2ZIWB

Crystal structure of the mus81-eme1 complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
318
structure length
228
Chain Sequence
KHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRVEEPTVLVLLRAEDITAKTAGKSLVIVDQEKSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRRIGPELSRRIYLQMTTLQPHLSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
total genus 48
structure length 228
sequence length 318
ec nomenclature ec 3.1.22.-:
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziwB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ziwB01
4BXOB 2ZIVB 4P0PA 2ZIWA 4M6WA 4P0QB 1J25A 2M9MA 2BGWA 1J23A 2ZIUB 1J22A 2ZIXB 2ZIWB 4P0PB 4BXOA 2ZIVA 2BHNA 4M6WB 2JNWA 2A1IA 1J24A 4P0QA 2JPDA 2ZIUA 2ZIXA
chains in the Genus database with same CATH superfamily
2WSSA 2BKAA 3ZH2A 1ZQ1C 1TZBA 5JTTA 3VPGA 4F91B 3JPWA 2IMWP 2NNWB 1EP9A 3WKCA 3PV8A 4QXRA 5D00A 5LR6A 2W9MA 3ERCA 4AZVA 2Y0SC 3PR4A 16PKA 5J2HA 2JFOA 3ZNOA 2J4FA 2C5AA 4KGVA 2YJ6A 1Q91A 2QR3A 1H8EA 3REQB 1JR3D 2ODTX 4FS8A 2Z4RA 1NF9A 4ZRNA 5DWVA 1V39A 3PLRA 3V33A 4B9LA 3R7AA 4Y2XA 4ZYXA 5JMTA 4KGZA 2CXUA 4XGIA 3ZK8A 2JVIA 2PEYA 2G9NA 2MSWA 4O2BA 4N3GA 4HXEB 1FSFA 3FSGD 1KMCA 4FDUA 1IDOA 2RFLA 1PLLA 4NBWA 1JKIA 2Q2QA 4MUKA 5F33A 4USAA 1NZDA 3GUVA 1WG8A 3G23A 4ZVRA 4UAYA 2Q41A 2Q45A 3PZPA 2AXEA 4MW4A 4DILA 1JAXA 2VDWB 4DL3A 2X3YA 4ZCMA 2A0YA 1ZOSA 3HBAA 3HJGA 3ITKA 4FINA 1ZQDA 4YHBA 5IK2A 1DE0A 2JGEA 2H1WA 3KWFA 4B4OA 4QX6A 1NBMD 4AQ7A 2KTQA 3MGCA 3V8QA 3TL6A 1WDLA 4OFBA 3COYA 4GXIA 3UJ6A 1HL7A 4LY3A 4IF4A 1N9ZA 2DYKA 4PGHA 5EXSA 1S2NA 4NM1A 1C3JA 1UBOS 3KTQA 5H0IA 4RF2A 4ECXA 2VANA 1MG0A 2G1KA 3UT5B 4M3NA 1JQBA 1FLAA 4D4JA 1C7FA 3B53X 3ICCA 1T0PA 