2ZIUB

Crystal structure of the mus81-eme1 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
322
structure length
258
Chain Sequence
b'ECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQESRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGETSRRIGPELSRRIYLQMTTLQPHLSLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mus81 protein
molecule tags Hydrolase
source organism Danio rerio
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
total genus 73
structure length 258
sequence length 322
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziuB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ziuB01
1J23A 1J24A 2JPDA 2BGWA 1J22A 4BXOA 2ZIWB 4M6WB 4P0PA 2ZIXB 4M6WA 2BHNA 4P0PB 2A1IA 2ZIXA 2ZIUA 4P0QB 2JNWA 4BXOB 2ZIVB 2M9MA 2ZIUB 1J25A 4P0QA 2ZIWA 2ZIVA
chains in the Genus database with same CATH superfamily
4C3UA 4S2UA 3I64A 2FDXA 4L02A 1C1DB 3FFTA 1YKSA 1E1QD 4H16A 2RCNA 2P68A 2Y0PA 2HMAA 1GNQA 3ADPA 3K15A 4KZPA 2OM2A 2VHQA 1YC5A 2GOYA 5TT1A 3VUEA 4B46A 1T1RA 4TWBA 1PHRA 2I2XB 3LNCA 2QROA 4JB8A 4ZKEA 2EKZA 2MSLA 3DYVA 4Z4QA 3TLYA 3A2LA 5FBQB 1V95A 2CVPA 2HHTA 5ARCA 3WMEA 1KYXA 1PGJA 2QXTA 4XRRA 5LVAA 5E1DA 3KPUA 3K6SA 3GP3A 2IE0A 3QV1A 4KLOA 3OZBA 4B4WA 1VPWA 4C7OB 3VYUB 4YRQA 4F3RA 1PK8A 4D4IA 1GT6A 1UZMA 1Z4MA 1NMQA 2C5BA 3KSZO 3U3ZA 2Z2JA 3K2IA 5KWVA 1OH6A 4LJ8A 2IQIA 1EYZA 3TI9A 3G82C 4QAJA 4AP9A 2GGSA 1UK9A 2Q5QA 2VJCA 2ST1A 3HCCA 1U8EA 2N1MA 1WPQA 1XCLA 3A9CA 3OUZA 1K3FA 3JARB 4I4TF 4KQ9A 4Q93A 2ZU0C 4XX1A 3VOSA 4YMGA 4ZGGA 2VHWA 4KWHA 3RC2A 4NL9C 5LL6P 4DV4B 3D3QA 4Q9JA 5BMVA 2Z98A 3NX4A 2Z2ZA 3QJYA 1UT6A 3MUFA 3UATA 1KEKA 4G41A 3IJEB 4DJDC 4HADA 3LPAA 1GN8A 4WZBA 3RR2A 4Y2RA 1QV7A 3JQFC 3QF4A 1FFXA 3DP7A 1UH5A 1MT0A 3FFXA 1U3CA 4OUDB 2VTBB 1JG1A 2W71A 3D0KA 3AFMA 1MZPA 1LFAA 3AIKA 2IUFA 1XQ6A 1V1MA 4G2NA 4DG8A 4HRXA 3FZGA 5KTPA 1FNNA 3RG8A 4GD3Q 3ZG6A 1T24A 1C8VB 1WMSA 3MOIA 1T4DA 1P0CA 3VPAA 4ZOLA 4NJEB 4BNXA 5KJCA 1PK7A 1F17A 1VPVA 1SU7A 3R5SA 4G5XA 1F9EA 1KWGA 1JG7A 1T5HX 4YQWA 2ZYGA 4G86A 1VIMA 4FC7A 3ENWA 5L3SB 1NNUA 5LCXA 1MABB 1XZKA 1ZITA 1ADGA 3EXHA 4P7FA 4DMLA 1NG9A 1L7XA 4LY9A 1I2AA 1O8BA 1ORWA 3J81k 1VHLA 3SX4A 3IUNA 5A3RA 1L6IA 2KK0A 4I1YA 3KQVA 5EIHA 4C7BA 3KC2A 1OFGA 2PI5A 3KYDB 4AWAA 3MK31 5H02A 5FPPA 3IR6A 4D1YA 4BO8A 2XIQA 1WAMA 4J1SA 1O6CA 4Y6GB 1EEHA 4MK4A 5CT6A 4EDHA 2ZB3A 3C8MA 2F2AB 4KL8S 4KZKA 4LWQA 2RGDA 3TI0A 4Q3KA 3PD1A 3RLIA 1K06A 4M99A 4BTLA 4L28A 2DWUA 2VHTA 1XCGB 4KXNA 2W2OA 2PUGA 4OL0A 4USAA 4HDAA 2JH3A 2ZTMA 2VSXA 4MQFB 3TECE 3FB1A 3HJBA 1IMJA 1EHIA 1ONNA 1PWXA 2NZUG 4WNYA 2QN3A 3UW3A 2NAFA 1E9VA 5M3BA 4L15A 4IQTA 5A1TA 1OCEA 1PQUA 3OKPA 4RYLA 1ECWA 2PZEA 2Z9BA 5IF3A 3QKRA 3DZBA 1V9PA 1OXKB 2Q5IA 4NATA 2BCVA 1KMMA 3VAYA 4GMXA 5LM3A 4YUVA 2ZVPX 1N5KA 5AHRA 4BVHA 2XGJA 3TB4A 5CDFA 2E89A 4IQVA 3GHHA 3WTCA 1AC5A 3OZSA 4Q43A 2PE5A 1I51A 2ZS9A 1BS1A 1HLPA 3VC7A 4DVJA 2Y93A 1ZRHA 1DOAA 1RMYA 2FNAA 1E62A 2ZOSA 4JQZA 1UUFA 2IXDA 3BHMA 1N5JA 3M6WA 5D3MA 2HYIC 4UVDA 3VH2A 2E6KA 4NQZA 2NM0A 1SVKA 3CRNA 1HYEA 4FX5A 4IS3A 3IPXA 1Y4AE 1WULS 3UAZA 3OIFA 1M2WA 4MRNA 1L5ZA 1XDSA 4G09A 4G1EB 3M7DA 4RT2A 1G8HA 4K9QA 4L78A 1MB4A 3CFYA 3THVA 1KQFA 121PA 1CDOA 1SXDA 4HGZA 4BB0A 4M21A 1E9BA 5BYAA 1GPMA 1WU8A 1PD0A 2ZSJA 3O0TA 2JFNA 4DMFA 1G4HA 4FW9A 2OXOA 1A9PA 1I1OA 2LBPA 3K8ZA 8ICQA 2C8LA 5KG3A 3ORQA 4ZARA 4JITA 4MWCA 2Q2QA 4ZVPA 3T54A 4B6OA 1D2RA 1SKQA 2R8ZA 2C3YA 3BWMA 1FU8A 2A0FA 2V4UA 3IOCA 1O95A 4RS3A 4UTOA 1ZKMA 1JDJA 2F1HA 1LNSA 2HBLA 2UUOA 4EUFA 2O8BB 3CPEA 3D8UA 2ZSEA 3F2CA 1PLJA 4HEQA 3RUCA 2WRZA 4AZ0B 4UHEA 1EVZA 2OYYA 1RJWA 1KY3A 2JGEA 4PAWA 4C4RA 2IYVA 2WJJA 2OLEA 4NG5A 1X9XA 4NOJA 1X9WA 1VKJA 2E4ZA 3RV4A 4BNZA 3QY9A 5BT8A 5JOQA 1EGQA 2HCTA 3EYZA 2VLIA 2WPDA 2PVPA 2Y1OA 1M67A 1NLFA 2QL9A 2Y0CA 2VUSA 3IE0A 3JWGA 3PQ6A 5DTEA 3KTOA 5A9RA 2HA2A 5HUJA 2A8YA 3KVNA 3NRJA 4B4KA 4MYTA 2YWRA 4MYUA 4YS6A 1E3JA 1H6AA 5IS2A 4HH0A 5KU7A 4LYAA 2P79A 4ZPJA 3ZHZA 4PGXA 4D41A 4W9MC 3PDUA 1UANA 4LI0A 1G5FA 1QHEA 3GX1A 4XD7D 3PJDA 4UBCA 3MQ2A 2NZXA 1LV5A 4FTWA 4JUAA 5EE5B 5EJGA 2RKWA 3V3KA 2ZSAA 2HMXA 1KFDA 3DB2A 4EKDA 4DV7B 1EBBA 1S7GA 1Z7BA 4QIWC 4G26A 3LCCA 3DYBA 3VH4A 4BQPA 3L49A 2YHSA 4RQTA 3KWMA 1BD4A 4HPWA 4QU8A 2IYFA 1Q6ZA 1XP5A 3G5AA 2QIOA 3TQ1A 2V7QD 2J3IA 4CT4B 3CZRA 5K99A 2UXBB 4V38A 4AMGA 2HBJA 2RBKA 3V00A 3LZDA 2GF2A 1FVXA 1N5IA 4FEGA 4F0JA 4UHJA 2IZZA 1FNCA 1W59A 2QUZA 3ZHSA 3UQ2A 4ZIRB 5JRDS 2VF7A 3GLGA 4CV3A 2IHBA 5EWMB 3R7FA 2D7DA 3KTDA 5HIKA 2O6KA 1WOYA 2PUJA 3GA5A 3ROEA 2B99A 2CVOA 3EZFA 3KV3O 1VCOA 1H93A 4DMRA 3GBPA 3GF4A 2D0DA 2ID8A 5BSWA 4UB1A 1UDAA 1RABA 5D3MB 2ZWMA 4HSEA 3STWA 1ZI8A 2ZJFA 1TZ2A 4RQ6A 2ZDQA 3LO5A 2N0SA 3QZ7A 4J2HA 4RVFA 2V8BA 5DG7A 1U65A 2X8AA 4OM8A 4UE6A 3TIVA 3KZXA 4C2AA 3G6XA 2YW9A 1SBQA 5I9SA 1C14A 2VP2A 4IRDA 4B7UA 1L9KA 4CCAA 2X76A 1Z5GA 3D4LA 1E32A 1WQ1R 1QB8A 1BXGB 5CFZA 1CCWA 1LS6A 4DQRA 4F9TA 2HGSA 1E89A 3CT4A 5KFZA 2I7DA 1HQCA 4FEYA 4J9LA 1BJRE 1V41E 2RGGA 4B4DA 5ITWA 5AVXA 4B32A 4RU9A 3TVTA 5DX1A 3U4QA 2HCFA 5K8VA 4W5QA 2HDOA 3DR3A 3VI3B 1L1EA 1PNQA 4YXWD 