 3C87A 2JIMA 3WNBA 4Q19A 1KGSA 1SGWA 3VISA 1EKXA 2MMCA 4X91A 4N0DA 4KAJA 1C14A 1ZSNA 2J46A 3D31A 3OPYA 2JLZA 2Y0DA 2GA8A 4XLTA 1L3VA 3GLUA 1TUBB 5AKJA 4URZR 5F9NA 5LUBA 3PQ8A 3FPBA 2VJQA 1RABA 2YVQA 5JRDS 2A0UA 3VU0A 1T2NA 3CUSA 2CL5A 1DWUA 5TGZA 4BOYA 4FQ7A 4E21A 4UKDA 3RB0A 4IJQA 4B85A 2BCQA 4C1NA 3RVMA 3RB8A 4HFJA 3U09A 4GP9A 2IIPA 4BN4A 1QO7A 5CLFA 3UMVA 4G5HA 1SZPA 3UXMA 2R18A 3TFSA 1QBGA 1UDXA 1BE1A 3AR5A 3ZZ0A 4AJ4A 4KBYA 1OZHA 1FFCA 1UJ2A 3UKJA 4YJ2F 1MO6A 3NAMA 4C6SA 5H9VA 2OCGA 3M1LA 3AQEA 2IYSA 1N2CE 1DTWB 1OU0A 3DEYX 3H40A 1U2PA 3HNRA 1NU8A 4OHCA 4EKNB 3A37A 3SIWA 4OJQA 4ZV7A 5JUWA 5JMTA 1Z39A 5CFMA 1FX1A 3V2GA 2PX2A 2CXRA 5FOUA 2BJVA 4B83A 7ABPA 1XEFA 1M0EA 3NW9A 2FCAA 4RD3A 3K0FA 4GVXA 2R8GA 2H48A 3DJYA 2W2VA 5DB7A 1ZMBA 1EBFA 1ECJA 2XXAA 2FW0A 3HWX1 2JJ8A 2PUEA 3FN4A 1NZJA 1F4VA 4YONB 4B31A 4XUSA 3BE4A 2H1IA 1S2GA 3PFNA 3RSZA 3N0TA 2G4LA 3WBBA 3RFVA 3O8QB 1VE7A 2H65A 3QLVA 2RCNA 1CJMA 2H08A 1AQLA 2A1JA 4EM6A 1M0WA 2HHJA 3YASA 1GGEA 4UNSA 3JARB 2QN7A 1AMOA 4RFSA 3EF1A 2XC9A 1YL6A 3KCNA 4FYPA 1DG9A 2VA2A 1I0LA 4JL8A 2I76A 4TKVB 4RSRA 1CJSA 3EZ9A 2FPPA 3F49S 3E27A 2QYSA 2O0HA 2ODPA 4RQ8A 3EFOB 5AUPB 1UMDA 3DAGA 2F6RA 5CRXA 2CYBA 1HC7A 2AX3A 2FY8A 4LNHA 1Y80A 5TISU 1ZQZA 2H0AA 4DA6A 4G9BA 3V8MA 5L4NA 1B0UA 3NHRA 4PSAA 1G2OA 3H8SA 4YP6A 4MQUA 1YR6A 1TCVA 3VZCA 4FS8A 1WLYA 1H2XA 1QHHA 2QRJA 2W6ID 2ALJA 3O3NB 1IATA 3U4DA 4UEJA 3S2SA 1R88A 3PJDA 3ADPA 2BV3A 3QK7A 5AW4A 2Q27A 5ESDA 2HF9A 3LUFA 3OE7D 4Y1GA 1GFWA 3UHAA 5LNK6 2B61A 2FAXA 5BORA 1NT4A 2PMDA 1ZRNA 5C80A 5CEFA 2PZEA 1NUSA 2RLTA 3N2LA 2IBTA 3HRDD 3H5RA 2DC1A 1UZMA 1RADA 4AJ9A 3SZMA 5DHRA 3CH4B 2ISSD 4NOMA 3MEQA 4JVOA 2O0MA 2B8NA 1LUAA 1RJ9B 121PA 4TMFA 3GUCA 3ZJUA 2Y0BA 4A91A 2DKXA 1PLKA 1MJNA 1LQ2A 4FR5A 4Q3BA 5JZSA 2YW9A 5C46F 4BYMA 2J59A 5DI9A 2PFOA 1PJCA 4X5OA 4MRAA 3EQ8A 2Z1MA 4AT1A 1ZXBA 4FOPA 3DEIA 1H05A 5C3MA 4X8MA 1T36B 4RQ4A 3EZ7A 2J7KA 4I36A 3V42A 1R6UA 3MAGA 5LMCA 5HKKA 4ZGBA 1GCGA 1I4TD 3NBKA 1PX2A 3JQFA 1I1OA 2FJUA 4BMNA 1C9EA 3VR6A 5FOQA 1VBFA 5AVTA 3QUAA 3I6YA 1O6FA 3L7DA 1GZHB 2ZJOA 1O0CA 2IJGX 5KYGA 3UT5A 1SVWA 5AVXA 1NLUA 3UJBA 1XU7A 1K4YA 1BW9B 4CEIB 5IEJA 1QIIA 4P4LA 4GG1A 3PF8A 1BMFD 1V96A 4UE6A 4C06A 2YINC 1GD1O 3RAEC 4LZNA 5TEVA 1SKAA 1L5LA 4F5PA 3RODA 3NUQA 4W1SA 1USIA 2FPSA 3NCTA 3RANA 4J9MA 3RYFB 3EDYA 4ZZ0A 2WJPA 1KJNA 1NY6A 1FP6A 1G19A 4YMHA 2Y0CA 4E5PA 1N6PA 1TRKA 2H85A 1T9GS 3ZY6A 1MT3A 1X94A 3Q7RA 2G9RA 1MVLA 4WY5A 1J2JA 1WW2A 2D1YA 1L5YA 3KUXA 1F48A 1BVRA 3IKJA 3KO8A 4RY0A 3T0GA 1SGGA 1QR6A 3IG8A 3RU7A 1SU4A 3I2YX 2GCPA 2AUNA 3QNMA 3V5NA 5J2UF 4O4LF 5KQMA 4G81A 4PLFA 1SQ5A 1L5MA 1DZ3A 3WVNA 2XNDD 1TLTA 4HUJA 4L8VA 2QTMA 4PTYA 2DQ4A 1X9SA 3ZYCA 5DBIA 5KG0A 3HJUA 4EG3A 2DPJA 4WDQA 4GICA 3FYUA 1KY4A 5I4CA 3ANMA 4M38A 3UFBA 3NOQA 3NVMB 3PIRA 5GTHU 1R4NB 1W76A 4GEKA 2V7QA 5IDQA 2UYCA 5JI3E 4HNSA 4XSHA 4Z7NB 4CCHA 1DQNA 4NONA 2ZXIA 1B0PA 3BF8A 4EZIA 3QTBA 3GLGE 1L4HA 4D9MA 2KK0A 3BJYA 3UQYS 3V2UA 3H1BA 3WLNA 3RSFA 3D2QA 1S89A 5ER6A 2BDEA 2CNBA 3PGXA 5EUMA 3PNQA 1M7HA 3CTPA 1G21A 2QSYA 2EEZA 2MIIA 4RIHA 2Z1DA 4MS1B 4Y67A 4QXPA 2XYQA 1JG2A 3OCJA 4IGIA 4DF3A 5KC8A 4J8PA 2EP8A 4XWTA 3HCOA 4OMCA 2XB8A 5I48A 1CY2A 2BZFA 2ECQA 3O4GA 4KKVA 4D8WA 1K7XB 4BFYA 4K1XA 2RARA 5LXTF 1XD2B 2B2CA 2Y68A 4UM5A 2JASA 5C81A 2Q1XA 1KFEB 1GZDA 2YB1A 3L8MA 5BPHA 2YQ4A 10MHA 2P11A 4YCDA 4UAGA 2FP4B 4F4XA 3FPGA 4F97A 5LL6P 2AOUA 3VR0A 1EVJA 5JSYA 2PZLA 1SCQA 1NLFA 1HMPA 1ZQNA 2ANBA 2H31A 3FPJA 3ROKA 5AHXA 2VT2A 3VC7A 1TEZA 1VXRA 4URFA 4JLJA 1XB2A 4ZT6A 3NJ4A 5HQ3B 4B4UA 4IDGA 4DOCA 5LP6C 1XHFA 1TKRA 3QVOA 1FLDA 1UMCB 3U4GA 1E60A 3DF7A 2QIOA 2FPMA 1VP9A 5DMHA 1K6IA 1F6WA 3QFSA 1Y1TA 