2ZIWB

Crystal structure of the mus81-eme1 complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
318
structure length
228
Chain Sequence
b'KHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRVEEPTVLVLLRAEDITAKTAGKSLVIVDQEKSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRRIGPELSRRIYLQMTTLQPHLSLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 48
structure length 228
sequence length 318
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziwB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ziwB01
4M6WA 2ZIXA 2M9MA 4BXOB 2JNWA 2ZIWB 4BXOA 2ZIWA 1J22A 2ZIVB 2ZIUB 1J23A 2ZIVA 1J25A 2BHNA 4P0PB 2ZIUA 4P0QB 4P0PA 2JPDA 4P0QA 2A1IA 4M6WB 2ZIXB 2BGWA 1J24A
chains in the Genus database with same CATH superfamily
1XQVA 5CW2A 4GOKA 2XGMA 2UVPA 2ZIAA 3OZIA 3UFXB 1NLUA 2FE1A 5KG1A 3GFTA 3EEQA 3BRWA 4LHSA 2JEFA 1PQ4A 1D5WA 1CK4A 9ICUA 1H93A 1B0XA 1B8PA 2F1HA 3OHBA 8LDHA 4DYVA 3LVFO 4MVJH 3L8YA 1LKYA 2BZ1A 1THMA 3LPDA 5ALPA 1EJ6A 1YQWA 1J2RA 3GO4A 2ZS8A 3ZE0B 1Z8NA 5HKKD 3GEBA 1B6TA 1PUXA 3PC4A 3JQGA 4GMKA 5LD2C 4BWGA 1CXZA 2CVOA 2D5BA 5AKKA 3DVRX 4HNSA 1CUIA 2XD4A 4G0UA 3I58A 1NVXQ 3B89A 2NU7A 3UWSA 3CH4B 1WVGA 3JASB 1O6GA 1QLWA 2EKPA 1QKJA 3DL0A 4QZGA 1C7IA 2RONA 3LDAA 3VSDA 3V4LA 4CLOB 8ICVA 1BHO1 1W35A 4C7JA 1YKSA 2FZGA 5K45A 2B37A 1QRUA 3STVA 3IOYA 1VL1A 1TVKB 4TT3A 5J59A 3BMCA 2HT6A 4CM8A 4KRFA 4PRYA 1Q0QA 2P5SA 2VP2A 1P17A 2IQ5A 2YKGA 2D3DA 3PDJA 3U56A 3BC1A 1GLGA 4NH4A 2NYAA 2P35A 4BLSA 2GCEA 5F9MA 2KTQA 5DM0A 3OQJA 2PE5A 3SD7A 3JV7A 3LOUA 3BWCA 5IN4A 2IP2A 2ZKLA 3DBLA 2C5BA 3DTVB 1UDWA 3KWLA 2HWWA 2L0XA 2P66A 4MW6A 4PBRA 3ROTA 2HK6A 2X1MA 4LYDA 5KQMA 1KL9A 3MCZA 2CVZA 3COJA 1TL7C 1G38A 1W5FA 5FOWA 5K3AA 1YS2X 3A6JA 3COZA 1GDTA 2ZT6A 2J6CA 3ZCQA 3QFHA 2NRXA 4JBXA 2ZXHA 3B5IA 2P4EA 1DRVA 2AOVA 2YWXA 1W93A 2JNWA 4RQ3A 2I2WA 2B1RA 1GNRA 4KBFA 1P4GA 3ITDA 1V9CA 5JBQA 1U7UA 2JI7A 1RWNA 3RARA 4QATA 1JQ5A 3WRYC 3L2OB 3RU7A 3P32A 2L42A 2HLDD 3F8WA 4I4TF 1QO0A 3GLQA 2XNCA 1MP0A 1XDWA 4C06A 2XV1A 2J6UA 4R40A 1H4TA 2K4IA 1EWQA 4P0QB 5EVJA 2XR1A 4GT1A 1N1MA 3GNLA 4MB2A 1V2HE 4AYBC 4O9MA 1W76A 3EGCA 3AX6A 3L8FA 2KM1A 4KLOA 2C5SA 4YX9A 2FMXA 2FGJA 2B2XA 3EF3A 3TNFA 4GRIA 1V16B 4AY3A 5EHZA 1X8KA 2H7YA 4QKQA 3URKA 1JF8A 2Q3DA 1ZM9A 1KMNA 1GWNA 2J5XA 3KXKA 1Z6PA 3CKLA 1ULUA 5K5EA 1CI4A 4WKOA 3GYGA 1NYRA 3NHPA 3UQ0A 2JJ2D 4ZZ2A 4QQNA 2HM7A 2GEVA 4EPRA 2R1TA 3BF7A 1N2CB 3U61B 3QMVA 9ICNA 4MRRA 3ZCSA 2EX4A 1JU4A 4FGUA 1ORWA 4C5AA 2ATIA 2DX7A 1C30B 3FZGA 2IZ7A 3FPHA 3UVEA 1F8FA 2AN5A 4ZZ0A 4DFDA 2QGFA 3O1JC 3ASUA 5HZGA 1MZVA 4M1OA 4WJ3B 3OQIA 4HEA6 1M2OA 3VYWA 5FJIA 3VPCA 4PGQA 3VDNB 1Y34E 4YRJA 4IMPA 1ORHA 4F12A 4GPTA 3HU5A 5TJHA 2IPXA 5CT8A 1CUHA 1L4UA 3DV2A 2EBHX 4YXWD 4KMUA 4XFDA 4MF8A 2PFGA 2CXYA 4C7VA 4LJ9A 2JB9A 3KJHA 3C39A 4TL6A 4D74A 5A71A 1T8YA 1G5IA 3TCNA 1YDEA 2W2QA 5A04A 1B0AA 4DSJA 4UCQA 1WXXA 4CN8A 2O2SA 1MLDA 2FY8A 1CZRA 4HSGA 4HSEA 2PH7A 3EMDA 4R0MA 4B6RA 1U2TA 3F98A 3OX1A 1IXZA 1KYQA 1G2OA 4U2DA 4JEIA 2WPDD 1UXHA 1E99A 4R8KA 1U7TA 1IPHA 1RHRA 4OB6A 2DB3A 1QFZA 3AHHA 1XMIA 1Z12A 1YZGA 1DVRA 2CLFB 4OIFA 2HRBA 2H1LA 4Z6DA 2VP6A 4YMUA 1GA4A 3WIVA 3RAJA 1K4YA 4B3BA 1J21A 4CIBA 4OFXA 1QFYA 1LQUA 4Q3EA 1SKUA 3TH5A 4YAKA 2OLEA 2XKBA 3PIIA 3D3KA 2BPGA 1R6DA 5FAKA 5I7SA 3C28A 3CLRC 1FSPA 1JI7A 4K1LA 2JZNA 1TRHA 4KQWA 4OSPA 1AU9A 3A6FA 1ZMOA 4Z7QB 3AKDA 5EP2A 4MK4A 2IW1A 5C8DA 4F3YA 2NT3A 4IRUB 4B9VA 7ICRA 1UEXC 1AHIA 1SY7A 2FXIA 1RCUA 5GP1A 1L0BA 1EG7A 3DEYX 1OREA 2IDMA 4XTRA 1V43A 3W90A 3NVZA 3PLNA 3SKXA 4EBCA 2E1FA 3NC1C 5B3JA 1SXJE 4KUGA 4IEEA 2F4VB 2JGNA 4AYWA 4D9CA 2Q29A 1GVNB 1OX4B 2VWGA 3ICXA 4LRSB 3PHBE 4FJ0A 3CEAA 1Y5NA 1ORDA 4F5QA 4NCHA 2QN3A 5KYXB 3C3CA 1RI1A 4H18A 1UZAA 4H60A 5EKTA 2C5GA 4KG7A 4HG2A 2XMZA 1I7LA 2G1PA 3U1VA 5KG7A 1AKVA 3OFJA 1QB8A 3AI2A 1A7KA 4MI9A 2ZIZA 3SAHA 1YZHA 4OHVA 2WWFA 1U9JA 1FY2A 3LCCA 3NASA 1KSFX 2C4KA 1WXFA 3U3OA 4J91A 3CB2A 3AZOA 1X7ZA 4CJXA 4CT0A 2J09A 1Y3AA 1FDSA 3BDAA 2HA7A 2RC5A 5EUMA 4XSGA 2UXBB 2HMYB 1KIMA 5D85A 2EFJA 4FZJA 2PRKA 2I6FA 5EZ6B 4I2BA 2A14A 2LHTA 3X1DA 2OCAA 2MMGA 1BX3A 3T7CA 2QNRA 1JAZA 1G1MA 5FI1B 1CB0A 4RO0A 3ZX4A 3A8TA 5T4EA 1VSUA 2B1GA 5AW6A 2RK6A 3LDUA 5CFNA 3IL2A 4JLWA 1Y8ZA 2HRZA 1AGNA 3UT0A 2H9YA 1KK0A 1FNBA 3UB3A 3RJJA 1EWYA 3OHAA 2QTBA 5CDFA 2A0YA 4FI3F 1PL6A 4YR9A 4F91B 4WCFB 1N3IA 3TGWA 3D1JA 1FDTA 5BV2P 2IE0A 1SV0A 5C8XA 4OMUA 2MT9A 3OBIA 4M86A 4KGZA 4ZMBA 5LP6F 2XUIA 1ZYQA 3GDGA 1NJXA 3LQ2A 4W7HA 4EKYA 1HTWA 1ETHA 4XPIB 2LVBA 3OT4A 2G6TA 1YJ5A 5D84A 1XL0A 2E8OA 1U3GA 2C57A 1M8FA 1HZZA 4C4XA 5KVVA 4PX9A 3GGOA 1ID8A 1ZNQO 4HRAA 2K7FA 2X9NA 3GRVA 1ZICA 2AS0A 4B35A 1P1HA 3KPJA 2C98A 2GJKA 2DT8A 4QTYA 1GGJA 4MVJP 1R66A 3KTQA 4R9SA 7YASA 4PZYA 4M1SA 3HFRA 3D8HA 1WLYA 2ZRBA 4JT4A 3FSJX 1KC1A 1FUKA 4IF6A 5KJ6A 2GASA 3M4XA 1F3LA 3Q8PB 1T3LA 3MCAA 4KITB 2YN4A 4PHPA 1NJYA 4L15A 3V3KA 3HNOA 1WBDA 5CM2Z 1XXHE 2K87A 3N0TA 5IJ0A 3VU1A 3BZUA 5FPHA 1F9AA 1HPLA 2NP6A 1DIOB 3MTAA 1CZUA 4Y2JA 4RDIA 4XH9B 4CLDA 1KQFA 1U4NA 3GG2A 5DDMA 4AM8A 3UXEA 4DFJA 3N87A 1WA5A 5EMMA 1RQGA 