5G40A 3W5JA 1CZRA 3CG4A 1SCKA 4P4SB 4CM9A 2DU8A 2DBRA 3PQCA 2ACWA 3OHSX 4ARZB 1CF4A 2GEVA 3A7EA 5E6SA 1YWGO 3QHPA 2PMCA 4BV2A 3O7WA 3FNIA 2RDJA 1J2TA 1FL9A 5T3YA 5KWEA 1GTRA 5TPWB 5AI6A 4W5JA 4JXZA 4EL0A 4XDZA 5BWMA 5JWRA 4AUKA 3I0NA 3I52A 1QQ6A 2XTZA 1W36D 2V3CC 4Z1MD 2D7CA 1AH2A 3WNVA 1M3SA 1I4WA 3H1AA 4ZREA 3JYOA 3KQWA 3H4IA 3ITDA 3VKWA 4INZA 1JQDA 3Q0EA 4DLKA 5B58C 1HUQA 2QGNA 1T2NA 1YCDA 3E3OA 3Q98A 4MVJM 5JH7B 3VR3A 5JAPA 3C6QA 1O0CA 3E0FA 4CMEA 3NDJA 4QIHA 2B7BA 3SSOA 3AFNA 1A7JA 4P3OA 3PTZA 3NALA 3ES9A 2VHZA 1MIOB 2RJ3A 4J4HA 4RKWA 2HIMA 1TQ6A 3OIUA 3HJGA 5J63A 2MJLA 1TTTA 3GEBA 5A05A 1AF7A 1GPWB 2WF9A 2NU7B 2C2BA 2VJNA 2ZTCA 4XIIA 1YI1A 3KR2A 2NMVA 2O5CA 1XWLA 1VJ0A 2C9OA 3FMOB 5TMPA 4LBVA 2F9FA 3GBSA 3LUGA 1EIWA 4FW8A 3LT1A 1KK1A 5DQGA 1NVFA 1ZXBA 5H16A 5ARBA 4D97A 2ZJ3A 2ZRQA 3MMNA 4JS0A 3PV0A 5CM8B 3WQHA 1TA9A 2CW5A 4KV7A 4I81A 5C2JB 1TKDA 1UBNA 3MMSA 5EXEA 2CJXA 3OLXA 3PGVA 4QGAA 3IBFA 4M7RA 3RF7A 2DFKB 2JH9A 4YGYA 2WSMA 4OD0A 1BFDA 3QOFA 4LPSA 4LQ4A 3MABA 4LHSA 4YJGA 3DLHA 4TRNA 2R44A 3AZQA 2C4NA 1UT8A 3GIWA 5JZSA 3KQMA 3RJKA 1T9HA 5CHYA 5JPDA 3R5FA 3X1JA 3GN1A 2IT1A 4W1RA 3C3MA 3VNRA 3KR0A 1ZJ6A 1DP4A 3C5EA 3HCAA 4LS3A 4NBTA 2H00A 4UHHA 3V6JA 4DCGA 4B17A 3FPCA 3MWLA 2FPXA 2CKMA 4YCLA 2HNAA 2HTEA 1U0RA 5IM4A 1P80A 3HA5A 1NQWA 1I0IA 5FBRB 3DBHB 3BE5A 3NASA 1XL0A 3QIVA 4DLYA 1DAGA 1L5GB 4UB5A 4ZJUA 2EDCA 1OZ0A 4JN6B 1UXGA 4A0FA 3LHIA 4M1EA 4PYJA 1YR6A 5F3WB 3RH6A 1UMDA 1H9BA 1P3Y1 3MGCA 3L06A 1LQTA 4H1WA 2NO6A 5EJ9A 2RHWA 4ENVA 3FRIA 1VLMA 3A2MA 4UNSA 4QGGA 1NOKA 1XMSA 2XMZA 3IQWA 4KI0A 3CPSA 5CR9A 3AESB 2IMWP 4WK2B 3TAPA 2B2CA 1OZFA 3UFXA 2Y0SF 4HNVA 1GPJA 1XVTA 5CXSA 1NJYA 4P4PA 1O1YA 4EAAA 4R9VA 4GOLD 3EEYA 5I7SA 1Z82A 5DGXA 4QDZA 1B22A 2ZREA 3EZ9A 4IDHA 1XMJA 5IT0A 4QEZA 4YA6A 4YP6A 1Z0AA 4XEUA 3PPVA 4ND1A 3V2GA 2FWMX 2IYSA 4L8VA 4C7ZA 2QENA 5E7IA 5B1IA 3M8RA 8ABPA 1IHYA 4JBWA 4OBWA 2FKAA 4J0GA 1FTYA 4L5CA 4DCPA 4UZEA 4B3XA 2QA5A 3UWPA 4KO4S 4KW7A 4A6PA 4HAUA 1NULA 1M2NA 4R7ZA 4HX2A 4BJ1A 2FCAA 2R65A 3GD7A 4RIEA 3LXXA 1VSUA 2WTXA 4JL8A 4RD6A 1IUOA 2YDYA 5KTMA 4EM6A 2Z83A 2PKXA 3KVOA 4LECA 1CR2A 4UEQA 1OXSC 2Q3MA 2OV1A 2VWHA 2OXTA 1UADA 4FOSA 2IXFA 3ABZA 4K3VA 2NU7A 2UXCB 1Q5PA 1VE9A 1G16A 4JP5A 2J0QA 3TACB 4YTEA 1DAKA 4UVHA 1NVTA 2PQ6A 5IIJA 2WVAA 5EZ6B 4DLEA 2R1TA 5CCDA 4E5UA 5KL1B 4LY0A 4G1UC 4WN9A 2C96A 1USWA 2G6TA 2XZPA 3W5IA 3OPYI 4M0FA 4F6RA 2GM5A 3WNQA 3KG2A 3GLIA 4AXBA 2J6HA 3HV2A 4OO1J 1EE2A 2IP1A 3DA8A 5IDWA 2I91A 3GQBB 4R8LA 2QB0B 2FPIB 4H6WA 4LSZA 1LWOA 1WCV1 2JKVA 5T8KC 3EXFA 1LI5A 2E4XA 3NBMA 2F7SA 4JFRA 1DTWB 4IG4A 3IN5A 4RYDA 3FWZA 3IEVA 3ZZTA 5I7WA 5A0LA 1R4NB 3SC6A 4JJEA 4YAEA 2ADMA 4YMIA 3SV4A 3MHTA 1OXMA 4MEBA 4OJLA 1NC1A 2GXAA 1WTAA 4N12A 3TZKA 3OEHA 3U7RA 3WU2U 4IOMA 5JAMA 3G5MA 3I2YX 2WSYB 2WSSD 1QFSA 3L0BA 4G36A 4L7VA 5AVOA 5FTMA 3DD5A 4BU1A 2PFPA 1OJLA 4HWTA 4RELA 3D7KA 4O4HF 1DEXA 4Y3UA 3IE1A 1PJAA 4CKZA 2W43A 1H2XA 2Q1SA 4F38A 3AG5A 1Z07A 1YB6A 4DJTA 3DVLA 4Y6PA 1OFHA 1RQPA 3L8CA 1YA8A 4WOPA 3RJ5A 3T1OA 5DLFA 1CWUA 1XTRA 3KD3A 1NI3A 1B1CA 2LDXA 4YQYA 5T5QA 4NLNA 3WIUA 1N5XA 1YK1A 3A8TA 3GZTB 4JLUA 4WDRA 3T41A 3H6GA 2XITA 4YO7A 1RBYA 2A1IA 2RGNC 3P20A 1L3BA 1ZCFA 2KJQA 4C29A 4B8YA 2PUBA 3U80A 2H4YA 1WSWA 2PD6A 2WLSA 1N5MA 4L4SA 3VYVA 1HNXB 4C07A 4EX7A 5DB6A 2QW0X 1UC5B 3I1JA 2UZAA 2RK6A 2EGHA 4CIBA 1JMYA 2WU8A 5E3IA 2HSDA 5DSZA 1MMFB 5F35A 4BLQA 4CKWA 2FJUA 3WISA 2ZITA 3LUJA 3PC8A 2EBWA 3TLBA 3O1LA 4HV4A 1YASA 3MF4A 2XUQA 1L5QA 3HJUA 4LYFA 3R76A 1J1IA 2Z8YA 3TI7A 3EZ7A 2BM8A 3VPFA 5DCLA 4AL4A 3KBBA 1IN7A 1R7RA 3W1EA 4WLNA 5HX7A 4AY4A 5HJEA 4BZQA 4KLEA 1H2FA 2X13A 1WP9A 4I9UA 2ZKLA 5KFMA 4ID9A 4ZD6A 3RBAA 1U28A 5KT4A 1I6LA 2CF6A 3T5GA 4CMKA 1X8KA 2BBSA 4LZWA 4F86A 2NSLA 3PVCA 5E1BA 4GXQA 1QVVA 3FYUA 3LK9A 3PX7A 1C7FA 1ZJZA 1ILWA 2LI6A 3NM6B 3VVMA 4S0ZA 4WZ6A 2HWXA 3VZPA 4JYAB 4R8UA 1KMHA 3FG9A 2J87A 2QDXA 1P9LA 1E0JA 2CLDX 4EH1A 1IATA 5FNVF 3TCKA 1K1QA 2EGGA 1K7CA 3PUHA 4PYOA 2OO5A 3C24A 3ICOA 3IP3A 4JUZA 1C3EA 3PCRB 4FONA 1G55A 5I45A 1BQEA 4HAZA 3MWJA 5LNK1 3AQFA 3FROA 3WWYA 1RHQA 4OGGA 3LK7A 1WVMA 1F2DA 4F1KA 1MTZA 3O9VA 3ETRA 3ROXA 4J3FA 3TPZA 3W8EA 4GS5A 2GCIA 1V5EA 3PFHA 4K9OA 3UB2A 4JI2B 4MV4A 3WXBA 4BGEA 5AKJA 1NK7A 3H2BA 3PV8A 5D85A 3WJAA 1J39A 1PTJA 1OIXA 4JWKA 3R5KA 4LOHA 4EMUA 2RGRA 3T3MB 5FUXA 3AGQA 4UUMA 1OIWA 2EOAA 2ZSFA 1G59A 5K4LA 5F5NA 3RFXA 5CDGA 2E1RA 4Q4JA 2JCVA 3UUFA 4M8LA 3JATA 4MX8A 4V3BA 3VHRA 1BH6A 5DNWA 2BFMA 2PUHA 2CJWB 4GMKA 5CW2A 5GJVC 2WJGA 3J7AC 3IKVA 2AHOB 1GG5A 4NV1A 1L4GA 3PZRA 2B4RO 3VOTA 3COSA 5K3FA 1NHWA 1WXIA 2ZM5A 1N1MA 5BXQC 2Y1JA 1E9EA 2D6FA 2IYZA 2XCLA 2H48A 3LX8A 4R1SA 3IOMA 5DEOA 4JWTA 3LVFO 5ERYA 3S40A 4K4IA 5KFJA 5FB3A 4MJXA 5IW8A 1Z4JA 4URUR 1XX6A 5B2FA 2CHVA 5CFNA 3BHJA 2JZNA 2VZ0A 3WB2A 5TPZD 4DR4B 2IS1A 1Y3DE 2NPOA 1HDCA 2YXDA 4OLBA 5CCEA 5K0ZA 4AQ7A 1P5HA 4J9QA 1W36C 7REQB 2G9VA 2IXTA 4E21A 2NO0A 4YREA 3P96A 3SYTA 4AG3A 1QCDA 3JD1A 1AQ6A 1SXPA 1BRMA 2I4IA 4ZVKA 1DINA 1ZIOA 2C92A 2HJGA 2VJQA 2HI0A 4KXXA 4WECA 2X3YA 4GYJA 3K2EA 4IXTA 4Q5IA 2BE7A 