1NBIA 5EERA 1JX6A 1ZJMA 1A9XA 2BR5A 1J4AA 4BTVA 1JU4A 3PFIA 5BN1A 5HKBA 2PANA 4X93A 1WEHA 2G76A 3V55A 4UNNA 2XE4A 2C57A 2WJYA 4C0JA 2I7VA 5LZ4A 4P7GA 5BMVB 5K4LA 3I28A 1UXGA 4DSFA 2O14A 1SOAA 1LFAA 4DCUA 4JMLA 3SLKA 3V6JA 3AU8A 1VL1A 4NP6A 4YDSA 4TVSA 3FMFA 4FLMA 2I1LA 2X2EA 4DV0B 3OQBA 4R65A 4HADA 1VMDA 3P94A 4ARZB 3AX6A 1I36A 3LCMA 1E79A 3HKZC 1IE3A 5L9AA 3PX2A 4TRNA 5LZ7A 4D3FA 1GSAA 4UPDA 3LWNA 4JX9A 4H7IA 3L4KA 4C2AA 4MRSA 1B1AA 4A8JB 7ICOA 3V7LA 3X0DA 1QVVA 2AYYA 4LVCA 3NGXA 3M6ZA 1YZVA 1A96A 2BFOA 4O8CA 3KXDA 2ID7A 4YRFA 3LHDA 3KB8A 2FLWA 4OQFA 4M83A 3MJTA 1O9GA 1CHNA 1S5PA 4HVTA 2I1VB 3FR8A 5TRTA 2ONCA 3GVXA 2AT1A 3QVTA 5AK0A 4PGYA 1GFSA 2XMBA 1UXKA 4BFWA 5KVVA 1N3LA 5AOAA 4F92B 2J7PD 1GQOA 1CR2A 5C5IA 2ATXA 4X60A 4KLHA 2VJMB 3FOFC 2CVZA 1WCXA 3H97A 2Z3WA 3LQQA 4DEZA 5DBHX 3Q9NA 5EZSA 2GUWA 1DXOA 4R3WA 5DBAA 4AQ7A 1Z6GA 1DEHA 1JYFA 2FP3A 3TKYA 1K86A 1ESNA 1YS6A 4CF6A 1BX1A 3GR6A 1C29B 4ER6A 3RFUA 4WK6A 3C4JA 2HLDD 3WRXA 3G2NA 5KFEA 3HTXA 1W36C 3RTBA 3VAYA 3HRIA 3MJ4A 3K2EA 5F76A 4U7DA 4QUJA 3GV7B 2IZZA 3R4VA 5LLTA 2W2QA 5G3YA 3GUVA 4FYWA 1KEVA 1XMSA 5KAPA 1YZHA 1QYXA 4IV5A 3QVMA 5EMMA 3AF4A 2OP1A 4KQ6A 3R1IA 5ICSA 3ETGA 1SU8A 3I0MA 2KJ9A 3OD1A 2ZUWA 3C5WP 3E9QA 5TDHA 4KR6A 1K5GA 2RD2A 3DHWC 5AJVB 2PVCA 5HGJA 4P58A 3C7KA 5KMGA 5TF4A 2LMRA 1OPXA 3AHCA 4OEHA 1T13A 1E64A 4M1SA 5EIFA 3UB3A 3SG0A 4KBFA 4L5BA 3RK0A 1OLUB 1P18A 3LPCA 2FSVC 4YQYA 5K8LA 5E6UB 1C3EA 1PZNA 2C42A 1CUEA 4OSPA 2A9PA 2XT0A 4BFCA 3T0IA 3U7EB 1AGRA 3IT3A 3D7MA 1ENPA 4PIPA 2O2XA 2W7OA 3LECA 1W93A 2AUTA 1SJ9A 4GOND 3QM1A 3P97A 4US0R 3MABA 2ALZA 3GIJA 5FA6A 3RRZA 2XVAA 3S2UA 3QX9A 1M3SA 3Q0EA 3FDZA 3OESA 1EM8A 5FI1B 4GAEA 1BX0A 4EG5A 4UB3A 2XX3A 1RYEA 3NDBB 4JITA 1HJPA 3KSDO 2FPIA 4A16A 3LUAA 1GKUB 5BWBA 2EIXA 4YJ3F 1RJWA 5I7UA 5H80A 4KMOB 1M72A 1NNUA 4Z0PA 8ICGA 3GIMA 2D54A 4PPYA 2ZGVA 5ALIA 1T29A 2YZKA 2V6MA 4CTKA 4ZO9A 1Q50A 2YRXA 2VLBA 1Q84A 4FHDA 4DG8A 3LUDA 1A2BA 4CLHA 4U39A 4Y6RA 1YS2X 1BMQA 2WY2D 1G8GA 3SZUA 4BFSA 4OLJA 3ZCUA 4UC0A 2WF6A 3U7RA 4YCJA 1ZO8A 1DOZA 5CLQA 1OHHA 4AMYA 2Y0SC 2GOLA 3EGVA 3X1WA 4MQLA 2M6SA 1U0BB 3DMGA 2WSSA 1EB9A 3FCEA 3KQSA 3BGSA 1OGIA 3EIXA 1FSPA 5K03A 3UMJA 3U80A 1AQUA 4YNBA 1XMQB 2WKRA 2IVFA 3Q7TA 2DWCA 2Y1JA 2BOVA 4RQ6A 2ZUCA 3GA5A 1EFVB 4RVHA 1MFZA 2HXYA 3T3FA 3EN0A 2JEJA 2W9CB 2OBMA 4GHWA 1OFUA 4POOA 1XEAA 3WO1A 1SBTA 4JYAB 1T1EA 3MXOA 3B13B 2P2LA 1N5DA 4A8JC 4CKYA 5CVCA 4C3OB 3DCIA 4JP3A 3MWKA 3T7TA 1L6RA 1Y3CE 3O7MA 3PXGA 2QAGC 1IMJA 4JCCA 1QCZA 2BGKA 1E2EA 3ZXXA 1ZVQA 2GKOA 4IUYA 3VO8A 2DY0A 3UVEA 3VU9B 4CG0A 3TTWA 3FY4A 1KSJA 3TRHA 2G5CA 3JVEA 5JQWA 5CR0A 3FHCB 3AL3A 1XVVA 3NTOA 3DB2A 3M6XA 4KGZA 1XTPA 2JLBA 5KCZA 4ETWA 1BVHA 4ALKA 4PHTA 1F6BA 2OV1A 3DBOB 1ZL2A 5KREA 1XG5A 3VAAA 3TJRA 4WK4B 3BE6A 4BNVA 5AJZA 3N7SC 1RSZA 1J8DA 1S1CA 5EKXA 3AFIA 1J23A 2HIAA 4WXMA 4F1JA 2BEWB 1O5IA 2V7WA 2GRUA 3OCXA 4AQDA 4LSZA 3JQ6A 1W85B 4AJJA 4XI9A 3M9WA 2OR3A 4PZUA 3R0ZA 2X22A 1GVNB 5JPIA 1OBCA 3I9V6 3ZV6A 2REQA 3O8OB 3L9WA 4JC8A 1OKKD 2ZCJA 1E92A 2QN2A 4ED8A 4L4YA 1K92A 4UFOA 4BLTA 4PCLA 1PL7A 1ZQVA 4J4BA 3AU6A 4CUKA 3EH2A 2XA2A 3COJA 2PX0A 1ISJA 4YAIA 1KEPA 3IHWA 4DLSA 4JBNA 3CQ9A 2OGZA 2NU9B 5REQA 5JOQA 3HYNA 3HBLA 2YNMA 4LG1A 4M60A 1LJLA 4UD2A 3VHRA 1GUZA 3KQUA 2R1TA 4TV9F 2HF7A 4RM2A 3KHRA 4BNTA 4II3A 1K8XB 3I83A 2ZCUA 3EVBA 1N57A 1E7MA 2GJAA 4W9NA 2I1WA 3JQGB 4HPJB 2ZYIA 1RI2A 3PC2A 1MW9X 3RB6A 3PGMA 1Z4LA 3VNUA 3L4SO 4E5NA 5TXGA 4CLRB 2FV8A 3A9VA 3R6DA 5K6TA 3HCBA 3DTYA 3K1ZA 2PK3A 4I4LA 4DA4A 5CJ2A 4FJ0A 2YTUA 4Q6WA 3MTDA 3RSSA 1W9MA 3GJXC 3W3AH 4RY8A 3QH4A 1ZQPA 1YBFA 3CGGA 5BR1A 5FPPA 3R7WB 1YD7A 5IJ9A 1SKUA 3KEGA 5A6SB 5TLSA 1BOOA 4YT8A 