2ZIWB

Crystal structure of the mus81-eme1 complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
318
structure length
228
Chain Sequence
KHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRVEEPTVLVLLRAEDITAKTAGKSLVIVDQEKSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRRIGPELSRRIYLQMTTLQPHLSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 48
structure length 228
sequence length 318
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziwB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ziwB01
2ZIVB 2ZIVA 4P0QB 2JNWA 4P0QA 2ZIXB 4M6WB 2ZIXA 2BGWA 4M6WA 4P0PB 1J22A 1J23A 4BXOB 4BXOA 4P0PA 2ZIWB 2M9MA 2ZIWA 2ZIUB 1J24A 2ZIUA 1J25A 2A1IA 2BHNA 2JPDA
chains in the Genus database with same CATH superfamily
4W1PA 1VE5A 3ONNA 5JNUA 2W03A 5KWJA 3IS3A 1G8MA 1R74A 3JY6A 5KYWA 4YQEA 4ITVA 1XRNA 1P73A 2J6CA 2Y1DA 1EVYA 4URWR 2P62A 1Y6GA 4RACA 2QT9A 2PZAA 5HFAA 3C45A 3MOIA 1H4VB 1LLDA 3CF6R 4WCFB 3LWNA 4IQ4A 5C18A 3C2MA 4MOWA 2CFOA 4UB4A 3T9AA 4F7WA 3LDUA 1JPNA 2K4MA 4JQSA 4LF7B 3TS1A 4A0FA 5KQPA 5FLEX 1GUAA 4QX6A 1MB4A 1H9BA 1PEYA 3QVJA 1NU6A 3KYDA 1F6DA 4KGVA 2PAAA 1ICEA 1ZS9A 3VUFA 2EFEB 3FDIA 4Z4QA 2Q1SA 4IL6U 4YCXA 3NTVA 2FQ1A 1T9KA 1S3IA 3H11A 4PHTA 3CONA 2YTUA 1BX0A 5J0OA 2O7RA 4ZYVA 6ABPA 5AHRA 3BQTA 2HREA 1WBDA 3IMEA 1XU4A 1WZNA 2I2XB 4XDZA 4R01A 5FRDA 5C9ZA 3P2YA 4WJKB 4Y2GA 1JB9A 1BJRE 2A58A 2FWJA 4JUZA 3ETJA 1LDYA 1CDZA 3ESZA 3F9CA 4BMZA 4UMDA 1SUSA 1T1SA 5IVHA 2HTFA 4LFBB 1KYYA 2IU4A 4GF5A 1PR1A 4Y2XA 4CEJA 5I9MA 3PGXA 3B82A 3T5BA 2REQB 2WSBA 1W0JA 3ACCA 3QWIA 2XBMA 1U45A 3OT5A 3LIIA 2RGEA 3L3FX 1QB8A 5JD3A 5C8YB 1KSHA 4OQPA 3ACDA 2IA6A 3S4YA 1D4OA 5BOLA 3I32A 2ZE5A 4MVWA 5DTMA 1HT2E 1QVZA 3UG6A 4M2YA 2R8HA 3AUKA 2O8FA 4R8MA 2WSMA 4PC1A 5CT4A 4ZOQI 2OCIA 4GXIA 2ZBFA 1V7ZA 1QO9A 1VPWA 5E95A 1U7OA 2ZT7A 1VZ3A 3SX4A 4M0UA 3H2HA 1E61A 5EPEA 1K1EA 2PUTA 5CIWA 3C43A 2K8CB 2ZDHA 4X00A 1K27A 3TF5A 4PHCA 1HTTA 4RH0A 2JLSA 4P4MA 3SBEA 8ICZA 1IY9A 4RKEA 1EVZA 1X14A 3G5UA 3EWSA 3RTAA 3QUSA 1SG6A 4MW4A 4L22A 4YRLA 3AR9A 1Z5UA 1RYFA 2H06A 3LNCA 3N2KB 3HYTA 3DV0A 1GO2A 1E6EA 4EFMA 4CMGA 3J80A 1JPUA 4CKEA 7ICLA 3ANYB 5D51S 4KWIA 2YZKA 4NYIR 4QGBA 1F1BA 4NCAA 1V8OA 4WKBA 4K9LA 1A9SA 4TSFD 4ISBA 4IJVA 2Q07A 1BFKA 1XXHB 1MB0A 1XNSA 2XZOA 4FDMA 2XMPA 4I66A 4NS1A 1M0EA 1KTVA 1GD1O 2H65A 1R3DA 1E0KA 3GT7A 2VQEB 4DL5A 4ZVNA 1TEHA 2QXYA 2YICA 4CEHA 4XB6B 1UHUA 1UPTA 3KOYA 2OVFA 3C41J 3A32A 3MR5A 2HYDA 2P4EA 2KZ3A 4FHGA 3CO5A 1NK8A 2ALJA 4K0RA 2VXBA 3FJOA 4K8RB 2XXAB 2JGDA 3NT5A 2EGHA 2GXAA 4J07A 4B82A 3H9JA 3B5EA 3NGDA 3K0HA 2Q41A 2KEYA 3ZE6A 1C4KA 5F12A 4OMUA 1ZVJA 5CA0B 2YJ4A 5DTEA 3LRXA 5IKPA 3TNYA 1H9AA 2W58A 3P0FA 4ZVPA 1CZKA 5E1DA 1DJLA 1UDBA 1YAJA 4IFIA 4P7KA 5HIMA 5JBQA 1VLBA 3PNYA 4HPWA 2WWRA 4M38A 3EGDA 2I0FA 1KR5A 2RHLA 3OZWA 4UFPA 3GUUA 1TYAE 2WAOA 5ALYA 3SJBA 3ETEA 2VUIB 1T0IA 5FOWA 2PD6A 1XRQA 2Q1YA 4RUCA 4PFJA 3AESB 3GEPA 4ZDJA 3AEQB 4I5GA 1GGKA 1N0HA 1ZHHA 4QJBA 2AC2A 3MBYA 3RFXA 3M33A 2I6GA 4A6EA 5KFCA 1GSAA 2UZ3A 4IQVA 3OTQA 1LBSA 3PX7A 4F21A 6YASA 2O59A 4B43A 3T7JA 1WO8A 4RHXA 1TYBE 3RRHA 4R05A 1T94A 2BYTA 3FWZA 1RC0A 4ML3A 4QOFA 4U7TB 1KC3A 1ODKA 4DSIA 1TJNA 3UK7A 4ND3A 1WUKS 3D3QA 2PS9A 4MGKR 4OM8A 1DHRA 2GM3A 3KJFA 4CM6A 3DNMA 3HB4X 2JEGA 3LX6A 3QLVC 3T3HA 2GYWA 5B3JA 2OD9A 4G5FA 2I2AA 3M0EA 5HKKA 2KOBA 1AROP 4LX8A 3JPPA 4BE4A 2GLEA 3BERA 5HK9A 3GMDA 4ZT7A 1QLNA 4RQ1A 1TJ4A 1CNMA 3IH5A 4E5SA 2XWSA 2ZB3A 1OWLA 3ABRB 3OA2A 1G7TA 1ZZGA 3TW8B 1NK9A 5KG3A 2IX9A 2D3DA 3G2IA 1TTQB 2MUTA 5GJVC 2ZTEA 1FRFS 3PSHA 3FYSA 2NYUA 1QKIA 1UCFA 1EGVB 4FWIB 3V4ZA 5EVJA 4M9LA 5J0YA 2E8NA 3EXHA 5A4AA 3BFJA 5AIBA 2QTVB 4XXHA 4R81A 4ZP1A 1KP2A 5HQJA 3LUPA 5IABA 1H1LB 3LGSA 3CUWA 1PO7A 1RYZA 1BYUA 2N1BA 4M9NA 3JYLA 2C98A 3COSA 3INNA 4GVXA 2AGPA 1D07A 1R5JA 3M6ZA 3TQFA 2VFAA 1NSTA 3IP3A 3TZBA 1ZH2A 3HWSA 3VYUB 1HEIA 4M37A 4BXOB 4D5GA 3QKTA 4Q37A 3PPXA 4KODA 3OWHA 2HD4A 3QIVA 1OYWA 3PHJA 2IUEA 4MVJM 3RAPR 3LQ4A 4XYMA 3RHSA 3R5SA 3B6ZA 1NOMA 4FR5A 3ZLUA 1OFUX 4L72A 5IULC 4Q4AB 4IX9A 1G59A 4PCLA 3A36A 1B8OA 4QW8A 1W75A 3OEHA 4GX1A 3IOMA 5FOUA 3W1VA 5HCIA 3RU7A 1TB4A 4ZYWA 4O2AB 1RZRD 2OBYA 5CM8B 4CV3A 1GPLA 2VT7A 3RHZA 4FXPA 4HK4A 1KSPA 1TPYA 4LTDA 2PXHA 2O8DA 1P2BA 4EJSB 1RR6A 3AMVA 5FBKA 1Z17A 2BCQA 3DZCA 2EYQA 4PQRA 5F73A 1NHGA 5LLTA 5KFUA 3U7IA 3HBNA 2XMSA 5CRXA 1QGUB 2ISOA 3NWEA 4EDFA 3PR4A 3MQFA 3BAZA 5JTIA 1W8DA 2BHRA 1O77A 4I3GA 2WNIA 3W8NA 2ZUTA 5JU6A 3OO0A 1C30A 1HRKA 3QXJA 1QH8B 1RPNA 2RBEA 3GJ7A 4V0OA 5FX2A 3ISCA 2DFPA 4BV3A 3K4GA 5SYNA 1M2GA 1H3NA 5EN4A 5J1TB 5CCEA 2NZVG 3FAKA 4GKAA 2EZZA 4PHHA 1OA1A 3OIYA 3NUQA 4EVIA 1JQ5A 2ACKA 3V7FA 5IT9A 1ZSNA 2DBVO 2EFHB 4JSYA 4UU7A 1XDBA 4ETWA 2GOYA 5DW3A 1IJFA 3PXDA 1J9GA 4ED2A 2XJ9A 1T34A 1K7FB 2IYFA 2AKEA 2YJ5A 3ML1A 1SIJA 2P27A 3HYNA 2E18A 2WPNA 4RHYA 1MOSA 2H85A 3ISDA 4MQFB 1BXGB 2WJJA 4K8OA 4F11A 2O3UA 1V38A 1NVEA 4AS3A 2MSKA 1C0PA 2FFJA 5ADWA 1JILA 5IWAB 3ALRA 2YBDA 1WD7A 1CUFA 5JS8A 3M9MB 1I4TD 3GDHA 4C7JA 4KAXA 1H2HA 1GNQA 3DLCA 1K2WA 1XVUA 2OK7A 4GYJA 1BCSB 3R0QA 1WB4A 3EFBA 1KZ7B 