1AA9A 2WV9A 2Q07A 3R0ZA 2KTQA 2O20A 1OFUA 3PT5A 4CUKA 5H2FU 1ZCAA 2C99A 4BBJA 1NDQA 4GVPA 3OCJA 4URHA 3DWGA 3VBEA 5HP4A 4LK2A 1EK6A 2EFDB 2ILTA 5DG9A 3JW8A 4TXNA 4UZFA 2G25A 5K3BA 4EG3A 1WJGA 2QDKA 4YRAA 3IUPA 3F6EX 3PNMA 4RJIA 4TSFD 5CT9A 1GLGA 2J5QA 5LP6B 3Q72A 4HH3C 5CP8A 2QRVB 4QNRA 4IHJB 4ZRDA 2XX3A 2JXJA 4W5RA 4C21A 3KJNA 3FSGA 3WHIA 3GLHB 3HKBA 2ORED 5CEEA 1L5RA 3MGHA 1D2CA 2YY7A 4F8EA 5JSZA 5L40A 3R23A 1ZA2A 2IDJA 1FLDA 1ZGGA 3L8MA 5ALPA 2QI9C 3DV0B 3PPXA 5FFMA 4EKIA 2OC4A 3FJYA 3GROA 2NWQA 5CA0A 2YV4A 5H3HA 5EWEA 2GHQA 3NBFA 4C0SA 4D4KA 4FFPA 2QUAA 1A8IA 4B7XA 2QT1A 3KJZA 2EYQA 1NVKA 2H1FA 4U7FA 4ZT3A 1RCUA 4CMBA 4JEUA 5KYYA 4WBSA 4P58A 5TXGA 2VJ4A 5C5EA 3CSSA 4RJKA 5JJBA 2I1LA 2Q9BA 1G19A 2BBOA 2FWAA 1NOMA 5HIMA 4BQQA 4QLBA 5FV7A 3AOEC 4EA9A 1IG0A 3CB2A 1F1BA 1GY8A 1ZQLA 1I10A 2IUUA 4MUIA 1VJDA 3RGGA 2CVHA 4WZAB 3ZUPA 1EWRA 1IXRC 1FVFA 5L7WA 2MMCA 2RGXA 4ED7A 1ZK2A 2GR9A 1YRYE 2UZ4A 4C78A 4WOKA 2R8IA 3OT4A 1DQZA 3NHJA 1DAOA 4IKPA 5DXJA 4DPLA 3BDIA 3KVYA 3LGSA 2P1DA 1WCYA 3FSRA 4KXVA 4NS1A 4OXKA 4PQGA 2B1RA 4BMPB 1E3DA 2FX5A 4JJAA 1JDBC 4KLLA 2J7PD 9ICHA 4IRUB 2RH9B 1KFKB 2XWBF 2QORA 1KY2A 5J2KA 4O5KA 4QC2A 4UQOA 4KHZA 4BGVA 4KDCA 2ES6A 4IQUA 2GT1A 3M1YA 2I22A 4GPAA 5DKFA 4BLPA 4LF4B 1XDBA 5HTOA 1TB4A 1ZLYA 4EGAA 3TO5A 2I87A 2Q1YA 4U6SA 4AKTA 4ICAA 1NXPA 1L0BA 1N2CB 3QUAA 4KO3S 1QDLB 4BRUA 4UBBA 3N6XA 2WHPA 2DKZA 1JHOA 1AVTA 4CLDA 3BB3A 4U8GA 1E9CA 3GRPA 4Z4IA 3EPRA 1EX1A 3JVVA 3OKCA 2R7AA 2P2LA 4IQ4A 4OJKA 2WVJA 3UK7A 4ALKA 2QRZA 2FXIA 2M32A 3BH0A 3SBOA 3WAJA 1VE1A 3DE6X 4TQSA 4E0DA 4HRVA 4PWYA 1JLLA 1R0RE 1WQ3A 1R6AA 4O0LA 5KNDH 1P6UA 1OTYA 2YX1A 3C41J 4GGPA 1CPYA 4I29A 2F3QA 2GBCA 3NUGA 3UWSA 3OOEA 4EHFA 4F2HA 4I99A 5CFLA 4I1IA 2WZDA 1BVUA 3O0FA 1CU1A 1MB9A 3QNMA 2G1JA 2CLHB 2L2QA 4ZRMA 3S44A 2OE2A 1DAMA 3GFKB 1AHIA 1TF5A 2WI8A 2ISCA 3DNMA 4GOKA 4TLBA 2MSCB 4RO0A 5KT7A 3FYCA 4ABYA 4Z9BA 4BU0A 2FK8A 5DH9A 4QQNA 1SZHA 2YZNA 3IMEA 4O2BB 2NO7A 4AS1A 1KJZA 2YDXA 1OQAA 4HQFA 4Z4GA 5F64A 4LVUA 3FTFA 4RUCA 4QD3A 1RC8A 4BMSA 1Q7TA 3ET4A 4AZSA 4Z4CA 3MAGA 3SYRA 4FZNA 3QW2A 2Y27A 3GI1A 1NYRA 5ANRB 4B3BA 3BTOA 2NQTA 4REQB 1LW6E 2VH5R 3JD3A 1NTOA 4TS1A 1JMKC 4ARVA 1M1YE 3AR5A 1Y5NA 4Q8FA 2OMKA 2VP9A 4KQEA 4YAFA 2W7TA 5EUCA 5EXDA 3S55A 3WNBA 4E2FA 1EXVA 2KW5A 2AS0A 3LDUA 4AIRA 1F3OA 4KC0A 1JHYA 4TYPA 2Z4RA 1H65A 2C00A 4MKIA 4DV0B 1XZQA 1E4EA 4XYGA 5DGCA 5EMLA 4UU1A 2Z04A 2YZMA 3I45A 2JJ2D 4NOKA 2A7QA 4E88A 1BQ4A 3TAHA 3CY6A 2PWZA 2JFUA 1SBCA 2PAAA 1XJCA 3IB3A 3R41A 2VXCA 4MUGA 3UT5B 5JECA 1JI7A 1ZQRA 4K7JA 3UMGA 4KE8A 2RHHA 3QA9A 4EJMA 3SF0A 3UHPA 4X9XA 4NDZA 4UAWA 2ZYHA 1X6JA 1E58A 2VF4X 2WU4A 2XRYA 3DW3X 4XDYA 1PJ2A 5FOTA 3OE7D 2XGPA 2NVUB 4EW6A 2XKKA 3GP8A 1Q0TA 1K3TA 1KFSA 1MO2A 3LBNA 3NHZA 1OXXK 3JPWA 4IJUA 1C7IA 2CD9A 5D6OA 1RYMA 2NUAB 3RSLA 1Y6QA 1U0FA 3L0YA 5JXHA 1K66A 3UMRA 3PLAE 2EF0A 3KZKA 3DMFA 1GGJA 1BHJA 3NBUA 1IRIA 4MUJA 4LF5B 1EGMB 1DAFA 5GGXA 2PA3A 1DX9A 4DXAA 1ECJA 1Y63A 4CU2A 1MP0A 2FMHA 5AXDA 3AB8A 2V7PA 2LM4A 4KQJA 1ZQTA 1TMOA 4GT1A 2DUYA 3HEAA 1G20E 4JLAA 2PH5A 2QQ5A 4I1UA 4XSVA 1GKYA 2DHDA 4N47A 3R7DA 4QZEA 3NBYC 3NPAA 3ETCA 3GAZA 4OHZA 1XZPA 4LJ7A 4CT5A 1DOZA 2H5IA 3IO3A 4DNXA 4B3TB 1OI7A 3T9BA 1IXSB 1JG6A 3NHRA 4WK0B 2I9GA 1TKCA 3ZQKA 2H54A 5BUSA 5KT5A 3SQMA 5I5EA 1SOWA 2YXBA 2G4LA 2HUPA 3DBHA 2FW9A 1VPTA 2VSQA 2ODEA 3PI7A 2R00C 3CUTA 4O0IA 3JWJA 3D8RA 4ZYUA 1IONA 4DIUA 2YHUA 1CEQA 1RZ3A 1YS7A 3ENVA 3P9RA 4YALA 4RZRA 1TUBA 3SX2A 3WLNA 4CM3A 2V65A 3UG7A 1M8FA 1S2DA 1ZPDA 1YJBA 3EAFA 3T5DA 3NAGA 1K9SA 1KYYA 3EIQA 1VLBA 3ZZUA 3W2EA 3KHHA 5AIAA 2FSUA 4H3KB 2BDUA 8ICGA 3OLVA 1YDFA 2R8GA 1ZQUA 1W4LA 2XOEA 4N7BA 3SC3A 3HCEA 4I2GA 4RNOA 4RJLA 4HXYA 4K40A 4W6QA 1JQJC 4M9XA 3JALA 1PEKE 5EG5A 2PY6A 3MIIA 4F4UA 2C61A 1Y8AA 1NM5C 4BN5A 3D6NB 3DE4X 3GVHA 4PIVA 2FW1A 4YQZA 4D6YA 4PC3A 2BJVA 4BJ3A 4QOIA 1C80A 1VJCA 2W83A 3T5PA 1XLVA 4L08A 4YUXA 4IEFB 2FN9A 2H4WA 5JNTA 5TV2A 3T3GA 5L6MB 2I3ZA 1D4OA 3VPGA 1JR3A 4Y2HA 3IP9A 2EBUA 1G4UR 2V6IA 3RBVA 4OJ6A 2XE8A 3EF3A 4GQAA 3VVLA 4PXAA 1QRUA 2GK6A 2GFIA 4BKPA 2GPJA 1CE8A 3NWEA 3RTBA 4BLRA 3VCBA 3B20A 3Q3JB 5KOHA 4HO1X 4F85A 1PX0A 3LG2A 2H2WA 2C28A 3BXGA 2BT4A 1B8OA 3OQ6A 2WT4A 1N2OA 3DKPA 2GZAA 4D02A 7MHTA 4QVGA 4I9FA 1RYDA 3HWTA 4EB8A 1ORHA 3TDNA 1Y9DA 1S2NA 5LA6B 1NF9A 5TQ2A 4ZOLF 4ZTZB 4JSTA 3N87A 1V5IA 1PGPA 1AGXA 4DRXA 1N32B 3LA6A 1HDEA 4JBYA 4IXDA 3GIJA 3BWYA 5DSTA 2VA2A 3S3TA 3MEQA 3AVOA 3JPOA 2GI4A 1GAXA 4S12A 1ZN7A 4LYHA 2VIIA 3NEAA 3D3NA 4WCVA 4I4TA 1FP4B 1VIYA 2OESA 5MFPA 1E7YA 1DQSA 5K0NA 1TK8A 3C15C 1YFKA 3HU5A 3V8VA 3TFQA 4XTRA 1W94A 2I1VB 3H99A 2ERCA 2QMYA 2O8EB 2V74B 1ZL0A 1RM4A 1F6WA 2I1WA 3IEIA 3X43A 3C7KA 2WB4A 3A70A 3LZ6A 4KI7A 2WLTA 3RUEA 3ZC3A 4NHEA 3JVUA 4ITVA 1P5FA 3DZDA 1H4VB 1YRHA 4JC5A 5EQJB 5JYEA 4XCXA 1SXGA 3D2NA 3SLRA 3T1TA 5D86A 3D7SA 4IKOA 3KSAC 4NDAA 2FZCA 1SOMA 2JB9A 3W4JA 1ADCA 1O5IA 2O7RA 4M8NE 5FBZA 3TOVA 3N3BC 1GQFA 1XRMA 1COWD 2ANBA 4J0HA 4N39A 2AFRA 4AYXA 3FPLA 4UAJA 1L5NA 3UJ3X 3LQQA 6REQB 3W9YA 2KZZA 3ICXA 3T1NA 3RC3A 2OCPA 2DSNA 2XA9A 4Q7QA 2P3QA 