2UKDA 2XTAA 2YHIA 1CY1A 4DSUA 2ETXA 2AFHA 4U2EA 1U7ZA 3IT0A 4P5EA 1NJGA 4HUQB 4EPYA 2GM5A 3MQ4A 1MO5A 1OBVA 1Q3KA 3T5GA 2A9OA 3KZIU 4D79A 3W4JA 2ZBGA 3EPIA 4XVRA 3O3OB 3V8NA 4BB0A 3RJTA 3ED1A 5BV1A 1U8UA 1M2NA 5FHRA 1M2VA 3THSA 1LC3A 4I3HA 4MEXA 2NV3A 4KQ2A 4K2HA 3UA3A 2VIIA 5CA0B 1ZNXA 3G0DA 5EWGA 4NZPA 5ICCA 1PAUA 2HBRA 3G8AA 1WS6A 4Q3OA 1XNSA 5BUQA 1JHXA 1V1JA 5J2TA 8ICVA 2FWBA 3W79A 2C2OA 4WLUA 2HT1A 3QEAZ 5JPCA 2OM6A 5G4KA 4CMIA 3O2NA 1V3TA 2V7TA 1TQ4A 3NETA 4FOSA 4R0NA 4QO8A 4D9HA 1X7ZA 2GHRA 4KWIA 3LW7A 3S5UA 4LS3A 2OZLA 4YWJA 2UVUA 4R81A 2OHGA 4QQRA 4CMHA 3UMMA 1LJUA 2XMPA 2NRVA 4IJ6A 4K0KB 3FG9A 3EXAA 1BKYA 4M76B 2PR2A 2QA5A 1Y6GA 4DQSA 3D0RA 3PVCA 4ALMA 5I4BA 3CLKA 1SHLA 4OMDA 3U9LA 1PR3A 1DQYA 4MVJD 3MBKA 5CURA 4PNEA 3H0RB 3JPTA 2Y1LA 3ADDA 2RAPA 1KI4A 3FYCA 2GQ0A 3JZFA 2CGEA 2MSLA 3DZFA 5K4GA 5FBHA 2QRUA 3EMKA 5EE9A 3Q72A 3NWEA 2FMIA 4OJTA 2A9VA 2LXNA 3H6KA 2BH2A 1T5DX 2R1ZA 2IUEA 4UREA 1GILA 2WSMA 3F5FA 5IINA 5EESA 1K3TA 1TUEA 2PGLA 4WAUA 5ALXA 1X40A 1KZ6A 3FIJA 4X7RA 2FWNA 3CRQA 5J4LA 4BVLA 2XCPA 4BJ3A 4LBWA 1Y6QA 1YCDA 2BUBA 2YHSA 1SO8A 3R23A 3N8DA 2OBXA 4S2UA 1ODTC 4DLEA 2RAFA 4E3ZA 3K2BA 1P0PA 1DINA 3OIDA 4ZDKA 2ATEA 1C1HA 1GZ4A 7ADHA 4WOBA 3H9BA 1E9SA 3SAGA 4TX1A 4WBSA 3PHLA 4QODA 4FYMA 3I2GA 4YRIA 2GEUA 3UJCA 2QX7A 5GTDA 4LOAA 5DLPA 4EYIB 4CM7A 2IE8A 5ES3A 5KDOA 3K20A 5SYNA 4RQ1A 4HQNA 4LJYA 4MSUA 4GRIA 3U4QB 2D0OB 3V8VA 3AFHA 4OSEA 2R84A 2XH8A 3U19A 3W78A 5GV7A 4BN0A 2V7XA 3EY4A 3DUFB 1EYZA 4D6YA 1K1QA 2V4ZA 2HA2A 5DU2A 3NC1C 1E1KA 5FPHA 2Q41A 1PU2A 5ELLA 3KKPA 4QYMA 4IXNA 5B6PA 3HDGA 3LPDA 1YS4A 3ZGLA 4TV8B 4L3VA 5A5FA 4ICAA 2WP8J 1GZ5A 5CHGA 3QSYA 4JP2A 2ODQA 3RVRA 2NG1A 5JNRA 2GUGA 1DSSG 2KZ3A 1Z35A 1SUPA 2B1JA 4KQHA 3I72A 3FPFA 2M1XA 2G83A 3RKUA 4UU1A 1E9RA 4PCAA 4BTLA 3PC6A 1I2MA 3TSYA 4YI5A 3QELB 1N2JA 1COKA 4PXAA 3F9CA 1TF2A 4HGPA 2BBOA 4BRWA 3NG1A 5K7SA 4X71A 2F76X 1KQ3A 4MCHA 2CNWA 1NWHA 1KJ9A 3JZIA 1Q57A 2D5LA 2IZ6A 3ZJ5A 1C4WA 1V1RA 5D3MB 5BSRA 3IV9A 2G1PA 1KEKA 1LDNA 4HZGA 2IW1A 3KQPA 2HHAA 1O4VA 1SG9A 3EA0A 1FS6A 3PUHA 4P8RA 2C9YA 3ABRB 2PFPA 3MAJA 2QVYX 3Q2OA 1G6KA 3H13A 1E1DA 4CKWA 1PI3A 5AW0A 2H5JA 2DTDA 1PJ8A 2WJJA 3HJCA 1FP4A 2ZROA 1NPYA 2I2XB 1EGMB 4MHTA 4P3XA 3R5KA 4XRRA 4OHYA 1F8YA 3SHWA 1PVPA 1TK0A 2AMVA 4Z7OB 3NFRA 1GRRA 3P2JA 2BMEA 4O4JF 2WBLC 4BNWA 4BP3A 4QYIB 4B87A 3A1DA 4P4OA 3JVDA 1R7RA 1NXPA 1AMNA 4EVSA 2WJ6A 2J9FB 4B46A 4H08A 4RPXA 4PHAA 3LBFA 4HV4A 4XVUA 1ZQ1C 1M54A 1ZICA 4HG2A 4E7OA 3ASVA 3N6XA 2ZR9A 4A2PA 2G0NA 2C4MA 4PIMA 3LQFA 4YR9A 2J5KA 1U8XX 4IOLA 1G6OA 3DG9A 3H18A 1PZGA 1CQJA 2XWJI 2EKPA 1LKYB 1JMSA 1XWWA 3DLCA 1YK0A 2WRZA 3QXSA 3D8UA 3UKOA 3STYA 2LI6A 3MD9A 4UM8B 4HB4A 2XDYA 3DMTA 4NCAA 1KFCB 3LX8A 3GRFA 3K6RA 2PFNA 3QMPA 4NMWA 5DIFA 3JWIA 5HF9A 1MQ3A 5DTQA 4ND4A 1H5NA 4YRPA 3DZ8A 1WF3A 3ZPXA 4BB5A 4BUZA 4EJ2A 1G3UA 1DK2A 1MIOA 4KPUA 1ULUA 4NCJA 1JQKA 2C5LA 2IK8A 4B9TA 3V6HA 2EQBA 1NK8A 3PUZA 3FHOA 4IDPA 1DC5A 3I1FA 1HDYA 1UOEA 1UKAA 2PUCA 3MPOA 5B66U 5AW3A 9GPBA 4X20A 4MLZA 3CF4G 3ISTA 4BNYA 1RXSA 3OSZA 5JH7A 4JWTA 2PSFA 3OUTA 3GZ4A 1G1MA 3FW1A 2W9MA 2G6BA 1R5JA 1LQTA 4KIJA 2NVUB 3QF7A 1VC2A 1V11B 1VLJA 4M0DA 3QU2A 2WJWA 3JQ9A 4AP6A 4GKBA 1FFGA 2DPLA 1D6NA 1UM9B 3IQWA 4N4AA 5JAZA 4RQ0A 1TAGA 1ZUNA 3AW8A 4N5MA 4BE4A 5E7QA 4TVBA 3CKKA 1Q3TA 1K8ZB 1JLKA 3UUEA 3EVNA 5DLGA 2GBLC 5A5EA 1CI4A 1EVEA 3EX7C 2G0TA 4Q01A 1OBHA 3E22A 4L4UA 2PRKA 4GLFA 3KB2A 4Z7JA 3GVCA 3ND9A 3E03A 4WDRA 4CLXA 4C7OB 3WYGA 3QU7A 4MI3A 4GI1A 1T9HA 1NVTA 1Z7WA 3VBEA 5FB3A 2IY8A 4O1MA 3A9UA 2ZTUA 1QVZA 2VSXA 4WVFA 5M2QA 2GN9A 2QMUA 1U3VA 3MC1A 3NI2A 3OBBA 4CF3A 4XTCS 3PR5B 5I47A 5EXDA 5DWQA 4NZNA 3VGPA 2N46A 4V3BA 2HY7A 2D74A 