4BLRA 1M2EA 1U0NA 2WC1A 4MRMB 5HWSA 4II2A 4CWAA 2ZJ6A 1OT5A 4RVHA 2BHNA 1HK7A 3H05A 4E1AA 3ER9A 4EWLA 1PR6A 1GG2A 2UZAA 3LHIA 5IZCA 1X3LA 1N75A 3L6RA 4M9GA 1ZIYA 4JU8A 1ULTA 1WZUA 1NGSA 3WIOA 3EE6A 3VHRA 5FOVA 3PRYA 3GLIB 1Y3FE 2GN8A 5JVDB 1Z5VA 3R7WA 4AJLA 2VHTA 2V97A 1VLVA 4JLWA 4E13A 2W48A 2A1JA 1Z6TA 1L7OA 1VJDA 4AJOA 4FGSA 4BAZA 4RIFA 3NALA 1SOVA 4M1KA 2P75A 5CDFE 3QPVA 2R97A 4PYQA 3MCUA 1KY3A 1XD9A 1ZD8A 4BN5A 2O8BB 4FCVA 1I80A 5JMWA 4PG5A 3KOZA 2YWCA 3AL0C 4IXNA 4HP8A 1Y0BA 3RR8A 3BREA 5KAMA 2E6KA 1RQLA 2KBEA 9ICWA 2QRNA 4V02A 2F7SA 3KE9A 4EITA 1E59A 4CKBA 4B9LA 2ACVA 3IR7A 5B3KA 4MS3A 2CWDA 4F2SA 2PMDA 1DKUA 4EYSA 1MC5A 4DA7A 2ZI9A 1NN3A 2B1JA 1FUYB 2NXNA 3LKZA 3I6ZA 3OQ6A 3QVLA 5D4BA 3EH1A 2JD0A 1OOEA 2FJPA 3PGJA 7ICRA 2WWXA 4QGHA 2XICA 4UQOA 1GCGA 5JAIA 1C7IA 1C81A 5JAZA 3PO4A 2GPJA 2AZXA 4I46A 3WLJA 4LC1A 3B6IA 1FW6A 5EXTA 1A2QA 5DNYB 1TC2A 3AG6A 2O2JA 1Y8RB 3GGDA 3O84A 2ENWA 2JI7A 1Y4ZA 4JYMA 4RKQA 2BELA 3SXUA 4OIFA 1JR6A 3T3IA 3IEIA 3TOCA 3DPSA 4DV5B 3QLVA 2W9BB 5K99A 1YXMA 1KFBB 2J3MA 2DZDA 2GEJA 3FM9A 3T3EA 4ZZ0A 1Q2UA 4BZPA 2RHJA 4OXNA 4UPDA 5IBCA 4UEKA 3RVBA 3UM9A 4B87A 3W6OA 1GPH1 4EHFA 5DKFA 1GAQA 4UDXX 1SL1A 4FP9A 1S01A 2O7VA 2OORA 4EB3A 4CEIB 2IY7A 2X5JO 1Z74A 4XUGB 2IPAB 5EQFA 5C1DA 1CY0A 4NL9C 2K7ZA 2BJWA 4ITUA 1Z5GA 3DKVA 1UDAA 1AV6A 5K9ZA 3C3KA 1QIGA 1K68A 4EIWA 3NBQA 4TQGA 3IT0A 2ZTSA 2OV6A 4ND2A 1GTRA 1V2HE 3ZZUA 3DWGA 1SZHA 1SKYE 1U8EA 4BNXA 3NM6B 4QW9A 3STVA 3PJEA 2GK3A 2ZIGA 1C1HA 5CTJA 4ZRMA 3PJRA 1FTYA 3NXSA 4OP1A 1U0OC 1A98A 4C2UA 4UBLA 3KB6A 1WXEA 4FO6A 1LS1A 1GKKA 3KAQA 2QARB 3X44A 2GN6A 4I29A 4XTRA 4MJXA 1K63A 3S1SA 3UFXB 1ZMXA 3HCOA 1E3WB 2AI1A 1ZOIA 4FEGA 3LXMA 1Q74A 3QKSA 1I7QB 2HNKA 1UFOA 2LE0A 5GADl 1B74A 3T9CA 4MIOA 4OX9Y 3EPPA 1MVOA 1U3VA 4HVAA 4YXWD 1PAUA 4Q43A 3SZRA 2AE2A 5C7YA 3HCBA 4BUCA 4DEYA 1BU8A 3GLGB 4GDFA 1R15A 1G6HA 2DOKA 3OQVA 2PXXA 3WR5A 1H42A 1DIOB 4KH0A 2ZJ5A 4YXMA 5JSYA 4E1VA 1ZJJA 1RWXA 4X84A 4K6KA 2QG9A 4JUAA 5BV8A 2RHMA 2OB2A 2XLBA 1KXJA 3RVMA 5M34A 2BKUA 2RB4A 4L0QA 3X2EA 1KK3A 4EA9A 1ADFA 3KEFA 4TXLA 1JFVA 1I6WA 5JI3E 2VANA 1G21A 1RYUA 3I3OA 4OF4A 3KD3A 4QUAA 3SI8A 5ALWA 1U2PA 5TF0A 1ARZA 2DERA 1KI8A 4QXPA 4X60A 1X94A 3NETA 3SR3A 1VCNA 4G0VA 1TT5A 3AFHA 1F8XA 2CE7A 4J75A 2IYQA 1JJIA 3TFQA 1NNEA 1UK8A 4B5LA 1GSHA 4K9MA 2OE2A 4YAKA 3DG9A 5TJ9A 4XB1A 4NG4A 4OXQA 1XROA 2MA1A 1ZC3A 1GL7A 3RSLA 5IBPA 5CJPA 4JBWA 4K9RA 4YJFA 2NYAA 3CBQA 3ADDA 3RYCA 2P6PA 1ZQRA 5U4XA 1XYYA 4F3YA 3CRRA 2Y3IA 1K6XA 1OU0A 1OBFO 1HYGA 4OBEA 2SHKA 4EEKA 2EOAA 2N1RA 1ZCFA 3UJAA 1WDWB 1W36C 2XGSA 1TU0A 2Q5FA 4BX8A 3L3BA 3AR6A 2GPYA 1IMOA 2BKAA 3SYTA 4TM7A 4YV2A 3RM3A 2O3SA 1N0IA 2W11A 1IL0A 3O9VA 1DAEA 2OHOA 5CB4F 4ED0A 4CU5A 1L4UA 3D3EA 3EAQA 3L79A 2FRDA 3EVEA 5HTOA 4BRSA 5J0QA 3J81A 4FT2A 5KMGA 3AOEC 3ZBQA 1N2XA 2RHFA 4F92B 3U17A 1CFZA 1E2DA 4DY6A 1QK4A 4L6CA 3WK7A 4MQEA 3G5MA 3FBGA 2VRCD 5BR8B 3RVQA 2PX2A 1VPLA 3RAGA 1O5OA 3N05A 1Z00B 2HMAA 5E2AA 3EIFA 3TMAA 3LT1A 4KX3A 3RYHA 5IG2A 3BGDA 4LE0A 4P3PA 4RUAA 3UBMA 1VQ1A 4IZ6A 1YZVA 1N48A 2LCFA 4M1YA 3ZHTA 3BRCA 3DM5A 3LOUA 4PPYA 2ZS8A 2HHHB 2VF7A 3H9UA 2Q62A 1L4EA 1A04A 8ADHA 4MVJH 4O4IA 1CD5A 3L0OA 1KU0A 2Q7XA 5G41A 1JHRA 2BFOA 3LUCA 4LF8B 3ICQB 2I1LA 3F7OA 2PVSA 3H8MA 1OC2A 1T1RA 5CEJA 4P1ZA 5KSOA 3UHJA 1S2IA 4HUJA 1M34A 2ERXA 4ENQA 4DL6A 3MWDB 3ZZ0A 1DJQA 1YQDA 2O2SA 3U3DA 1RYMA 4JIGA 4DLZA 5HF9A 3UENA 2JFZA 3B9JA 1WZIA 2GXSA 2PEZA 2CCKA 3CKKA 1N7JA 4KN4A 4YT8A 1O1YA 1X39A 1WSDA 3PXEA 4KRYA 2WUWE 4HLNA 1SN7A 4GE0A 2H4WA 2I9GA 2ZRCA 3OTHA 4ZYYA 1NYLA 8ICQA 2Q50A 1E1KA 2WPDA 3MTJA 1BS9A 2J4DA 1Y1PA 5E4TA 3BMNA 4HNVA 3TTYA 4A23A 1QC5A 4HWPA 4E88A 4G5GA 1YNSA 4J0FA 3X0DA 3TKYA 4XQCA 2FEKA 4YT5A 5ALQA 1NQTA 3OD5A 2VBIA 3L8YA 2UYOA 3NPAA 1A5AB 4EMUA 1S4QA 2YVLA 3O4RA 2C2MA 1KYZA 4BCDA 5KG6A 4B75A 3TQRA 1TU3A 3WL8A 2ERYA 5KFKA 3K9NA 1FDVA 1NXVA 2YQEA 4H7FA 4IXTA 2ID7A 5CDSA 4DVJA 4LUCA 1P0FA 2P5UA 5DH9A 2A0WA 3HXQA 4D80A 5EUMA 2FWMX 4FZ3A 2YMLA 5KQGA 3DDWA 1RKBA 1E92A 1NFFA 3OIGA 2X8JB 5F5LA 4B6RA 2D13A 2AOUA 2C5SA 3E5RA 5HIJA 1DAKA 1XSLA 3TVDA 1CJCA 1U4SA 3J81j 2QYHA 3Q0EA 1WDKA 1ILEA 2WWIA 2GZMA 4NATA 1TD9A 4GRDA 3N7UA 2ZRKA 5BRJA 3V1NA 1L3SA 4FTWA 4EA6A 2V3WA 5L3SB 4EGJA 2MHCA 2JIPA 1M6NA 4O1HA 3UUGA 4IZHA 1X42A 1ZNWA 1O9GA 4X54A 3HK2A 1E1RA 5FH9A 2XR1A 3BQ9A 5K3DA 4HGRA 3EH2A 1XDSA 4B9UA 3NH9A 2YFHA 4AKHA 4BHTA 3OOSA 4BGIA 3ZJUA 1NI4B 3H2BA 4JLKA 3Q12A 3PSFA 1VYVA 1Q1ZA 2EFJA 1FFDA 1GTJ1 3BRSA 3IOEA 2RGAA 4RM3A 4I36A 1JAYA 1ZXIA 2SKEA 1T9GR 4ZU3A 2GWRA 3EVBA 2XEDA 2Q7OE 2XUOA 4XRRA 1NRJB 5GIOE 1XLWA 2XPCA 1LQ2A 1EFDN 1ZQAA 3BXXA 2G4LA 1P77A 5EMNA 2I7VA 2GETA 2OQ2A 4XVCA 7REQA 2M0NA 2REBA 7ICPA 4U3JB 1BGVA 1QSLA 4OVKA 3OCZA 3NMUF 3DBHB 1CRWG 5BR7A 2DLCX 2QTZA 3TEFA 2YWEA 4MPRA 4B6JA 1KZ4A 3W5JA 3K71B 3GRVA 1ZD2P 3SF0A 1YUBA 2CGEA 3FRIA 4QZDA 1YQXA 1SXQA 5FTWA 2VZ8A 1OXXK 5DNEA 1NW6A 1GAXA 1ODFA 1OWPA 2Z58A 1H85A 3FPCA 4AG5A 5T5QA 3MINA 1V26A 5ALKA 4OREX 1V3VA 1PLJA 4C5AA 3SR0A 2E4AA 4DFDA 3OM8A 2GX6A 3WKBA 3RRZA 2Z95A 1A6SA 1ST2A 3URMA 5MFPA 5KFWA 3RJHA 