5IVIA 3IP7A 3N07A 2FGJA 5DFAA 2I66A 3PFBA 4W5HA 2FPLA 4N0MA 3LLMA 5DWQA 2Y6UA 3V55A 1M2JA 2AFHB 8ICWA 3GEPA 1EHCA 1T3SA 3AVVA 4ZZ1A 1ZQQA 1DIGA 4V03A 3PE6A 1SVSA 4LW8A 2P65A 5SYMA 5LOVA 1IUKA 3GJSA 1N9KA 5F9FA 2B8EA 1FLVA 1Z68A 3MGKA 3LLCA 2BE9A 2IOFA 4DPMA 4RQ8A 3DMYA 4FFDA 1ZH8A 3ZJYA 2HA7A 4C1NA 2PXAA 4EFDA 3HWX1 1PZMA 2YUTA 2HNBA 1R6VA 3T3NA 1W0KD 3F6BX 2COEA 3IHLA 1I3MA 5LZ7A 1J2RA 4WLUA 3RHFA 1SCUA 4P6VF 2QTFA 2CNNA 2WHQA 2JIBA 2XA2A 1ZJMA 1EE9A 1UXHA 4JLKA 4UEOA 1GU1A 2VYVA 4DREA 2XGMA 3OQIA 5HR6A 4B2IA 4BX8A 3O7MA 3ZDQA 3TPFA 4ZVNA 1ACLA 1QHNA 2GTIA 2Y2UA 2JI6A 4OXXA 3PHGA 4P5PA 4RE6A 2ATCA 3ZWWA 4OXIA 3CO5A 2GN8A 4E5DA 2ZUWA 1NLYA 5EOZA 4C7VA 1INLA 4IXMA 5DF1A 1N1EA 1PJ3A 2AKYA 3LNTA 3NI2A 4YACA 1XCBA 4OQPA 4AF6A 4Z0TA 5HRAA 1SKMA 3WFJA 2QAGC 5EZYA 1MG5A 2PH1A 2FQXA 3DLPX 1JAXA 2RC6A 3SIRA 4O63O 3I6IA 5B58T 4DRXB 3REQB 2XYQA 4Z99A 5B7GA 2ZJ2A 1AGYA 1XD8A 2YWGA 3PVXA 5A4KA 1CULC 5J2FA 1HSOA 1XC7A 3O38A 1NPTO 2QV7A 3AEQB 5CLHA 3W5HA 4MW5A 2HA3A 4HFRA 4ZHSA 4U02A 1JU4A 1KK3A 2G63A 1S0NA 1SUDA 2IOQA 2V6MA 1R8QA 2VNIA 3RYTC 2O0JA 2HQRA 2Y92A 3HBLA 4EQZA 3ZE0B 1E9SA 1NIJA 3TW0A 3IPAA 5CB4B 1EJ6A 2WJ4A 4ACBA 3IEPA 5DHAA 5KNLA 4QBHA 3EMDA 5EIOA 4C80A 3UMYA 3JQ9A 3L4JA 3S2FA 1RLJA 3QFRA 1ZIYA 2P8JA 3F7TA 1TM5E 2H17A 2IYEA 3G8CA 2G1PA 2ZZMA 4K03A 4ON9A 4A6EA 3HPOA 4JR0A 3UV7A 2ZI9A 1X1CA 4PE5B 4DQVA 3KWLA 1EFRD 4R2XA 2ZXHA 1XROA 2CNWD 3MUEA 4OI4A 2GZSA 3RWMB 4XIGS 3SHVA 2WV7A 1TJPB 2HEIA 1U9YA 3PNCA 2EZYA 2QPOA 4MCHA 4BLUA 5KSZA 4YRSA 3PPWA 1L7DA 4HB2A 1K7EB 4L0MA 4QUAA 4TTSA 4UFOA 3V8QA 1KBQA 4Q00A 1NSFA 1A04A 4CYMA 5EUBA 4PG5A 2Y77A 4YJKA 2HOIA 4MCIA 2C0QA 3IR5A 1Y5RA 1PK9A 1J42A 2IU0A 1RDFA 4A7PA 4DLTA 2C5GA 1UJ4A 3GP5A 4B8ZA 1VL6A 5ELXA 3QW4B 3FMPB 1XTIA 3WIOA 3FNGA 4MINA 1IBCA 1QLHA 3FBWA 4B6PA 1L3CA 2CUZA 2CXTA 3OTHA 3WDSA 5C8YB 1AB6A 5LWQA 4BMDA 2ZXUA 4MS4B 1ODJA 1NZDA 3EC1A 3LLSA 3A1TA 1D4FA 2PX0A 1A8SA 1G8MA 3PDWA 3W6NA 5J0OA 3F90A 1WWUA 5KFWA 2AJQA 4NAVA 4S1VA 2R7KA 4AP5A 2JLQA 4L6AA 2HHWA 4XASA 1MH9A 5TQ0B 2J6SA 1RZRD 2FSFA 1NC3A 1W8DA 4OI0A 4FNGA 2F8TA 4JGIA 2H2AA 4D4JA 4PU0A 1KDRA 7REQA 1N6OA 1AO3A 5J0RA 2DBVO 2NSJA 1ZWLA 3NNNA 2RIRA 2BLLA 2W58A 1G8JA 3PSAA 3DTYA 4GNKA 2OO3A 3O47A 3RS7A 1ZR4A 1CZLA 4BNUA 4ZJZA 2WIKA 4YD1A 3TJZA 5E4FA 2QUKA 3RVMA 1P7CA 3EXG1 3BCUA 4DLZA 3EPPA 1JA9A 4IQ0A 3UQYS 4C76A 1QPZA 2PT6A 3GNSA 3EBPA 2IHZA 3JWEA 4K05A 2RFLA 3EZYA 4M4SA 3ME5A 3P7MA 5H3CA 4E31A 4NBWA 4QM7A 1NWCA 1WW2A 4ENUA 2WM3A 3EW7A 3R3YA 2KHVA 2IF0A 3LC2O 1GL7A 2O0HA 1E4YA 1OTXA 3ORRA 4HNQA 1FFEA 2I62A 5CR0A 3DZJA 2AYYA 1FSFA 3F2BA 3PHJA 3RUFA 1KERA 2NV3A 2PM8A 3HCBA 3PWKA 3ZDEA 3GLHE 1JQ5A 3DE2X 3U31A 1T3NA 1Y8RA 4BLSA 3ZGXA 2WKPA 4YP7A 5LDGA 3KUCA 1RIFA 5G0WA 3DFKA 2HPVA 4QEKA 3CWCA 4GW3A 3HPQA 2IUEA 3I34X 4Y1EA 4QSHA 4XEHA 4ZQHA 4RTNA 3EBOA 5HF5A 5DN6D 1N2IA 4WSOA 4OJMX 4P82A 3UB4A 5AUQA 3I2FA 5BSTA 2EJTA 3BMCA 2IYAA 3FCEA 5GTHU 3KFVA 3F47A 1S5PA 2BGTA 1W88A 2BGWA 1D0IA 4FSHA 4HSGA 4M36A 3PIDA 4DSEA 4MCJA 4QTTB 4Q9AA 1CUIA 1UOQA 3ZU2A 3JR3A 5CG1A 5TEVA 4A8JA 4GH5A 2WG0A 1R9NA 3W7BA 1RHMA 2PANA 2VYNA 4PLCA 3RYHA 5JR3A 1BDJA 4NG4A 2ODPA 4Q4HB 2BC9A 3T3HA 5LR6A 5EMKA 3KQYA 3QKSB 4EG0A 3M4XA 4FI3C 4UU0A 5K8LA 1T2VA 1MDBA 3DMHA 4OHFA 4ZQBA 1EUCA 2EWMA 2FMTA 3P1JA 1C0KA 1W47A 3TZHA 1Z4KA 3HXTA 1D2EA 2QR3A 1LA2A 3W0LB 2VJAA 1J33A 1KSHA 4DLRA 4LSMA 3K0CC 1PJCA 2NXJA 3UJAA 1MOSA 3VXKA 2OCEA 5C4IA 4G0MA 1OBFO 4CLEA 5JEEA 4CR8A 2RE8A 1BA2A 4HHEA 1IPHA 2R86A 1UFQA 3DF7A 3IOEA 3IVRA 3I58A 3QVGA 2CMHA 1VXOA 5M7EA 3OD5A 1E1RD 3VC1A 4UM8B 3ILYA 4UDYX 5E6SB 1EMDA 1IAVA 3D4NA 5LYJB 1NSYA 4DS4A 1X9HA 3G8YA 2VH1A 1B6SA 1CJKC 4AFNA 5BORA 1ZVKA 3HUUA 1CRPA 2OG2A 3QXSA 2CV0A 3KTAA 1LVHA 3AMZA 4FDUA 4IRXA 4L7QA 2MA1A 2AXEA 2B8NA 4L22A 3T35A 3AEYA 4M1SA 3TNYA 4NYMQ 5EHXA 4RT3A 2BFBB 4GXKA 1X9IA 1V6SA 5F52A 4W1QA 4WNAB 1XJ0A 1XO1A 5BSEA 2P5TB 4UB3A 4Y2SA 4JMPA 3GT0A 3IDQA 3EPJA 1AXEA 5JEDA 2QX6A 5JRJA 1Y3BE 1ZW1A 2GH1A 1J20A 3E3MA 3NWJA 4UD6A 3K31A 5GADl 2X6TA 2YMLA 2ZIXB 4RH0A 4KAJA 3SBDA 3ONFA 2WFZA 2XMPA 4ITRC 4DG9A 4EK9A 3GV5B 1Z5UA 3E58A 1DBVO 2XUGA 4KACA 4G0YA 4Y6OA 4EYHB 4AULA 4DEYA 3TTSA 4XI9A 3CISA 5AOVA 3ZJVA 2QQEA 2Y67A 2AJBA 3KQQA 3JQBA 3KSDO 3K05A 2VYFA 2IYXA 5DYYA 2FFJA 2F3RA 2INGX 2ZRMA 4NYMR 4X62B 5A0VA 3G7SA 1LRJA 3PTAA 1ULBA 1XXHE 4K9RA 3KT6A 3B85A 2G72A 4Y0AA 2W2LA 5KG5A 4X91A 1KP9A 4LWPA 3LRPA 7ICEA 3GIIA 1GG8A 5K45A 2JK0A 1M1YB 5KUTA 3SSAA 3RH0A 4DR7B 3QUSA 1M7GA 3MGBA 2PI4A 4KQFA 1IHPA 4PYRA 3TNFA 1JTEA 2EZZA 4UE3S 3OFJA 3MAJA 4N3AA 1NVGA 2GPWA 5J2GA 3OTIA 1D04A 3W78A 1TV9A 4M49A 1XE3A 4MKZA 5H0IA 3HXQA 4KN4A 3C3KA 3G2QA 1PZEA 2WUVA 3MNFA 1A9QA 2B82A 5KINB 1UM9B 2GERA 4LWZA 4AF8A 1BPEA 1MOQA 3UH1A 4DR3B 2PSFA 2G9QA 3BOSA 4CM1A 3KQOA 1OTHA 1ZUIA 1RKVA 3BTSA 4W63A 4DY4A 3EPKA 1U0JA 4P0TA 1JIUA 2JGAA 4LJLA 3OOYA 1KKMA 1MN6A 2XSZA 2F2TA 2JJ1D 4W82A 3QE4A 1JG4A 1DUVG 5JCXA 4B83A 1RRGA 3LU1A 3TQOA 2V1UA 1CQJA 3CUUA 2TMGA 2E5SA 1FJHA 3CCCA 3OCYA 5E95A 3PFFA 5CEHA 5G2OA 5K6TA 1CY6A 4NCHA 2IS6A 3DHVA 3QUCA 5DG8A 4G97A 1MPXA 1FRZA 1KE2A 4F5QA 