1VPTA 2UUCB 4CQMA 3ZCRA 2PWBA 4HKTA 4R7GA 2NAFA 1E1RA 3OSNA 4HNQA 2OPHA 1W5TA 1WNFA 2VN8A 1PFGA 5FUVA 2YTZA 2LZ0A 2HA0A 1Y7IA 3X43A 3VR5D 3ZDRA 3C0KA 2H7VA 3G79A 4KLNA 4DCOA 2WAQC 3UK1A 3TTYA 1R00A 2X4GA 1QC5A 5E9AA 5CW1A 1Y5NA 3ZCXA 4M37A 2DECA 4CEJA 1RM6C 1YRHA 5BV2P 1JR4A 1TOAA 3GF4A 4MUHA 5TVKA 2Y67A 2ZKIA 1F2UB 1ZVVA 4KLFA 1CUWA 4FQ8A 4JNKA 3HDTA 1YZLA 4TLDA 2OD9A 5J2FA 3KG2A 3O4JA 2ZI5A 4ZIRA 4HAYA 1YDEA 4OX9Y 3V72A 4RSMA 3SSNA 3H9CA 3HKEA 4JKIA 4JSYA 1J8YF 3IB3A 1ADYA 4PYQA 1OIVA 3TQHA 1ZGCA 3RFAA 4DT1B 5A9TA 1AGXA 1WQ4A 2H1CA 1NKVA 3ADCA 2V9CA 1DNPA 3DV0B 1X6IA 1V95A 1XJ0A 2H1OA 4QU9A 3C5FA 3QXCA 1BPBA 3L7CA 5C37A 2UVVA 1JAYA 1U0JA 4FCTA 5GPBA 4LK2A 1MC8A 1PIWA 4EGCB 4FD2A 3CG4A 5C8YB 3GLIA 1NBHA 1G20B 2UUOA 1U2GC 4WESA 2M98A 4JOCA 3L7LA 1LWNA 5IU6A 1YS7A 4NEGA 1E2HA 1HSZA 1OOEA 3DLHA 4L22A 1RCUA 1ZUWA 1A9RA 4LBZA 1QCDA 2WWHA 4UAYA 3TDNA 4BIIA 3REGA 1XNGA 2GJ8A 3HCRA 4RULA 3RS2A 3OG9A 4BUJA 3JVUA 1ODIA 4KFRA 2OCYC 3DM5A 2CJFA 3DD1A 3BCHA 2Z2IA 3L3BA 1PQ4A 1X9MA 5DGIA 1KSHA 3I9MA 5IW8A 5HQTA 5FFNA 3A2KA 4FP9A 3CF0A 1NK7A 2YIDA 1MAWA 3LPNA 2GPSA 2WYOA 4NEQA 1CUCA 2B4TO 5B5EU 1U2DC 5F23A 1F4PA 1GLNA 2BKLA 4L7QA 3U17A 1C2YA 4KN5A 2CXXA 3D5QA 1WHTB 1WY7A 3BHIA 2D2IA 2WPNA 1JJVA 4CL8A 3OPXA 1I10A 2NRWA 3MT0A 4MPJA 3OUZA 3ZHQA 2HIHA 4ZOLA 1AK9A 4MGKR 2HMTA 1P0CA 1DAOA 1CY7A 4YCCA 5JFOA 2ES6A 2N42A 1XRNA 3JCZA 4U9UA 3SZGA 3VDXA 3CFYA 3T1YB 1US8B 2M6LA 3SGLA 4FFVA 3ZXSA 5HEKA 4G23A 1C9MA 3EXHA 3VJMA 4FX2A 1IG6A 1ZG3A 3RSLA 2GFIA 3W6ZA 5EWFA 4E15A 5D6OA 4PLGA 1GN9A 3RWOA 4MW9A 4ZC1A 5EP1A 4UMDA 1MDBA 4K87A 3V00A 5KVAA 1PJRA 3MUNA 3KYCB 3HXOA 4DIMA 3ZDCA 2QL6A 4PONA 4R01A 2QTRA 4Z4CA 4RJLA 3KT8A 3WMWA 4BATA 1L3IA 4QUEA 3DEHA 1XPOA 2G1JA 3HVHA 1Y1RA 2PM8A 4RGYA 4G5SA 5BW5A 4CHTA 1CLEA 3R9WA 4EHNA 5JDIA 5EGSA 2DP4E 3RI3A 3L6UA 1I51A 1U98A 3LW8A 5HFAA 1O9HA 1ECGA 4C2UA 4Q7KA 1C4OA 1QNFA 4IGAA 4BZXA 3LYLA 4HLQB 5IUJC 2W2TA 1NJWA 3AM1A 2F8SA 3WE7A 1NMXA 3ET4A 1DU4A 1PJAA 1JXOA 4DM4A 4AZWA 1TMOA 2NMVA 4B7UA 3WA7A 9LDTA 1IDN1 4NQRA 5DW3A 1T0BA 3T1VA 2YYYA 4XPZA 4AY2A 5P8WA 3I4FA 4UBMA 4BJ6A 2IXGA 3BQ0A 1SZDA 5IKOA 1C80A 3AEYA 3LIIA 4IF6A 3F4BA 1M2GA 2AUMA 3WTBA 1SL1A 3BHMA 4X45A 1WSBA 2LUOA 2VANA 5EQFA 4DTCA 3BMNB 3IOBA 1V5IA 2HZBA 4C7JA 4P3YA 1DQRA 2HMWA 5AKEA 1H2HA 2L42A 2EZYA 1KDHA 4LGCA 1CUGA 3OHMA 5DHPA 3K3PA 1LW7A 4UW9A 3OEEA 4KTVE 1XMJA 1Y33E 1KQOA 2Z43A 3CZQA 1GOTA 3I8SA 1SQFA 2OFXA 5DXFA 2YV3A 2UYHA 3EQZA 3V9AA 1R9MA 3EXIB 3ODPA 3NTUA 3P1JA 3RC1A 4YCSA 1N4DA 3A6KA 2FDRA 4ZMRA 4EMSA 1ZVJA 3JX9A 4R9NA 1M2HA 4MCJA 5I01A 2PJDA 2PWYA 1FP7A 2HU2A 1O8BA 3QUSA 1YH3A 1QZXA 4LJ7A 3R3HA 4J7CA 3MWFA 4C0QC 4YP1A 3RG8A 3BCRA 3QI2A 3RVPA 4A23A 5ESRA 4DSZA 2D4AA 4G01B 3TLKA 5BYJA 1DBPA 2C03A 3NBQA 3F6BX 2YL2A 3I9KA 1EXDA 1KEZA 3VYVA 1YCGA 2HADA 3DDHA 3C3DA 3EWNA 3OURA 2R4UA 4DL2A 4RORA 5CGZA 2WPDD 3X3HA 4BBZA 1WUIS 2W04A 2WZBA 3CRW1 4I55A 4WZ6A 5HZKA 1VIMA 1W96A 5BSFA 3GFSA 4DWVA 1HWYA 3UAYA 3EZGA 4G5YA 5HRUA 1PWHA 3RREA 4EGAA 3I0ZA 1Z36A 4TWAA 1K97A 2NZUG 4US9A 4Y30A 2C2XA 2GVDC 5I51A 2ZI4A 4E3WA 4URWR 2ORIA 5F4BA 1OR8A 4JUFA 4B5LA 2NAPA 3AHIA 2KEYA 4Z4GA 4O4HA 3T5AA 3OJSA 4EW1A 3HVKA 3SJ7A 4Q34A 4W8GA 3PXUA 5K3BA 1VIAA 1XGKA 3FGNA 2PYDA 3BTVA 3R75A 5AVUA 1KQFA 2X23A 3HMKA 2EV9A 2ZZMA 2R6HA 5J2BA 4B0PA 3GEDA 4V2UA 3K0EA 1P6QA 1M8PA 1RWKA 2VQSA 1HI9A 3NHFA 3RYHB 4QQ8A 3IALA 1CC1S 2NNWB 3U7JA 1HLGA 1OYYA 3IEPA 1KZHA 1EG7A 3JSXA 2HO4A 4BCBA 4TSFD 4RD6A 4KQ1A 3UXNA 3ZZUA 4CIDA 1BX3A 4MW4A 3FX2A 5I9SA 3OZFA 3H3XA 3PA6A 1UP7A 3IVAA 4PX9A 1L7NA 2EERA 3BJIC 2NO9A 2BGNA 3IIKA 2FOLA 3RU9A 2VJ5A 5EUCA 2XY7A 1CG6A 2CHVA 2QP9X 3FYHA 4QJFB 4PH5A 2LKYA 5HILA 4CKEA 3T1OA 4FXPA 