2O7QA 4EMUA 3IP3A 1X1CA 3JVDA 1TZMA 3EMBA 4TT8A 3H8VA 1CVIA 1HA3A 3MW8A 4O5EA 4I46A 1K98A 3A4IA 1EM6A 1P2UA 1EKXA 1SZCA 2Y1JA 4ALLA 4PG7A 5AKGA 2BKEA 4Y2VA 1ZR4A 2G0TA 5CLJA 3AHGA 3R7LA 8ICWA 5AXCA 3L9XA 1P1FA 3DZCA 4QX6A 1EVKA 3HE3A 1RT9A 3LUKA 3V8RA 3AEUA 1JE0A 5KFHA 4ZK6A 3E5MA 4F11A 1ZL2A 4KWTA 1GHTA 2HSJA 3RT7A 1P8JA 4KTVE 3MLAA 4LTNA 4KN8A 5JE8A 1ZOIA 2BP7B 1MOPA 3WFJA 4GKJB 2XJ4A 1PN3A 2O2CA 2PRJA 5FL7D 1NVVQ 5BXYA 3CVYA 5KNDD 3NDJA 5FQNA 1Z1VA 1RMQA 3BD9A 4GP7A 1RLJA 5I7EA 5HWSA 3UAVA 2C5HA 4IRKA 4E7OA 3O0TA 4BVFA 1Z3IX 2P2YA 4AY6A 1T3QA 4GR9A 2AUMA 3NRBA 2WWGA 1ZHOA 2Q0QA 4FHFA 5JLAA 3SFTA 2BTQB 4FUTA 5DTQA 4AURA 5I7UA 1VIDA 3Q3EA 1G59A 1J2YA 1U3CA 2AZ4A 2RBKA 3UWDA 2FMTA 4RVGA 2BMJA 4ZN6A 1G6OA 2OD7A 1S0UA 3L5OA 1R1DA 2VJYA 1LV7A 3O03A 4BEVA 3QE3A 3GVIA 1G3UA 1R2QA 5IKEA 1RLMA 4LTDA 1YRAA 4J4HA 3C5CA 1JLLA 3O31A 1OWOA 2OYRA 3D9QX 2VO1A 1CUAA 4PZ9A 3H0LB 3K2IA 3I52A 4RCYA 3QMMA 3SC4A 4KLDA 4CL0A 3O2NA 1PK1B 1TZKA 4E31A 5CXQA 3U3ZA 4QGSA 3ZCXA 1IM5A 2JBAA 3G9TA 4O4JA 2KX7A 3H5IA 2FX3A 1JQKA 4F2WA 3RT1A 5HOEA 2QD5A 3C45A 3WKCA 3KKMA 4BLWA 2R8KA 5A9RA 2C92A 3BTVA 4JSYA 1SXPA 3O1IC 3EHEA 3ZW9A 2YMPA 3BMNA 4RUCA 4TQAA 4FMDF 1KI8A 4A6PA 1UPTA 2OAGA 2FSFA 4J7UA 1ZQOA 2HHXA 4JLJA 1R4AA 4QELA 3T5MA 2JI4A 1ZD1A 1GEEA 1ZD2P 1OHHA 5JH7F 3ECSA 4OBWA 4V2IA 1H1LB 3TRIA 5IC5A 3G02A 1RZRA 1FRVA 3LUHA 4PTYA 1ECCA 1Z47A 3JD4A 1J2UA 1NJFA 4AZTA 4QZ8A 2VJPA 1J8DA 4E1BA 1LFAA 4XW2A 2IX3A 1JDJA 4Q6BA 1GFSA 3QXHA 2WP8J 3KUXA 1XP5A 2IK8A 4DV6B 4R1UA 3CLHA 1U9CA 1P2DA 3OOEA 1NZDA 1AO0A 3FI9A 4R69A 3T12A 4F8YA 4I1UA 1E2NA 3LBYA 3LXRA 3JQ6A 3JQEA 4PF1A 4W7IA 4RLHA 2OZVA 4B3MB 2P27A 1AM4D 4GE3A 4HAWA 5HFNA 4ECWA 4WZBA 4G1FA 4ER0A 3U4AA 5FV7A 2G63A 3ONVA 5BN4B 3R5FA 1JRLA 5KAMA 1NNEA 3H2GA 2BM9A 3IQFA 4DQDA 1L4FA 3OZSA 2KVSA 1G5HA 1DG9A 3HBFA 3EZXA 4WXMA 1KBUA 2WJHA 4UTVA 3ECAA 1PG5A 1Z88A 3T9FA 4R98A 3DE1X 1P60A 4CTJA 2WJGA 2AQ8A 2VR1A 3OPQA 2R47A 4FHCA 1CR4A 3WGMA 4EY6A 3VR0A 3MRXA 4BAUA 1TJNA 3M9MB 3RC8A 3PV0A 4MDHA 3AUFA 3THRA 3W06A 3X2EA 4G8BA 2AZTA 2RHMA 3DZBA 1A8IA 3LH5A 5CHYA 4L72A 3I01M 4OOFA 3KETA 1LPOA 1KEVA 1V41E 5KFRA 2UZ1B 2I2AA 1CLUA 1MX3A 3PNPA 1KTVA 3MJ4A 3ZKWA 1DOAA 1P19A 2OWDA 3C8ZA 4HH3C 1U0OC 2CCKA 2HZ7A 2QXTA 1QE0A 5BNFA 3DLHA 2VSXA 4EUFA 4IICA 3CZ9A 2DUMA 1KVRA 1D8AA 3AU8A 4TMYA 4RXMA 3H3XA 4ZYTA 1SHLA 1QF7A 5GPBA 3HMKA 4LSMA 4G4SO 1NN1A 2P9HA 4F2DA 4HDMA 1H0RA 1BPXA 4RPKA 1QFSA 2H3QA 3VRHA 4DNFA 3P4UA 2VP3A 4UHCA 1MVNA 1VKRA 2WWYA 2GHRA 3GPCA 3ITEA 4F4XA 2XRYA 2VBIA 4K6MA 2X19A 4ECVA 2XZPA 1NN5A 4EPTA 4ZVLA 3HDQA 3GAAA 4JVMA 4KZPA 4NS4A 4OMCA 2KBEA 2VH2A 4TYMA 1NKTA 3B1KA 3EBLA 2MIIA 1ZEMA 1KFSA 4MP6A 1U2PA 2JJ8A 2QRVA 4NC9A 3AVVA 1HYGA 1JHZA 3BFXA 3D6JA 2KLHA 4HVAA 4R2HA 1SVNA 5IXSA 2QR2A 3G7UA 4KPFC 4X95A 1TZCA 4DNOA 1ZN9A 3SC2B 2A1UB 4X6LA 1TM7E 5TSDA 5AM1A 5B57C 1K5HA 2CMDA 3VDRA 3ZU6A 4R68A 4QLAA 4RHTA 4Q3CA 2ANCA 5J2TF 1EVIA 1JIUA 1P29A 3KHTA 3FRIA 3WGOA 5AYVA 1J56A 1W29A 5B3JC 1MQAA 1CR0A 3A4YA 1VGRA 1V6CA 2MYTA 5LBTA 3TSZA 2ZRAA 2HWUA 4FT2A 3FBWA 2QZ4A 4X1KB 1R4MB 4RS4A 5DHAA 1F1JA 1X9HA 1JEEA 5AM2A 3EH1A 4HVLA 4P33A 4TUYB 3IEIA 4BWVA 1QCKA 1IWBB 1DELA 1XZHA 1KH2A 4JXZA 5F52A 5I01A 1G3IA 1LS6A 1H5QA 2GBLA 4FQ8A 4AP5A 5EJMA 3NVVA 4PAWA 1QRAA 2PD3A 5FA8A 1HDOA 3D1LA 3WMGA 1UINA 4WUTA 3JS5A 5K4HA 2YFHA 4QQFA 1OX5A 1Y37A 1RFGE 3UAWA 3TSAA 4BLPA 3KQQA 3OY2A 3A58B 1U9LA 3EPPA 3WMRA 4L27A 3RAPR 4W5HA 4WEQA 3JXEA 4A1OA 1NZJA 3QLUA 4MV7A 2BHRA 4RSMA 5AJUA 4ZI7F 1V1JA 4XR4A 1MAWA 2WWHA 4XVCA 5U4XA 1F0NA 2Z2XA 2A7QA 4OM8A 4UVDA 2HYDA 1U8UA 4GO1A 2ZG6A 2JJYA 1NURA 3RS2A 4CR8A 4W1RA 2GWRA 1HE8B 1TCCA 4GL4A 4UTOA 4LDPA 2F2TA 1GL9B 1CEXA 4YXJA 4JBWA 2C7QA 1SV0C 4QQKA 1EE2A 1C7FA 3H2ZA 2RCNA 1W5AA 3R44A 3IN5A 1ADBA 1KS2A 2JGDA 3HVIA 3FE2A 5CVJA 4DM7A 3IQEA 1LBQA 3R1IA 5FUQA 1XD9A 1HZZC 3FOAA 1ZK2A 3CO0S 1M2VB 1I7NA 2BYTA 4N1AA 1T25A 3OLZA 2DFTA 1JEAA 3N6RA 3PIRA 3R5SA 1FK8A 5DV9A 1WVMA 3IPXA 3MJSA 5KKAA 5LZ8A 1GPMA 4F8RA 3WO0A 1Z00A 4D0SA 3AY6A 5G0VA 4FFBB 4ZYVA 4UCXA 4XLTA 4CR7A 3FZYA 3OJEA 2BMAA 2C88A 2N3ZA 2X8WA 3OCZA 5M3BA 4W82A 2GCPA 3V7LA 1QHEA 4QZ9A 2XWJI 3HZZA 1E6UA 1TKAA 2IHVA 5FI3A 4OMFG 1TTPB 1OGJA 1NQTA 1IQUA 2B3DA 3QH4A 1N3BA 1R4NB 2LTAA 2A1IA 2G06A 4COOA 3ZIDA 1FDWA 4GBGA 4LOIA 4KXFB 4I9GA 3JARA 1KVUA 1CIPA 4KPUB 5HFAA 1DXOA 3RWMB 2ISCA 1VA4A 1XTUA 2J87A 1Q91A 3IG5A 4BZPA 1F3OA 4XDZA 2EZTA 1E63A 1FLNA 3VYTB 5AHXA 1HETA 4ZAXA 4ZQEA 2RDMA 4XSVA 1JJIA 2WM8A 2FPMA 4FUQA 1PZFA 1QSGA 3GLFB 2GEBA 1TDJA 8ICPA 3RVJA 3CVJA 4G81A 2PS3A 4N5DA 4PCVA 3SIPA 1FMJA 1UBMS 3HBJA 5TEWA 4FM9A 2VKTA 3PFCA 4QXMA 4YJHA 5DGIA 5BQFA 3T0FA 5MN6A 3F49S 1SCIA 3VR4H 4N0PA 4GUAA 5K0SA 2ZSUA 3HLYA 1WM1A 4ZRNA 4DIEA 2LW7A 2PY6A 4CKBA 4LDJA 5KWVA 4AYBF 2QMHA 5JCOA 2PKWA 4NAHA 4FBGA 4H3KB 4MQ4A 4Q1FA 4JIGA 3IV7A 4G3IA 1KWKA 1NR7A 1QV9A 1V11A 2CL7X 3Q8SB 1PEAA 1QVZA 3DP7A 3BMQA 2VXYA 3W6ZA 4O3OA 4AULA 2JEIA 2GBPA 1N2JA 1NKEA 1STOA 2ECOA 1U3FA 4GIBA 3NCTA 3NJ4A 5FTMA 3T8YA 1E8DA 1PGNA 2TYSB 3V1LA 2XZTA 1GQYA 3I34X 1U1FA 3PNQA 3GCZA 1FIQA 1V6AA 3FYUB 1S2IA 5FYQA 