2CHQA 1SBZA 4RMHA 3WGOA 7ICVA 5LU9A 1PNRA 2H51A 4J7CA 2R0QC 3KZIU 3BDVA 2ECFA 3F8TA 3QK7A 3PFKA 3FYHA 2DYKA 4XFDA 2C0CA 2YHAA 3GCXA 3SJBA 1OIVA 3CWZA 4DA9A 3P32A 4PGHA 3E2EA 1YB7A 2Q2WA 2EANA 3C7CB 4D45A 4BIMA 3HCOA 1R37A 2XTNA 1KEEB 3K0EA 2Q3HA 4G1BA 4G25A 3MGAA 4W9RA 1WO8A 4YR7A 5M34A 5FPQA 4CL8A 4J0IA 3NRZA 1QVWA 1RXYA 1X7ZB 1H0RA 1F0KA 3WMGA 4C0KA 1M83A 2GK3A 1W2WB 2W9XA 4AVYA 4B43A 1XPOA 3TW8B 3S70A 2R6CA 3KUKA 2FEPA 2ZIXA 1I01A 2RCYA 3L79A 2OENG 3VZCA 3A9TA 3C1TA 1E2HA 4AJOA 4CVNA 3H2ZA 5DSXA 5IVPA 3AONB 3BWXA 1JEYB 3LPLA 1E2GA 1Q0UA 2AVDA 2GM3A 2R7MA 4K0RA 3IQHX 3RSSA 3A04A 4HLUA 4MP6A 3CNLA 5MGBA 1D2AA 3AWDA 4MQEB 4Z7NB 2B1JA 5ALRA 3LQKA 5GMOA 2IYQA 2FPUA 1WB9A 1ZI9A 1A7UA 1RTKA 2IA6A 5JU5A 3DAYA 3GJYA 4OM7A 4ZIRA 3A3OA 1JZSA 3KAQA 1MHTA 4B4OA 3QQPA 4XUSA 2BHNA 3P5BA 4INOA 3CH4B 4OL9A 4TXJA 2G28A 5FQOA 3RVPA 1J7KA 3U39A 4YR9A 3EAQA 3GPIA 2M98A 3KR9A 5JAQA 3DLBA 4TTTS 1UBCA 4BN4A 3AOGA 4E5PA 3RM3A 3HHEA 2AOVA 2VHXA 4IEEA 4MJ3A 5LLSA 3S7TA 2ORYA 2ZSBA 3H5OA 4LVNA 1XDWA 1XZMA 1EI9A 2YJNA 1G3MA 4UASA 3KE9A 4PSAA 3PFNA 1EG2A 4A8HA 2HR1A 1FXWF 4GLLA 2XUKA 3LKDA 3QY0A 1SJ9A 2ZUCA 1ZQXA 1ZQSA 1L8AA 3I28A 4JYPA 4PO8A 3TTYA 3UICA 5DNUA 1SXQA 2W5UA 1NV9A 1LKZA 4ECRA 3QXXA 1DRJA 2PUWA 1IDN1 4Y6RA 5FBWB 2OFWA 1IRXA 3LO8A 5DDMA 3HDJA 4IDFA 2WF8A 3FR7A 4KJZA 4OFWA 4FNOA 5IBRA 3OQMA 2JLSA 1JIIA 1E7SA 2WAOA 1DRUA 3WK8A 1JE1A 1XK7A 3IUMA 5TY0A 3OU2A 5IJ9A 4DQIA 1E5TA 1URPA 2PEYA 4JUCA 1RWOA 1XD2B 1ZL2A 1I4OA 2I33A 1X0XA 4OSEA 1QM5A 1T3TA 3ZDZB 2HW3A 3KOWA 4I5IA 1OPRA 4GLOA 3AF5A 2RDIA 3OFKA 4G0OA 4O4HB 1AS3A 3L93A 4IRCA 8ICPA 1JVNA 2QYHA 3GN2A 2D54A 2EP7A 3P4YA 3PC4A 4KPGA 4OSOA 2B94A 1SUFA 2BJWA 1U5AA 4OJYA 2O07A 2VUTA 4QHSA 1LTHR 13PKA 1XAIA 3VA7A 1RI4A 2OV4A 2FWPA 4PRYA 1PWHA 3T5AA 3VQTA 1YRQA 2IDMA 3WRVA 3I39X 1R6UA 5J1TB 3UUGA 3AEUA 3CHYA 3LOUA 3UC9A 4E5SA 2J85A 2I6UA 1QX3A 2JLWA 5GZ3A 3RU9A 5H68A 4FB5A 4MITA 1OVMA 1OLSA 1V9SA 4WT7A 4M9HA 5EGSA 2M6LA 3BD7A 3W2TA 4BNMA 4BMVA 3OPVA 4JLMA 5T14A 2O23A 3RC9A 5F2OA 2QTVB 4KREA 2C03A 1K8RA 1UK8A 2B5OA 3FPAA 3LC7O 4P7BA 1WP4A 3QG5A 1X8LA 2BW0A 3R5JA 4NE2A 3I4LA 4NBSA 1F48A 1FFUA 1PQYA 1MX3A 1WXGA 2O8VA 3GV0A 2JEZA 4O1HA 5HG0A 4DSNA 2ZS7A 4A36A 4I5FA 3L7YA 5D49A 5LOVB 1EU1A 4C06A 1RPAA 3L7LA 3Q3IA 2I2BA 3LKBA 1DEKA 1Y7PA 4XSHA 2JAPA 1UBLS 3LUKA 1CVIA 3KPJA 1UPFA 4N3CA 4YRJA 5TDHA 2VDLB 1Q44A 3CF6R 3U3KA 3ZV5A 4LCJA 9ICBA 3C1YA 2R11A 3SEQA 4HYKA 1IY2A 2IPMA 4R1PA 3NHAA 4B79A 3OWOA 5EP3A 4F3KA 1M6VB 1A2BA 1IH8A 4M0AA 2D06A 3SE0A 4PZPA 2HHJA 4LDRA 4KTVE 1YS4A 1S96A 1Y9JA 4GWLA 5DKWA 2C4MA 4W8GA 1PO7A 1OLXA 3BRWD 3ER8A 1FO4A 4ZH4A 1KI9A 1UQTA 5L7TA 1PD1A 5DLYA 1MV5A 3OJEA 5EYPB 2K89A 4K86A 1U99A 1MAWA 3G7NA 4BO3A 2YS6A 3OHPA 2ZPTX 1QSGA 4BEBA 2ISOA 5JROA 1Y37A 3EWAA 4I50F 4QNMA 3WRXC 4RW0A 4ENSA 2FZ4A 3MT9A 3U9SA 1SULA 4EGJA 1AKWA 4ED8A 1HG1A 2FCRA 2Z30A 3D6FA 3MB8A 3FMIA 3CH6A 1RWXA 1L7BA 5DB9A 2PK3A 2RGBA 5L1LA 4QATA 5K2OA 1CI4A 1KEZA 2Q5CA 3ANLA 3KCNA 1JRLA 2H31A 4MLCA 3V9PA 3GUUA 4EHJA 5BN5A 2XHZA 3QI7A 3G0GA 1SG6A 4PSCA 4YMTA 5ABPA 4GC5A 5CPBA 3N6RA 4ACOA 4Q01A 2JFWA 4FDLA 4PPGA 4X1IA 4X63A 1H0KA 3GNQA 3IURA 3VOBA 3SENA 1J5EB 2JJ1A 3K4QA 4AU1A 4X00A 8ADHA 1LX7A 3V8RA 3D0OA 2Q4OA 1VGVA 1U45A 7ICGA 1Z0UA 3GDGA 1XMPA 4FT2A 2WSBA 4JP2A 4KB5A 4PNHA 3CVWA 3N2GB 4QZFA 3EWNA 3AZPA 4M8SA 2EBHX 1N5DA 2M6SA 4G9EA 1NUSA 4P1ZA 3UJ9A 1XF1A 3VDMA 3Q5DA 5DI3B 2JRZA 1DL5A 4G65A 6ABPA 2P75A 2GO7A 3ON5A 3EB9A 4NYJQ 1M8PA 4I2BA 1KQGA 4UDNA 3FGPA 1JG3A 3IP6A 5EWLB 2QUBA 5JMTA 1B23P 4JUFA 2I4OA 3SG0A 1X80B 5IAEA 3LPMA 1JKIA 4WKGA 5SZJA 1LC0A 3SZ3A 1R5NA 1SBTA 4ANFA 3ED5A 1ES9A 3HV0A 3CRZA 4ED6A 3W8NA 3E8XA 4FD3A 1YDHA 3QWIA 5EJMA 4ELTA 1AKNA 2VZLA 2F9LA 4DHWA 5AI5A 2J3LA 1A9XB 1LNZA 2C29D 1PGQA 2PYDA 3L77A 3ODGA 4B9EA 1KYTA 1GPYA 2W6CX 1M6HA 4M83A 4MDHA 2CDNA 4CI9A 1M5RA 3RJIA 3PDHA 4B76A 2Q0XA 4PCAA 1YIDA 4NRDA 1SL0A 2BHSA 3BZBA 2WF7A 1BHO1 3E9QA 2W0SA 1QCCA 3LP8A 3B8HA 4MGIR 3I6QA 2PUFA 5ILQA 3N7RC 4GMDA 4OUDA 3AM9A 4P0PB 1IQRA 4ECQA 2WYIA 1HV8A 3FLBA 3O3NB 4HQOA 4IHJA 4POAA 4Y2QA 1CW2B 1BX0A 1WOMA 4XQCA 5ALMA 1NJZA 1THGA 3ANTA 3KEGA 4RDIA 4X41A 5AP9A 3UHFA 1M6VA 3B5EA 4FS8A 2WJVA 4HYTA 2A0UA 2CYAA 5J0PA 1GFSA 2VAWA 1YRAA 4O2AF 2W04A 3O03A 2W00A 3PFIA 3TTTA 4QZHA 3JASA 4MLDA 1NGSA 4MUBA 1LVGA 4LC9A 1LDGA 4FBMA 5C0YA 2KE5A 3FUWA 5TGZA 5BR1A 3MBYA 1X7WA 3EIEA 2GEFA 4G81A 4OQQA 1ZJWA 1IOZA 1M10A 2AZDA 4RVHA 3RTAA 3JX9A 1DJMA 1XA4A 3OU6A 4FOPA 3EXIA 1WBJB 3GARA 4PSVA 2QVCA 2FX2A 2QZZA 3Q9LA 4J9PA 4ED1A 2BR0A 4KXUA 1HDRA 4PAOA 4ZODA 2AH5A 5G1NA 1EFVB 3I3OA 5KAFU 4BX0A 4CG1A 1EM8A 5BP7A 4L6CA 5CM2Z 4DC0A 3UPUA 4I66A 2AZTA 4N49A 1DADA 1HY3A 1FNSA 1ZD4A 1S0VA 1J07A 2XUOA 3MG9A 4FLFA 5DYTA 5GVRA 1NI4B 1VE7A 4YC7A 1U7HA 1ZAKA 5LP6F 1E96A 1IAQA 3O8BA 5BV1A 1CSEE 4G85A 3TKLA 3ZKAA 3CLRC 1KDOA 1B8VA 1ZD9A 1QE5A 1RI5A 1ZGZA 2DT8A 2ZUUA 5T67A 1KSJA 1ZHFA 2XE4A 3IVMA 4RUAA 3I23A 1IPFA 2PO5A 2ZSDA 2FJPA 3MFHA 3T3EA 3QRWA 3OT5A 5DVZA 1KMCA 1ZLXA 1S76D 4MV7A 3S8EA 4PPXA 4CEHA 4CE6A 1NXQA 1OU4A 1BWPA 1RVDA 1TDJA 2BQ3A 4IZOA 2DFDA 4MAAA 3EPHA 