4MK4A 4PHGA 3MJHA 4TTPA 4ADSG 4B3GA 5CX4A 1Z8DA 4KVZA 4UEKA 2XR1A 3L7IA 1ZQXA 1QYCA 1AD2A 3GPCA 1PFVA 4EKIA 1AF4A 5K4AA 4K28A 2IWHA 3M82A 4LYJA 3KWLA 2FLNA 4HBGA 4N39A 3PUIA 4PWZA 3ZE7A 3O0TA 3KTDA 1RTTA 2XYPA 3JW8A 2ZI7A 1F51E 5KINB 3GLGB 2P4SA 1BQEA 4JOQA 2KSOA 4EUHA 2QTCA 5EZYB 3EGEA 1KQNA 1GGMA 2XNCA 1CUYA 7YASA 4RKQA 2ZVJA 1WF6A 3JALA 2X7JA 3DOOA 5EHIA 1VI2A 5H8WA 1F5SA 4JH0A 1C3JA 1OV6A 3GV5B 2ZTMA 4GZ6A 1LDMA 1ESDA 4ZAGA 2JAHA 1HV8A 3GEMA 1NULA 1R37A 3BZWA 2NX2A 3ADKA 2P3OA 2DQNB 4KU4A 1VTKA 2OORA 1FLAA 2OXIA 1E6WA 2NU6B 1G7CA 1KHTA 2WAOA 1RI4A 4CM9A 3L04A 3AF0A 4NOKA 4MS3B 1JHMA 1Y1QA 1ZH8A 5P21A 2RAVA 1WG8A 4HQ0A 3E35A 3QVWA 2GRJA 1NAHA 3ZE8A 3KJHA 3VKHA 4ECQA 2BM0A 5EPOA 5F2OA 4RL6A 2RE8A 3IJRA 4ZVNA 4JQCA 3GOHA 3S99A 2C7RA 1V4BA 1OA0A 1PWYE 2IEZA 4D97A 5LIPA 2R7NA 4X62B 1HEIA 4QOGA 4IWNA 3TNFA 3LLCA 2QK4A 5ENDA 1VLMA 1LLQA 4Y2UA 3SIXA 2X6RA 2CF6A 4AN0A 1UFOA 4N5NA 1GL3A 4KXUA 5D46A 1CJTC 5T8KA 5KTRA 3LA6A 4UNIA 2P41A 5JNLA 3HUTA 1A9SA 3K8YA 2PG3A 5DOVA 4GC6A 1NBMA 1Y0BA 2H29A 2OZEA 4E14A 4I2VA 2CLFB 4I1IA 1VHTA 3TD9A 4F86A 4Q3DA 5EFZA 5KHAA 2IEGA 4XWAA 2NVOA 4JJFA 1XCJA 2X0IA 3D2NA 4E03A 3MRSA 4DV3B 2O8DB 4RV4A 3GYBA 2POCA 3G8DA 1HDGO 2FW1A 4QLOA 4D98A 4TUYB 2KIWA 5AK6A 1L5NA 3P9CA 1U9YA 2IBSA 2W55A 4LYAA 5LQKA 4RNCA 1VE3A 1XLVA 5C53B 4R1TA 1S4QA 3JZMA 6GPBA 4C5CA 2XD4A 5ICFA 5CXXA 2DLDA 4Z9YA 2PO7A 1RAIA 4EI7A 1WDKA 3PE3A 5EMKA 1GUBA 3TN7A 1SPXA 4CEHA 5GIPE 1ISFA 2PUBA 3HZHA 3BWEA 1YVDA 5B1HA 4AZVA 2PFSA 2IHBA 1CUJA 1IHOA 1QFXA 3A9RA 2DLNA 5JECA 3L1VA 4YB8A 3LVBA 1T5HX 3ENKA 4I4CA 3VOTA 1ID1A 3RC7A 4WZAB 4Q7LA 1X1BA 2EFHB 1JBKA 2J5XA 3PWTA 4IINA 3SV4A 5CH8A 1Z4QA 5BOLA 3GUUA 5AFSA 1QPBA 3R5XA 1NIJA 1NXQA 1BOFA 2EJBA 2OFPA 1IXZA 3A1EA 4BMVA 2FWMX 4LRUA 5DGHA 4M6WB 2H63A 5KFFA 1RYUA 2ENWA 1WPQA 4ZGWA 1OYWA 2PUJA 2FUG1 1XRMA 3GV0A 4C3UA 5B3JA 5ABPA 1A76A 1CFZA 1U7WA 3I1IA 4I1VA 4WBNA 4IFTA 5FTKA 2ZRPA 4EGSA 3HUEA 3R76A 2NP6A 1IPEA 2Q6LA 2WWWA 3BFXA 5LQNA 4FNOA 1B3RA 5JQGA 1LC0A 1KO4A 2Q6TA 4H1UA 3S5JA 4ZPXA 3TG2A 3HKBB 2GT1A 3MWEB 3EC1A 2OSVA 3ZJ4A 2Z9CA 4DF8A 3MPUA 3DR5A 4UVDA 4YJHA 1NRJB 2IEBA 5K3SA 1IHYA 5D8DA 5FUMA 4DWIA 1X66A 3PFGA 3V8RA 1ISIA 4NBWA 1KTVA 3K94A 2F1RA 1ORIA 4O33A 4IIJF 2D8CA 4AUNA 4YMOA 1DFGA 1N6RA 5I8ZA 5COBA 1ZRMA 2JCXA 1G8SA 1T91A 4WIAA 3OOHA 4DV1B 2ESEA 1ONSA 4LXYA 3MUEA 2VP2A 2CZGA 4U5XA 2H1SA 1JG3A 3DMNA 1JHPA 3DQPA 1BSVA 2X58A 2GCEA 5DGDA 5EIEA 1DAGA 4N9QA 1NJSA 1U81A 1JDSA 1X1DA 2CXTA 3FD8A 3OJLA 2UVQA 1JKXA 1KKXA 4CIVA 4FZJA 1IBMB 5JJLA 2AIRA 3QKRB 2YFYA 1Y8CA 4CF5A 4DMLA 4MHSA 3ZCQA 2EFDB 4NCIA 5DSXA 5B58C 1M2FA 5FWYA 3LZCA 5LN1A 4J0HA 4NJOA 3T5MA 3DFFA 5U9CA 1E8DA 1Z15A 1CRXA 3QZ7A 3CO5A 4RM3A 2WSYB 2GCNA 2ZIGA 4WW0A 3A2NA 3CLVA 5EJ4A 3I73A 2KG5A 4OQZA 1RPTA 3THOA 1ZOIA 5F1YA 4O4IA 3ELBA 3VZQA 4NZMA 2V54A 2DH5A 4C01A 3FUXA 5CEHA 3EPJA 3ZDAA 4QOJA 2GPWA 5FWXB 4P36A 4HDSB 5EWMB 1CUAA 2EYQA 3B0XA 3DCYA 3U7QB 5DB4A 3DAFA 4EEKA 5A62A 4UVHA 3UMRA 1JR3E 4ACOA 3PUWA 3KJIA 5DM0A 3FPEA 3EMVA 3OLYA 4TL9A 4EJ0A 1ISMA 1OXXK 1FNBA 4WZAE 3VZDA 1MOPA 1L3UA 2PGOA 1FFXA 4BX8A 3VR6H 3HQ4O 3LF1A 5JZ9A 1Y9JA 2XUGA 3W3AD 3WKBA 4LRQA 5BYBA 3HR8A 4P7FA 1IB6A 5F5LA 1WQ3A 1YVPA 2LDXA 4CUZA 4PAQA 4Z0TA 1Z4IA 1TLLA 1U2EA 1ISRA 2PXCA 4R2MA 2LR0A 3Q3JB 4UUAA 3M3PA 1J22A 3OCCA 1VM6A 2JFZA 3PKIA 3ZW8A 3DE0X 3TBFA 2XDAA 4BLQA 4IJMA 5ALZA 3UOGA 1UM8A 3FLMA 1B6SA 3V7NA 5ALEA 2XTMA 3M33A 1N5WA 4RA6B 2VRCA 4ECYA 2WTEA 4FJ1A 3C14C 3FR7A 2ACEA 1XMPA 2D7CA 3MJCA 2ZUSA 3NPMA 1LX6A 1MRZA 2CFSA 3IDOA 4UU8A 4KP7A 3AKDA 3AF3A 1NFQA 1DBRA 2OGTA 1V6AA 5COAA 4IVQA 2VPWA 3KE8A 1QK5A 3X44A 2F3PA 3AGQA 5IT5A 2Q07A 4OVKA 3DTNA 4O5AA 3FNFA 1Y1KE 5EQDA 2FRDC 