3W5HA 1GZ7A 3SR4A 2GHTA 3I42A 3RVNA 3UG7A 1CUAA 3WE7A 3BOSA 5LP6C 1QUEA 3G1TA 1DJPA 2DCUA 4LIPD 4GEKA 4YAGA 1YS6A 2AT1A 3HSYA 1ZQQA 2VTBB 4CT0A 4PYKA 1Q1NA 4RDHA 1O58A 4MI3A 4CL8A 2QIPA 4JNKA 2BHLA 4J9VA 3T38A 1BXRA 3GGJA 2V96A 2VWQA 4INJA 5F98A 4MV0A 4YRGA 5HUJA 2JI4A 2O6LA 4UB2A 1F17A 4EBBA 5KFIA 3ZDEA 3GJ8A 3L4KA 3DXXA 1N6KA 5BXYA 3LQ1A 1HZZC 2QRZA 4DE5A 2MYPA 4FEAA 3PSIA 5FEUA 1SVUA 4RQ8A 3ETHA 1RC1A 2PMBA 4D4LA 1R0LA 3VZBA 5ABPA 4WUVA 5E6UA 4YMVA 3TAUA 3H1FA 1GUFA 2EZXA 1U8XX 3ORHA 3F3YA 2QP4A 5BUSA 2NVBA 4MP8A 2I4OA 2HVIA 4P5EA 1XZBA 2HLDA 3SC2A 4W8HA 2IS2A 4F2HA 4B32A 4D3SA 3NWOA 4L2IB 2ILVA 4FR0A 4K3UA 2IDMA 4IOMA 1EYZA 4CVNA 1SXJC 1VG0B 1BFDA 1YBFA 1AN0A 4S0XA 1ZICA 1VI2A 3RAQA 1S0NA 2HI0A 1A5ZA 3WP0A 2BD0A 3FJYA 2GRUA 2B82A 4I55B 2H1SA 2R7NA 3ENKA 1ZHOA 1LJ8A 2ZBGA 1DOAA 3HHPA 4EGQA 4IMPA 4MLDA 2Q4EA 1IONA 5KX5A 1DAPA 1U0FA 1GZVA 4NV1A 4J0JA 4ERNA 3LTEA 3DHNA 3MEQA 4YN4A 1USIA 4FQ8A 4ECYA 4F3OA 5JNTA 4GKJB 1YI8A 2HXYA 2WF8A 1W2HA 4H1WA 4ENPA 1YUMA 1NXTA 1KDZA 3PITA 4LRUA 5C37A 4GFJA 4E5PA 1T5IA 2XQVA 3IUYA 1RACA 4PFSA 1SIWA 4GC7A 1G1MA 2HU7A 3WRYC 2ZRMA 2HMWA 4Q7KA 3PDIB 4HDRB 4NCHA 1J8DA 4IXMA 4LSMA 4AZ0B 2FDCA 2POCA 1II0A 2D74A 2O0JA 1UXJA 3KFLA 3JQAD 2FPPB 1YFKA 3SEZA 1MOQA 2D1YA 4QGSA 1DQPA 1N6PA 4O1MA 2BDTA 2CNWD 2ZSFA 1WR8A 4ZO9A 4YG2A 4ND8A 2EZ9A 3I9LA 3VU0A 3FKSA 5LNK6 1PFWA 1FFVA 5DYTA 4DJ5X 1DKMA 1BH6A 1USWA 3QX9A 4RA6B 3N5CA 2KIVA 3KQNA 2DYKA 3IE0A 3F67A 1E9SA 5IIIA 2VAMA 3M1YA 2BCJQ 2PVPA 3H2SA 2W2KA 4QZGA 3IB6A 2WJHA 3KJZA 4R2IA 1JXOA 4DW8A 5EWGA 1JXLA 2IYZA 4DMUB 1D2HA 5KFFA 1JMSA 1GU1A 3WGMA 4LJKA 1XSNA 4EVQA 1DEAA 2ESRA 4NY1A 1TK9A 3UMVA 3LCJA 4NZNA 4FFDA 4L4YA 2FG5A 5KL8B 1UA0A 4JEIA 4BGDA 2V5AA 2ZLBA 3ZK8A 5PNTA 2BHSA 3JQ8B 2QTLA 1YIOA 1KGDA 3RSHA 2ZI4A 1C3VA 4LOHA 2EATA 4FBUA 3U26A 3QHAA 5L3QB 1LFDB 3KNZA 3Q87B 3VTFA 3KT6A 1WV0A 4JBLA 3OE1A 4L8FA 5L4SA 2GD6A 4NM2A 4GVPA 1G63A 1V16A 3TM4A 2I1WA 2WHEA 4MHTA 5FTMA 2Q4OA 1Q6YA 1U1FA 1L7NA 4XVRA 5TT0A 5JHHB 1IHUA 5K8JB 1AG9A 1YJBA 2G77B 2P41A 3BXOA 4QBGB 3L7BA 1WRBA 4FK8A 3IBSA 5KQMA 3CSSA 1L7VC 2QTWB 3HBAA 4OL0A 2CUZA 2Q2VA 4A8JC 3QPBA 4BVFA 4E2YA 4DIEA 5K4HA 3JQCA 1SL2A 3DMGA 1N9ZA 1G3QA 4KLOA 3PIIA 5JTUA 2ADOA 4BFVA 2DT8A 5JV5A 2NO6A 3ZIDA 1Z2PX 5KT5A 5L51A 5AKXA 3GFOA 2J9RA 5K3SA 3GIDA 4IDPA 3FSGD 4KQ1A 3FNRA 1BGWA 1KR2A 5ALNA 2PMZC 1YB6A 3CHYA 2AQIA 2UVPB 3C4VA 4D98A 2VSXA 3ICPA 3I64A 1J2NA 1ML3A 1TJPB 2ZT6A 4AQYB 5HJ7A 3HFRA 3L2OB 3RRNA 5I6DA 4EGSA 4JELA 1UPAA 1XTQA 5J2TF 3ZTWA 5AW7A 4HXGA 3DOFA 5DMHA 1E2HA 4FGUA 1MZVA 1XKLA 5DNWA 2CCJA 1JKFA 2WYIA 2IH2A 2YV3A 4BCBA 4GGMX 3LQ2A 3EZFA 5A4DA 4DKXA 3IAAA 2FPKA 4O63O 5F33A 2HSZA 5IDWA 3VYSB 1HBJA 3ROKA 1EUDA 3GD5A 2RP5A 2G63A 2CWWA 2QVXX 2NO1A 2W6CX 5E4FA 1I2CA 2XHEA 1KVSA 1C8VB 5JSKA 5LP6A 1T0JB 4YMNA 3TLBA 3D8TA 3BCUA 5JQGF 3LLMA 2XOXA 3ES9A 5REQB 5LJLA 2B0CA 5KQLA 3RCBA 3SVZA 1E1MA 3QA9A 4IGEA 4J94A 4TTRA 3B3AA 3ZDXB 4UCFA 2QQ0A 2HRBA 4RIHA 1FFXA 1GOTA 5EE0A 1J70A 3L0YA 3G0IA 2C2DA 2R8IA 1VKNA 2FP4A 1FU8A 3RC9A 4KCGA 3TM5A 2VA8A 1P7ZA 1J20A 4M8IA 3IUBA 3KP1A 1XHFA 4MV4A 3JALB 2AQKA 2OYRA 1FRNA 5DIZA 2F43A 1XNQB 1CEEA 3IQFA 4O5EA 4ZVTA 2GHIA 3CRMA 4OK3A 5A02A 2Z4RA 4PR0A 4MVJP 1MC4A 1SQ6A 1L3VA 1RAIA 1EK0A 5BSRA 2Z6VA 1ORVA 1KO1A 3VOSA 2WY2D 4TN5A 1BA2A 1GYQA 5DG7A 4F04A 1GKYA 5KO2A 1ZUD1 3UY4A 2N3ZA 1GUDA 1OAKA 4KYUA 4TKVA 3TOXA 2Y1OA 3ZDBA 2X76A 4JJ4A 2DJ5A 1LVHA 1RLJA 1TM4E 1F20A 4L3WA 3FDJA 2GSDA 5TQVA 5AVKA 4IHJB 5CDUA 3EA5A 1CIPA 3I04A 3GUVA 4OI4A 1KAGA 4H3SA 1SCJA 4WK0B 1J00A 1VB3A 4QUEA 1QZ3A 4RPCA 3G2PA 3ISBA 2VWPA 4JASB 4BP3A 4FCCA 2C8LA 2BV3A 3FSEA 3DJYA 5A2QA 4XSVA 5JUWA 1E3DA 2W8ZA 5DBIA 2JHCA 1PZHA 4KSCA 1HI9A 1K7EB 2GHRA 5J43A 2VJLA 5L4NA 3PZRA 1MB3A 3TG2A 1JIVA 2Y27A 3ZD9A 4WOBA 4NLCA 1U2QA 2VQSA 4JLNA 2QKYA 2XWQA 4FSHA 4NOKA 4KMMA 2IZ7A 1IEXA 3ZW8A 2VWGA 4V2IA 5TEVA 1R0SA 4I2HA 1V6CA 3U60B 2YJZA 3GFGA 4BJ3A 1T4DA 5LZ8A 2CLLB 1KOLA 2ZBDA 2HB6A 4W1RA 1KNXA 3H4TA 3C3XA 3BL8A 4IQGA 1CVRA 3WRYA 1QKKA 4XLTA 2VAXA 4MR7A 4UTNA 4YMLA 1MC8A 1MTOA 4JJ8A 2QD1A 2YHAA 4P58A 4MO9A 4DIOA 2IBKA 3CKYA 2C7VA 1F0PA 2B92A 4EEYA 2E1PA 1ECCA 2X14A 1PR9A 2IP1A 3AR5A 2DC1A 5ALTA 1CRPA 1ZVVA 2BGWA 1SPXA 4GLOA 5DNVA 4W9NC 2Q2NA 1PK8A 1TKBA 4L57A 2UZ1A 2IYAA 4KBYA 3P4XA 1DUIA 1PZMA 4FHFA 1E1DA 1BAPA 2OCGA 3GEMA 4I1UA 2FGJA 2SBTA 5ENVA 1BSVA 3SOPA 4ZK2A 5JFGA 1E2JA 3T7CA 1G21E 3P2IA 4TYNA 2EDUA 4BO2A 4J9OA 3BA6A 1IHOA 1WX1A 4NIMA 4Q1AA 5AXCA 1H4TA 5DHPA 5T3YA 3HJUA 2FJ6A 4AM8A 1WWUA 3S8MA 1GNSA 4BNYA 3OJFA 3STYA 4XDGA 3ZH2A 4IKPA 2VJMB 1TAUA 1LFAA 5H68A 4I2AA 1NY6A 4U39A 4OUDA 4L3VA 3BG5A 3ITNA 3DA8A 2IHKA 1UXGA 1AD2A 1X9GA 3VAAA 3I2YX 1BN6A 3A1SA 3RT1A 4L02A 1P44A 1ZLYA 3CLRD 3WGZA 5KPJA 4R1OA 3LV8A 3DV2A 1H94A 4TROA 4I4LA 1P75A 2FWPA 3HKDB 2PUDA 1RQ2A 4YC7A 1RWMA 3IJPA 2O1WA 2W7PA 1C7JA 3MDCA 2HBJA 1C0LA 1VMDA 3MWLA 4C01A 4B47A 2XA2A 1BNPA 5HXAA 4XARA 1HMPA 1SVNA 1MTZA 3WICA 4K6MA 2G9QA 3WLIA 3FROA 2ODQA 3FGZA 1PK1B 1XTBA 5EZYA 3MUEA 3MILA 2OC4A 3K15A 3SZLA 3PUZA 2FPSA 4HDKA 2ZU0C 4ZAGA 2BEVA 3LKDA 5KNDH 1XTJA 4YP6A 