3DXXA 5EZQA 2IDJA 1RW4A 1QTRA 1N2OA 4ZOHC 1VHTA 2M32A 2QK4A 4FYWA 4TQRA 4L0DA 3C2MA 2GJ9A 3K53A 2G88A 1DBRA 1VPWA 1D8BA 2X86A 4LOHA 3CX6A 2ORVA 4DVJA 1IUOA 5K0EA 3TKLA 3R0VA 1OR8A 5EL0A 3S68A 3S1AB 3UH0A 5JZBA 1CV2A 3KVRA 1AGYA 4YIHA 4M9QA 3QM1A 3I42A 1PT7A 1JQEA 1AB5A 4M7RA 4QXOA 4AO8A 3T4XA 1K4MA 3IMGA 2YX8A 2H4XA 3PSTA 4HDRA 5CJ2A 3B6MA 1VJDA 3GDHA 4A0RA 3LV8A 4FYPA 4FYXA 2EZYA 1CUUA 4F1WA 1RZTA 4BP9A 2P3SA 4V0KA 1B74A 3L5KA 5A9TA 1F8UA 3SBDA 3WFIA 4L6AA 4C8OA 2JFWA 5BRNA 2CUNA 1Y63A 1W30A 2O3RA 3R77A 4I50A 4ZTZB 3SQMA 5A0VA 4MVJM 5C1BA 1UBGA 1PR0A 4CCYB 4INZA 3BB3A 2AN1A 3SICE 2H0AA 4IXDA 3GUHA 2I4LA 2XCAA 3C5VA 1QHNA 2BM1A 3GDFA 4JUFA 2O7RA 4MROA 3V1TC 4Z2YA 1MQ2A 2G17A 4UM7A 3V97A 3EOAI 2AW3A 3EDOA 4UU0A 5AI6A 1SKBA 2BI4A 3UJDA 1QG2A 4IR1A 4Z3KA 4A2QA 1TU3A 4CKEB 4OU4A 3LCJA 1Y7HA 1INLA 4KVZA 4DZTA 1GG2A 3TR5A 2ZULA 4JC0A 3QFRA 5IMBA 2E1RA 2W6JD 3DMNA 821PA 8OHMA 3HXKA 3HCPA 4LBYA 2H18A 2R65A 3GRAA 3H2IA 4DFKA 4E88A 3VR6A 3MFIA 3JAMA 4UPDA 3R0JA 2Z30A 7ICLA 2EDAA 3ILHA 3PD7A 1PSDA 1E3QA 3FOBA 1E2IA 1XVAA 4MRNA 2GTIA 4AQDA 1WDWB 4V0MA 1JFFA 1REQA 4F5RA 1NTRA 4G4IA 4MRMA 1KDTA 1IM2A 3G3EA 1JS1X 1YNSA 3I6MA 4B1FA 3X43A 4DSEA 4QFCA 1NVEA 2QRHA 4C80A 1T5OA 1O5OA 2Q7DA 4C88A 2V8OA 4CQNA 1P18A 3LA6A 1YZVA 6REQA 2CBXA 2XUJA 1D4AA 1BMFD 3JYOA 4DA4A 4Y2HA 4FHGA 1K68A 4JOSA 1QMPA 4CGYA 2YQEA 1ZM7A 2XI4A 4A5SA 1DU4A 2VDRB 1OH7A 1TKCA 2WLTA 1MEEA 4ZU3A 1OWLA 3G6XA 4RPIA 2X7XA 4L7QA 5E6UB 3ZX5A 4UHEA 1KY5A 3IDQA 1KYVA 5ALFA 2Q9UA 2I71A 9GPBA 5D6OA 1YZYA 2H92A 2ZTSA 3ZGXA 4JLVA 4G65A 1M2EA 1U8YA 3W78A 2CSUA 5EAIA 1QGUA 5IMSA 3UMMA 2B8TA 1ABEA 4V1CA 2WJIA 2XO7A 3S70A 3TTWA 1TEVA 5EIBC 4DSKA 4BYGA 2XNHA 2CJWA 1C1DB 1FDOA 1J0AA 4HRVA 3JWJA 3ZLVA 1VHWA 4OQPA 3RS3A 2VJKA 1MIOA 5DNVA 3Q10A 3N74A 3EXEA 5FEUA 2AQIA 3HCWA 1LJLA 1C9YA 3ZTWA 4USAA 5I45A 1L3TA 2OXEA 3QENA 1CRLA 2QD2A 1C9EA 1B26A 3SDSA 3WZ2A 3VHXB 5DHUA 3CT6A 3RRJA 1ND5A 2GPWA 4F21A 2Q46A 5HE9A 3GEEA 2BFEB 2D8AA 5K3FA 3EYZA 1RKBA 3PHLA 1RRVA 4Q03A 1MO6A 4REOA 5DSXA 3IQXA 3HJFA 3A6PC 2HHVA 3URMA 2XMCA 4RMIA 1FFHA 4MNTA 4KLFA 1BHJA 1S89A 3PUYA 1QOQB 1J0BA 2JLBA 3F5EA 4MRSA 1GT91 2PBFA 4DWVA 2FWMX 2E49A 3B1JA 2QQEA 1N2EA 2XQFA 2C95A 1OXJA 2AFRA 5DI3A 3TSCA 3WGZA 3EY9A 4EPXA 3AERA 1M6NA 3GQCA 1PQPA 5GAJA 2I22A 2WQZA 3IXQA 1NQWA 3T4EA 2XXAB 3MCWA 3I0NA 4K6HA 3PFWO 3VPBA 3F7OA 4B4DA 5CFRA 2I1LA 1Y4SA 2C9DA 3SS7X 4WLUA 2XI9A 2FPSA 3SZ3A 4GL2A 4KK4A 4NHEA 4DOMA 4ENQA 4OYHA 2QLJA 3MTIA 1DJNA 2WSSD 3F5FA 1QQAA 1SC4A 4XM2A 3EZGA 5KYYA 1VFPA 3QVKA 2GBLC 1J0XO 3KEQA 1DQNA 2IELA 3ZY4A 4N7MA 2NRTA 4MJLA 2JI9A 1EGAA 4A92A 5KHAA 3GFVA 5MHTA 1QTIA 3PT5A 1BE1A 3OZ7A 4LAFA 1M33A 1XF1A 3E3OA 3SLRA 3D02A 1ZGBA 1DUVG 3D6AA 2Q0ZX 2A1TR 4GZ6A 3RB3A 3QPCA 3BK2A 3GCWA 2EW2A 3QLUC 1EE1A 2XUAA 1ZRSA 4H4DA 1T15A 3A27A 5LR6A 2LPEA 3OZTA 4YUVA 4S3MA 2Y66A 1BS2A 1W6UA 2I55A 3BE4A 3BA1A 2FF5A 3L7BA 2ODAA 4C30A 5JNTA 1ZQRA 4UKDA 4DA9A 7REQA 4ZYLA 2QTMA 4MYRA 1H2BA 2K4MA 2IODA 2NV3A 1Z6TA 1KZ7B 1XQ1A 3BIOA 3WV5A 3HYNA 2QRZA 5ILQA 2IZ6A 5DVZA 2BEKA 2I33A 4DABA 3TQSA 5A4FS 1AKRA 2YOFA 3ACDA 4G0QA 6YASA 5TIIA 5C5DA 3TZQA 4HQKA 1Z6GA 2NO6A 2W8BA 1EK6A 1GM5A 1OAKA 3JALA 2Q62A 2QSYA 5F3RA 3A0HU 1VI2A 4OUDA 3TTVA 2ZUCA 3HXQA 3R8XA 2KHVA 4PM4A 1RTTA 4H7EA 4DOAA 3EOBI 2ZIXB 1JIQA 2DPYA 1VIMA 3W2HA 3ZJUA 3AYZB 2K4HA 5FI0B 3AFNA 3QU7A 4UTXA 4ALJA 4FFWA 3FZNA 3HBLA 3AI1A 3PEWA 1BGWA 3K1JA 3SF8A 1YTLA 2XYHA 4C14A 4OGWA 4BECA 2FETA 3WQSB 5HS4A 2GAAA 4XARA 5HRAA 3R7NA 3H0KA 3LQ1A 2LRHA 2Z1NA 1PK8A 2YJ6A 2PK3A 3AV3A 1XN1A 4G07A 4HLCA 1LLUA 2OWOA 4CKZA 3O7MA 1E1CA 4WESB 2BGRA 3PC2A 1ZK1A 1EQ2A 1BXRA 3N2ZB 5B7GA 4QPJC 3M6XA 8ICUA 4W63A 5LP1A 3SFVA 3K96A 5EE0A 1R8YA 3J7TA 4M2LA 4X6YA 4AX8A 3U81A 4LHEA 4CM6A 1OV6A 4F3RA 3ETCA 5JZ9A 4ECYA 1M7BA 1KQNA 4Q0MA 5EUCA 2XBMA 4X0EA 3BH7A 3UK1A 1NY6A 3F4BA 3LW7A 4LKRA 1AV6A 1QKIA 5IASA 4CIAA 1VZ3A 3LMKA 2YDYA 2B8WA 1XLVA 1J8YF 1OLSB 4L78A 1B4FA 2CY0A 1ZOLA 4YAUA 1VPEA 5SY4A 4NMHA 3BGOS 1PCXA 2INGX 2B6NA 4UD2A 4Z6CA 4JJZA 4R0VA 2GR9A 4ZKEA 1WPGA 1TW2A 4QIWC 3RASA 2IZOA 3T1VA 1KPGA 2UVUA 4JI5B 1N7IA 5DPMA 5JCOC 2WQ6A 3M6FA 3A3OA 1FS5A 2PGAA 2FPPB 1RWVA 4F2SA 3D2AA 3KJIA 2AUTA 1XCBA 3MOSA 1SA0A 3U16A 3MTGA 1Z0JA 3D7SA 2GPBA 2VXCA 4ND2A 4B3RB 4LSWA 5DX8A 4NBRA 1T10A 1IN6A 4YLGA 3VPHA 4DQQA 3CWQA 1EX9A 5G5GA 3MB5A 3QA9A 1ZQGA 3HJHA 4QT0A 1DB3A 3AUKA 4PIVA 1DKPA 3TLGB 1I7SB 1AUXA 4J9LA 1WHTB 3W34A 4YQEA 3RJ9A 1PJQA 3IOCA 1PRYA 1QTNA 2RDIA 4H59A 4I6JA 2FQYA 3LI2A 3CLSD 2GTHA 5JAQA 4R01A 1ZO8A 3IVCA 2FX5A 4WVLA 2ZUDA 5ENDA 4LZOA 4MA4A 1N5LA 1K8YB 1CQIB 4AY2A 4UEQA 1XZPA 4RQ8A 2AMLA 1U1IA 4OL9A 3SR4A 4M9XA 5KWIA 1LF0A 1O5IA 2ZTCA 3HR7A 3FA2A 2OQVA 3OCUA 1YHZA 1H3NA 3EZNA 1JSZA 3BILA 3THXB 4X20B 1W48A 2PEZA 2GZDA 4B4VA 2V98A 3UJCA 2VWPA 1YE3A 4HI0E 4O63O 2F48A 1CQXA 4OHWA 3IURA 4W5NA 1W5TA 4ECAA 4ETWA 4HNQA 5KVQA 3IO3A 3ELBA 1IUKA 1NKSA 3ZTTA 1N4AA 1BS1A 4JI3B 1D2RA 3WZLA 1YZUA 3ROMA 1WCXA 5BN1A 3TACB 3WMXA 4RK6A 5K6AA 4DL2A 1Z39A 1PNOA 3I53A 5DBAA 4IYJA 4M8NE 3UMJA 1G9SA 2R7AA 4C0LA 2Q99A 3BG5A 3OZEA 2PA0A 3K6SB 1U45A 