5KFJA 4L5AA 5JYDA 2HHCA 4HDQB 2Q9BA 1YB4A 5KTQA 4ZRMA 5ALEA 4URZR 3V1UA 2D2EA 1MQ2A 4CDGA 4B84A 3VNSA 4MDYA 4MVCA 1KDYA 5BO5A 3BGDA 3W2FA 4TKLA 1KPHA 3S55A 4ECRA 5CFOA 1V5EA 4G0WA 3CRQA 3CE9A 2X3FA 2J1LA 3NLLA 3OFSA 5DW0A 6NULA 2P3QA 1KDHA 4FFNA 2XYRA 4EHFA 3IUEA 4TLDA 2I6XA 5A0LA 4V02A 4NM2A 1QTMA 3ZV4A 3H5OA 1JKXA 3Q7SA 3D64A 1FS6A 3SYZA 4FX2A 4RPLA 5EZYB 5BNZA 3AF5A 4MS1B 5KJFA 4GZLA 4EYHB 4F5YA 4R2IA 2NXJA 3DBRA 3MCZA 4WCVA 5JSFA 3B5IA 1SR8A 3HKCB 2HCBA 1NW9B 2H2WA 3P9PA 1C1HA 4RJKA 1Y6ZA 2FSVA 4WGGA 1KKLA 3S27A 3R2JA 5BT8A 2X4GA 5CNMA 1EYZA 2YWJA 5ER9A 1L4BA 1WVIA 5BNIA 1AHPA 2ZWAA 2J07A 2W9CB 3P8ZA 2VNJA 5AESA 5JCJD 5JZVA 2FB9A 4LA4A 3FVRA 4F11A 1I9CA 3ZV3A 2ZQ5A 4DLRA 1GFIA 2Y71A 1YZLA 2QRKA 2HLNA 5JH7B 2X22A 4EPRA 1US8A 2WV7A 2W42A 2X4DA 3I9LA 1EVIA 4Q02A 3GHYA 2FRVA 5FUWA 1Z7EA 1MUUA 4EI2A 4FBGA 2QD1A 3I45A 3TTXA 1VSQA 3RREA 9ICFA 4PTYA 1ECCA 5AW3A 4RW0A 3RJTA 3PW7A 1DX4A 2J46A 4IH9A 5D01A 3D0KA 4JLNA 4JIMA 5CFMA 2I3ZA 4WXPA 3ZE0B 3T1QA 4QQKA 4MZDA 1Z0IA 3V5NA 5MGNA 1KWKA 3WNBA 1OGYA 4UTPA 2TMDA 4D6PA 2WWXA 4PAOA 5DWQA 1NPDA 4W9MC 4UAUA 4KN7A 4FR2A 3DLCA 1DEOA 3I6QA 4P4MA 4Y6GB 2VAMA 3PX7A 1G18A 4KWHA 1L7EA 5CTJA 3E35A 3I01M 3L7OA 5B1IA 3ANLA 4N0MA 5ALVA 4RPZA 1JQ3A 1F8UA 3EF0A 2IBSA 1KPGA 2B8TA 2X8WA 4YRZA 3VISA 4EO7A 1FUIA 2O8EB 3QV1A 5LYYA 3BWEA 2XCPA 3GP8A 4HNHA 2J9FB 3UGTA 4M1WA 2BCGY 3ANXA 5FF9A 2EVWX 4PIMA 3MJRA 1QWSA 4RPCA 5C4GB 1U0BB 4DOMA 2O6LA 2HJVA 3UAZA 1UMBA 3H9BA 1NKTA 4IDOA 1HA3A 4I9UA 4GI2A 1OILA 2JVKA 1T3NA 5B58T 5LNK6 4KTTE 1O6GA 4DSAA 4A3SA 1D0SA 1HYGA 1B8OA 3ZBUA 4J90A 3CJRA 4TWAA 2F1RA 4UM7A 2FW8A 2PKXA 1GO3F 1KMIY 1CCWA 3G2LA 3U3ZA 3UAWA 2ZBGA 3DH0A 4LOKA 3DE0X 3KM0A 3C5WP 