1H0SA 4FR2A 4R84A 5ARCA 1V6SA 3IE2A 4WDRA 1SUDA 4DXDA 2AJTA 2GCIA 1HG1A 2AMYA 4PX9A 3T5GA 3P9PA 3I0MA 5EJMA 3VJKA 1ZNZA 1MV5A 2WFLA 4YRIA 1XKTA 4LI3X 1QS0B 3R24A 4L9RA 1ZESA 1KOJA 3P32A 5CEEA 4PNPA 3EDQA 4KJXA 3WLPA 1MENA 4JENA 1ZAYA 4XQ0A 4BFTA 1SBYA 3UCFA 4P93A 4CCAA 4MVYA 4P4GA 4B6GA 1JF8A 1NIJA 1HV8A 1T6YA 2NZXA 2NVUB 3BWMA 2ADFA 2DKZA 1XCBA 2H59A 2AD1A 4V0SA 2CVZA 2X6QA 3H6GA 5BSMA 2BOVA 3B53X 1M34E 3QPWA 3GGGA 4RD4A 1KEZA 2Q0ZX 3RD5A 4N39A 4DRYA 1D9FA 1UMBB 1WCIB 3TL2A 1BA3A 4GHWA 2Q5OA 4X1OA 1H5UA 2YQ5A 5D3QA 1XNRB 4QUGA 3U7EB 2BPOA 1NURA 1HPLA 1QXSA 3I45A 1QTMA 3MWEA 4Z7QB 2H3FA 3M5CA 5LOVF 1OH5A 4PO9A 1KETA 3STUA 1W88B 3UB4A 2HW8A 2I7XA 1KFEB 3W34A 2X9LA 1BDMA 5G1OA 3KVNA 2JIMA 3WGHA 2RG7A 1YVEI 5KTSA 4RQ3A 2I7CA 5C51B 4ZC1A 2JJ2D 4PYRA 1YS4A 1F4PA 4JITA 4H6PA 2Y6UA 1SD2A 4RVCA 3O2NA 1DOQA 3SBXA 1CYEA 2EQBA 2C5AA 10MHA 1CEZA 2Q5QA 4J0CA 3KPJA 4CMIB 4DR7B 2JZBA 4MV7A 3PNSA 2C96A 3V1KA 4LSZA 4L4ZA 3KR0A 3KYBA 4MDYA 2K6GA 1OIXA 2RD2A 4Y18A 2HHVA 1XVLA 2UKDA 2FXVA 1CS4C 4RL6A 5HK8A 1UEIA 1E2LA 5J4YA 4C6TA 4GBMA 2C4VA 3RIXA 4LJ8A 3CN7A 1ISRA 3W9SA 3V6LA 3FMPB 1UWVA 4PS1A 4HXEB 1IG3A 5FTLA 1B8UA 3C16C 3QVMA 5TGTA 4RT3A 3AEUB 3EQ2A 4ZAXA 2R25B 2H52A 4BO6A 5KPDA 3HP4A 2A9FA 3PEEA 3TXXA 1JFFA 1PFGA 2A4KA 1L5ZA 2RAVA 1QCDA 4OD0A 3MCZA 3F2VA 3LHFA 1VHJA 1Y1LA 3RG8A 1G9XA 3C8MA 5EEHA 1NZJA 2BISA 1E1LA 4N7RA 4ENUA 3U80A 5D49A 4PIMA 1KI6A 3AERB 3NXKA 3QY9A 1X1SA 4MCIA 1UODA 4RKRA 3UMSA 3CJRA 4I5DA 3EXFB 2AFIB 1YMUA 2GEUA 3N7SC 4JWKA 3B9PA 1WKBA 3CUUA 3WRXC 4QLAA 1OLXB 4LVSA 1Y3IA 3P9SA 1NW5A 1U7WA 4FOPA 1C8BA 3WLOA 3HXPA 5KFDA 1ZRMA 4IEFB 1E2EA 5IK2D 4D3XA 1OFUA 1YE8A 5EIBD 4BNKA 1YR8A 2HAEA 1U2GC 1FYDA 3HDQA 3OOJA 4KNWA 1Q11A 1JMVA 5J2TB 3L7DA 5JZVA 4S2UA 4W9NA 3TFWA 3NBKA 1KI9A 4C20A 2G36A 2FPGA 2PZMA 3HN7A 4OAQA 5KYKA 4HTFA 1S9DA 1D09A 1ZOOA 4F1WA 3AP2A 5I3ZA 4QXOA 3M6KA 1M2VB 5DXAA 2ZCJA 2ODGA 2DUMA 1E99A 2ZRQA 1K5HA 3KS9A 3NHPA 3CUTA 4R8VA 3MCAA 1CVLA 1EX7A 2JEFA 3FIJA 3MC1A 2WIDA 4M49A 4MWZA 4G84A 1CERA 5HF5A 5JQGB 5F4ZA 4A27A 1PNRA 4IQUA 5J2GA 2B83A 5DK4A 5B6PA 1UIMA 3LWLA 4XIGS 3Q40A 5EIHA 2E4ZA 2PH3A 4PPNA 3ZWBA 3WQRA 4FD2A 3PGA1 4ECRA 5AM4A 1LGYA 1P9RA 4PFKA 5KFLA 1GWNA 5CU7A 4KI0A 3GEHA 3LVBA 3COPA 1GFZA 3GJTA 3KELA 2GS9A 1JWAB 2NG1A 4I6EA 5D2CA 2WJAA 3PLNA 1YMVA 5JRJA 2IW3A 1POXA 2F55A 2VT3A 3PK0A 5CNKA 3X1WA 1SM4A 2WJ6A 5CBKA 4Z9BA 1A9RA 3OAAD 2AMLA 2A5FA 2RI0A 1K75A 3RAEC 3A9UA 3ZGVA 1XWFA 2GPTA 3IP1A 4M8NE 1J1ZA 4G5XA 1SBQA 4R1NA 4ME6A 1YRBA 3AETA 3NDBB 3C3BA 4GLBA 1ADBA 5D00A 2AW3A 4Y9RA 2Z8XA 2HGZA 1YMQA 4QGAA 2HGSA 6NULA 2M9NA 2M6RA 1V7PC 4I1RA 5F3RA 1TKRA 3B1FA 3A6DA 4MJ3A 1IPHA 3RF9A 1XB2A 1W9MA 4CI9A 2YXEA 3FMOB 4C7YA 3MTEA 3T7SA 7ICIA 4Y2SA 1XL1A 5C4GB 3OQOA 1ND5A 4OQZA 3GIJA 2RCYA 1P18A 4I2NA 4JLPA 1AUXA 1BWPA 3A1VA 1F2TB 5L7TA 2C5HA 4FYPA 2BZGA 4ZIRA 3EFOA 2CVQA 1NYTA 1G19A 1P91A 1JG2A 5K01A 2O07A 2K4PA 3JPTA 1NUPA 1WU8A 1HRDA 5ERGB 5CXUA 621PA 1AKWA 5ED0A 1RDFA 4RY9A 1OLUA 3LUDA 3THRA 3UMFA 2OZPA 1BDBA 4D0NA 3GZFA 1M1UA 1XHLA 2FSIA 2IYOA 3PW0A 5LQJA 3F6PA 8OHMA 3JPSA 4Z2YA 1N2ZA 3PHCA 4PC7A 1DQSA 2QGZA 4XFDA 3GA5A 3MMXA 4F5QA 4M9CA 1VIVA 2Z4SA 2ACWA 7ICKA 2NZWA 1ISGA 4EFNA 4RKFA 1WMBA 2HPAA 4HWSA 4GZ3A 4Z99A 2VP5A 5TC4A 3VPCA 4GMGA 4EG8A 1KVUA 2UYQA 4KIFA 1N0VC 4X7RA 4E21A 4GI3A 1G8SA 2PX0A 5BWOA 1U6KA 1YIAA 3NDPA 4JI1B 5CGQB 2CY0A 3IO5A 1EFVA 1ZHFA 5GJBA 2WOOA 3QZ7A 1V8DA 2QRUA 3LFHA 5IIOA 1FUIA 3NOVA 4YVZA 3DE2X 4UBOA 4GXJA 3TLMA 4QUHA 3A06A 4LOIA 1FDOA 3WLAA 4L0CA 5EJEA 4LX0A 1SQFA 1E9AA 2XVXA 5HJ2A 5FYDA 4YJ3A 4LS3A 1OZAA 1EAMA 4E0DA 1QG4A 4X6XA 2YY6A 4E70A 2FUNB 1CR1A 4IDBA 2I76A 1JZSA 5CP8A 1E9RA 3WBJA 5JXJA 2JZCA 2P2NA 1WCXA 4LHEA 1WVGA 1CG6A 1E6KA 1U02A 3PGVA 1VRVA 3IRUA 5FWYB 5CBPA 1ZUNA 4G6ZA 2IJGX 1X8JA 1HL7A 1XP5A 3ELWA 3PI6A 1RLMA 3RT7A 3ZW7A 2NXEA 3MUNA 3DT6A 4M6WA 1Y8AA 2OV3A 4D9CA 1RZRA 1IHDA 1TQ6A 5AJXA 4ZEOA 2VCHA 4OLAA 3EWAA 2XECA 3AVYA 5JXIA 1R4MA 2QF7A 1N63A 4QNLA 1XQYA 1YRYE 2C4UA 2OUIA 5JI2E 2HNAA 3L7MA 5A03A 2XYQA 4YX9A 1JSXA 1L1QA 3AL2A 4TKZA 2YJNA 3ZK9A 5LQNA 1B76A 4GR9A 5LXTF 3OZRA 2PU5A 4IKOA 2C1ZA 3VZQA 1BD3A 2CHGA 3HJFA 3UH1A 1W1UA 3JQPA 4JLSA 1U2GA 1R8XA 1NUSA 3CS3A 4OPMA 4HQRA 1JIJA 1XEAA 3AF5A 2V3CC 5BWNA 1BEZA 1NSFA 3A26A 4AWBA 3ZEAA 1PVDA 3GEGA 4BFCA 1ID8A 2E8MA 1GLGA 1JBQA 1A71A 3HKBA 2JD2A 3MCVA 1TKDA 2LM4A 3M8KA 1BG6A 1HY3A 2X4GA 4RZUA 1B2RA 4Q00A 3Q2OA 1KN5A 4ZT3A 2J0EA 4R83A 5KNIA 3RH0A 2RMKA 2GGSA 2BCVA 4JOBA 4P3NA 1CJVC 1UJCA 4DADA 2W54A 2CLMB 4JBXA 3A4MA 2OCXA 2GPAA 5KT3A 4NJOA 2B4YA 2TSYB 3TPZA 1J0CA 1NM5C 3ZX4A 4YMIA 3E15A 4CQMD 3TQHA 4JLVA 5JOQA 2VKQA 1O9BA 2QP3A 2BUBA 4BX9C 1CE8B 2IYUA 4X24A 4HUTA 4E5YA 4MGIR 5IC5A 2G80A 3G8BA 5IYZA 5JXGA 2ZI3A 1OX4A 3DTNA 1NVDA 3E8XA 1X8XA 4S24A 5HHIA 4IDAA 5AVTA 3TSAA 4YP9A 2F3TA 1RKUA 4Q82A 3O7MA 1V0JA 2WYOA 4R98A 1NQXA 3X3HA 5HRUA 1GTVA 2ZWMA 4C9BA 2P4QA 4PHDA 3KYCA 5IAEA 1ZQHA 4UEWA 4M3NA 1SUFA 5A6SA 2FJUA 1F3LA 1JG1A 1W44A 3TPFA 4COOA 4NECA 2C0PA 3L7OA 3LSYA 3CF4A 3HB7A 3K1AB 4N0DA 4I2GA 2EGUA 4JHLA 4ED9A 2IYTA 2NTJA 4N0EA 4ZT5A 