4O3RA 4D4KA 1YQTA 5BN3A 3TAHA 2GF9A 4B2IA 1D9XA 4P7JA 1UMCA 2AOTB 1OFUX 4PGHA 3AFMA 2QRUA 4X7MA 5FTKA 1T4BA 4HB2A 4TXNA 3AM5A 1SK9A 4JOCA 3MWEA 4UTZA 1QYRA 4LY3A 3JQAD 4YDQA 2UUOA 2AR9A 1O0SA 1ECWA 2G6BA 3P9ZA 4QRDA 3L8ZA 2V9ZA 1GDHA 1OV4A 4LOAA 3FGZA 2BGTA 1AKMA 5KJEA 1XTBA 2C96A 3SYMA 1G8MA 4RD6A 2H5LA 2PYZA 4NG5A 5HJEA 2J0QA 2J0UB 4O4HA 2CEAA 2ZB7A 3AEKA 2V4ZA 4RPJA 2WZQA 3A9SA 4YJ2A 1QHSA 5CB4F 1NZFA 1C8BA 1OYVA 5KS2A 3FMPB 3K8OE 3WOVA 1LEHA 4ZVKA 3JX9A 4YR7A 4C7YA 1RJ9B 3FOFC 2AEFA 3CVVA 3Q7RA 4WKNA 3B6ZA 3LC7O 3T3IA 1SVUA 3H3FA 1PVRA 1VSQA 3ETRA 4MKXA 5LXTB 3C4VA 5KOYA 5GM1A 3TD9A 2PL9A 3EPIA 2OXRA 1W7AA 1LSOA 3NTLA 1CU1A 4I1VA 5I7VA 4IL5A 3ASVA 2XUFA 5CLLA 5F23A 3WBJA 1G16A 3E8SA 2GN2A 1IUNA 1QOZA 1NI3A 4RH1A 2GEDA 3CURA 1HI9A 4FLFA 4MV5A 4Q01A 1E3WA 1U7XA 2C7GA 1YB1A 1HDEA 3DOUA 1ACMA 2W6OA 2ZLBA 5JZOA 5CLQA 4MYSA 4JJFA 3Q0TA 3VVCA 2QE7D 3NUQA 4GSYA 4P58A 2JKYA 5LA6A 3AJ9A 3AF2A 4HWPA 4I99A 4FBTA 4ZOBA 4H7FA 3H4IA 2XGPA 2VEOA 1NG9A 3AT1A 2ZI4A 5C52B 2YIJA 3PC7A 5JWOA 5LDDC 3WGKA 4BFWA 1L4YA 2B5OA 2J9YB 4RIEA 1Y5IA 3OKPA 3EUAA 3ENWA 5JSQA 4BNLA 3BCSA 4X24A 4NI5A 2PWZA 2NZWA 3ZN2A 5KPDA 2GD6A 5T7BA 2VIIA 1HEKA 5B7NA 1RAAA 2I29A 1Q0ZA 3RS0A 4EHKA 2P9YA 1UBSB 3B1XA 4G25A 2IMWP 3LBNA 1HF3A 5LQDA 3TANA 4OHFA 2FUKA 2A5LA 2ZRKA 3I9MA 1FEZA 4GKVA 3KSDO 2PX8A 5H83A 1BE0A 3LSTA 5EWMB 4CT4B 5ALJA 2JI8A 2HBQA 3WLJA 3ZHZA 4TQGA 1PWYE 1Y0BA 1BQEA 4IH9A 2EWVA 3IBTA 2CFTA 2ZQZA 1QMGA 2X42A 2WSMA 4H16A 2WFAA 3LW8A 3IIEA 2O23A 4BO3A 4XQ8A 1RI4A 2AEEA 3PGJA 3NONA 4CZ2A 4DRXA 3SQIA 1LI4A 5D01A 1PP4A 4H1UA 1JQLB 1E6KA 1HLPA 3L4BA 3GLIB 1ADYA 3GUZA 2H2DA 1GSOA 2E5WA 5EZ5A 3UPUA 4LMPA 4YD2A 1ID1A 2QKYA 3ANLA 5DF1A 1DSSG 1JTFA 3D3JA 2R44A 1W1UA 4XQ9A 2ATEA 2OZLA 1SOMA 3O2QB 3PQ5A 1GZUA 1XTIA 2JLRA 2PWAA 3GQBB 2FSHA 1NAHA 1USIA 4KQMA 3EDMA 2TMKA 2JS7A 1Z19A 1IZ8A 3R9XA 4LZPA 1KTQA 1I2CA 4TTPA 4G5HA 4RPYA 3RJEA 1VJGA 3A6DA 1C7QA 1IY0A 3NNSA 5DN6A 2FPGA 1DJOA 3O38A 3INRA 2WYVA 3HA7A 1XQ9A 1EWVA 3ZD9A 3QVGA 3QVJA 1JEJA 3AVYA 5ILOA 4HAVA 2V7XA 2Y68A 2ZAMA 4UTRA 4EYOA 1JKIA 1DQZA 1NBOA 3OF2A 1CYEA 2F77X 3TGLA 2M6RA 1PBTA 4Y30A 3A32A 4JMPA 3LTEA 2SKEA 3K75D 2BCJQ 1CNMA 4J0JA 3TZEA 4QUJA 2RIPA 4ND7A 5B6PA 1CDEA 5DG9A 5HIJA 1R6UA 1LB2B 1BZYA 5FYDA 2J7PA 3H2JA 3ZNQA 8ICNA 1PGPA 5KFNA 1CY4A 5HPYB 4M9SA 1V3QE 3QA3E 1CJVC 4PPXA 2HIHA 4RJ2A 3WRVA 2AXEA 1HFWA 4JWKA 4CG1A 1A9RA 2V6BA 4AVYA 2G5PA 4WOCA 5BUZA 3WSVA 3TINA 3UBMA 3LFHA 5GOTA 4A0GA 1EFUA 3BYZA 1ZISA 1XLUA 5LWHA 2OYSA 4Z9AA 4GAEA 1COWA 2XAAA 1XAGA 4BCCA 1ISFA 5ALMA 7ICMA 5DBOA 3NTRA 1URJA 4QTTB 5AIAA 4GI5A 4RXUA 1RJDA 4J4TA 3PPXA 2NUAB 4BLQA 4J0IA 1K66A 1IZ9A 1UP7A 1I4TD 5COAA 3PW5A 4DWJA 2DWUA 5B2ZA 3U3JA 1JPNA 3NZEA 2Y1DA 5MGNA 5EIXA 4AKSA 2IIPA 4NOMA 3PW7A 3VU8A 3K1AA 3ZDAA 3TRKA 1KJZA 4U3JB 1GZ5A 2Q9BA 2XMRA 4CF3A 3KAQA 3NBFA 4Y2YA 3OOYA 1Y3IA 3IALA 5DB9A 4W1SA 5LZ4A 3FF4A 1FPQA 2O0HA 1D8YA 2P68A 2CVQA 1CEQA 3BGWA 4GYYA 4M4SA 3CPHA 4DLAA 2QX7A 4D8XA 2V7TA 2JCBA 3H2HA 3VNUA 3NNNA 4QXAA 2XSZD 3ADBA 3QE0A 2Z5VA 1HT0A 1UHUA 2EAUA 4R2WA 4CBVA 3I01A 1Q20A 2DEUA 1AQJA 4O4JF 3O0FA 4Y6SA 3TQFA 3U31A 4E0BA 1FQJA 4R66A 4EWLA 1XWIA 2FK7A 5DXFA 4DXHA 5KBYA 1OY1A 5KT2A 4K8RB 5JEEA 4M83A 1KORA 3GJ7A 4F5EA 4QIHA 2FWRA 4B6FA 3U17A 4DV4B 4V2UA 3WGJA 1RXCA 1HWYA 1TGYA 1WZCA 4JUZA 3EVEA 3LT1A 3V6MA 2IUEA 1VFNA 1G1AA 1SXGA 2G1KA 4DR5B 1KO7A 6ADHA 5CXXA 1JQDA 4IIVA 4ND6A 1MOZA 1U2SA 3T4UA 2BR3A 3B8HA 3JPNA 2JJQA 2ODTX 1E3DA 4A27A 1RCTE 3UQ2A 5C31A 5HUHA 4BB0A 1HX7A 3GEDA 2D8CA 3B52X 4OYLA 3A9WA 5NULA 1SULA 1F5SA 2CFCA 1GGEA 4KH1A 4O4LA 1DDGA 1U0FA 3DT6A 2Q7XA 2WB4A 3WNBA 3U1BA 1SOUA 1F0MA 4AF8A 1BRMA 4BO0A 3HM2A 5FUVA 1UP4A 2B5VA 3K4GA 3O92A 1ZNYA 3G9XA 3VKFA 1M5RA 4LWQA 1MAUA 4ED9A 4P3OA 1N92A 4K9KA 4BMVA 1ZUD1 4G4GA 4LOKA 3USZA 3K8ZA 5E7MA 2PKXA 3W8EA 3WKAA 3SNHA 3KVOA 4BL5A 1A5SB 1QR6A 3HP6A 1TK9A 4G9BA 1JG4A 1OH6A 2YXBA 3R6WA 4KNVA 4X6XA 4Y9TA 1HNXB 1F51E 3TD2A 3NORA 2ZE6A 4OA5A 5JC8A 2VTKA 3A6ZA 2AVNA 5CB1A 2I80A 2QTGA 1O9HA 1KMHB 4NR0A 4PGXA 3W2FA 2GQ0A 3KZNA 4GECA 1W88B 3TPZA 4G1CA 3S5UA 1CR2A 3AB8A 4Z1OA 3BWBA 3EGVA 3L7IA 2YJGA 2ZYSA 3GLSA 3JSXA 2G5HB 3SM9A 4QWDA 4RF5A 4X63A 4CE6A 1DKRA 4C0HA 3AVOA 5B66U 1IG0A 3QUCA 2VZ0A 4AG6A 1JA9A 4QA9A 1LRJA 1EGMB 2WAQC 2WWTA 1IJKA 5J2CA 4RVCA 4AECA 4WT7A 1Z5WA 5K6AC 2H5JA 3AF0A 3IAXA 3DBRB 1KPHA 1OWPA 2VJOA 2QTTA 1UBNA 1KOFA 3P4XA 3DYVA 3DHEA 1ENOA 2EKZA 1CZKA 1T9AA 4FS3A 3UB2A 2WAYA 1DIBA 1Z2PX 1W581 5E9QA 5DNDA 4EGQA 3ALRA 3T7IA 1DPGA 3EZYA 5TS2A 2HQBA 2F1IA 2HGZA 3ORQA 3PI7A 1V5FA 3PUXA 3VOAA 4DFMA 4A9AA 2OUIA 3H11B 4E11A 3DFMA 3RPEA 2ETVA 3R8CA 3B3GA 1QE5A 1H0KA 3WADA 2NTEA 3C8DA 5AQEA 9ICAA 2MU1A 2QEQA 2HQRA 1GQ2A 2PAAA 2DFKB 3AONB 3U39A 4UVIA 3DW1X 2OAEA 3DOOA 5AK5A 5FUMA 5J2FA 1N7HA 4ERNA 4RKFA 3Q3GE 3BGDA 2BFCA 4GXIA 2X9VA 1YOVA 2BTEA 2QZSA 1I6MA 4KLIA 1ZUNB 3UUWA 2F1OA 2HREA 2I03A 2DSTA 2QM8A 1Y48E 4M0EA 3CJRA 2YXPX 1GPLA 1B7GO 4AN1A 3NAZA 3N0XA 2LE0A 3KVVA 1D6SA 3ROGA 5LQSA 5BWNA 1JXMA 4E4RA 4R1MA 1H5UA 5D3KA 2I2BA 2PMFA 3TBFA 1VYVA 3KSZO 3DFUA 4ZC1A 1DEKA 1WCIA 3WLKX 