3CCFA 3PWKA 4EG8A 1ZD4A 4LRWA 3KEMA 1VXOA 4U9HS 4H7HA 4F3TA 2C58A 3IILA 3AFGA 4EB6A 3L41A 4TMZA 3EMBA 3GIIA 1N2BA 1G98A 4LAFA 1DTSA 5BV7A 2HTEA 4IUBS 2NU8B 1ZLXA 4S0ZA 1YZQA 5DRYA 3H5NA 1P17A 3LMKA 1LSJA 1ENZA 1Z63A 4CIBA 5CH3A 5KFMA 4W5QA 2YWFA 1KFTA 5U4XA 1N8SA 4OFBA 1ZD2P 4Q45A 2PX6A 3N7AA 2XICA 1C4KA 3VZPA 3QWHA 2BUCA 3G6XA 4DEXA 1OJ7A 1VKRA 4ZYWA 4QYTA 2ZR7A 4TXHA 2IRWA 1HYGA 3URMA 1SC4A 4LFBB 2HFKA 3DFUA 1ZM9A 2WSSD 2Y1EA 1VYVA 4KVAA 3C2MA 2C3OA 2FPUA 1VLHA 9ICSA 4XASA 3AVPA 2VP3A 3KHLA 4R41A 1THGA 2H4WA 1KWGA 5DHAA 1GNQA 4ILEA 4CDRA 3BGIA 2X7HA 4JASB 3H7IA 1SG0A 2GX6A 1W88B 4LC9A 2OHFA 2JJ1A 1LEHA 4QIHA 3HVRA 2GLEA 2PZ8A 2B9VA 2QU7A 3E9NA 4C0HA 1CJUC 4YCXA 3HFGA 5BMOA 4UEQA 4M9XA 4Y1RA 1SD2A 1GQYA 4D46A 3AV0B 3H17A 3P2IA 3TZKA 3OP4A 2ZBPA 2AXTU 5C34B 1RVV1 5DB8A 4C87A 3ZZMA 4ZMBA 2BTQA 3VSAA 1I4OA 4RMNA 4PZ0A 4KXXA 5CDSA 4KACA 3D1JA 2OHVA 4MQBA 1Z7YA 3QPDA 2QI9C 1CVRA 5C7OO 3ZLTA 1MN8A 2Z3ZA 3C8HA 3E4CA 3N3AC 3KKQA 2YJ4A 5KJ1A 5KYUB 2GHTA 3QG5A 3FKJA 4F2RA 1XUOA 2QAJA 7MDHA 3ONFA 2WZQA 3FNRA 3GN1A 1MV5A 5KAMA 3TL3A 4OHFA 1NSYA 1R50A 2ZE6A 4C29A 3FUTA 5ITZA 2ZYSA 4OYLA 4R1OA 5FX2A 2VNHA 3IODA 2I99A 4PYLA 2BAGA 3TECE 1PWEA 2QJRA 3L6BA 2E5FA 4XXHA 2YMQA 2QV7A 2DZDA 4ITUA 3BK1A 1F14A 5IIMA 3VR3D 5LLSA 2YUTA 4BMYA 2ZSJA 1W8DA 4EPXA 5GM2A 1Z19A 4HEQA 4PL1A 4PF1A 1PTJA 2G72A 3QEOA 5KWIA 4WOKA 2NTYC 2JGIA 2CXNA 1T25A 3K9NA 2R25B 4DLBA 3MBOA 5KWEA 3KSUA 2GM3A 2ZVDA 3TFRA 5TQ2B 3G5TA 1EG2A 1GL7A 4KN4A 3AG6A 1G41A 5AJTA 1CE8B 3IOMA 2YWEA 4V0MA 4WGFA 2JAQA 1WB6A 3SIRA 4QYSA 2G3YA 4TWIA 5EXEA 4EMUA 4B7XA 3CA8A 1G9XA 4X3PA 2G5HB 3EIWA 2C7GA 3HKCA 2LM1A 3EG9B 1OY1A 2ZSIA 1MX3A 1ODFA 2IV2X 2VJAA 4Z3DA 4HO1X 1RHQA 3CVWA 4U7FA 3BRSA 2JH8A 3WGOA 3U1BA 1XNJA 4WKCA 4EB8A 2Q6VA 3FNEA 4GYKA 2OL4A 2VJBA 3BD7A 2Q9CA 1OAKA 2D5IA 2PTHA 5CH5A 2V98A 3DGEC 3HVUA 1P39A 1XPJA 1FSSA 3LSTA 4NY1A 2CXSA 1A8SA 1G5PA 3WK4A 1R64A 4BNIA 3HK2A 3OZTA 4O2RA 4LZOA 2IXTA 4CM4B 5EEGA 4JLVA 2QXTA 4RZQA 2G5PA 3JYPA 2X6QA 2B7CA 3P52A 4AJPA 3QHPA 3PU6A 3ZQKA 2RGUA 1RWBA 3L3FX 2EX4A 2D59A 3LGXA 1YZUA 1XJCA 4IBOA 3IA7A 4Q15A 2JEYA 4HP8A 6PFKA 5KG6A 5FI5A 1CRLA 5EKSA 1EWRA 3QVXA 3ZV4A 1RACA 4BNKA 5J2KA 3T94A 3HNOA 3FMGA 1VPDA 3TLGA 1Z5NA 2VT7A 3ENZA 1JN0A 4II7A 4X7BA 1U7XA 3S1SA 3KXIA 4KJXA 1QU3A 3K70B 1NVDA 2FVYA 4D99A 2IQIA 3GJ8A 4BN5A 4RKYA 1CDEA 3EEFA 2P4UA 5DYGA 3SYNA 1D4FA 2DHDA 3LXMA 2APJA 1BA3A 2I55A 4JBWA 3VV3A 4DABA 2ZIWA 1RAFA 2C99A 2WABA 3Q5DA 4Q48A 2J9GA 2QN6A 4B35A 5JNVA 2PVPA 2Q6OA 3LUHA 3LBNA 2LCFA 3BZKA 1ZK3A 4G8CA 2GJSA 2W71A 1DDIA 3SFZA 1QTNA 4KQGA 4XUCA 4REOA 5B36A 5KEIA 5LP6A 3QOFA 4NLGA 4XPIB 2BH9A 1ZKDA 2DCUA 3RV3A 1RAEA 1Z5WA 4RZ3A 2C8VA 2V0NA 4MI6A 5EYPB 1OIXA 4YUWA 3C3WA 1TA4A 5AI5A 2C9BA 4REMA 2LBOA 4QZ9A 1CY0A 5BQOA 2J0QA 3BDIA 4FB4A 4ECTA 3JD3A 3R4CA 4AMVA 1TKAA 3SSOA 1E2GA 3IBTA 2V59A 2JD0A 3U61B 1K88A 2RCYA 1P2UA 3BFVA 1T6XA 2MSKA 3QJ5A 4FJ2A 1F20A 3DTVB 4F45A 3NBAA 2OEHA 1WCIA 3IT2A 1MHTA 3AR9A 4RVFA 3ZDYB 3Q98A 3IUPA 2C5FA 3AESA 2XSZA 1J8QA 5IC5A 1YE3A 5TMEA 1KR5A 2PWAA 1BS2A 3FWNA 1J5EB 4E1VA 1NRXA 4H18A 5DQGA 1YL7A 4FE7A 3OFND 1RQGA 1HL3A 2O3RA 3M6FA 3KLMX 4BVJA 1IAQA 1O96B 4UQGA 3TL6A 4ZVQA 2HH9A 5FLXA 4OQYA 1G66A 1TUGA 3MTIA 3CEHA 1XZGA 7ICKA 1DRJA 1GGFA 5DZSA 1XJ5A 3HU5A 4NU8X 5C51B 3O2QB 2P6MA 3LXRA 3GBSA 1GG2A 4G0XA 3GGSA 1DRGA 3TE7A 2C54A 2XMRA 1CQWA 2RJNA 3U7FB 4CU5A 5K3OA 1W0JA 1YONA 3VUFA 5L6MB 1T6ZA 4KQ9A 2XUQA 1W2HA 4FMPA 4QVKA 5SZIA 4CLOA 3ZE0B 3KJEA 5AI6A 1FVXA 4A8EA 1VCMA 2A5FA 2L69A 1E1CB 1Z33A 1N8NA 2YBEA 4JELA 1GT91 3OF5A 2W6ZA 1QLNA 3R24A 5JUMA 1GKYA 1N8KA 1H2EA 3K0BA 1ZH6A 3BD6A 4GX2A 3MSXA 4R98A 5H9WA 1HH4A 3O4RA 4ASUD 4PO3X 4EPRA 3VGJA 