3PXUA 4OLAA 3HU1A 2C22A 3WRWA 1XZFA 1PK1B 2P6UA 3F73A 2V5UA 2JHAA 5SZIA 3IMKA 1UK8A 5IF3A 2AR7A 2Z8YA 4FOPA 1YDFA 2WKWA 5EE1A 2EG9A 3AF6A 3GELA 1CHDA 1Z6TA 5AK5A 3SZMA 2QD3A 4PLYA 4A8JC 2BSXA 5JY6A 4EFLA 2CSXA 4R6XA 4C0QC 4DDHA 4ELVA 3GHHA 2RSLA 3OKPA 3TW4A 1YZNA 4RKQA 3D0QA 3FFWA 5CEJA 4X91A 1OX4B 1CY2A 3AEKB 2HLHA 2PCLA 4XARA 2AXNA 1HI9A 5IX8A 2EZXA 3WFIA 3NPAA 1IBSA 1C41A 1QXSA 5C8ZA 5CXXA 5HM6A 1PJSA 1O77A 1OJLA 2R6JA 1UFKA 3H11A 2PK3A 1K7FB 4IUDS 3CLVA 5TISU 1GEEA 2QARB 1MH9A 2AKEA 3MJHA 4Y1GA 1IEXA 2A9PA 2XCUA 4ZYYA 3A6FA 1IZ9A 4FB4A 2EG5A 3DZ8A 4RTSA 4LY9A 2GTHA 2ZJ3A 3M4JA 3AM4A 3TOXA 1RRKA 4OO3A 1QOPB 4WH0A 1V1MB 3NFRA 5LQDA 3W06A 4FM9A 3RADC 1JHQA 3ESZA 2PMEA 1KOLA 1TCAA 1P0MA 4EZIA 2O4CA 2ATVA 4EY4A 2WJPA 2JK1A 3T5PA 2JH1A 2QKYA 1PNRA 3RS9A 3C3AA 2XJ9A 3KPVA 2FSGA 3NBUA 2B1RA 1G64A 2QVZX 5LJLA 1XVAA 3EEFA 5KT6A 4TTPA 3AI1A 2WPNA 1F0KA 3LUFA 3ZBQA 4NLZA 2OYRA 3PXDA 2M98A 4F85A 1Y7TA 3A1TA 3OJEA 5JBQA 4KPGA 3PCTA 3FGZA 2WHRA 2I8AA 5I9SA 5KWVA 3KJQA 1GM5A 3TFWA 4D9HA 1P7PA 1IN6A 1AKNA 2X13A 1TUIA 1CY1A 4D6YA 3WYAA 3OOEA 4JK3A 1C14A 2LM4A 1PF7E 2ZW9A 4TV9B 4XI9A 1CU1A 3OH8A 4GC5A 3OLCX 1QZTA 2E8MA 3FMFA 2NZJA 1UJ6A 1E8NA 2YZ7A 4EHDA 4UCQA 4XEHA 5I8WA 5HPYB 2BKLA 3AR6A 4HGZA 5EYPA 4HMOA 1SV0C 5JWRA 3VGJA 5EPOA 2DSTA 4QZFA 4Q21A 4O4JA 4KPUA 4BLTA 5SY9A 2CB0A 4PHDA 2PO7A 3BZCA 1G1MA 3GNTA 1ULZA 2R7KA 5BSEA 4PGMA 4BPRA 3M9WA 5H3HA 1RIFA 2FAXA 4FMDF 1X9WA 3RF9A 3KAKA 5IIJA 2R7AA 4TRNA 1GGJA 1U7WA 1TRKA 3OM8A 4UNNA 2PL1A 1AMOA 3U7JA 4MICA 4BHTA 2QE7A 3OZDA 4G2TA 4RK0A 4KGXA 3VTKA 1EHYA 2CVZA 4AC9A 3FR8A 1OBVA 1XLTA 3SQWA 2HMSA 3IPCA 4B5LA 2FU5C 1XXHB 4NK5A 1XTZA 3VR5D 1I7SB 1RXYA 3WBFA 1RWWA 1QHSA 