3SZMA 2ZB8A 2H9IA 1H6DA 3CRW1 4ZOLF 2CXTA 4PZNA 1NT2A 2VNSA 3MLEA 4UDNA 4IQUA 721PA 2ZSFA 3A9CA 3RUHA 1XWFA 3PXUA 3K2BA 1TEZA 3G0HA 2ZTUA 5KZMB 2NV6A 1CUGA 2OORA 1BPZA 1AK1A 1YZFA 2AQ0A 3R0QA 4DV5B 2W2NA 4UBMA 3F7NA 3SK0A 2GARA 3F1LA 4MQUA 4UAGA 9ICTA 2Q3JA 1SKMA 4YY3B 3OPYI 4X54A 1R0ZA 2VQSA 2NUTB 1YU9A 4AJEA 2W9AA 3UMBA 5F7JA 5BWBA 4GRDA 5CNJA 4GYJA 1IVYA 3OQMA 1FSSA 3GOQA 4UBNA 1UIRA 4A26A 4S1PA 1XNHA 3TZKA 3OM1A 4MDEA 4F5NA 1DRWA 2VTVA 3EYAA 4J9SA 1SU7A 1T9BA 2G76A 3ZCPA 1QPZA 3UGTA 2QT1A 1Z37A 1OTHA 3B1FA 6GPBA 3OH8A 1WSAA 3AI3A 1TEXA 4FS8A 2QJWA 4HX2A 4QJBA 1S2NA 1W85B 3B5JA 4LVNA 3VBEA 1QUEA 2WILA 4CLRA 5K7SA 2Q6OA 3FMGA 3GCGA 4K9RA 3BSWA 3BM5A 1HUOA 2GZ1A 3A7DA 1S02A 1Q5PA 5KNDH 1EK1A 3BJIC 4FR5A 1IK4A 2HHJA 2XUOA 5BW8A 1P1IA 1HY3A 2ZUFA 3LPCA 4A8TA 3PE3A 3NT5A 3PE6A 4IF4A 1P74A 4M1KA 1FTGA 4WGGA 4Q3LA 3VAYA 1BN6A 3EXFA 3QX8A 5HA5A 1UBHS 4IDOA 3B0XA 4M9GA 2OXFA 5AW7A 1UPFA 3H04A 4L5BA 1TCUA 2B78A 3Q7EA 2DSNA 2PT7A 3ON5A 4LI3X 2C78A 3S8YA 2MYPA 3RTEA 2X8JA 2O9JA 3HJTA 4TXLA 2WHYA 1BDMA 4KH0A 3L4BC 1I2MA 3HGMA 4EO9A 4GC6A 1Q16A 4MQ5A 4GPD1 3FMOB 3EUEA 4QFBA 5DOVA 4OXIA 4R7TA 1V8OA 1ZOSA 4W8GA 4JROA 3W9UA 5EJ7A 1TRKA 2X1HA 3PNCA 1GQQA 3ELYA 4L08A 3IKLA 2IH2A 1TC1A 4IWNA 2HPVA 2AFIE 2OBLA 3AM9A 2XA9A 2FJ6A 4K7JA 1K8ZB 4CL8A 5FPSA 2EX0A 3OPXA 1ESEA 2IEAA 4G8JA 1T3ZA 1VJTA 3TLEA 1WMSA 4B7CA 4NYIQ 3AVPA 5AVZA 1MRZA 3Q11A 2P11A 5J2AA 4FDMA 3RS9A 1E5TA 2JGRA 5H4GA 2QMYA 2OCLA 3TN7A 2V9CA 4QZHA 1E9DA 1I3NA 3GP8A 5DLPA 5FNVB 5JSHA 2POQX 1KLNA 4BBZA 3R3JA 1WQ1R 5KYVA 1GEGA 3CISA 4XB2A 5CM8B 4CU2A 4X1IB 4CKXA 3RRXA 1NV9A 2DUNA 4REQB 2DR0A 4RA9A 3IBFA 1IAQA 1MJGM 2D4HA 3RRHA 3ZD6A 4ZHQB 3CTMA 2I66A 1OFVA 4KI7A 5CA1B 4MVJA 4AP9A 2X5XA 4BVBA 2FPXA 2EQAA 1RMYA 2F67A 1JX6A 2HK8A 3WAGA 2WIFA 4CUJA 3OEHA 2PGIA 3A04A 5L7YA 2XIDA 3IE1A 4DUGA 2XHZA 1JB1A 5EMJA 5TC4A 2JRZA 1LVUA 3DG9A 3IMKA 3GARA 2NV2B 1K4KA 2B9EA 3QG5A 1QCYA 3FR8A 3GJRA 2VJBA 1ODSA 4A5OA 1NF8A 1U7PA 1ZR2A 3QVMA 4E2YA 3R40A 3O8QB 1G8HA 4F9EA 3TW8B 5DTMA 3AU9A 1K97A 2VSQA 1G4AE 4GI1A 4WE3A 4K1XA 2ZWPA 1OXMA 4R8UA 4YT2A 1ZD5A 1G5QA 2Z3VA 2OGUA 5KVSA 2QUJA 3C6XA 3KT3A 4PNZA 3D5EA 3PHCA 1PV4A 4NV0A 2E87A 3BL8A 2JH9A 4WNYA 1DXYA 1ZVQA 3FVTA 4ZA2A 3UZUA 2RQ5A 3I8XA 3HYTA 1N57A 2AMFA 3H5OA 3RAQA 1K1QA 3A4LA 1JR3E 4WNAA 2FUG1 4PFKA 3TD6A 2XCRB 3WHPA 1V39A 3A0RB 1WBBA 9ICIA 4B6SA 3IAAA 1QIIA 5LC1A 4CV0A 5LYJA 1OOEA 4J9PA 4JN6B 2VWHA 3ZD8A 3OJ0A 3C7TA 9ICJA 2DCUA 1KZ1A 2CRXA 4CKYA 2DWPA 1Z4JA 4Y2GA 5T57A 1WUJS 2J45A 1JIIA 1LY1A 2C2MA 3DWGA 1ZJYA 4BLOA 3W2EA 5GADl 3PFKA 1ZAYA 4YCCA 1LCIA 3OUZA 1CEZA 3SX2A 1WTAA 4KCGA 1RYDA 3RQSA 5L6MB 1G8GA 4DMKA 2GZAA 1FP7A 1XRJA 4LNAA 2P7IA 4WK4B 4QWBA 2EZ8A 2VK2A 3BWVA 5BRJA 1U04A 3AO0B 3QEJA 4GGPA 2RGBA 2CVFA 4I50F 4ZALA 1TM1E 5A5EA 4OI0A 2ZDQA 1HM5A 1O2DA 2OCPA 3A31A 1YK1A 3NP9A 3VR2A 3BOSA 1D4OA 3NIWA 2WYOA 4F06A 5CB0A 2ES6A 2VRCA 4FNMA 1QH8B 3BWDD 3CBGA 1SCAA 1EJ0A 3MR6A 5IULC 2IUFA 1D2AA 5JTTA 4FCTA 2BJHA 3PG5A 3OE4A 3TEMA 1VG0B 2ZBEA 2WWXA 4CWAA 1Y88A 1X0XA 3G82C 5DG7A 3R23A 1XU7A 3CT4A 4KVFA 2XEXA 9ICWA 3T5PA 1X6VA 1BCRB 1YV9A 1UEIA 2RH4A 5I47A 3QVOA 1IDOA 4KLCA 4ILEA 1LVGA 2WSIA 2MHCA 1AJEA 1R0RE 4ZCPA 2Z5LA 1E1RA 3QV2A 1BXGB 1R37A 3HO8A 4JK3A 5T14A 2X2FA 4RFLA 3WG9A 2OVBA 4LJ8A 4DLPA 2MRLA 3AILA 3DL7A 1E4OA 1R18A 1I2AA 2O1EA 1EJ2A 4IOLA 1PYGA 1RZ3A 3GG9A 2NSDA 3HY6A 3RIGA 3IRUA 2Q1TA 3CJTA 5LJLA 5BQ5A 5PNTA 1JWAB 1T5LA 4OX9Y 4TQUS 4V03A 2D0PB 1X7YA 3THYB 8ATCA 1WDTA 4LHVA 2AGPA 5BVGB 3TZHA 1V1RA 2JMGA 3TWOA 1JG2A 2YRFA 3RI3A 4MZDA 2EHJA 3WIOA 2XVXA 5C34B 5E6SA 4FDLA 4NJEB 3EG9B 1G4HA 2BGNA 2I9PA 3T3GA 3USES 3WGUA 3NCHA 5JI3E 4Z0PA 3IUQA 4FYJA 1QXSA 2ZJAA 3K70C 1NW4A 1M34E 4BFVA 2Z2IA 2XKKA 4M8IA 5CP2A 1YFLA 4YV1A 4JV5B 2SCUB 4XFKA 2WF5A 1XAJA 2IOYA 4RM2A 1KIAA 1O94A 4FEGA 5K09A 1DOHA 1GGHA 3QWHA 2FW6A 3RRFA 3OZDA 4NCAA 1Y9EA 5JNSA 4G63A 1ZQYA 1KK3A 4MEBA 4KGXA 5JYEA 3GT4A 3AQIA 2EZZA 4KIGA 2GZ3A 4R54A 4LMRA 4WZAE 4DV7B 3PNVA 2LUOA 1OGYA 4FT4A 5K4AA 4YN4A 3K20A 1C0IA 3KS9A 2TMGA 4MIEA 1NMEA 4E6PA 3GMTA 1P1CA 4PWZA 4H7KA 2ZTHA 4PQEA 4IHKA 3K72B 3VPAA 2B8EA 3ZNOA 5CBPA 1K7FB 4EHHA 4ENRA 1S1MA 1L5YA 4QNRA 4EY5A 4IJWA 2R96A 1ZD8A 3OJCA 3PV8A 1DC7A 3CPSA 2WWRA 4TKMA 3RANA 3UHFA 4BRZA 3CNBA 1RPAA 3L0PA 1X7WB 3A05A 2EEPA 1G21B 2BRUA 5FLKA 3ESAA 3T9CA 3EQ2A 2R48A 5KQPA 4XQCA 3M81A 4RL6A 1M9NA 1R9NA 2HJWA 1XA3A 2HK7A 1L8XA 1S2GA 2F64A 1VJ0A 4F72A 2A19A 1SKWA 3E05A 1Y8AA 3V7NA 3DD5A 2VVTA 3T95A 4IIYA 4MQMA 9ATCA 4DWWA 4NAUA 3C43A 3CNQS 2QTFA 3ASZA 2OORC 4UHJA 4QZDA 5K3DA 4W8OA 2CV0A 2BGGA 1XA4A 1CP3A 2PWPA 4MKIA 3RKRA 1O03A 3C5EA 4BQIA 1V71A 3U7HB 5CJJA 4E46A 3QY9A 4NCKA 1RYNA 3NT4A 1JHQA 4O4IB 1U3UA 2OZPA 2QAGA 5HBRA 3AC0A 4W5OA 4EGAA 5THKA 4MMXB 2M1ZA 1JIJA 2DVMA 3T5AA 3RV3A 5JRZA 1SGWA 2QORA 1SKAA 1ZYUA 4CF4A 3BPSA 4LF8B 4LZJA 3C85A 3PGMA 1PQUA 2HDWA 3D6FA 3DR3A 2G4VA 4L7VA 4YRBA 4OP3A 3DVQX 3LY9A 1M54A 2BELA 2QJFA 3EJWA 3D3QA 2VZEA 1E3MA 5AW2A 4DQVA 4KDRA 1GSAA 1YRLA 3ANMA 4KR3A 2OHVA 2V7PA 1O97D 3QUBA 4D9GA 3G8DA 1I1OA 3KOWA 3HYRA 2PV7A 1Q46A 2C8JA 3HWTA 