4ZQCB 3H9EO 2Q2NA 3PTZA 3IJ5A 3F5QA 2HA3A 4HWGA 2X8JB 1YAHA 1UBMS 2NUTA 4Z0NA 1DIRA 1V35A 3SYZA 1TJPB 2PS0A 4OH1A 4PC2A 4Y8VA 4IKEA 3WKCA 2ZPAA 1EE1A 2PGAA 1OE0A 2ODEA 1T8YA 5IILA 2TECE 3SR3A 1PNRA 4GQBA 2WWFA 2UYOA 4NMLA 1YASA 5CT6A 1WP4A 1KIMA 2GPNA 5JJKA 1CYEA 3BFPA 1NYLA 1A4XA 4BWMA 2EGGA 5HJ5A 4KG7A 1MLDA 3I1YA 1Y6FA 3OJEA 1XVTA 1FPMA 4BQSA 4CQLB 1H1DA 2DKOA 2QTHA 3SXJA 2CDCA 1JMYA 5IX8A 1VSUA 4BO9A 4Y2RA 4Y0AA 2X8LA 4AFNA 4R9SA 3ROXA 2Q5HA 2P9ZA 2DWUA 4NZZA 3VRHA 3VVLA 4DFMA 1MAHA 1XYYA 4Q24A 4TQGA 2XA1A 2YY7A 1UQUA 2I54A 1GV0A 3ESDA 1WDTA 1Y5IA 2ZB7A 3EZ6A 4KQKA 5BOSB 2NO5A 1YZFA 1DKRA 3GRVA 3B2EA 4U6SA 3PSFA 3KBOA 1KAGA 2YIVX 1ZN2A 5C4IA 5J5CA 3G2OA 1AN0A 1PR6A 3CVJA 3IO3A 4FS2A 1J1UA 3K70C 1NN1A 3LLVA 3IUEA 1WBJB 1S8AA 1JZQA 4F2DA 4WY2A 2MMGA 1NMSA 5JVDA 4AG6A 4MMXB 2IUSA 2GZDA 2A7QA 3Q1LA 1YQUA 3BJRA 2OENG 4MR7B 4RTQA 3SYRA 1R15A 1KOJA 4LJ6A 4FFPA 1G8YA 9ICJA 3Q9LA 3A6LA 4EYEA 4OATA 1KVTA 4N12A 1OH7A 4MIOA 1CULC 4AS2A 5A7GA 3ZXUB 3OHAA 2I4LA 4JC0A 1UOQA 3ZU6A 1KYXA 1RHRA 3W9YA 4IMIB 4N7MA 3OA2A 4M8KA 3NDRA 5LA6A 4ZAVA 1LDYA 4RTKA 3DOHA 3C2LA 3H2JA 3BSYA 2FU5C 4JYZA 4P7BA 2AOTB 1SCNE 3HB1A 4MS4B 3DMPA 4G5RA 2UZ1B 3QKWA 3ZOKA 2KJ8A 2NU7B 3F2IA 1ZH0A 2PXXA 4DARA 3O1JC 1WA5A 4YQZA 2V4UA 5L3SA 1COZA 1CR1A 2P5TB 4UDXX 2R48A 4EW2A 1GGJA 4WZBA 5K05A 5DSTA 1IZ7A 1GCIA 4JUCA 4EUEA 5K51A 1K8RA 5K8JB 3CJRA 4PPXA 5KT4A 2QP4A 3AOGA 1JE0A 2FWIA 3BAZA 4BNNA 1CS0A 1RIIA 4EI9A 5JS7A 4AYBF 3W5IA 3G2IA 1V8ZA 3ANSA 5IVHA 1KMHA 1EUDB 3LU1A 1Q1NA 3JZDA 4QWBA 5C8XA 2XUHA 4XLZA 2Q0HA 5ITWA 1VDVA 3EYZA 4RPHA 2BFFB 4J29A 3UWKA 1N9KA 5DE3A 5T41A 4ZVLA 3H8MA 3UC5A 3S3TA 3O3CA 3T5TA 2O2DA 2XNSA 1SD1A 3A9TA 5C31A 4DLGA 3RJ5A 5IYZF 3EC2A 3UJDA 4P3PA 3BMXA 4I50B 1SURA 4L9SA 2GCIA 4Q7EA 4YFVA 2IS6A 2QAGA 2I3DA 3G1TA 4BB9A 2J8ZA 3NYWA 2KJ5A 3AR2A 4DLKA 3BL6A 3LCRA 3GDWA 3DF9A 1SHUX 4EWLA 1WB4A 1EAMA 1UBTS 4L6CA 3CMMA 3SEIA 1K27A 1EBBA 4HY3A 3TIXB 2H1LA 4GQIA 4BIMA 3G85A 5IM4F 3Q6NA 1NMYA 1WPXA 3GLHB 5ALDA 3IPYA 3X2FA 2A92A 3SC4A 3K7EA 1IFXA 5AKLA 1ZQJA 4MAAA 2DKFA 1E0DA 1R3UA 5B6IA 3QE2A 4CQMD 3RLIA 2JRZA 1SCIA 4LC1A 3UUWA 4MZXA 1E1RD 1JROA 1LX7A 2NSDA 4GPEA 3SM9A 1IXRC 1X7XA 4X66B 1CD5A 4MV3A 4RMGA 5KU1A 1BA2A 8ICIA 1I80A 1RPAA 4MR8A 2XBMA 2J3QA 4MEBA 2JLQA 5ITVA 2Y6UA 1JXQA 2C92A 3GA7A 1KERA 5JU6A 2PX4A 2D8AA 1LFDB 3AMVA 2ODGA 5I7AA 3QEBZ 4BEBA 3ZWMA 1I6LA 2NT4A 1UOOA 4WXEA 1YMUA 2WNSA 3A1TA 4AZ0B 3LFUA 4Y6SA 3S2IA 2EW1A 5DBBA 1W46A 4YQFA 4PHCA 2C3UA 4D8XA 1UPFA 3LXUX 3RSQA 3L8ZA 4OHUA 4ZT5A 4LKRA 2MR6A 4MUFA 3M5CA 4G41A 3L7KA 3SC3A 5BR7A 5ARCA 3TRJA 3SP1A 3UIEA 2KIVA 1YI0A 4QZFA 4CGZA 2DF4B 4KRGA 4I5GA 5BWOA 2GJKA 1U9LA 2DKZA 3L4BA 4WX2B 3ZNQA 3FZQA 5TPWB 3HB7A 5FUQA 3S70A 3HU1A 2GXUA 3GGJA 1FQWA 1R66A 3GC6A 4RD4A 2IMWP 4U63A 3QRWA 4RQ5A 1Z0ZA 3ZDBA 2VP6A 5K4HA 5J5VA 1S2OA 1WUDA 2VBGA 1N77A 2ZPUA 4RQ3A 3AHJA 2BHNA 1TTQB 3RBDA 4RENA 2ZATA 5F2KA 5TQVA 4MZDA 1SV0A 3E1SA 1GPUA 2AX4A 4C7ZA 1QJ4A 4IO0A 2Q6IA 2EJVA 3UHFA 2WF9A 2WICA 1FTYA 4URUR 4TXJA 1YRQA 4H0NA 4UTPA 1JECA 1QFJA 1PLJA 1Y3AA 2M0NA 5KQGA 3KZ1E 1ZINA 3P0IA 2JK1A 5DJ5A 4E13A 2O8CA 1G8HA 3TTUA 2ICAA 3ML1A 3LC7O 3N3BC 3QOWA 2IS2A 2YN2A 5CITA 2E5SA 4GXQA 5K0BA 3ZJYA 3E9RA 4LRYA 1XROA 2Q1TA 3U4AA 1UF9A 2WHPA 4G0QA 4FT2A 4E31A 1MJHA 2UYQA 2ZWVA 2ERCA 3L79A 3KZNA 4Y6GB 1EE2A 1W2WB 4AF6A 3U9TA 4IQFA 2XQFA 3AERA 1QH8A 3AZQA 3PX7A 3GLHE 1FNSA 3TLAA 2KYRA 3I6BA 3IAS1 1C3OB 1HG0A 1P9NA 3D6AA 4CMEC 2ZIXB 2B6GA 3PDJA 1L4NA 1R6BX 4RQBA 5E3HA 4NARA 4L5CA 1KNQA 1TCBA 2ZTHA 5E6RA 2W48A 4G56A 4IS2A 4YBRA 3L4JA 5CXUA 2DJIA 2Z6VA 3AVOA 2RIPA 5ETJA 5J2DA 1MEOA 4IOKA 1OVGA 2V9WA 3A32A 3CPEA 2BJWA 4ZU6X 3I92A 3QZ8A 4OP1A 5YASA 2O5RA 4AIIA 