1RWNA 3GVPA 2DBYA 4J4TA 3ZVKA 2F90A 3EXEB 5JV5A 5ALXA 3BE5A 2BFPA 1BXRB 3GW8A 4AM8A 5H3LA 2IE0A 4L4SA 3EEQA 1LF0A 4FGKA 1E98A 1XSPA 5HZHA 4JX8A 4KBFA 2B0CA 5EZSA 1NW4A 3ETRA 1S9FA 4MVJD 3U4CA 5BV8A 1X42A 4P54A 5HP4A 2KIVA 2REQB 1E6WA 3RANA 2GCOB 3AJ8A 4M0AA 1YASA 2ZJFA 2IX3A 1P2VA 3TZ6A 2V7XA 5FWXA 3E03A 5JCOC 3AFOA 1E2EA 1M5UA 3KVRA 1PS0A 1XMJA 2P0AA 5F5XA 1WUJS 3B1YA 4MAFA 3GH1A 1Z18A 2PL5A 2YICA 5F2NA 5FLYA 2F4VB 4NECA 2ECFA 1JALA 1RHMA 2IHVA 4QOGA 5KOHB 4P9NA 1WTAA 3TR5A 1SXJB 4DIDA 2FUCA 1XNQB 3ZGXA 4A2WA 2O57A 3E1SA 1XPOA 3SIRA 1IUKA 3HE3A 4AJ4A 1H93A 3KALA 4ZI7F 2G77B 4U7GA 4TRJA 2YY5A 2G08A 5ALTA 2ORWA 3HXKA 3MGAA 3LWNA 4YR9A 1AGNA 3K8ZA 1EUCA 221PA 3PD7A 5BQ5A 4URYR 3CLRC 5ISMA 1CG6A 2W2LD 2CMGA 2ZJBA 2W6NA 3C4QA 3COJA 3ZIAD 1DBVO 1JDPA 4QZ9A 1RXUA 1XNRB 5DLEA 3OX4A 2Z4TA 1NRJB 5KSWB 2IUSA 1AO3A 3QTLA 4A2PA 2O2DA 3OESA 4PRZA 1I0LA 3R0ZA 2GB4A 3A4TA 2G8LA 1FJXA 4JHXA 3MMPA 4FZJA 3MR6A 3R7FA 2B6NA 4Q12A 1E3LA 1OTYA 4GEGA 5KSZA 1BJRE 4YMTA 2RKWA 2ZTHA 5FR2A 1EQ2A 1L4LA 5COQA 2AOUB 4Q4HA 3MUNA 3BSWA 2N1MA 1SBNE 4ZVMA 1DJOA 4XPZA 2EAMA 1SBCA 2O05A 3I32A 5BN4B 3AJAA 1AUOA 4MNTA 2GYVA 2IUTA 3VO8A 3ET5A 4DR3B 3T61A 1E3IA 2YASA 1N75A 4D26A 2CLFB 3L4SO 2HHTA 3ZBTA 3VYTB 2P11A 3HDHA 1QG0A 2YXDA 4P6VF 3T79A 4BQQA 1ZNQO 1KI1A 1QQTA 3ZGYA 3ZGOA 1ZOLA 2JA1A 2R1TB 4LJSA 4QPZA 1UH5A 1YC5A 3I42A 5AXDA 4AMZA 2QRUA 2W2VA 2IRWA 5B36A 2NUBA 3SK0A 3SDSA 1ZJZA 3EG9A 4UBCA 3CZ4A 2JH3A 4ED9A 1Q6YA 1G4UR 1BPBA 2M9MA 2I6TA 1E2IA 2FN3A 1K8XB 4H0CA 4D8XA 3Q98A 3TLAA 1JGTA 3FCEA 4YS6A 3KSUA 3H83A 4D3FA 4OD0A 2C54A 3OCCA 1XYGA 1NVEA 1NHGA 1TKRA 2VT2A 1DWUA 2C83A 2VSYA 3CKYA 2H4FA 2EFDB 3EFOA 3MZ0A 1CUGA 5BSMA 3WIBA 1DEAA 3HYLA 