4Z86A 2FCRA 3GCXA 5CA7A 3RUPA 2REBA 2GHIA 1U2DA 4WI1A 1M0WA 4O5CA 1IY9A 3G6KA 4Y3UA 3RK0A 2P77A 1VMKA 4J03A 1A8UA 4YMWA 4MKRA 3SC6A 5BSEA 3MPUA 3IQWA 1QIMA 3VZBA 3W5DA 1U7DA 4TS4A 4UZFA 3RRGA 2X4LA 1N9GB 3MCVA 4DUYB 1TTHA 2VF5X 4P32A 1UJ2A 4CRWB 5LQNA 2CZGA 1JALA 4JODA 2N0SA 4F86A 2HB6A 4H7IA 2WFLB 1W4CA 1NNSA 1ZQUA 3ROEA 5DK6A 3ND7A 4MS1A 1XGKA 2EGHA 3HWSA 3JAKA 1NM5A 3OTOB 1UQUA 1YS4A 3ET4A 3V7WA 2EZ9A 1XZIA 1K7YA 4IJUA 1E0DA 2GSDA 4WLOA 1XP8A 3QVLA 2GK6A 3G0IA 5KFFA 4L3WA 2QRGA 2HF9A 4NBNA 4NJOA 3OFNA 4JYCA 4E13A 1EP9A 1G0NA 2NVOA 3X0DA 4CV3A 3T6KA 5TGDA 3H5WA 4I2EA 2X9LA 2X0RA 4MGKR 3HO1A 2FQWA 3NHWA 3R6GA 5CYPA 2Y1IA 4CXMA 3TMKA 2NZJA 3SDZA 5DIZA 3AKYA 2YB4A 3CIFA 3K5PA 2DAPA 5J8YA 2VZ8A 4ZQBA 2GO1A 4ECUA 1DQPA 3B2NA 5G53C 4UHKA 3HCEA 1CUJA 1TF5A 2A9JA 5AKLA 4EZIA 3DW3X 1EB8A 3KDSE 1ZQMA 2QTVB 3AR6A 2BFBA 3G2IA 1JPUA 1NJ6A 2WWWA 2WIBA 3V4SA 2OOSA 4IY1A 3GUUA 1TK5A 1WXGA 1QH0A 3B8EA 3PSHA 5CFOA 4KR2A 4ALKA 5CAEA 4DR1B 3OZGA 2DY1A 3D7MA 4URHA 4I2IA 1A0OA 3FZQA 3UF0A 2FW8A 4EB6B 1E6MA 1I9GA 5TARA 1BA3A 1ZITA 2GHTA 1T2VA 2NP7A 3IA2A 1YCGA 3UMFA 4FDVA 3N4MB 5C8YB 2KIWA 5IIMA 4GMXA 3D4LA 4I5IA 3PB3A 3PY8A 4RJKA 2A9OA 2MR6A 5I9MA 2QN6A 1N8TA 3A9VA 4QPDA 4CM9A 2IYEA 3SS9X 1XN4A 5T5QA 1ULBA 2JDIA 5CT4A 5DM2A 1O6ZA 3LD9A 3U4MA 1CJCA 1QM5A 2A58A 4PL1A 2TSYB 3TOVA 2K4EA 1Y81A 5AFSA 3E1GA 3S7ZA 2D3WA 5KFWA 3KU1A 4XR9A 2IZ0A 5H81A 1DUSA 1CULC 2B4TO 3HR8A 2GPTA 3E22B 4B47A 4B73A 3IESA 5IWCA 4UAYA 3O8BA 3IMCA 5EZYB 3I04M 2EXXA 3FPFA 1Z0ZA 3HJCA 2B20A 2CLSA 2C2DA 5JNRA 3AEQB 1DIRA 1KXZA 4GMFA 2AA3A 3NG1A 3NO4A 1T4MA 4B9SA 1DEAA 3HPRA 1D6JA 2ZDHA 3VO1A 4X65B 3N7SC 2QPLA 4N6GA 1XZLA 3FFTA 1CYDA 5H80A 2FVXA 1N34B 7ICKA 3H65A 1YJ8A 2Y76A 3HJAA 4KK3A 2J6TA 2GN1A 1NXWA 4IG4A 1LVHA 2GAOA 4HNGA 4RIHA 2AXNA 2E37A 3L4JA 2O5EA 5JJ5A 2BHLA 3JYHA 4JX9A 2WJ3A 4UB8U 2YHBA 4B74A 1D04A 4D3SA 2HW8A 3HFGA 4IOMA 2WAQF 1NW8A 2LMRA 2NO9A 4I7EA 3KWMA 1UKBA 4H4CA 1K7SN 3AHFA 2NRZA 2ZBRA 2JLVA 3R20A 4HQ6A 1X8XA 4FYHA 2QY9A 3MHPA 4BQEA 2EZ4A 4X7PA 5CX1B 1T1SA 3ZWPA 2W98A 2AN3A 4UM8B 3X3HA 4FCCA 1XJ5A 2IUTA 2XTMA 1BVSA 5T4BA 3CGGA 1EFVB 2HMTA 1IB0A 3KKZA 1PLLA 3HBAA 4FLEA 3GJSA 4BE4A 2C20A 1R3DA 1IBRA 5LMNB 1MOQA 1XPJA 3PJEA 3DVSX 3W1EA 2B6HA 3P1JA 2IYOA 5HR5A 3QFSA 4E5UA 3E9QA 4D0NA 3NHMA 4MW1A 4KL8S 2YBDA 2EYUA 3KZMA 1JPVA 1QZUA 1QKKA 1Y1RA 4MGHA 4PRLA 1N5IA 4RESA 4RA6A 4RW0A 1LA2A 5L7TA 2YNMA 3KJZA 5AJTA 3B5EA 1Z35A 2ODEA 4HTFA 3IHWA 1R4ZA 2ZYGA 2GK4A 2XYGA 4O4HF 3R6TA 1H2XA 2WHXA 4YJ2F 2WJYA 1IVSA 1XTZA 2ZPTX 1WNTA 3AEYA 2PLFA 1YZ3A 2VYNA 3MAGA 3TRHA 3EPRA 4RUAA 2ZB4A 1SCUA 5CTJA 4YROA 1ZQAA 4O8ZA 4AWAA 3HSYA 3SZGA 3UKDA 3PXEA 1ZQSA 5F5XA 4KQ9A 3MCUA 1EB9A 1PNQA 3FTDA 3FKJA 5B1DA 5B7PA 2CFSA 2HI0A 2Q5HA 3QEMB 4RNOA 1MEOA 5FWAA 1UZNA 4PN3A 4MHSA 2FMQA 1DAIA 4MJ7A 2ERXA 3KAJA 3NM4A 4RCZA 2ZJ5A 5I8PA 2C4MA 2AI2A 3OPVA 2C7OA 4ZDWA 1WEKA 2G9ZA 3OTWA 1Z26A 4RNNA 3FNEA 1O94C 1D2MA 3TOSA 1RJEA 4LNUB 2CF5A 4QASA 4P98A 2AFHB 3UFXA 4RVSA 3VR3D 2QX8A 4XWAA 2ZR9A 3O2SB 3WYFA 5LA6F 4DAOA 9ICKA 4RNDB 3NT2A 3RJMA 4I27A 1HEIA 2H8KA 1DAFA 1YACA 1XJQA 1X19A 2DRIA 1N0UA 3KK0A 4HAOA 4PBTA 1WXHA 3W6UA 5LQAA 3T9DA 4J2HA 5EI5A 3BN3A 1EFRA 1FU7A 4I4IA 2WKSA 5MFPA 3JASA 1K75A 1UODA 4S0XA 2QD1A 4XQEA 2JARA 1IY8A 3V4VB 4GX5A 2WW8A 4DS3A 3WQBA 4E32A 5CDSA 9ICRA 1MUUA 5JUWA 4CLOA 3GJ6A 3X1XA 3IVXA 2BRUC 2LV8A 3FRHA 5KTSA 4QNNA 3TDKA 1AQNA 2NYRA 2E1PA 2GCIA 1TVKA 4EFNA 1V7PC 4ZAWA 4AKHA 1RRGA 4BKQA 2RI0A 4RTMA 7ICEA 4FGZA 3DWIA 5KQSA 1Z5ZA 4BC1A 1ODIA 4LYJA 2GEUA 4MEYA 4Q1AA 1BEZA 1SKYE 4HHEA 3IE2A 3IGFA 4RHXA 1EDZA 3SYLA 3WOHA 3EAGA 3TAPA 1P44A 3U26A 4O2BB 1FMCA 3DTVA 1NN3A 1QK4A 2G9QA 4WA8A 4KLNA 4A15A 2ZVQX 1IMOA 3V1MA 2OAP1 5EPEA 4EH1A 4BQQA 1FSGA 2GS9A 5A0LA 4BMZA 2GX6A 2QAGC 5AVJA 2BPFA 2IZ5A 3MGBA 2X1LA 3EBOA 4GWGA 3CUTA 2QLNA 3GFBA 1TJ5A 4MV9A 4NH0A 3L0BA 1RKUA 3ZWVA 2XMPA 3UHJA 5E3JA 4EYEA 3ANNA 2DETA 1QZXA 1WF6A 3INNA 4FGLA 2KJ8A 5HCNA 4TLAA 2QB0B 5TQJA 4RPGA 4P0QA 3VZQA 1P5JA 1Z4OA 3OQ1A 3ZDFA 4J7XA 4BQPA 3ANTA 3FKQA 1RXSA 2G0NA 3RVNA 3GJZA 1SIWA 1YIDA 1V16A 1U2DC 1HL3A 2ABWA 2YCLA 1MA0A 3GLUA 4BKRA 4ZTBA 3B7PA 3ZQJA 2PLWA 2FH5B 1K3UB 2IHZA 5K0GA 3VU9B 3FZEA 1MRSA 1XVVA 1SHZA 4NMLA 1D0VA 2XRMA 4RSHA 4Q9JA 1J42A 2EF0A 1BU5A 5KQGA 2C2EA 1YL5A 3UJ8A 3EUFA 1N2CA 4HXGA 3K9WA 4FHDA 1P7WA 2IBTA 5AVSA 1K6IA 4RZQA 4KO1S 4YC7A 4EY7A 3C2LA 3NW9A 3SQLA 1C30A 4QFDA 4HDNB 3K9BA 3QUAA 3G2HA 2DXIA 2AMYA 1SRRA 3IUMA 3RB4A 3MC1A 1RM5A 4Y6LA 2H7CA 4GOXA 4GNRA 1P7VA 1NQVA 1WKVA 1E0SA 4NYMQ 2Q6LA 2HTEA 2WTEA 1LNZA 4LVOA 2HXSA 4S2EA 2P30A 3H1AA 4HXEB 1FS6A 2XOKA 3DCNA 4MP3A 3BTOA 3HXLA 4URZR 2GGSA 4ZEWA 1XQ6A 2XMDA 1U3TA 3MGAA 5BNZA 4OXRA 2FRVA 2C28A 2JGAA 3FLMA 1CDZA 3B1WA 1WZ2A 3UKOA 3ILYA 1HORA 1QG6A 1EU1A 3M4JA 4LX8A 4ZAZA 5J8YC 1ZZEA 2OKCA 3VHRA 3ZE1B 5EIAA 1QK5A 2X5JO 1IHOA 1N25A 1DWQA 1XCGB 3VTKA 3MBKA 2PFQA 4LYFA 1DO8A 1TCAA 5BYBA 4JBIA 4KNWA 2QYTA 4AYTA 3HGTA 2XCQA 1D2HA 4ZQIA 3DL4A 8ICRA 3N05A 3BB1A 3WYEA 5J2KA 4MITA 1DCMA 1GGVA 3PU6A 3IERA 4CHTA 4FBMA 2VDMB 4OX9B 2FSPA 3CX4A 3VR4A 2D1YA 5AICA 3P9RA 