4RZSA 1A3CA 3QGMA 4UUMA 1NK6A 1GQOA 3Q3GE 3S7ZA 2Z6AA 2H1LA 2XDWA 4JZYA 2QRMA 2CHEA 4LF6B 1MJFA 2C4MA 1TAGA 4CM8A 1QBKC 1PFYA 3EZXA 3OT4A 2O8NA 1C3OA 4PAOA 5SYAA 3UW3A 5G02A 3L06A 4KR3A 1SXJE 3TIFA 2Z83A 3BMQA 3IMKA 2CNLA 2A5YB 3AB7A 3PYXA 5FA5A 3WSTA 2TMKA 4N18A 2AC4A 3HJAA 2HEIA 5KT2A 1UQTA 3UA3A 4BNWA 2E1FA 1M74A 2AFHB 3DUFA 4ALJA 1H6CA 2JLZA 3ZY4A 3GQVA 2ORED 2PKYX 4EZEA 4AB1A 1P8JA 3G5LA 1E7YA 5FBHA 2P9JA 1MGOA 4I2CA 1WB5A 5LR6A 3NO4A 1Z29A 3RJMA 2RHHA 3GUYA 2VRWA 5EJ4A 1DBVO 1U3TA 5F1PA 1FIQA 4KQIA 2Y0SC 4HRYA 2W3RA 2P3SA 4BJ6A 4QEDA 2VJBA 3PXUA 1V97A 2V0NA 5DI3B 1DC3A 2GNOA 3E9RA 3TB4A 1KKXA 3VPAA 4RY8A 2RHTA 5D1HA 4R0NA 4WLOA 4U0KA 1RXCA 5EL0A 4NXZA 3BD9A 1RYSA 4HWRA 8ICGA 3OLXA 2BF7A 4EBDA 3SQLA 2WV7A 3COYA 4YRZA 2CXNA 1EB9A 1O87A 1B41A 4G4JA 3RVSA 4G36A 1IOWA 1J25A 4KDFA 1SU4A 1P7VA 1X7YA 1R37A 3KJHA 2C9ZA 2I2WA 2WZBA 1IK4A 3M1AA 3AVPA 2KSQA 8ATCA 5D8DA 5C8VA 3WO0A 4S0ZA 2WIAA 3THOA 4X66B 4OLJA 3RB8A 2P3QA 2I03A 4YJ2F 3AEZA 4NBUA 3MXTA 3GWZA 1THTA 5IP5A 1R4ZA 1U63A 5BWBA 2JAWA 5I5EA 1S1CA 1DUSA 1WDTA 4JBGA 2ILTA 2VJPA 8ICOA 1DX9A 4KR0A 2FSFA 2AK2A 1VHTA 2GT1A 4CM4A 3THYB 3CRQA 1IIRA 3AHDA 1NY5A 4U7WA 3U13A 4NRDA 4GGPA 3K3PA 1GTZA 3P26A 2X7JA 3HXLA 2OEHA 3RGWS 4QDKA 4E46A 4JV1A 3B3JA 4CUJA 3NDJA 3UVEA 4EGCB 4NL4H 2FTKE 3HKZF 1WCWA 1SRRA 3I01M 5CK5A 3HT3A 2FVYA 1V8ZA 4JSTA 3CH4B 4AN4A 2NPIA 2PNFA 1MIHA 4KOEC 4P3XA 1JU9A 3VMFA 3CUYA 1V3UA 1E7QA 2AOTB 1YB2A 2DKNA 3HKEB 1P80A 3IKVA 3FFBA 4RW0A 4MYRA 1YR1A 2C77A 3QLUC 5FB3A 4I14A 5KWEA 1AE1A 1R0XA 4JL5A 1XO1A 2GR9A 1SRQA 1NNUA 2OBFA 1ZFNA 1X66A 3UANA 1WB9A 4KPYA 5KTPA 4H7EA 2O48X 1L3CA 4JFAA 4RNOA 1X19A 2C1XA 3OCJA 2YYAA 4IR7A 4P5PA 1EG2A 3HJGA 5JS6A 2OP1A 5LIRA 4B4DA 1AO3A 2IZ6A 2VP0A 1ZBQA 4YJDA 3Q8SB 5E9JA 3S1LA 4ZPJA 4XR9A 3KZVA 2JAXA 1N3BA 2D0IA 4RL4A 1SUAA 5DYIA 5L9AA 1URPA 3P2KA 1DQNA 3MGBA 4HLDA 1VSVA 2G82A 3T41A 1QV9A 4HS9A 1L6NA 3U0BA 4R65A 4IQFA 2C1EA 4TV9F 4TLDA 1F0NA 3DDNA 3VR0A 4RSHA 4AFNA 3I72A 2QQEA 3OLWA 1GPBA 1UA1A 1RPAA 2HMVA 5AW9A 5INTA 1NM5A 4KGXA 3KL2A 3GILA 4AKIA 3KRTA 4BQIA 3F3MA 1S2GA 1Q3HA 4BX9A 5CT5A 3BX1A 1O94D 3OTIA 1UBLS 4NL9A 3AIKA 5EE1A 4TUYA 2I71A 2NM0A 3PR2B 2QTAA 1OGYA 4WXHA 5BSVA 4BLOA 4Q47A 1ISJA 4W4TA 3VNAA 5DLQC 4IDGA 1OX6A 4BNJA 1T13A 1GY8A 3WNDA 1NL3A 4B6QA 2Q2QA 1ANKA 1U80A 4DSEA 4AN1A 2P8JA 4B3HA 3HFSA 5TVKA 2JJYA 3SIPA 4L9SA 3X2FA 3JTMA 4Y1EA 1NZPA 4IYRA 2QV7A 4BKQA 3E23A 1L0BA 3F9RA 3DMNA 3RYFB 5E6SB 4UMFA 4YBZA 3QWBA 2I9KA 4KK3A 4F97A 4YRNA 3DKPA 1PQ4A 1URJA 1ZH6A 3MHPA 1YTLA 2JEYA 3HZHA 2G6BA 1W2GA 2B6NA 3D2LA 2JCVA 1GLVA 5AUPB 1EFAA 4I4IA 5IBQA 2KW5A 1QYDA 4O5CA 1XEWY 2JFVA 1UJBA 4F8JA 1X7WB 1Y7HA 3CUKA 4AUKA 3I76A 3A1NA 3WYCA 3TWOA 5KYYB 3NOOA 1UPUA 3CKLA 1U2EA 2AR9A 1I6MA 1T5OA 6LDHA 1V5WA 4MQMA 1ZR2A 1P9LA 4RHEA 3GLTA 3PL1A 4L5YA 2Q3JA 3OPMA 4D9GA 1WHTB 5AHKA 3REQA 3PSPA 2PWAA 5HJ5A 1UANA 5FDFA 1W59A 2ZYDA 2HBZA 4L78A 1KEEB 4R2WA 1AMOA 3BWBA 4MGZR 3DLTA 1T5DX 3JVDA 3HR7A 5TDHA 4BNDA 1B15A 4M8LA 4YRRA 2JEIA 3W78A 4QBTA 4P08A 4B3MB 5ANRB 5HCNA 3PDJA 4G5SA 1W5EA 1AF4A 1C4WA 2GO7A 1LTQA 4KN9S 4NULA 3L43A 2REOA 3ZHZA 3K1RB 3HCAA 2WKPA 3W5UA 2QA5A 4QE3A 2D54A 2PN1A 4FFNA 3R0VA 4GZLA 3ROGA 1W6RA 4DGSA 4UXHA 5KIAA 2JCBA 1PQUA 2OZLA 1TYDE 4LWPA 2F8TA 7MHTA 4RU9A 2GCOB 1PJSA 2C3UA 1UT5A 2J48A 3MQ2A 2W2PA 4LBZA 1CJMA 1OGIA 4JS0A 5E9AA 1MA3A 4YR9A 3QWHA 2EVWX 1U8YA 3OP1A 1S77D 4CQLA 4LZGA 3NC1C 2XNCA 1ZU4A 2R18A 5LYYA 4ZI7A 4QTYA 5B66U 3IKMB 4H16A 1Y9JA 4QIWF 2HUPA 1QJCA 4NJMB 1HE8B 2PFGA 3L7IA 1UJMA 4ZVSA 1EFPB 3PKJA 2VZ0A 1X13A 1D4FA 1WULS 2VNKA 5F35A 4I9HA 2XTZA 4QGFA 3M8RA 3H75A 4I50A 5IAGA 1D0VA 1XTPA 4OYRA 3FYDA 1DPGA 3OCYA 4X91A 2DBRA 2ODAA 3AOEA 1B0UA 3QPAA 3CW2C 1ZN9A 2JFQA 3ISJA 5DLEA 5BPHA 3EIEA 1ISSA 4ER5A 5GONA 3UPUA 4ARAA 5GJWC 1ECLA 4K6HA 2H4JA 1DGQA 3UOGA 4KE8A 1JS1X 1H4SA 2HQBA 5FOTA 3E53A 3T5HA 5DGCA 4DLVA 3F49S 1QZXA 5G4KA 1NTOA 1X92A 2UUAB 2KD1A 2A9PA 2ZUDA 3D7NA 1B26A 1KYXA 1R0RE 4F3NA 1YVDA 3KBBA 1E1CB 2GWSA 2P3LA 1F12A 2AXNA 5E8RA 4O3MA 6REQB 1ABFA 1NJSA 5JDCC 2ZJOA 4ZXPA 3D02A 3UQYS 3B9QA 1AXGA 2V6IA 3FDZB 5ALEA 3QLUA 3PC4A 2ZRIA 5MFZA 3L7YA 1QCZA 4M1OA 4TWAA 3HEAA 1XYGA 4CKCA 1S9HA 3SQMA 5I8WA 4IF4A 3GYBA 4H2DA 4GZ5A 1TW3A 3KEOA 2X8AA 3D7LA 2COUA 4M1SA 3MS4A 2A57A 1R2QA 2JBAB 4IGIA 2HCBA 1S2OA 1A0OA 4DLUA 1RI3A 3KOWA 4TMWA 4GOOD 3HGMA 3UJHA 3IN5A 2RGBA 5DXJA 2P11A 1XZNA 2HO5A 1RQ7A 3GXBA 2ZIXB 1PYGA 2VHUA 1RMTA 3GLFB 4MV3A 3O4HA 4BU0A 3V8EA 3KQMA 5DGHA 2E49A 1U9YA 1KZ1A 3NEAA 3NTLA 4KV9A 8AT1A 2VAWA 5I4IA 5J5VA 1UDWA 2VC2B 4PZ0A 1TGVA 1IUPA 4C4YA 3Q10A 4RZXA 2UZIR 2FW7A 3AWIA 2JGFA 3OPVA 3D7KA 3RADC 3VISA 4QZHA 3PA8A 4Y1GA 1A5BB 4HXYA 2WB2A 1GEGA 3TZKA 7ICQA 1ULSA 4P34A 1VG8A 4AX4A 3CPHA 1C3JA 2IHYA 4EF5A 5FUYA 2VNHA 2XT9A 4UEOA 1L4NA 4LGYA 1NJXA 1IWPB 2XAUA 1ZK4A 5F21A 5AW4A 4P92A 2UV8A 1KJ9A 5B53A 2I4MA 1P5RA 4ZYXA 3IKTA 1U31A 2V58A 5DX0A 3GZJA 1J49A 5CB4B 4E2WA 1JJBA 3KKOA 4LZLA 2PNJA 1HNZB 3B5IA 2QMQA 5AK0A 5DM1A 5DQIA 2YN2A 4M0DA 3E9DA 4HAIA 3AM3A 2P2ZA 1AN9A 5EHXA 5ADVA 2FQXA 3DCNA 5CURA 4FNAA 4PM4A 5H4GA 5TSDA 