1Y1RA 3V80A 3QYPA 4N7JA 4NU8X 4KYTA 4WLFA 4TKVA 3LDAA 1AQUA 3TMYA 4KDFA 2FFBA 4FGJA 4RORA 4B4VA 4CCWA 3H40A 4B3SB 2IELA 1WUYA 3R24A 1XR3A 1QSYA 5EN4A 5ESXA 3KKEA 2PBFA 4ZXPA 1PFKA 1L8XA 4IO1A 3TOSA 3FGZA 3QTBA 2X15A 1QYIA 5EWJB 5KNBA 4CT0A 1M34A 2GK7A 2ZAGA 1MB3A 1WLYA 1R0WA 2O7SA 1F06A 3PXGA 3RC1A 2I67A 3TQTA 2A1UB 1EXDA 1YCFA 3UXNA 4Y2JA 2ZTHA 4R8SA 4DCTA 4MV0A 4H7PA 3CVJA 2QZSA 5GJBA 3W5AA 1U3TA 3E82A 2GPYA 3KHUA 4RWEA 1R88A 3RUDA 3KKAA 1QLJA 4IUCS 4DYHA 3I2HA 4QU5A 1UBKS 421PA 1ISMA 5ENDA 4M9GA 2AGQA 5DE3A 4UREA 4U2EA 4QULA 3WZLA 5BRNA 1DBIA 3IEMA 3WNCA 1WHSB 3U40A 4I4NA 3L0OA 2YQZA 3TLKA 3X0DA 1AUOA 5LA6F 4EL5A 3IFSA 9GPBA 3ZGOA 1DIRA 2C7GA 2JCYA 1EGVB 2W8ZA 3ZBQA 1YBMA 4UTRA 1DC7A 2K60A 2Q3CA 3A6GA 2EWWA 1D0VA 8LDHA 1IUPA 1NXXA 2R68A 3NDRA 1JHDA 3SYMA 4ARBA 2JASA 3D4BA 1FDSA 1GGFA 3AZOA 4G3XA 2UVDA 1L5LA 1CF2O 3A4IA 2KSOB 1ODFA 4ED3A 3QU2A 2C8KA 2RI0A 2ZROA 5JCJA 3WIDA 3J81A 1MNAA 1SC9A 4DY6A 4KNWA 3R0IA 1JECA 1OKKA 2IVZA 3U17A 3H86A 3CLKA 5I9MA 1P9NA 3OU7A 1K5PA 1H4TA 4A8EA 4GUDA 3OKFA 3RE1A 4XUGB 1G41A 1BD3A 1LBQA 4J0DA 1DIOB 3TLGA 1U2RA 4E12A 4F6LA 4RC9A 3VNAA 4J49A 5KG0A 4KIGA 4YLEA 2NRVA 3PNYA 2PT9A 3NNSA 4I5EA 4A2CA 4PHEA 4WFKA 5ULLA 3D6TB 2UUCB 1N75A 1YVEI 1D5CA 1G6Q1 1DX4A 4CN8A 1NYQA 5IPFA 3U62A 2BGGA 3JQCA 3FA2A 3DDNA 1C2YA 3KZOA 4IZHA 3D2SA 1ATZA 3ZLUA 1KJIA 2NUAA 3DZCA 3WYFA 3RRGA 1FUUA 1KYIA 1TLLA 3EUEA 2EP5A 5J0WA 1DG9A 2PS1A 2QTWB 3GCGA 4IIDA 4RXTA 4EBBA 1LBTA 1D8LA 4HDMA 3OC0A 2D1SA 2Q62A 1N6RA 1QPGA 3ZE2B 4DR1B 5HBGA 2C1EA 3GLFE 2QD1A 4N03A 2CCJA 2WY2D 1DKOA 2X0NA 2JZCA 3RCBA 2VHYA 8ICLA 1VHDA 3O82A 3BQ9A 3WQQA 5B2EA 2C77A 4MIOA 1PJQA 1FC0A 3DOCA 4BX3A 3GZNB 3L3BA 4RFSA 3I1FA 4H9GA 3UXPA 1G7RA 1UM9A 2WAXA 2ZRLA 3AL2A 1VBNA 3ILXA 4EYIB 1YL7A 2FTKE 4K46A 4L1KA 4RLSA 3VJRA 5DGIA 1CD5A 1Z00B 4O3MA 3W7VA 3EVDA 1ZM4A 3ZZ1A 5E8RA 1T5LA 3JPSA 4AMBA 3HSKA 3KOOA 5AXAA 3U4GA 4IUYA 4J1QA 1O94C 3HM9A 2A9OA 4HQ0A 2ZZKA 4OEHA 1KEVA 3E1SA 3OPYA 3OHBA 4MR8A 4X64B 3Q3GE 4AAYA 5JNWA 1JMVA 1ZMRA 1JDSA 1N0HA 3FOEC 3HCPA 3VO9A 4YP3A 1DO8A 4IV0A 5E1OA 3GV7B 5DW0A 3ELBA 1WW3A 1VIAA 5H9VA 3HJHA 5E4TA 3UK1A 4FZ5A 3V48A 4NM2A 3JD0A 1IN4A 2XMQA 1QVRA 3RNOA 1CB7A 3RSCA 2Z1NA 1CRLA 1PJTA 1QHHA 3K6JA 4LE2A 4ND8B 5D2CA 2CHEA 4DFKA 1KBOA 3OZVA 3HYLA 3VVBA 5F23A 2RONA 3JWHA 4Y0VA 3V7WA 4BRZA 4WH0A 1ZRMA 2WM2A 3M4JA 1DGSA 3PXEA 4LBWA 4O25A 1UPXA 2KQUA 2YW2A 4G84A 1CHDA 1O9GA 5I7AA 4A03A 1HLGA 3C97A 2Q4DA 4PCUA 3ZOKA 3FKSA 4IC9A 1DMRA 3R5HA 4L3WA 3OPQA 1JHPA 3RJFA 2JCGA 2XGSA 1RP1A 3M6AA 4LJSA 1F1JA 3R3HA 4OHXA 5EINA 2DAPA 2VNAA 5IASA 3TAQA 5EE0A 2HTFA 1LLFA 5A9SA 5CLGA 2OXCA 5AHKA 3IHWA 3VZDA 2YFQA 3BRSA 3DVAB 1FTGA 2OSBA 5FLYA 3PC7A 1AE1A 3W3AD 3DLIA 3LHKA 4JJGA 1RE1A 4WOJA 3I5YA 4EGCB 1L8LA 1RFLA 3VAZA 2GBIA 4RACA 4LXTA 5EMHA 6YASA 5AKYA 4F3TA 1Z6YA 2Y05A 1KN5A 2YRWA 3JQBC 1XQYA 2NO4A 2IXEA 3DL7A 3PYXA 4KOAA 1QDEA 3LC0A 3MBOA 4MVWA 1Y82A 2GKSA 4GFDA 4N48A 4LQCA 2PGNA 2B21A 4RADA 1Q91A 3BMNA 1UKZA 3UAWA 3ZI4A 1NP3A 1RPLA 1NJXA 4FOLA 2JVIA 3DXXA 3E7DA 3OZAA 4FDMA 3TJRA 3V42A 4XVCA 4DZRA 5B57C 5E9QA 1GR0A 1XF9A 4RVUA 5IC6A 3W2IA 2B30A 3QKRB 1E3WA 1QUEA 4U4AA 3U3MA 5LBUA 4QFMA 2X8WA 3DPIA 4GI7A 5CRIA 5A1JA 1OA1A 2B34A 1PVRA 4OSPA 4RHYA 4TWJA 4TVSA 4EZEA 2DF8A 5AM5A 4QARA 1YOVB 2AG1A 5ESDA 2VZ8A 3THRA 5H1YA 2CXPA 5JHHB 1VI2A 2YOHA 3ORSA 1HIWA 4KIFA 1UIRA 1T13A 4K81B 3DDWA 3GELA 4FNMA 1ZQYA 2DPXA 3NATA 2C95A 1N6KA 4FYMA 5CA0F 2K2WA 4EKGA 2NP6A 1PK1A 1JDUA 4R65A 2BHRA 5DNDA 2BVNA 1FS4A 4H15A 2VT3A 4RLHA 5FR1A 1XNQB 4CCHA 3M6XA 4EHIA 2XOKD 3CW2C 2BGIA 3PI6A 1QGYA 5JVDB 2V54A 1BROA 2JJQA 4FMDB 4X3CA 8ICUA 3TR6A 3AETA 3ZHOA 4RGQA 1SVNA 3ZU3A 4OXNA 4PYNA 2SKEA 5KOYA 1U9IA 2ZAOA 4D9HA 1SHLA 1LPBB 1NF3A 1V4NA 2JZOA 5KI6A 3V32A 4DL9A 2DECA 1ZNQO 2UZ1B 1XPRA 3UO8B 3JQAA 4FGWA 4DL4A 2BGUA 4JHLA 4US0R 3VMMA 4O2AB 4AJPA 2OG1A 2EL7A 1KJQA 5DCYA 1Q0QA 3HJAA 5LMCA 1QNLA 2VK1A 3U4IA 5CJ2A 2ETXA 2EZXA 1QGED 3FGOA 4U2CA 1UKVY 1BTOA 1YJ5A 3QEMA 3D2QA 2AW5A 2DT5A 2JGLA 2RAPA 3PEFA 2CE7A 4KQHA 1ZQAA 4XJSA 4QXOA 4MFCA 3OJCA 4PXSA 3I2KA 3RTEA 3WHPA 2WYVA 3N7UA 5KQLA 1ZN8A 1EQAA 1GV0A 2RGEA 2EEZA 3ENKA 3GCWA 3OZTA 4ZOBA 1OHHD 4LYGA 4X0EA 2QUJA 1RZTA 4RNMA 1BRTA 1XWFA 3O4RA 2HADA 4ZOCA 4GPBA 1EFRA 1G98A 3HVJA 4FHEA 1YTLA 4H59A 4LNAA 5C7IO 2HU2A 3KUUA 1PR2A 2Q4BA 5DJ5A 5DGTA 5BV7A 3LPDA 3UJPA 1F4LA 1ZXXA 1H5QA 5SZIA 5A4FS 3ANNA 2PZGA 5DK6A 2Q1TA 4BP9A 3TUZC 1HI9A 2CL6X 2ESEA 2GJKA 4QQKA 4X8LA 5SZKB 1FK8A 1E5XA 2IPNA 1QGOA 4KK3A 2VCEA 1FFHA 2VKTA 2PR2A 3U09A 2QPLA 3K9FC 1MC1A 2CDBA 2EARA 2PMEA 5C8DA 2Y71A 4QOGA 2FFAA 3EHEA 4HQNA 1LD3A 1A7AA 5JQWA 3W3ZB 4HNTA 1Q1BA 1WTCA 2JCSA 2QK4A 5AWFC 3RSQA 5HFNA 3GPLA 3VZBA 4ASUD 4JJFA 2PS9A 4RGVA 3TNDA 1NYLA 1ZH4A 2HO5A 3VYRB 3P0JA 4O1IA 4JMUA 3I12A 2WUEA 1Q83A 1TUGA 3WSWA 3EJ6A 3ZX5A 2I6SA 3ZDCA 4M9QA 1M1NB 1N7HA 2HWKA 4YMNA 2C94A 3NB0A 3SYKA 2AXQA 4C9BA 4Y2UA 2XRZA 5A6SB 3LDGA 4BFWA 3ZTYA 1JGTA 3ISBA 3EXEB 3Q8PB 1TX4B 2W70A 4FD2A 3LOPA 2O7QA 4JQSA 5TLSA 2A0XA 3L4KA 3OQHA 2YB1A 3K30A 1COWA 3I3SR 1GQRA 4F5EA 2XWSA 3JRWA 3NFRA 1HRKA 2CXNA 