1Z7EA 3QPAA 1EQUA 3VR5D 2AG1A 4YR3A 3EF1A 4DSTA 4ZMRA 2BPOA 2BONA 2D5LA 1C0PA 4EUEA 1U6IA 1F0PA 3C74A 2P0AA 4EGSA 3G0DA 1J20A 1P7CA 4NFSA 3LCRA 4QUEA 1KDOA 1IATA 3RSSA 1SUDA 5CA0B 4RQ2A 3SFZA 2RI1A 4RQ7A 4JR1A 3GLGB 3S8MA 3KT8A 4C6HA 5JZVA 2DWOA 2DL0A 2H5IA 1J8FA 1EEXB 4RHEA 1NKCA 3EPGA 4HRXA 4JP8A 1KJJA 1MNQA 4O4LF 1OBHA 3NAMA 3AMZA 4NJMB 5JOQA 1Y3DE 2ILTA 1WKBA 2B30A 4X9XA 4MQLA 2QX6A 4QZAA 1EFHA 1E89A 4R6XA 4EG1A 1DXQA 2Z6QA 3W4IA 3FWYA 3SHQA 3LKBA 1ZCAA 3N70A 3OY7A 3WYDA 3GZJA 1OX4A 3MMXA 4JP2A 2J3DA 3V6HA 2ZSAA 3ANXA 2FJPA 2QZPA 1C4OA 2X2OA 2REXB 5KYXA 3MUOA 3M33A 3QEKA 4L16A 4LTMA 3VSAA 3KSRA 4RM3A 4EGCB 4DQXA 2YMMA 3H4VA 4FVTA 3P0JA 2GERA 1JAHA 5EMHA 1UBEA 4P2HA 3EGXB 1S8FA 3NKVA 5DNWA 2HO5A 5CRIA 2Q3MA 1A7JA 2H1CA 2OC9A 3GMDA 1W87A 3KIPA 2RGEA 5CW1A 3YASA 4HXFB 3U13A 3R0XA 3ANYB 3LUAA 2OYYA 2BBSA 3HN7A 3L0YA 3NBAA 4JOBA 3TCKA 4AK9A 5IKXA 1DI0A 2ZBVA 4PCAA 3K35A 4PYQA 3GFFA 3ZYZA 4Q4DA 3RR7A 1SBIA 2G07A 1WSDA 4DSLA 3ZQ6A 4NEQA 4XGRA 1DIAA 4NLGA 4UTNA 2G7MC 3IBCA 2WKQA 1EAMA 2VHYA 1RXVA 4E22A 1C4KA 5ECGC 1M2HA 1GUYA 2XY5A 1BOFA 2OP0A 5A3QA 1QVVA 4FFOA 4UZEA 3EXAA 1GZVA 2CXNA 1Y5LA 1KSGA 3OFSA 1SG6A 4S24A 4R8LA 2YWCA 3EVBA 5JSYA 1SQ0A 3GLHE 4KWCA 1KDRA 1Z33A 2ZXEA 4L57A 2UUAB 5L1KA 1NYQA 4WCFA 2CHQA 4L4XA 1KEPA 3IMEA 1QSYA 4PS0A 4ND4A 3G5TA 2QYHA 3ZC3A 1K08A 4RQMA 3LT5A 4XPIA 4ZPXA 3TXYA 2A57A 3RFTA 5EKSA 3OA2A 5HQJA 1G9XA 5F78A 3ND9A 4GLLA 1MC1A 3LCMA 5EXPA 2YNMC 1H2FA 4DM4A 2KJQA 3LP8A 4MXDA 3V42A 1FRNA 4YMGA 3MMSA 3FPGA 3AVXA 1NKVA 1N7GA 1OFUA 1FUIA 3T3FA 5JSZB 5NLLA 4MYHA 3RCBA 4KPEC 5BQXA 1HO3A 2DQSA 4ZCMA 4ERXA 3GDXA 2FW9A 1TIBA 3D54D 3EMKA 2PZJA 1U1EA 2RHCA 2ACWA 3OE7D 1BKSB 2PQMA 3CU5A 4BN0A 4YQZA 2CNBA 5K0ZA 1DBIA 3HJUA 3Q2KA 4ZPJA 5GONB 2LWIA 4QDKA 1EPUA 2CLMB 1XWLA 3TTTA 2EZUA 1F5NA 1HL7A 3B6EA 2ZZNA 3SQXA 2O8EB 1V9PA 3FHTA 1QQTA 6NULA 1G8JA 2W37A 1NNI1 4KLHA 5E8RA 3AU6A 4OM7A 2CZQA 2JVKA 5GQSA 4NKRA 4CTNA 4XA8A 4MUJA 2J0VA 5JFTA 3SX0A 4DYHA 1E79D 4DDVA 1XEXB 5FOXA 5HRUA 2QDKA 2OO7A 4MIKA 1VI6A 3QHPA 3LX5A 4Q12A 5KCZA 5IZ4A 2JFZA 4B4OA 2R6AA 4KO3S 4N5HX 5JC1A 3DEIA 2O57A 2ENWA 1OCEA 2V3VA 2ZUUA 4OI1A 2WMYA 2RLTA 3NOQA 3V3TA 3WS7A 1ODCA 3GH1A 2QUKA 1QF6A 3UJ3X 3QYJA 1MJGA 1NR5A 1I0IA 2W6ID 1MG0A 3KPUA 1RJFA 5J0TA 1SHTX 2OB2A 4Q19A 5ALVA 2BP7A 1V4NA 2UYQA 2QVBA 3V8EA 3BHNA 3PC3A 4EY3A 3KSAC 1BFKA 3CPJB 3LY8A 4YCDA 1OFIA 1X14A 2V7QA 2RHFA 2XUQA 1HNWB 3RSOA 1IJFA 1PJ2A 1T36B 4TXMA 3H4TA 4D98A 1RXWA 1UZMA 3GEHA 2RI6A 2ECPA 4IZHA 3S3TA 4G0XA 3ESCA 3OPNA 3HDJA 2PX5A 1YR2A 2R8BA 1U2GA 4OHPA 1II9A 1SVKA 4BO1A 2BTQA 1RWPA 5DMHA 1TCVA 3UMYA 1CY7A 1FQKA 4NCNA 4RSGA 3CRNA 4X1YB 2I4RA 1ML4A 4O0MA 3QF4B 1X66A 3PFHA 4QZBA 3ZV7A 2OFPA 1GQRA 2NYVA 3EH2A 3HKEB 5B1EA 3HRIA 4LXUA 3AFGA 1Q0SA 3VA7A 3EEFA 5FP0A 2W9CB 5B1IA 4G85A 3UT6A 4K2AA 1EESA 4KFUA 3GK3A 1G8KA 3WLHA 1IBSA 1BKDR 3Q72A 4BX2A 4D6XA 3SBXA 4OLBA 3F6SA 3KOMA 1PK1A 1UKVY 4J49A 4B3TB 5KFBA 2N1MA 4ABYA 1BH2A 4RENA 1ZU4A 3EQ9A 3OAAA 4DL5A 3R76A 3NVAA 2Q0SA 3Q8RB 3EC7A 1ZK0A 5CDFE 3C6KA 3RBAA 3BIWA 1IXKA 3DV0B 2IYPA 4PLGA 1VCIA 1QRTA 1PJLA 3F6YA 3T3MB 1VG8A 1PFWA 5LWQA 3IAS1 3KQYA 5G41A 1BO6A 2XPCA 3ITKA 2ZE8A 5J5CA 1WWUA 4GOJA 4XAQA 5DRYA 5LL6P 1H1LA 3Q8KA 4PQFA 4YUYA 2E4YA 4XTCS 1VCMA 3DUFB 2IV2X 3IDFA 3IX7A 4C43A 2HFJA 1HDIA 4KLJA 2HEIA 5HDBB 3ADOA 5HIIA 1U8EA 3NVYA 2QYOA 4GU5A 4Z9XA 2E89A 1K2VN 1GA1A 3GFKB 1JA0A 1W6RA 5ESRA 1RHJA 4N0DA 4E07A 4MKZA 4K40A 4S35A 1E9SA 3L0DA 2YL2A 4ITRC 2P41A 4NECA 1IZ0A 1ZVMA 3PJRA 1GAWA 3LL4A 4IIHA 2CHGA 1SJ9A 1ZIDA 4TL8A 4GKKB 5BN4A 4E33A 3ESBA 1JFVA 3SU8A 4WA7A 3P27A 2HCBA 3RWOA 1RRKA 1WTCA 1PJ8A 1ZSNA 1QX4A 1EP1B 4C6TB 4PAQA 2AW5A 3CEPB 1CCWA 4OXQA 3IPLA 2LBOA 1VCOA 3TEJA 2G4CA 5E4JA 5JNUA 1H38A 1G20B 1R6TA 1WY7A 1ES9A 5TMEA 3ICOA 4QGAA 3KNZA 4O33A 5L45A 1O0CA 3K3PA 2FB9A 1KIFA 4YJ3B 3RRBA 3LGSA 3PQ6A 2E4WA 4WQMA 4MVCA 3ZE6A 4A8EA 3ZBUA 1OBVA 3KDAA 1L5SA 5DP1A 1H22A 4RGQA 2VHUA 4XWTA 3SSNA 4UAWA 4EYQA 5KYTA 1KDYA 4AG5A 5D2CA 2ZU6A 3PR2B 2IS6A 2UZ1A 4L02A 4FWTA 2Z1DA 2RGYA 1UDBA 5EPOA 2C8LA 3RU3A 3X1YA 1QLJA 1LDEA 2G5CA 5LYJF 4Z9YA 1R6XA 3OBBA 4Y2PA 3CF4G 1P80A 3O1HB 2HPAA 3HBNA 2BFNA 5A5DA 1YDHA 2BM0A 3CSSA 5DGBA 3QWFA 2BKXA 2KV2A 2ZUEA 3NDIA 4N5IX 4GHWA 4M98A 1GAXA 4LJ5A 3B3JA 1KYWA 3QLJA 3AQFA 1FF9A 4L8VA 2NUBA 2WU8A 3KEOA 2O05A 4CCHA 1P2BA 5YASA 4JHXA 1G6Q1 5A05A 2V6IA 2ZW9A 4DQSA 3PQDA 5DK4A 4M0KA 2DHQA 3JQRA 4IUYA 4I6GA 3ONNA 4GH5A 5E1OA 2M2IA 4BNYA 2M6KA 5HF5A 1XZGA 4G9GA 2KFNA 3RGGA 4KSBA 4NZ9A 4BIIA 3J81j 3B6JA 4CF7A 4BXOB 1BKYA 3CLTD 1PHRA 1YZNA 2V3WA 1PZGA 4TWJA 5CEFA 5J1TB 4NX2A 1RAEA 3LTNC 5HG0A 1VLMA 5JSKA 1IN1A 3TJRA 3SC2A 2A1UA 4WUVA 1GYPA 2R00A 4LK2A 3E58A 3HFSA 1ML3A 1DKOA 2PYDA 2FOIA 1LK7A 1FP4B 2GVNA 5CFPA 3PVCA 4QIWF 2Q0XA 3QIVA 3L7NA 4OYYA 1W0CA 2WM3A 4RD1A 1X1DA 5FO1A 1QPGA 1RYSA 2FFQA 5LLTA 1HSOA 4OK6A 5HTOA 3LYAA 1AV7A 4BVGA 4JI7B 2CMGA 5C2JB 2DFNA 2PXIA 3ER9A 4X1KA 1R4MA 3W5AA 1UFKA 1H2RS 2ZATA 1P45A 5E0KB 4E2FA 4TUYA 1UQRA 1L5UA 5MGBA 1SUCA 3BJZA 3VZPA 2XZOA 1QIDA 2AOUB 1PO7A 5JY6A 1BNPA 5IT4A 1QAMA 1E1LA 1BFDA 1Z0KA 