3OIUA 3JD0A 1A50B 3OQJA 2JAPA 3HV0A 1D8LA 3HADA 3KB2A 3BBLA 3C6MA 3EASA 3ZJTA 1SL0A 1MG0A 2PUHA 3NHBA 2ZUWA 4Z4IA 2PSSA 1ORDA 2VYND 3HA5A 4WWHA 1KFKB 1DWOA 1W5FA 1U49A 2PZBA 1SVLA 3OCUA 2XYHA 2VDOB 4Z53A 1NRWA 4WECA 1U6IA 1JEEA 3SS9X 4PSDA 1NVBA 2E6UX 3WMGA 1YZYA 2P4UA 5GVSA 2QUKA 3FOCA 3ND8A 4BQPA 3CGGA 2X0FA 2ZSEA 1AA9A 3KSRA 4JUFA 1TQ2A 4I4CA 3D8BA 4P0QB 3FPJA 1ZK2A 2G1UA 5TR9A 1GGNA 4PLVA 1AS2A 1DT5A 1REQB 2CNWA 3VBCA 4OTZA 3UO8B 3CZAA 3IQHX 1ZM4A 5CYOA 4DILA 1CUYA 2BL4A 2DPJA 2ODPA 2AU0A 1E2UA 2I6UA 1TX4B 5L40A 5HTKA 1Y3HA 2R0QC 3AJRA 4O08A 5FNVF 4H3KB 1JLSA 4RADA 5HF8A 4NEGA 2H1OA 5F5NA 2XT6A 4AZ3B 1FVFA 4YCSA 3A9CA 4H59A 1SK9A 2JH1A 5AI5A 2VNSA 1HUQA 1ZRSA 5L7YA 2I8CA 4TV9B 3LFTA 3KXDA 5KEIA 4WI1A 4I4TA 2EP5A 4C87A 2WJVA 4FOLA 3FYUC 1JEAA 1HZZA 3BULA 2WU4A 2G1KA 4KW7A 3I83A 3ZXSA 4DR6B 2LV8A 2AEJA 2P3OA 4J9MA 4YJGA 3UEOA 4FWTA 2PUBA 2R751 2C7PA 2WMDA 3KDAA 5HEKA 4YJHB 1TA4A 3GCWA 3VR4H 3WOVA 3CW2A 3SMQA 3R44A 4BO4A 1X1EA 1LK0A 3QRWA 1KY5A 3E2IA 5IDXA 4NH4A 4UPVA 1XPOA 4HMOA 1SXJA 2AF4C 5F9HA 3L5OA 3BMOA 5LMNB 1Y6ZA 3BM5A 4URHA 1I24A 4CDNA 1ZYQA 1Y63A 1KDTA 3L84A 2JLBA 4IHQA 2DUUA 3ZKWA 3HW8A 4PCUA 3T52A 3DLPX 3JD1A 3UT0A 4CF3A 4ILKA 2OBLA 1SGGA 1MAUA 3H5NA 1IBLB 1GKIA 4EW3A 1CSEE 1P5FA 4DS4A 4QASA 4F71A 3EA4A 3NVDA 3QVOA 3PT9A 1RI4A 1M66A 2PG3A 1M72A 1IATA 4F6RB 2A5DA 5FL7D 3S2ZA 5JDCA 3W3AD 1RKQA 4ZJZA 5IAKA 1SCUA 4LZAA 1A5SB 5AJHA 4JVLA 4HRAA 1V2GA 2MJLA 1MCZA 3F6CA 1LSUA 3HTXA 4BMDA 2VRBA 1PV1A 4MTLA 2H9IA 4AMVA 3R9XB 3WZLA 4ZTUB 2HSWA 4KLJA 2Q4BA 4PO8A 1KEVA 1L5GB 5LSAA 1EUCA 1WXGA 1CY1A 4MYDA 5BWCA 4O0MA 2W4MA 1OZFA 3FOEC 4N8EA 3BFKA 1Y81A 4URZR 1MXFA 1T9BA 4FDTA 3QEAZ 1KL7A 4PG6A 1NXQA 5H59A 1UXHA 5H16A 2PSDA 2K8BB 4R2HA 1OXSC 2J67A 3ROFA 3JZDA 9ICBA 4XD2A 4LJRA 1GU0A 3G68A 5H3HA 1N2CE 1GN9A 2ZWPA 3OZVA 2QZSA 1MQ9A 3CG4A 3A3PA 2CNDA 1NAHA 2WQ6A 4DG8A 2DSTA 1QANA 3JPRA 5A0FA 4FIZA 4UM5A 5AQEA 4FMDF 5A7FA 3KO8A 5I7VA 1DC5A 4MQBA 1BEEA 1EWVA 3B8EA 1JT2A 2UAGA 1XMVA 5GTIU 4H1TA 3QTTA 1KZYC 3CXRA 1W4CA 4TZ6A 1W2WB 4AW9A 4A03A 1H2WA 3X1MA 4IMRA 1L1FA 2H9AA 3D0OA 3WQBA 5BV1A 1D8BA 1U5BB 3RS9A 4QO7A 4REQA 4ABYA 2GBPA 5CXQA 1DP4A 4H31A 1J97A 1KYTA 3RVOA 3QELA 4YLEA 2QYSA 1X77A 3ILHA 4C0SA 2V5VA 3FLAA 4U2BA 2XCUA 1ZYUA 1FSSA 1YCHA 2I22A 4UDYX 4YDRA 3KIPA 3B12A 3MWYW 3QVUA 1JX4A 3VSDA 4IFEA 4XX0A 3D8HA 3W1EA 4KAAA 1KEKA 2NNLD 5J4LA 1Y7TA 4A8JA 4IZIA 1RQXA 1ECWA 1GYRA 1MX9A 4X8OA 3MFHA 5TPWB 1N2JA 1SKUA 2YYSA 1AQUA 1YT5A 3HKCA 2GJKA 3EXEA 3EC7A 3NNNA 2PCJA 7ICOA 5SZIA 4F4WA 4JAVC 1NMEA 2BGRA 2G72A 1YULA 4ARUA 3ZC3A 4K4GA 4LA4A 2W7TA 4FQ5A 2V0GA 3D7MA 2VTEA 2PL5A 1USKA 1ECJA 3A37A 2LPEA 2BP7B 3GNTA 5FQNA 4CLEA 4ZOLA 9ICXA 1F44A 1TAMA 1P33A 2BFDB 2OXCA 4BNNA 1XMXA 3DBRB 1HFKA 4XEUA 1Z2DA 1R8SA 2CLOB 3PO5A 3MJHA 3K9FC 3LT2A 2OMKA 2D1SA 1IULA 1N62A 4RNNA 3FUWA 1QUFA 2AJLI 2HK6A 1WW8A 3QXCA 4MVJG 2C07A 5CRIA 5E8JA 5C7IO 4LV5B 1IUOA 4XVHA 4NG5A 3V1UA 4ZAVA 3T35A 3F71A 3VR1A 2M9MA 5EIBC 1ZETA 2QB0B 2JBHA 2QAGC 2TYSB 3L6CA 5BT9A 3QVKA 1X74A 1JEYB 1PWYE 2WINI 3U44A 3D2NA 5ALRA 3GJSA 2VF5X 1AKEA 1H8EA 4POAA 4ZQFA 1V9SA 4QYIA 3KYJB 3U3KA 2G9NA 3GNSA 1R12A 3OCVA 3L8HA 3TARA 1O95D 1HE5A 1SJ9A 3C3WA 3GJ4A 3MABA 2NTEA 1DIRA 1WL8A 3T7IA 3VZDA 2EKBA 3V8NA 1ULHA 4BO9A 1YJ5A 2CF5A 1R4AA 1NNI1 3NT4A 1QRAA 1Q14A 2VUTA 2JDIA 4X92A 5GOZA 3PCXA 4BUJA 3DHVA 4KLZA 1Y5LA 2PR2A 2Y6VA 1SB8A 4BC1A 4WUTA 4DLAA 3C2LA 3ZCVA 2XUDA 3VTZA 4QWDA 3PR1A 3QYPA 5AI4A 2D0OB 2XUAA 4D9KA 3FYUA 4P7GA 4EKDA 3F46A 4H1UA 4PCAA 4M4SA 2HX1A 2Y0DA 4CL2A 1QV7A 4OU5A 4WOJA 4OFZA 4NV0A 2SECE 4QD3A 2XXBA 4ESEA 5IJAA 3VH4A 4GI2A 1XKXA 2VDRB 3ROZA 4R2XA 5DBAA 5B7GA 1ZKDA 1XG5A 1ORIA 7AT1A 1YR6A 4KPUA 2KHVA 4LPSA 3IA2A 3U0VA 3Q9SA 5DOVA 5BOVA 4PF1A 5KG7A 4ZZ3A 1PSZA 3SLRA 2ZTCA 4LDZA 4GX0A 3D8NA 5E4JA 1JECA 1Z0JA 3A0HU 1TIKA 4C0WA 2QDKA 4NPAA 2A3NA 1HDIA 5ICFA 5BO5A 2ZRFA 1KQQA 5HKAA 3L1UA 3KU4A 2LUOA 4YCNA 4PGGA 2J9ZB 5C8ZA 4IY1A 4AJ1A 4ZQBA 3UW1A 4KAFA 4KQHA 1BS1A 4G1BA 1OXVA 5AKEA 2Z09A 1W4RA 1GNTA 1B1CA 2XY5A 3MD9A 2XX3A 4G0XA 2R7MA 1A8QA 3WU2U 1EXDA 3QEKA 2GFIA 1A7KA 4L85A 4YIKA 2EHJA 3PYMA 2ZEJA 4OQDA 4IRDA 4GMHA 1JDPA 4D6PA 4HWOA 5CYFA 3REOA 1OJ7A 2KHZA 1I01A 2R8OA 3FVQA 5BQPA 4QZFA 2J0UB 4ARSA 4ED6A 3PHHA 2WD8A 5AO9A 1ZQXA 3FTCA 1QVVA 5HPYB 4MWGA 3O8NA 4HH1A 2VNAA 1F2VA 1NUHA 2Q0QA 1W1WA 5BP7A 1SHTX 1K88A 1FJGB 4UE2A 2V7QD 2C59A 4OI2A 3C98A 2HZBA 4R64A 1US8B 3P5SA 3O3MB 3QEBZ 3M83A 4Q45A 4EPRA 1H0KA 2X42A 4KMOA 1W5AA 1JW9B 1QPZA 2QRLA 3NBMA 1CCWA 5FHRA 3B6JA 3MR2A 4DB4A 5BVGA 1PVRA 1I5EA 3LF2A 1AQ6A 1NX6A 1E0SA 1YDMA 3DEKA 1E2GA 4QHSA 1JR2A 3EODA 1E7SA 1EDEA 3WMRA 1O0CA 1JAXA 5FWAA 3SAJA 4C7BA 4IJUA 3OIWA 4JP5A 1NVTA 1I9GA 1JKJB 3OU2A 1ZPDA 5FTKA 2ZRJA 1UM9A 4L08A 3K70D 5JCXA 5LDGA 3JPWA 4TKLA 3RUIA 1QDUA 3L4BC 1X9XA 1OLSB 1MUUA 4G81A 5EJ9A 3WIEA 4TSFA 2WA1A 4YP5A 4MWEA 4F72A 4YXFA 1XZ8A 2QOEA 5GVRA 1CUJA 1Z4KA 4HDSB 2OZVA 2XHZA 2E4VA 2ZSBA 4B80A 2F00A 3Q7PA 5KYWB 5LA6A 4X1KA 1PUZA 2Q9CA 2OZEA 4C0QC 2JGIA 3IT2A 8ICRA 4QTTB 3UPDA 5J3JA 5BN3A 3TUIC 1J5XA 4PZDA 1Y8ZA 5AW0A 1PS9A 3UMYA 