4Q1AA 2NVBA 2ZE7A 5KFZA 1MG5A 4AO6A 3ILHA 3TNDA 4ODIA 2WWVD 2CFRA 1P5ZB 2C7QA 2I6QA 2B92A 5JC1A 1OH6A 5CVJA 3K1AB 5FNZA 2FKNA 2YWXA 4JFRA 2QLNA 2A9KA 4RQTA 4M7OA 1BNOA 2C2EA 3IGFA 3W6OA 9ICXA 4HAZA 4ME6A 4WTOA 5D3ZA 3H2BA 3D3KA 3SFTA 4D9IA 2D1TA 5K3FA 4JJKA 4B3BA 3SHQA 3A4TA 3GDGA 5E7IA 4E5VA 5DGXA 2ZT6A 4E2FA 3M70A 4CI9A 2EVWX 2M6RA 1WDMA 4YRMA 4EF5A 5TPZA 4BVHA 3VI4B 4PGGA 3DBLA 2CXQA 1X2EA 4EG0A 5EVJA 1JU9A 5EJ7A 5KWVA 3KWJA 4JLUA 4BGEA 2FVXA 2XZPA 5EPUA 1I24A 3F71A 1PK9A 5CJPA 3DXFA 4I6GA 3OOSA 3HRHA 2R1VB 5JCJA 3PR1A 1SZJG 3S27A 1A5BB 4BBJA 3H11A 3VU3A 9ICFA 1XZFA 2VCYA 2A30A 4O5EA 1WZEA 1KH1A 4L6AA 3PYXA 5JAUA 5EG5A 4CV3A 4XIYA 4DTIA 4BX3A 4QZ8A 1VRCA 2RJ3A 1XTTA 1J0BA 2VK8A 3AUYA 3GUZA 2B36A 2NZYA 1X7GA 1FNMA 3OEED 2GZ3A 4JJ6A 4MDYA 2VPQA 2CLKB 2AXQA 3IR6A 2F44A 3EA4A 1U8TA 4GKVA 5FQNA 2AFRA 4R5HA 2GDJA 3F6YA 5IDWA 4C7YA 4FI3F 4C6TB 3JD4A 2C7OA 4DG9A 1HSOA 1CJKC 3QFFA 3C3KA 3HYSA 4XJVA 2AYXA 4UXJA 3TTXA 4ND2A 3IQXA 2ZANA 1Y8ZA 4ZANA 5EI5A 3T8YA 1HPLA 3DDNA 3PXAA 4ZHQF 1ZC3A 3O8LA 3TEFA 3FPLA 1TVCA 3IDWA 3ONNA 3CR3C 4JA2A 1MV8A 3JQ8B 1M1YA 2FFAA 4KX3A 3M8RA 3DWGA 3UHPA 3D4OA 4OQQA 2P2CA 5ALSA 2YDYA 4N8SA 4FBMA 4YRQA 4Q3AA 3C3MA 1E7WA 1TXGA 1N48A 1Q5PA 3HFJA 1AKVA 2Z2YA 5LYJA 3KL2A 1NJFA 3J81A 3FSJX 1E94E 1E2BA 3RRFA 1K8QA 4X00A 2XZTA 2HK7A 4F8RA 4DJFC 1A7AA 3MGKA 3RJKA 4YR7A 2ZJYA 2JZBB 5B1EA 1UIRA 5BVHA 1JKFA 1KMMA 4N5DA 2IUTA 8ABPA 4O2BF 2CW5A 2LIVA 3MJEA 4R64A 4HFNA 1M8JA 1JZSA 4OY3A 4HH3C 1V38A 4S1NA 1C9JA 5LVAA 3QFRA 4YBZA 4DLYA 4EI2A 4B4WA 3NXSA 4BRSA 4DCNA 4CR8A 4OK6A 3TB4A 5EJIA 2F4NA 4OF4A 2RGBA 3S4YA 1FDWA 3MMNA 2G04A 2W3SA 3FYTA 3SC2A 1YUMA 1PHRA 1LPMA 3RS8A 2WYWA 2GKSA 2O4CA 4GX1A 2OY0A 4MRRA 2VTBA 2GESA 2H5EA 4P0PA 4H1WA 4FS3A 2W93A 3K8QA 1NONA 2J0UB 3K5WA 2IKQA 4L0MA 3F96A 4EAQA 4QFMA 4I4TA 3CX8A 5DP1A 4BRZA 4RXTA 2DM6A 4BPBA 4BMOB 4X92A 5A02A 1XDBA 3W34A 2Z9DA 2YVLA 4WUVA 2O54A 2IYRA 5DRTA 4XM1A 3HG7A 1T3QA 2ZEJA 4UAJA 1Q15A 3H04A 1G8FA 3UEOA 2R6CA 4WBXC 1RWPA 3ZHCA 1LF0A 3ORRA 5A7FA 5JY1A 1I01A 3R7SA 3TI7A 4Q9NA 4B3IA 3C16C 1RQRA 4G4JA 5ENVA 4MPRA 1Y8QB 2D5BA 1GO3F 2PV7A 16PKA 2XV1A 1JEJA 2GN6A 2OO5C 4IDAA 2E4AA 4TURA 1SUWA 4FNAA 1FRFS 4K0RA 1CTQA 4QAJA 5IBPA 4ND8B 1MIHA 1XZQA 4K88A 3IE0A 3S29A 3E53A 2I7TA 1FMFA 3RASA 3PBKA 4EELA 2HF8A 1SRRA 3D4BA 3FZNA 4OGFA 1U2RA 1Y6ZA 2WQZA 3DAPA 2ZJ6A 2ISCA 2ZIAA 3GMTA 2D1RA 2JJMA 3LHSA 4YTEA 1OXSC 1B8VA 3I05A 4JUZA 3LLSA 2EZ9A 4JVLA 3WBKA 3A3NA 3RS5A 2JPDA 3LUPA 2PMZC 4NECA 3DS8A 5FPQA 1U31A 3TSOA 1K68A 2BEVA 4EO7A 1LF5A 3ESCA 4YYEA 4Q9AA 2FX5A 1TCAA 1PJ3A 5AVJA 3L02A 1SKRA 4G65A 4KLJA 3MXTA 1C1YA 1CETA 4UM9D 5K5EA 3W3ZB 2GYUA 2XQVA 4TMVA 2E89A 3SQMA 3U37A 5JT1A 1JEQA 4UJ5A 3HN2A 4DQUA 4RJIA 4H35A 4ZH4A 2G1UA 4FFDA 2XKKA 5EJMA 2GK3A 3NYRA 2O8EB 4Z3OA 1II0A 3L8EA 1MQ2A 3QWIA 5HKKD 5FOTA 4YV2A 3RRYA 1RXIA 3T3EA 5JMWA 3VR6D 1ZA1A 4OJPA 3QPBA 4O5OA 1HOXA 3T3OA 3C6YA 2MCFA 3QP9A 5E8RA 1K5HA 4A26A 3D2LA 1ZFNA 3ULKA 3E58A 1L2TA 4ZGGA 1ZSYA 4R8VA 3TXXA 4TZTA 2WIJA 4KR2A 5C1BA 4HGQA 5MHTA 1MEEA 3LTEA 3HEMA 5CXQA 1E9CA 4YP0A 3QG1A 1GFIA 1E6UA 5KFHA 2JGDB 4M9RA 4U8GA 2OUKA 3AFOA 4X5VA 1HX7A 1KEUA 4QZDA 3VTZA 3PMLA 1RQXA 4WL0A 4EG6A 3NYIA 4MOWA 1I94B 2PMKA 5DWDA 4WLNA 3NKFA 3T61A 3B51X 3OC0A 2QUHA 1NN5A 1J2TA 4PG8A 2R7MA 4MQFA 2YFHA 4YXJA 4KOEC 2NUAB 4C1BA 3VJRA 1ZIPA 3BMOB 1VSQA 1ZUIA 3ZG6A 3DFMA 1ID8A 3KQVA 4MDFA 1S7CA 1V85A 4YP3A 4PZZA 3PW4A 4AG5A 1M1NB 4MVXA 4Y9DA 4EY5A 4UTZA 3N97B 5HUQA 5CM9C 3B52X 5JNUA 4BWGA 2E55A 3UV3A 1DJOA 2OKGA 3VBCA 3K9HA 4GBMA 1MABA 4LCBA 3AW9A 5MGNA 1ZGAA 3QA3E 4B6PA 4I5EA 1NVKA 1ECPA 2V7QD 1L1QA 1JKJB 3LT1A 3UF0A 3MB5A 1IN6A 3D7KA 3P19A 3MS7A 4Z53A 1TNDA 4ILKA 3LQ4A