3IULA 5L95A 3HP1A 1FFCA 4W5RA 4P34A 1V8PA 3NYQA 3G2MA 4E4TA 3TPFA 1R16A 4F7WA 1H65A 3COPA 1GR1A 4P7BA 1UBCA 2YV4A 1YJXA 2PI5A 1GNPA 4RNMA 2VNAA 2R4QA 1RRMA 4DJFC 1ZC3A 2VP5A 3NS1A 1D9ZA 4LOLA 4FYKA 5HHTA 3OQHA 4KLMA 2P6MA 2PHZA 1FJXA 3EIHA 5KNCD 2H0RA 3SCZA 2F55A 4NDZA 2GAJA 3DAGA 5EWEA 3CF6R 4GKBA 1P5ZB 1ST3A 5IC6A 4F71A 4Z51A 2H08A 3F6CA 2L69A 1XE3A 4M89A 3FSEA 3E9DA 1FXWA 1BNOA 3N97B 1DE0A 1MN6A 1YE8A 1DJQA 2Q6VA 4PZUA 4Z8YA 5LU8A 2KZZA 3CKKA 1V5WA 1XTJA 2FOXA 4RWZA 2B7BA 4EKIA 1UDCA 4WCFC 4JP3A 2NSJA 1L5WA 5ETJA 1M6VB 3ETNA 3I9OA 4I9UA 4HMOA 3HZRA 4BJ5A 3PZRA 1N3YA 3O7WA 3D4PA 2R6DA 2Z04A 3RVKA 3DE7X 1E3TA 3GRCA 1UMBB 2B83A 5A3RA 3IP4B 2IY7A 4L07A 4J0KA 3PBKA 2K8BB 2OESA 1W4LA 1HE2A 1VKJA 3NWOA 3EVTA 2JBWA 5TLSA 1R5OA 1EFLA 1M2VA 4JAVC 1F2UB 4IRXA 1E7YA 4OQXA 1XOIA 3BMOB 5HM8A 4TTRA 1DIHA 2DP4E 2Z43A 1E7RA 1IWOA 3MG9A 4FFBA 3SI8A 3KZXA 2HIMA 1B93A 3BRSA 4R3UC 3ZWNA 2H1IA 3PFGA 2G3YA 2YB1A 4CCWA 2WAMA 4TSFA 4YT8A 2ZYTX 1H3EA 1TD9A 4L8GA 1UWCA 1H8HD 1JXOA 3PEFA 1EFDN 2O48X 2GN4A 3HT3A 4O0LA 1R4NA 2M1XA 1JH9A 5BOSB 3DVLA 4PQYA 1R8SA 1JI3A 2Y2UA 1Z4MA 4HQNA 5A0TA 2X76A 2PQ6A 1HKUA 5HDQA 4R2IA 5BSRA 3RFVA 3BXXA 4KPUA 2ZTEA 4LDQA 3H1GA 4JYZA 1YT5A 3UEOA 3OSPA 2UZIR 4ASUD 3H4BA 3MJVA 4P4MA 3B2QA 1J00A 2NRVA 2YRWA 3JD2A 3HG7A 4EG6A 1Y3HA 5AT1A 2IEYA 2ZRGA 4Q45A 1CJBA 4IQWA 5K8IA 4HAIA 3GLFA 4AJ4A 8MHTA 2QGZA 1KP3A 3ETHA 3KTOA 1E5DA 4YRMA 4IGFA 3KCNA 2E8PA 3E5RA 1HYHA 3WLEA 4Y2TA 1ZQFA 3TB6A 5AVUA 4PQGA 1KFTA 4WW0A 4I8DA 4RIIA 2ZITA 2OV4A 5JHHB 3BFPA 3TG8A 5HKKA 5GTIU 1PNVA 4A0HA 4LJAA 2J4CA 2O50A 4P4TA 3RUAA 4OHKA 1P4RA 4ME6A 4QWMA 1GU7A 2EQYA 1JPJA 2YH2A 2C3OA 2X5OA 1R10A 3A06A 1COKA 4NNOA 5BYAA 3NB0A 4UXHA 3VVBA 5FOUA 3MQFA 5LM3A 3LQYA 5IN5A 1JG6A 4L85A 2GLTA 4BWMA 4LZZA 1GZ4A 4RPZA 2HU5A 2BQ3A 1L5GB 2J6IA 2R86A 5IZCA 3J81k 5D4BA 1K89A 2BEUB 4QWWA 1P0CA 4Y2SA 2HC9A 3INYA 1Z36A 2ZKIA 3IBYA 5EHXA 1XSPA 4V3CA 3CZQA 5P8WA 4EG0A 2EAPA 2IX9A 3JQAB 2HU7A 1PW7A 3V55A 5J0SA 2EP7A 3HNRA 1NP6A 3EFOB 5GVSA 3U49A 4J94A 1U2GC 4K88A 3WNDA 1RP7A 3REGA 4BVJA 4WXYB 1H6BA 3BD7A 3TMYA 2OWEA 2Q2VA 3L9WA 3FYUA 2KG5A 3FVWA 5EJAA 3E2MA 2PSFA 1OB5A 2PZKA 3SYTA 3T7JA 2F8SA 3IHTA 4P81A 3S1AA 1VSTA 2NW6A 3LVRE 3N07A 4RTPA 4ECTA 1CSEE 3GP3A 3ZXIA 1NONA 1Z17A 2UZ3A 1E9VA 4OLHA 1O96B 1ZH4A 5K2MA 2W9MA 2ZVJA 2B0CA 4DCGA 5I9IA 3FHJA 4HY3A 2XMGA 3MMPA 4U02A 3COWA 1ZJ5A 1CUYA 3PDHA 3T06B 1I24A 3GVXA 3KYIB 2CHFA 2WA1A 2W00A 3P2OA 1S0MA 4HMPA 2WE8A 2HLPA 5DE3A 3HXMA 2BGIA 2A0FA 2ADFA 4GOLD 4JL8A 4S1WA 3KQTA 2J3EA 3N5KA 1SXIA 3I04A 2XUPA 3GV5B 2O2IA 4I19A 4I6EA 3GNTA 4G5XA 1K63A 4CCYA 2FQXA 2Q7OE 3KXLA 4EEYA 2D06A 1M1YE 1FPMA 3AH8A 2RKOA 2ZT8A 2IHUA 5EE9A 3OM8A 4QJ4A 2ONJA 1FZQA 5CHGA 1ZA2A 1R7RA 1EJBA 2GSWA 5H1YA 1U48A 3ETLA 3DH0A 3AB3A 2GT1A 4LBZA 4CKEA 2PZGA 4ILKA 1L5FA 1D8LA 3U40A 3FTCA 1QCZA 2ZIVB 3T52A 5A5FA 2OUKA 1BDIA 5EP1A 2B0JA 5KSYA 2IH5A 1KSJA 3NIGB 5A06A 2ZYIA 1R00A 3PUIA 1LTQA 2JJ2A 5LQRA 2V3CC 3W3AD 5IVPA 4IP0A 3DQZA 3B82A 3D4BA 3UMCA 3I73A 4V0QA 3MTQA 4Q37A 1SM4A 4K81B 5FWNA 3O4JA 3R74A 2GVZC 4D80A 4QZCA 2EL9A 4X84A 2JAHA 2PT5A 4J9UE 3MM4A 4HLUA 1ZIPA 2QQFA 4NBVA 4ZD6A 2RIRA 1UPUA 2GUGA 3ZIAD 5K0NA 3VOTA 3BHMA 3JQPA 3X44A 8ICIA 3GHHA 2PEYA 2I2CA 1DLIA 3WWDA 1MXHA 4G97A 1CUSA 3ZHYA 4DL3A 2BL4A 5BW4A 2J9ZB 4GM4A 1ZQIA 4TVOA 5B5EU 4TUQA 1FJ2A 3MS7A 7ICNA 5KX5B 1JDZA 1U0SY 3P0IA 9LDBA 3P2IA 3CLUD 3QKUA 2IF0A 4ED8A 3N8GA 4HGOA 3VH3A 4DIKA 2YWHA 1FP6A 5E6UA 3F9RA 2X0NA 1C8LA 2Q5JA 3K0HA 1M2GA 4BBJA 2QNIA 1L1QA 1O87A 3D5QA 2PX4A 2O2JA 2YWJA 3SDBA 1R9GA 5HF9A 3PR3A 3PHHA 5HHIA 4L73A 3PRYA 1CRPA 3TQOA 3GU3A 4JEMA 3TI9A 1PKEA 1P4HA 4C0QC 2OBMA 3LHIA 4RTLA 3OMLA 2WPDA 2ZRHA 3D8TA 1C1DA 5AK6A 1A0PA 1E2FA 5A5GA 1TA9A 5BR8B 4IDAA 2DWQA 2B4AA 2W3RA 5JHGB 1UPBA 2KP7A 4TYQA 4J0DA 4JJ4A 2CXPA 2P8JA 3SE7A 1S8NA 1ISMA 3TTXA 4YMTA 4QW8A 4RQ0A 3VHXA 3C6ZA 1XXLA 2VQFB 4N47A 3KD3A 2MSEB 1NKBA 4D3FA 1YWGO 1NG1A 5KT4A 3IA7A 2CDCA 3QP9A 4LDRA 2BFEA 3V5NA 1Z15A 3KWFA 2PBZA 1TC2A 1QFJA 1ATIA 3EQ7A 1N36B 1SBHA 5JQGB 4RZXA 1YQ9A 2ALZA 3RJHA 5TDHA 2CUKA 2ECKA 2OEPA 5B1SA 4RJJA 4W99A 5ADVA 1IDN1 3H0EA 2R00C 1YCDA 1QLHA 4Z4CA 1P39A 2YJ5A 2G1UA 1GPH1 1GQOA 4NPCA 3F5QA 3IAM1 2E7ZA 3CMCO 4S1OA 4HS4A 5J0YA 1NXXA 2HN9A 4ENVA 1AS3A 1SXQA 4S0ZA 1PEDA 5ARDA 4W9RA 1G8FA 2WR8A 4B6GA 4WZZA 1KP2A 3BXFA 3NHSA 5EJ8A 1NXSA 2XXAA 3HEMA 4YB8A 3LX4A 1R0CA 3FFWA 1G0OA 2H17A 1DAPA 3G0BA 3W1VA 5AKJA 2O1SA 5K99A 3PWZA 1X9SA 3LYLA 2XCOA 4P8RA 3Q15C 2VUHB 3O6VA 4RVFA 4NYJQ 2LI6A 2JFXA 4AU1A 4JYMA 5KTPA 4D4LA 2A88A 1XLTA 3VO2A 5IJZA 4NOLA 3L8DA 4YJFB 2F43B 1JKJB 3G8AA 3H2BA 2JLUA 1OMOA 4H7PA 1FVXA 4PX3A 3BHJA 4DV1B 4XYLA 1OA1A 3RQIA 2VTBB 3SR3A 1XB2A 4CMBA 5JU5A 4NCBA 3DM9B 1P7PA 3KL2A 2B69A 8ICYA 1JWLA 3I0MA 3TUJC 4BN5A 3ZH9B 1SPBS 1LRKA 2JH8A 1IBCA 1RPZA 1JAXA 1Z2EA 2RHTA 3NOXA 2HW3A 5AVXA 5GGYA 1Z8DA 4NVRA 2W8LA 3R5HA 2UYYA 3BXHA 2CNWA 1VM6A 4AZVA 1XTTA 4KYTA 4KTTE 2VDOB 3VU3A 4EHDA 1A82A 1UOOA 3FRJA 2EKDA 2QAJA 1Z6ZA 3HVRA 1WXWA 1V6SA 1XZDA 1N3LA 1F20A 4UE2A 1E60A 3EVGA 4CQJA 1ZW6A 1HLGA 2CXSA 3I5MA 1YQUA 3IIKA