4QM7A 1LPMA 4ZO6A 4Q1EA 1N8TA 2PUWA 4PEVA 4IEIA 2WIFA 4OATA 4E12A 3IFSA 4EBCA 1HE2A 1EK2A 1QIHA 2BBSA 4XM2A 4NOMA 5FUQA 4C0KA 2DTDA 5TS2A 3KYDB 3GY0A 3E7FA 1SVSA 4JR1A 1Y1TA 1UPCA 2FE1A 2NT3A 4KG7A 2FN7A 3DMTC 4NARA 1SURA 3L01A 3OH8A 4S3MA 3I5UA 1YZQA 1YL7A 5JD4A 5IVIA 4N3GA 1H8HD 4KMRA 4P9NA 3H5LA 1AGXA 3THXB 1LU9A 4D43A 2R6AA 4QM6A 1N92A 1PGPA 3AF3A 2DCMA 4ZDIA 2C22A 4ISCA 2HXGA 4HUQA 3FUUA 4N47A 3PCRB 4U5XA 1HLFA 1ESDA 2WTMA 1EZ4A 4DBZA 3L02A 4C2AA 4EX6A 3IG5A 1VKZA 4WXRA 1YBVA 1AS0A 1VXRA 3DTTA 4QQFA 3SF8B 3L40A 5K03A 1WDMA 3DEZA 3NAGA 2Y4OA 1CRXA 1PHRA 1X1BA 3TIVA 5IK2A 4FXOA 4YQYA 3N87A 1U7TA 2DY0A 2QAGA 2PLWA 3QU4A 1RYRA 1XVIA 2FG6C 1Q15A 2EYUA 4GBGA 5H7XA 4ECEA 1V6AA 4L0DA 2QQ5A 1G5QA 2IUYA 1Y6JA 3DAOA 5TISU 2CMKA 1ODCA 3ZCXA 1Y3BE 4KWTA 4DL3A 3G13A 2KX7A 4O8ZA 1G6Q1 4F45A 2G40A 4Q02A 4XCVA 3ROTA 3DTVD 3DXZA 3V2HA 1TMGE 5KL1B 4RD0A 2R6ZA 3MMNA 4D0GA 1CEYA 5ALUA 1KBZA 1XWWA 1ADJA 3HZRA 2CFSA 4N12A 1NDQA 3L05A 4KMSA 1TZBA 2YJ6A 1WCYA 2HK9A 5J47A 3LLCA 1A1SA 5DLPA 3ORQA 4UEJA 4C6HA 2ST1A 1QIMA 4P4SA 2G06A 4ZDKA 1RPZA 1EWYA 1A9ZA 1TV9A 2BEWB 5JYCA 4GLJA 4F2DA 1E2BA 4AJJA 3VYTB 2ZJFA 4G26A 5KFYA 1VGQA 4FMDB 1Q7BA 4GC9A 1HEKA 5U9CA 2IQ5A 5L6LB 4ZC8A 1LF5A 2JCYA 4GG1A 3WAGA 1WBBA 3LX5A 1TT7A 1EP2B 4UTZA 4CCHA 1ZVMA 2HY7A 1J7KA 3BYZA 4CEHB 2FPIB 1AGYA 1XZPA 2DR3A 2G88A 4V38A 3MMSA 4B2IA 4TZ0A 2DUWA 4DWOA 4PPGA 3H4MA 3L8FA 1LUAA 2JGDB 1BRMA 2QLJA 2NRVA 4F4FA 4Z3DA 3G2QA 3RJJA 4F4HA 4LOKA 1VJCA 3ADOA 5CWRA 1JLMA 4F60A 1V1JA 4FNMA 2DY1A 1MJNA 1RWNA 2B4KA 5J9FA 4HSGA 5FV7A 4FGJA 3U1TA 3V7LA 2B98A 4KSYA 4ZOBA 3GA0A 1G8JA 5EQDA 3DYIA 4BO3A 3BQ2A 3TINA 4ZT6A 5H70A 4LRSB 2PO7A 8ICAA 3WRXA 3G6YA 3V1LA 4MJ7A 3LPAA 5JD6A 3U4CA 4EM6A 3DOUA 3L4JA 3IEXA 5A2GA 3H0LB 1JE1A 1QH0A 5D3ZA 5C7LO 1XHEA 3AI7A 1I10A 5LQAA 5ALVA 2X22A 4JLJA 1VE3A 3EXIA 3V34A 3AFMA 2BI4A 4IJ6A 1Q22A 1RYBA 3OM9A 4J0QA 4KTTE 1LKYA 3HJHA 5L1KA 1PG5A 1M5TA 5TMDA 4RZ2A 4Q8EA 5HGJA 3NWJA 1K9SA 2R6CA 4IIXA 4K4HA 1ZM7A 3HUUA 4IUYA 3SBDA 4KEAA 2J41A 2HT6A 3I1FA 4EARA 1OFGA 4UAJA 2FCRA 2HBYA 1U7UA 1H38A 3EA0A 4BNLA 4BYGA 1BXKA 1KDVA 2J32A 2JLRA 1YZTA 4JWMA 4JK3A 3NG1A 1UR5A 4DMMA 4C4XA 3MMPA 4CL0A 2NX2A 2CT8A 2O8EB 4FLMA 4NTZA 3UXOA 3RUDA 2AS0A 5LOVB 3DE0X 4L5IA 4TLEA 3UHAA 1USUA 2AV6A 2LM1A 5TMBA 5D3KA 3EUWA 3K5PA 4O29A 2GM9A 2FSSA 1WQ4A 3OECA 3QVWA 2ZE8A 4DDMA 3L4BA 4ND5A 2XQGA 3KV3O 2YN4A 3HSSA 5J2AA 2GD0A 2NPFA 2NP6A 1XN4A 4YVFA 2JPDA 5E4YA 4DAEA 3S3TA 3R4VA 4N65A 7ICJA 1NJYA 5C2JB 1RWKA 1A8HA 4A5SA 1RWPA 4TZKA 4TTAA 2MOKA 5B1HA 1VCIA 3X2SA 4D7AA 1RIFA 5I7SA 5CR9A 3R77A 1C41A 3LSTA 4RIGA 4D4MA 4CCYA 3DBLB 3PWTA 5KNCH 2P30A 4E1BA 3WLEA 4L8YA 3A14A 3DPIA 4MV6A 3T3DA 5G3ZA 3PSAA 2EJCA 4AMZA 3WL6A 1UOOA 2JCXA 4OHZA 3EZ7A 5LQDA 4DCOA 2OWEA 3SGLA 4V3CA 1SUWA 3FPBA 3TCNA 5IVKA 4O4IF 2YCBA 1E5QA 1GR1A 1ZP6A 3AKZA 4DC9A 4NMMA 5DPMA 1VIAA 3T1TA 2JAUA 5T3UA 1R0YA 2ASDA 1M3SA 4M9JA 1HG0A 1AX9A 3C14C 3G6VA 2B1IA 3MR3A 3U3JA 3E7PA 4B48A 3AFNA 4N5MA 5TGZA 1A7JA 3CLUD 1NKTA 2CMDA 3TD2A 4UEQA 2YQ4A 3K1YA 4HZGA 4J9RA 2F3UA 1U8FO 3JVEA 3Q72A 4U00A 1Z06A 1OFVA 2V7WA 2AZDA 2O8DB 1O89A 2C97A 1RM0A 3P2MA 5IS2A 4FDUA 2I78A 2BTOA 5CLQA 1N2CA 3CVJA 1JIIA 5EKXA 1JVSA 2AR7A 4BNZA 2CFTA 3FMIA 4JQCA 4FW8A 1DKRA 1XZFA 3AB3A 1FS6A 2B6GA 2JKVA 3NRCA 1PDWA 2JI6A 3INRA 1HIWA 4X20B 4R1TA 4KLDA 4LJXA 3RYTC 1Q21A 4XRGA 2WVAA 2BMAA 2HHWA 2EWMA 4DCNA 3W7BA 4F2GA 1EQUA 5FLKA 3GRAA 5A4IS 3QZUA 1N2BA 4FFWA 5KTKA 1CUXA 3MERA 2N9UA 4QBKA 1FMTA 3PUKA 1SQGA 4CT4B 4Z8XA 1PJ2A 2ZR9A 1GAWA 5JARA 3C8ZA 3ZH9B 1GPUA 2LKDA 3LY9A 1FDRA 4ETNA 4DC0A 1YKGA 3ZLVA 4MVJD 4CQMA 3HM2A 4DCTA 3B36A 5L53A 1E4YA 2IYYA 2ZB8A 3CW8X 3H4DA 3O03A 1NG9A 3K6RA 1O94C 1IEQA 8ICLA 4AQ7A 3OOEA 1IXRC 1EGMB 1CQIA 1KI4A 1ETUA 3M8SA 3M1LA 3VI3B 2HK8A 3FIUA 3UNXA 2DETA 1XCPA 4PG7A 3RAXA 1S1MA 2JGEA 5CNMA 4UAWA 3WGQA 2J3JA 1V3QE 4O8CA 3HB9A 2ISSD 2QN1A 2AEMA 4U5QA 4ZCIA 2VYCA 3CIOA 2VJCA 3ONWA 4BPRA 3DR3A 4JWNA 5U1PA 3ZCPA 1BMTA 3B48A 2RIPA 4BJQA 1GRRA 4JL8A 2UXDB 4WFQA 1HLGA 1MSWD 2VJYA 1SCAA 1C7ZA 2OD2A 821PA 5BYAA 2IYLD 1QRDA 3GFBA 3WP1B 4N3CA 3KWFA 3GRKA 3T5CA 4US8A 2Z9CA 5BSHA 1VDZA 4GXRA 3FMGA 3KEMA 4TLLB 5GTHU 1LV7A 2A9RA 1RS0A 2OECA 4KHZA 3JZFA 2FFAA 1OUMA 1B14A 3PFHA 3BJEA 1DLIA 3FTDA 4RYDA 3NASA 4YXWA 3I6MA 4TOIA 3WLQA 3C6ZA 2JRCA 2CBZA 3ON5A 1E5XA 3AV0B 4LVCA 3GHYA 1K1QA 1TTHA 5DYYA 4U02A 2GFQA 2OCKA 1HETA 3MSCA 2HQSA 2PX5A 4QPPA 3OWXA 4NF2A 3HE3A 5AVWA 4M60A 3FNHA 3PKZA 3RHTA 1IN5A 4MRSA 4DKJA 4MGYR 3NEYA 4KKVA 3CU5A 4P8RA 1ZD5A 4INOA 3W9YA 4CKBB 2JW5A 4BVHA 4IO0A 1D8YA 2FB9A 2RHGB 3EPRA 4MS3B 2YV4A 4F8YA 3A7EA 3L0BA 3S70A 3T6KA 3EIHA 1VLLA 3IDSA 3D2CA 3OTOB 3QQPA 1JFRA 4IIYA 3RRGA 2A19A 3OPXA 2WP8J 1PSDA 1Z4JA 1RXYA 3UXYA 2ZIWA 3NHWA 4K6CA 1ZCBA 3I2KA 3L6DA 5DTRA 4BFSA 1KBUA 2OA0A 5GZ1A 3ND9A 1NWHA 5JXHA 1W7AA 2PKEA 4Q9AA 2NQ8A 3RB0A 4F56A 4TLMB 2ZB7A 4ZCQA 3G7SA 3FB1A 3SXUB 3COVA 2K5UA 1VPEA 2G70A 3LWBA 3GT0A 4KSBA 3KKQA 3JASB 3N2IA 3LZCA 2WZQA 2XNKA 3WYBA 2H2IA 5IIMA 1ID1A 2HR1A 4JJKA 3EXAA 4MF2A 2VUHB 4G89A 4DARA 1TFRA 4ZYLA 5JPIA 2EIHA 4L5AA 3BF7A 