4O5CA 2HFKA 3LYUA 4KR9A 3SJZA 1UBHS 3THWA 2ZRGA 4QXMA 4MSUA 4U63A 2GXUA 3BWVA 1D2NA 2OQ2A 2Y0BA 2QRLA 3W6OA 1VBMA 2G8LA 1VA5A 3BJYA 4JA2A 3C29A 1JVBA 2J9GA 3AU6A 1W44A 3KKNA 2P77A 2QT0A 3K09A 4IIXA 4ZV4A 1M5UA 7ICSA 4QECA 4AN0A 2VP4A 1BE6A 5KDOA 2H3FA 5BT9A 1SCBA 2ADOA 4MW0A 4H7HA 3LLUA 4XARA 2X0FA 8MHTA 3SU8A 4NK4A 1PV1A 3G9TA 4MRPA 2WJHA 3LWMA 3NBQA 3JYLA 1XELA 4GLFA 4MKHA 1XTBA 2ECKA 1OGYA 2GD2A 4IBOA 2V4ZA 5B1YA 4IMIB 4K87A 5L3ZA 2F44A 1JQBA 4X1IB 1PSWA 2Z8XA 5F76A 2LYAA 2H5JA 4Y30A 3BAFA 2YWBA 5J5CA 4DE5A 5LKAA 3QEMB 2P6NA 4OK6A 3S6JA 3TIFA 4LRUA 2JFQA 4ZU3A 2PJUA 3GZFA 4TLCA 2Q3EA 1EX7A 4DF8A 3C3BA 2VPPA 1FSSA 4X1KB 4I1PA 3UKDA 2A86A 3WWCA 5JWOA 1TW2A 5LN1A 2OO7A 3D8TA 3RAEC 2M9MA 2P69A 5FPYA 1ZVMA 4OJQA 3IXLA 4H7KA 3GLQA 7ICKA 1U1EA 2KI5A 5I6DA 1K1EA 5CB1A 2PSJA 2AI3A 1YQTA 4C0LA 4MHTA 3IQEA 3UXOA 1NVMB 1LPAB 3CXRA 4FCCA 4IFIA 4RD4A 5KMGB 1Q1AA 4BWFB 3MQFA 3NGLA 3PGLA 4EATA 5CMLA 1HF3A 5D87A 2R97A 1XRNA 1UJ6A 4XYEA 2H3IA 4B3CA 4D9NA 2RGNA 3IPCA 4ND6A 3AJ8A 3QEKA 3BFVA 4RANA 4KLSA 4C5CA 4NLCA 5BPCA 1VCNA 1ZQBA 1HC7A 1KSFX 3DBRA 4OXQA 5AVQA 1M2OB 3RYCA 3IUSA 2JNWA 3E8MA 4RUKA 4IRKA 2G04A 3K8OE 5JCJD 4EJSC 1PR4A 2G8NA 3B53X 4IIEA 4M46A 3ZS8A 1SHTX 3KFLA 2P90A 4QASA 3BQNB 1ENZA 2DX7A 4CLHA 3PRHA 5KFAA 5DB7A 1NUHA 2YIJA 4P7JA 5EXSA 5KREA 1X6VA 1O9HA 1OOEA 5B1HA 2WM9B 3QVKA 4DOCA 1I7NA 4OHMA 4BC0A 4CKEA 1C9NA 4TZ0A 2NUBA 3B5JA 1BMQA 1I8TA 3QE9Y 2QM7A 1Q2UA 3CF2A 2PUAA 1G21A 1S02A 2PUCA 3I61A 2FLPA 3M34A 2Q2OA 4BV9A 1IEQA 2WJ6A 3KJQA 1MSWD 1SWVA 1EUYA 1RYEA 4G0PA 4DXDA 3TXAA 1E1CA 3A4TA 4MS1B 5CCXA 3JU3A 3SF8A 5U4QA 1VLJA 2WTEA 4G23A 3G79A 5DTMA 2FRDC 4CW7A 1CY1A 1Z12A 3ZNNA 3KHKA 3REOA 4D8TA 2ENWA 3TQIA 2C59A 5HKAA 5LMZA 1A8PA 1PR3A 4I3FA 2EJBA 5KCMA 4LX0A 5J2UB 4ER0A 4BNHA 4NS4A 3SS9X 2XB6A 2AYZA 4JA0A 2VA3A 1R5BA 2H2DA 4A15A 2EYUA 2EW1A 2FN3A 4J1TC 2CJWA 3IJPA 4E11A 3T5JA 2PQ2A 4MDFA 3ICCA 4XXHA 1WZ2A 4N7MA 3GRZA 4WA8A 1SUAA 4D0GA 3U7GA 3FNBA 2PL3A 3IAS6 3SM9A 2FSGA 3O2NA 7ICJA 1L7RA 5KFNA 5E7MA 2REOA 2LIVA 1UOEA 1RLTA 3LK6A 2DWCA 5IZCC 3F5EA 4OBEA 5K3DA 2IUYA 4X84A 2YCBA 3KSMA 3ELDA 4S1OA 1VL8A 4UD2A 4XUEA 2AUNA 1T2DA 1GTZA 1PL6A 3OEEA 2XEDA 1ISJA 3L9XA 4JOQA 4MUHA 4BRWA 2X0JA 2ZJ1A 4DWWA 3H2IA 4V0QA 5KFIA 2VBCA 3PHIA 3MS4A 4TT3D 1VBKA 5K7SA 3AIMA 4F4WA 3ULKA 1BXZA 4L74A 3ESRA 3FCUB 3QLUC 3MC1A 1EK5A 3TRFA 2OXEA 3ZXXA 5IJ0A 2OHXA 2R60A 4YIHA 3TXXA 4RPZA 3M49A 4XVRA 8ICHA 2VF8A 3R7WA 1IM5A 3OLWA 1JJVA 2CD7A 4U7GA 3SEZA 4GKJB 3E27A 5KYNA 1JB9A 4FGUA 4WJLA 1YBHA 2F1OA 2Q5HA 3OZEA 4QRDA 4YCXA 1SZPA 1DEOA 1QFXA 1XZGA 1HZZA 2GAAA 2DHEA 2AJTA 2VNSA 3KBOA 3KT8A 1Z19A 3DFMA 3NW9A 4GQIA 4MUKA 3PNVA 5I9BA 3NUQA 1TGVA 2RAVA 4QELA 4CDMA 4MPJA 4OQ4A 2A3VA 3ZWKA 4L0DA 3NWBA 1VMDA 1GPH1 2PQ0A 3D6HA 4RCYA 5EPUA 2Z6UA 3S2UA 2ATLA 2E48A 1A4RA 3C3JA 3IM1A 2WD7A 3KJIA 3OE1A 3G2HA 1L5KA 3EPGA 2ZB4A 5AFSA 6NULA 1E7RA 1V3QE 3DTNA 2I78A 4G5HA 3ZY3A 1N8TA 2QRQA 4PVDA 3ZWMA 5C46F 2E87A 2QTMA 4YXWA 4RK5A 5DHUA 4RKRA 4IH4A 1KE1A 5CA0B 5EKTA 1RYHA 1CUBA 2XCAA 3PXDA 4RD1A 4RNDB 1CK4A 3DOEA 2IYLD 4QPNA 3BDAA 4OUKX 5F4BA 5KHOC 4MPTA 2CEKA 2EBFX 4X5VA 2VZ9A 1WSAA 2CFRA 3GBVA 4H3HB 2H08A 3MXOA 2HHAA 2G77B 4B81A 3AVXA 2QTZA 3D2CA 3VKUA 3K1ZA 3ZKWB 4TKUB 4J07A 3H17A 1LPOA 1P77A 1T2CA 4MV3A 2TMYA 3DMRA 3JS5A 5CLLA 4TSKA 5JC8A 3VR4H 3NHKA 1K6XA 5ICSA 1UL1X 2VNJA 3CCBA 1XAGA 2XV1A 5FYDA 3TRDA 4AUEA 2MYNA 4GFJA 4TQAA 1QZUA 1T8WA 4Q16A 1EBFA 3NC1C 1ZXLA 4OQNA 3JQ7A 3JD2A 3A0BU 2AN9A 4AKHA 5KFDA 5F5LA 4FFLA 3TSCA 3B52X 4GRIA 2JFHA 1USKA 2XF2A 2B4TO 2KIWA 1BHSA 1NMYA 1RTTA 1CBUA 5F98A 3NLLA 2HLDD 4BJ6A 1X8JA 2RK3A 3ESZA 4FYYA 5C51B 3WGJA 2IYUA 1LKYB 1MPTA 1RAHA 1US8B 3B8EA 3R09A 1I2CA 1LSUA 4S3MA 3TPCA 1GRCA 1QRSA 4EYKA 3LY9A 3OICA 3TZQA 1M54A 9ATCA 1F4VA 2NXWA 3NRBA 3KKPA 2UU9B 3EMVA 1R0SA 1TZCA 3SK0A 1ZQZA 3N8GA 4LMPA 3R77A 4HBGA 2Q49A 4FINA 3UVEA 3V9AA 4E5MA 1RYBA 4EENA 3B9BA 5ALIA 4EBEA 5K8TA 1T6XA 1UWVA 3KHLA 1I3NA 3DLTA 4J4BA 3FVQA 2XECA 3SZ2A 1T8EA 1R8XA 2FX3A 3I92A 3HTXA 4TURA 3HU1A 1FBTA 3GZ4A 3T3IA 4URWR 2GBGA 3KKAC 2ZYRA 3GJ4A 4BNIA 2W6JA 4OJOA 3IT1A 4ENTA 1SKUA 1P0IA 3AINA 3I9V1 5JJ5A 5LIPA 5FTKA 4ZYZA 4E4YA 5AK0A 4GKKB 1PWZA 5KG6A 4NBUA 3DJFA 4F4CA 4K88A 4HUQA 4QGFA 1J25A 2H2GA 4MVCA 2JFBA 1P62B 1H2WA 2P0YA 3AEKA 4IIBA 4XVHA 4RDCA 1E1QA 3SBXA 2IX3A 3CW2A 1MJGA 3EZ2A 1V48A 4JYMA 3STYA 2ZJ6A 1KPIA 4MMYB 2C3PA 4Q1FA 4E5KA 4NBNA 1AN0A 1ZW6A 1Y4SA 1GN9A 4N9WA 3WRWA 1HDYA 4WCFC 3VR5D 3EULA 1QHHB 4N7RA 4ND8A 4OKIA 1T0HB 2BPFA 3AL3A 3UAOA 5A4IS 3IMGA 3GFGA 4KRYA 1P39A 5E7QA 5FH9A 1JSXA 3M5DA 1UXKA 3AR3A 3DEYX 1Z8DA 3FNFA 3G1TA 4YMMA 2QLLA 3BM5A 3UGJA 2VDKB 4FR2A 2HGZA 4LRQA 4QDKA 1E63A 2J6BA 3D0QA 2ZIZA 3WHLA 1NJSA 2FLNA 1ZDMA 1R8JA 3OQVA 5IARA 3WWOA 4CTNA 5ALTA 1XYGA 3DNPA 3ORFA 4IJ6A 3MS2A 2JATA 5AO9A 4B35A 1EEXB 2HC9A 621PA 4DMCA 5LQUA 3FDZA 3SQXA 4GWKA 4H1VA 3SZUA 2XMDA 3UC5A 5A02A 4CF4A 3FNRA 3RYHB 2LE0A 3SQWA 5C8XA 1NVAA 4Y1FA 1ISPA 4K6GA 2V5UA 4BFCA 4PJ0U 1AUXA 2GUGA 2MINB 3K32A 3WQRA 1EVYA 1KJ9A 3BIWA 1P45A 1NIPA 2NIPA 2PEZA 5FJIA 3FRHA 1V8ZA 3W5CA 1BDHA 4G0NA 