4G1VA 4RCYA 2P68A 1AZTA 3K0BA 8ICNA 1RRFA 5AW1A 4CHTA 2I1VB 1D1PA 2CLKB 1FDIA 3BHMA 3TNJA 2HA0A 3WFZA 1LBEA 2QUAA 3RABA 1GQQA 3V5NA 3LD9A 3I4LA 5ALIA 2I9PA 4NBRA 1YR7A 2ZWOA 4XIJA 4YTEA 4Q3NA 4DCUA 3AI1A 4C7VA 1PVOA 4B4UA 1BCRB 4HXFB 1QB7A 2QLBA 4LXHA 4NX2A 1YGPA 2XNDD 3UK6A 3GEIA 3FTEA 3A7DA 1PFKA 3B1JA 2KB0A 1ENYA 2FZKA 3R5KA 3TZCA 4LYYA 1XUOA 4HL6A 4G4GA 1XA0A 2VRCA 1IHPA 3N8NA 1DBRA 1V37A 4L8WB 3HXMA 5FBVB 1WSWA 4ZVUA 5KX5F 1KPHA 2C61A 4J1SA 3AHEA 3W1WA 4JKIA 1K4MA 4FI3F 1GU7A 2NRTA 4OQEA 4KQGA 2Q6OA 2YIDA 4B6FA 1OB5A 1RBYA 2YHSA 5JXWA 2Q45A 3QKSB 3NHZA 3WISA 1BE8A 1MEJA 2X86A 2R87A 1DQRA 3Q1LA 4HFRA 4GSKA 3QFTA 5T4EA 3VDMA 2PBFA 4QNMA 1VBNA 1RM4A 3VOBA 3C74A 4I9GA 1B23P 1M6HA 4UUPA 2BPCA 4FZLA 1FRVA 1V48A 1E2PA 1G1AA 3O5AA 1WZCA 3ODGA 3BS5A 4LRTB 3L0DA 2DF8A 3IUSA 4QOSA 1UMDA 4MEBA 1T8SA 1A2BA 4MRPA 1YKSA 1X7XB 1EFLA 1NBMD 3T94A 4PRKA 3TMYA 1QFXA 2DBQA 4L74A 1TVKB 3D1VA 1AHNA 2FE4A 1IB0A 3OSUA 3QUTA 3EGXB 1X3SA 3FCYA 1YAHA 1QCYA 1LX6A 4X8LA 2YY7A 4GPD1 3A11A 7ADHA 2EKPA 1WXQA 4BDTA 4D3ZA 3DDCA 1P6QA 3OPYA 3ASVA 2BFEA 5C1OA 2IL1A 5LYJA 4A2CA 9ICOA 4ZZ1A 1JEJA 4B7ZA 3AVVA 5B6IA 4BWGA 3QU2A 2XMGA 5LXTB 2FWIA 5HDQA 4WJLA 1D2CA 4C0XA 3OE7D 4P3KA 3WGOA 3LQYA 1T4MA 2CV1A 4YRAA 3U6BA 2PZEA 3VGJA 4JI5B 3IT1A 1R4NA 3A6ZA 5F77A 3A6GA 3LC2O 5KFXA 3O93A 3PL5A 2PQ0A 3OX4A 2CB9A 4TN1A 1PNQA 1EX9A 4FM9A 1QK3A 4I1PA 4YJFB 3I5AA 2A1UB 3LBIA 3W6PA 2UUCB 1PTKA 2ASEA 3RYCB 2HWWA 2RGWA 3VDRA 4U7DA 1HF3A 4Z0HO 4A73A 2CYAA 1G8GA 5KFVA 3GK3A 4Y6QA 1EINA 4RPLA 1Z0KA 1K6IA 3GV5B 1O94A 1E69A 5FBLB 3CVVA 4PHPA 1IXRA 2GJ4A 4JJAA 1X0VA 4G2NA 2G6TA 1ZQVA 2L42A 4LECA 4BMSA 1KK0A 1QGDA 1C4OA 4XVQA 2PI5A 4D4JA 4EDHA 1M75A 1XVVA 3C6QA 1Y9DA 4XJXA 1ZVKA 4UM9B 2NACA 1ZM2A 3HBFA 1LVGA 4BFUA 1DQYA 4KO2S 2N1MA 4UUBA 3V8QA 1B0PA 3GLSA 5H3CA 3C48A 3K2QA 1F2DA 2WG2A 3WHLA 1SQ0A 3KEGA 2QRVA 1R64A 2XF8A 1O57A 3VDQA 1SHLA 4Z9XA 3H9GA 3UJ7A 3H4IA 1L5RA 1HDGO 1BVHA 3DBVO 1FRQA 1CUKA 1NBOA 4UHBA 4ZVOA 5AM5A 1G38A 5KFGA 4B4OA 1Z4QA 3V1TC 3N2EA 3DZHA 4IWXA 5KOJA 4RJIA 4X45A 1NRIA 1I1NA 4JT2A 3QE4A 2XA1A 2ZWVA 3NCHA 3TRHA 1XZAA 3ZVNA 3NHUA 2VEDA 3CT4A 1G55A 1JHYA 3T7KA 9ICKA 2OY0A 3GC6A 5BT8A 3KPWA 4HD8A 1FSZA 4O4IB 4BAGA 3SLKA 4Q4CA 2WB1C 4DWWA 4EG3A 1H66A 2KYRA 4HYTA 1U3FA 2COEA 2CHQA 2NRZA 4Y2UA 3AL0B 1G3UA 4P36A 4X7MA 3JPNA 1VDMA 8GPBA 2W8BA 4C4TA 3WKCA 1TZ2A 2JI8A 2WD9A 3NOXA 2BWJA 1DINA 1P9WA 1QX4A 1R6BX 1M8PA 1LPBB 1DCMA 1WEKA 1YWGO 4R8UB 3DL0A 1S89A 1KQFA 3PQ2A 4KPFC 1Z56C 2VDWB 4J49A 3AKYA 5LP6F 1CXZA 3RR2A 1UBFA 3NAQA 2WU8A 3I9JA 3QX8A 2IEZA 2D1QA 1QGED 1S7CA 3W3ZB 1TUIA 1LBTA 3WWDA 5F7JA 2C92A 2A1IA 2JLQA 3BMNB 4PTYA 3TTUA 1QC5B 5IPFA 5JZSA 4ITRC 1M6WA 2A1TS 4KACA 2DECA 2RGRA 4B3CA 5F64A 2I8LA 5J2FA 2JZOA 3ZD7A 1RBQA 1MDBA 2YZGA 1PJ8A 3QFCA 1MJGM 2ONZA 2Q3EA 4CM9D 1QIDA 4B4WA 1TE2A 1KMCA 4NCXA 1OX5A 3NM4A 2YHBA 5DO9A 2QXTA 4YRKA 5IJ0A 4ZKDA 3N76A 5BW6B 4TGLA 3D1LA 1ZMRA 2WIJA 4FCWA 3NHAA 3ZLTA 1SBZA 1Z0IA 1UJ6A 1C1XB 5KDDA 3SV4A 1V5EA 1VC2A 1MABB 1Z2NX 3MT0A 3TQSA 1X7ZA 2KZZA 4B2LA 3A1CA 4B9EA 3PWSA 1LD3A 2J5RA 2NVOA 4ESHA 1U94A 2L82A 3IIKA 5DDIP 3PQ8A 1W25A 5HNKA 1CY4A 1U1CA 2JHDA 3O38A 4IEEA 4LYFA 3Q7SA 3FZEA 3DZJA 1ELOA 2CMFA 3LA8A 4CKWB 2PY6A 4HAYA 2P5TB 4GM1A 1K06A 1E1NA 4OBWA 2XUKA 1II8A 3W4KA 1WZEA 4K2HA 3JQGA 3VNUA 5KSYA 3LOQA 3V2UA 4OQMA 1PKXA 4YJ2B 3LNTA 2I67A 5M3BA 4LVUA 2GZ2A 3IV7A 3T4EA 4NNPA 3SJAA 2ZIEA 1OTXA 3PQCA 2J9FB 4US1R 4JX9A 4A6DA 4P3OA 4AY4A 1UZLA 4TYQA 5KG5A 2AYXA 1JT9A 1C1DA 3DHWC 3F4BA 1ZQWA 4XUCA 4CF6A 4J9PA 4FZ5A 2J6UA 3MPOA 5AK5A 4FMPA 2IU6A 2EAPA 4MFCA 1XU9A 3ZGOA 4BJHB 7REQB 2A9OA 3FHLA 3UXMA 2OYYA 3DO8A 2BFBB 3I9OA 2O7NA 3A6LA 1LX7A 1B0ZA 2I5HA 3AB8A 3BBPA 2P2CA 1CF9A 4TWBA 3AF6A 1L4KA 1T8TA 1ZWKA 5AJWA 2WKWA 2H4YA 4RJJA 2OCBA 3RJ9A 3E7DA 3JQAA 4UNIA 1TKCA 4N03A 1GXSA 1ONNA 3VPDA 4LQCA 5JJBA 3MJDA 5E2IA 4FEYA 3H1PA 5K51A 4US9A 5T64A 2FHPA 2CN1A 3AHCA 3KKLA 2R2GA 4C80A 2BM0A 3PWKA 4DS5A 1CC1S 2EZUA 4RHUA 3ETCA 3N0VA 3DHEA 3ANLA 1O6BA 3DZBA 1J0BA 2WILA 1KVRA 3VPFA 2MWMA 3I9KA 4UZSA 4N8DA 4RESA 1TAHA 4WVFA 4LYDA 3F6EX 2C9YA 1BXRB 3QU5A 3I4CA 4XQ8A 1DCKA 4RDXA 4WRRA 1FP1D 1QG6A 4OHWA 1DRKA 1DMSA 4CTKA 3Q7EA 3UXHA 3LCUA 3Q5GA 2UYYA 2H54A 3KB1A 1DFIA 3HN2A 5KFNA 4C3UA 1Z8DA 1QGOA 3PVCA 1VYUA 1ISHA 1JI0A 2FQYA 3WBFA 3L04A 1P2FA 3L0PA 1SUEA 3B3GA 1K2VN 3O83A 1W29A 2Z43A 3CLRC 3ESDA 3U4MA 4H08A 5F2KA 2EBUA 4WBXC 5HG0A 2Z8ZA 3E7XA 1N1DA 2F48A 4J0KA 2O7SA 2UZ0A 3I0ZA 5KWIA 4QOGA 3PX0A 5EZYF 3I61A 4H3VA 2XB8A 3KD2A 3NAZA 2B9EA 1NVXQ 4P31A 3ESRA 3GMTA 3K4HA 2E4UA 1HOXA 2J33A 2KP7A 5KT6A 3WJ7A 3DAFA 4OYYA 1G20A 1NKCA 2OTCA 3VPGA 1W46A 1EE9A 3GG9A 3P2OA 3KBOA 4Z9YA 1Y48E 3RBXA 1S5LU 4NDNE 3IBYA 1O6CA 1SEPA 4WHMA 1UBHS 5KX5B 4DL2A 2ZTHA 3DF9A 1SEVA 1TEXA 1XEWX 3K0AA 2C9OA 2P7HA 2YZNA 3RH4A 3FSGA 3B1WA 5G0TA 5E79U 3A2NA 4RD3A 4L07A 3VUEA 3KSZO 2QPAA 2ORVA 3HI4A 1UBSB 2VXOA 4RD6A 3QE9Y 1AVTA 4HAVA 1N5OX 1KZHA 4OJPA 1ZQZA 4C06A 2YOGA 3ID6C 4Y2QA 3K2IA 2NUTA 4EJ2A 4JY7A 1N5JA 4NAUA 4I6JA 1FXSA 3EOBI 2HJVA 3TXAA 5AM1A 2HLNA 4F50A 4FWBA 1I7PA 3ZHYA 3T1HB 1E20A