4AX4A 2CK3D 3TADC 3QZUA 1PL8A 2C3MA 1TC2A 2BD0A 3NT2A 1BS2A 4G24A 1Z3EB 1JYEA 2X40A 4MEJA 5I01A 3NH6A 1UBTS 4TV8A 3TL3A 5KNDD 1P81A 2XTAA 1QF7A 2HK8A 3QXJA 4JEMA 4DANA 4EF4A 1CQXA 2CRXA 3L1IA 5HWSA 3R9XB 4ILKA 2KBEA 3GDWA 1JQAA 2B36A 2GN2A 4P2GA 4AX8A 4J9RA 1PQ4A 3A1DA 3L92A 5A2GA 2EAUA 3VVCA 4KNYA 3WK9A 1QQ7A 1P0QA 4PHFA 3WHKA 1PZXA 2PCJA 2XXJA 3C23A 3JWIA 1GCIA 3DTVA 4M9ZA 5J0TA 1U0OC 5IMBA 4AZ0A 2QRUA 4DPKA 3R0JA 3CLTC 3AF1A 3EGEA 1AN9A 1LV7A 3GWGA 4PZOA 5H83A 1XMXA 4BMZA 3LECA 4MEAA 1Y7IA 3ZVMA 2X7HA 2ZRIA 2P8SA 1Q95A 3EGWA 4HTAA 9ICXA 2O3SA 4RZHA 4YFVA 1SCQA 5F3RA 2UYOA 4G5RA 3TRJA 3SQIA 2F1IA 1E2QA 1NUQA 1ACMA 2A9FA 5AJXA 3LBIA 4GYWA 1O87A 1E6UA 1N9GA 4OHWA 4W8OA 5FNZA 4S05A 1HURA 1ODCA 3NR2A 3HS3A 3EZ5A 3H11B 1LEHA 1Z8NA 4I5DA 4LTNA 2FP4A 3K72B 4KX5A 2H07A 1PN3A 5HCNA 3QUQA 1ODSA 4MKXA 5EZSA 3BQ7A 1K0UA 3Q0IA 4MR8B 3G6YA 1SC4A 2DTEA 3EYWA 3KKOA 3KFUF 1U04A 4JP1A 4KOEC 4MZXA 2WWVD 1JXOA 4W4TA 3ACDA 3HBJA 5MN5A 1A6SA 4WZAE 3VPBA 4S04A 1JKJA 2OQRA 1Z25A 4P8RA 1B8PA 5IDVA 4BKUA 3HKBB 2XRMA 4WBNB 2XUJA 3QE2A 3PW5A 1N8NA 2CLCX 3SMVA 4QWCA 3KU4A 5G3YA 3AJEA 4E32A 2VJPA 4ZMSA 3JZDA 3SVTA 1O0BA 2R8PA 4K9SA 1AIPA 5GINE 2WIAA 4BFXA 4GC7A 9ICAA 1TLTA 4AJKA 4B6GA 2CXYA 1M34E 2OOKA 2D1TA 3D5EA 3EIOA 3GLFB 2HT1A 1P33A 2W2QA 4JBGA 3H13A 3AM3A 2BMFA 1G2OA 2D3DA 1BEUB 2A0KA 4JVOA 4OHBA 1GKLA 1C1HA 4E70A 3U1VA 3F97A 2J07A 1UBOS 5D4BA 1FNBA 1VCMA 1OAOA 2EKDA 3ENNA 4FLEA 4WPGA 5AVZA 2XBMA 2HVIA 2R8RA 3ABOB 1L3VA 3ZBPA 4WFIA 5CM9C 5HIIA 3FOBA 6Q21A 3CF4G 5GVSA 2AR7A 3H18A 4LCEA 3RPEA 2C31A 4GZ6A 2IOYA 1SG0A 3BMXA 3TLMA 1BGWA 1EE1A 1Z7EA 5E0OA 5TR9A 1F14A 3HSYA 4K9LA 1PF7E 4YMVA 4NH0A 4KGDA 3NC4A 2Z0MA 4M0PA 4TLDA 1GRVA 4RY8A 1WIWA 1X1EA 3OZRA 4U0KA 5J58A 3GDHA 5FOXA 5DNYB 4N6NA 3WRXA 3HVRA 4MPRA 5TQJA 2YQEA 3INYA 3OX1A 4K8OA 1I2BA 2PIAA 1B8UA 4MWSA 5IAKA 1X9MA 1FYWA 1WB6A 2R751 4P4GA 4PHHA 5HE8A 4B71A 5ICCA 1QP0A 3ZE8A 2JHDA 4HFNA 2VSOA 3PQ7A 3IR7A 5T3UA 3USES 1W4CA 2NU8B 5JALA 3VU0A 3E9RA 2PAFA 1JAZA 5FHRA 2NV2B 1YE5A 1FA9A 5C7LO 3BG5A 4LTMA 3Q7PA 3GUVA 1XALA 1TTQB 3BCRA 1WZNA 2XYVA 1A5AB 3DFZA 3P2YA 2O3JA 1J0AA 2HLDA 1N57A 5KYUB 3VNVA 4C30A 3M0EA 4I55A 4KQKA 3CH7A 4CCYB 2ZI5A 5KAPA 4Y6LA 1I2DA 5B7QA 4BV3A 2F1KA 4ESEA 4CMHA 4EA7A 4M9CA 1B93A 2WA1A 1U7PA 1RI1A 4B9UA 1IUNA 4J8PA 2E1EA 8ICCA 1Z2CA 1UMBA 1VSVA 2LZ0A 1GFZA 3ZV7A 4B6EA 4B40A 4ZEMA 5TGTA 5JH7A 5L4SA 1V35A 2NW6A 5KC8A 2OHHA 4D25A 2PL9A 4L0QA 3BQTA 1C4WA 4QZIA 3KTFA 1FU7A 3RK1A 4A2QA 1M1UA 1RR6A 4D0RA 4CKCA 1D9FA 5ILGA 4OI1A 3K0AB 4RENA 3V6LA 2FPGA 3RH5A 2DPJA 4OBBA 5GJWC 3PHLA 2W6JD 4YPFA 4EO4A 1LI4A 4LZOA 1TCUA 16PKA 3TSAA 4G56A 3NP7A 3PE3A 5FFFA 3VR6H 3NETA 3P9XA 3BB1A 3EPLA 4B9SA 1H2EA 5B36A 5KG4A 1MQ9A 2JLRA 1QIIA 1OUQA 3DV9A 2WAQF 1NXWA 4L9SA 3ICEA 4KTQA 2O19A 3PC2A 4LOJA 4W7HA 4DCUA 4OAQA 4X20A 4INJA 5BUZA 1ZA1A 4HYYA 3N7SC 1M6WA 4ZV9A 1DCKA 1M0WA 4GVXA 4Z9XA 3WAGA 3E5RA 1RLOA 1FZTA 1Y9ZA 1NW7A 5F51A 3VU9B 4TV9B 1R8YA 1XN1A 2KV2A 3OQIB 2LKYA 4GSLA 1NQUA 1XKLA 2LW7A 2CMDA 2JD0A 4FZLA 2PV7A 3BL6A 2ISSD 3JQ6A 4KUGA 2EATA 4WEQA 2R4QA 2P1ZA 3OCXA 1QE0A 4MUAA 4XPZA 1NDHA 4PTYA 3LE8A 5KG2A 3R9IA 4NJMB 2B4AA 4X6YA 5ES3A 5JQGA 5K01A 4AQYB 2HHVA 5LA6A 1H66A 1B6RA 1HL3A 1R16A 1OR8A 4R5HA 3B78A 3UT6A 3T79A 4TTJA 1RHKA 1F8FA 1KRHA 4P7KA 2HU8A 4ZGWA 4OJNA 4MW4A 1HE1C 4J0EA 4UXHA 5JBIA 3GQCA 3G49A 5BWNA 1HR0B 3ZEIA 1NTRA 1SHKA 5CIWA 4KXFB 1OZAA 1U1CA 1G5QA 5EMMA 2Y4OA 5HZKA 4OHUA 1DGJA 5L7YA 5AOCA 3ZN2A 2BN4A 2C8VA 2OCXA 4JJ8A 2ZJAA 4UXJA 4WOCA 4MF2A 5KFSA 5C31A 2OQVA 3X2FA 1V1JA 3N0XA 1N3LA 1DQYA 3KDSE 2HSZA 3R20A 2P27A 4TMXA 1XL1A 1Z3IX 1PSZA 5IKEA 5JY1A 1A9YA 5CT8A 1B8NA 2EX0A 3BC1A 3M2TA 4OQEA 3BFJA 2B69A 5A04A 2EZTA 4GPZA 3IUEA 4PZCA 4W5TA 3BULA 5BUQA 3FOZA 4I2EA 1Z0DA 5FPTA 3FTQA 5ICEA 5AJWA 1J2EA 3M9MB 4JV1A 1JHMA 3SHQA 1UC4B 3O8OA 4KK4A 5DGHA 1GGEA 4DGQA 1L3SA 3DT9A 5BNTA 2E8OA 4NJ8A 1YJQA 4KQGA 3LAWA 5AH0A 1JBKA 4C01A 3ROGA 4EQ6B 5IJWA 1LS1A 1QHXA 4Y2VA 4NU6A 4DA7A 1KS2A 2H52A 4G0VA 5CYOA 4U9IS 1CZKA 4EMSA 1PFWA 3WB0A 2P7IA 2RKOA 4HGRA 4OY3A 2IBMA 2O14A 4NKRA 4QXAA 5TRTA 4DMMA 4QZVA 5ICMA 1WUIS 4RHTA 4QSMA 4HN9A 5HKOA 2BFDB 5BNWA 1P8AA 2JGFA 5G0TA 1BVYF 3BMOB 3W1WA 3FE2A 3DO6A 5J5VA 5FUMA 4MEXA 3SN6A 2HHSA 1X87A 1CB0A 1PNTA 2I0FA 5EIFA 3C4VA 1B0ZA 4C4TA 3DHNA 3JALB 3OTGA 1GNLA 4FXOA 3TZEA 4BVEA 3CONA 1FDIA 2IZ6A 4ZO9A 3RT7A 5CB4F 3WGIA 5TT0A 4QLOA 4MIEA 3REFA 2Q0SA 4NL4H 1BCRB 1UPAA 2AC2A 1A2QA 4TS3A 3REGA 5K3SA 1KSGA 2VTEA 2CB9A 4CLOA 1ZUD1 1JKXA 4NNJA 4PPYA 4WNCA 5DI9A 2Q5JA 2C2GA 5E6UA 4YVZA 4JB2A 4Z0NA 4WNIA 5HM6A 4R1LA 3TM5A 4HNSA 2KSOA 1LWNA 3FETA 1CF9A 1M72A 2C42A 4X5OA 3UFXB 4GLBA 3R3VA 5D1HA 5AUPB 3VDRA 3BILA 3EDOA 3GEMA 4PHGA 1A96A 4AZ3A 1ZRSA 3ZW9A 3TSZA 1P1IA 4WFQA 2J0UA 2V5VA 1YDEA 2ZETA 4DM7A 2H9IA 1DQPA 3REQA 1JB1A 4OLHA 3ZHUA 2A2ZA 5LP1A 2GBLA 3F74A 3GEGA 4IR7A 4WXHA 3T99A 4ETWA 2HW8A 3ZIDA 3COZA 4KUEA 3OJUA 2FETA 3T0GA 5A3JA 1ECLA 1IWOA 1Y3CE 3HU3A 2H2HA 1QGZA 3THYB 4YD2A 1EX9A 1U90A 4GZLA 4GPEA 4NP6A 3PFGA 1Q21A 5L1JA 1U9LA 2VRCD 3PXBA 1EVJA 3H4DA 2IHVA 3G0CA 4DL3A 3N74A 4ND2A