5AK0A 3QPAA 3VOAA 3U6KA 3L5KA 1NE7A 2P2LA 1BFKA 2FJ0A 1RU3A 5ADUS 1JVBA 5IKEA 3KUDA 3I1IA 2JFPA 2IVZA 3L0OA 1VFNA 5JCXA 1XD8A 3OQNA 1LRLA 4KXXA 1L5SA 3IEUA 5J4KA 2NZWA 4A6EA 4B81A 2WK1A 2C03A 3QJGA 3U7HB 3MCVA 5AJYA 4ZAWA 4BTEA 1PFUA 1DCKA 2V7GA 1BHQ1 2GK7A 1ZNXA 3CUSA 2V54A 4M9ZA 1GLGA 4C4XA 5JXWA 3O8RA 4HQFA 1N7GA 5B66U 3EGXA 4FZNA 4QYWA 5IJXA 2PS1A 4Q7LA 3L8EA 3ZE6A 4MX8A 5CDUA 3GIDA 2QUHA 4JUBA 1N6PA 3H1PA 3K20A 3Q3JB 2J3EA 1Y63A 2P79A 5JAPA 9ICUA 4WPGA 3K0KA 3LQYA 4AIIA 3AFNA 5DOVA 2GBCA 3TCNA 4ISCA 5LBIA 3T54A 2OZVA 4ZMRA 3RASA 4R9RA 4BFZA 5F77A 4R1LA 2C96A 2QYHA 3B2NA 5JAUA 4YMSA 3H3XA 1QH8B 4ZHQB 3JASA 1KL7A 4Z4FA 3W8EA 3BZKA 4GC6A 4JITA 4EB6B 4HUJA 4BNXA 3P9CA 3GIIA 2P2SA 3COWA 3U61B 3EIOA 4CV2A 5JC8A 4XWKA 5DHFA 4U8GA 5KSPA 4S04A 2O6KA 4W5OA 2GLXA 2IYNA 2OGUA 1HE3A 5JEEA 4F4CA 3M9XA 2ZVDA 3Q41A 5FA8A 4DBZA 4P4LA 3DEZA 3T5MA 4ER6A 4K9DA 2PQMA 3VYRB 2BM0A 1PWXA 5IT0A 3R77A 3BG5A 4HCJA 3TAUA 2HFJA 3O74A 1R10A 3HB1A 3HZZA 4BMXA 4BX9A 3CJTA 1SAYA 1PSZA 1IHUA 5IT4A 4AMGA 1QBKC 4UU1A 1UDXA 4HZGA 4L8LA 3PWKA 4IQTA 2YHSA 5J59A 4C0WA 3GFQA 2EW2A 2Y1FA 2D1RA 4D74A 2DMRA 2B82A 2WVHA 1FCJA 1Z0KA 3WLLA 1WXQA 1Q46A 3IALA 1A69A 3IMCA 5JCZA 2DUYA 1I1NA 5AKLA 3PZBA 1MJGM 3SC2B 4QBFA 5EEGA 1MRNA 3EIWA 8ICNA 1JVNA 1S2IA 3HZOA 4F2DA 9ICWA 1WB6A 3QLJA 3LK7A 4AJLA 1G3MA 1E5VA 1WP4A 3EDRA 3D6JA 4WXMA 4BNDA 3GV0A 1Q1ZA 4A26A 4RQBA 1P0IA 3WNCA 4Q3KA 1FDWA 2NT4A 4D8VA 1X9MA 1LTQA 5MN5A 3H04A 5JJKA 3ZVNA 2DC1A 3MYRA 1XVTA 5LU8A 4G09A 2XZDA 1FMFA 3TOSA 4D96A 1FU7A 2BR3A 4QLBA 4LOIA 4MYCA 5CYOA 4F1WA 4DNFA 2HH9A 4TV8A 1FMTA 1RYFA 2EBFX 1EESA 4RK1A 2VHYA 1IIBA 1G7SA 1NVFA 2PT9A 3WGLA 2R6AA 4YPFA 2H9IA 2PGOA 1NR5A 5CAEA 3SFVA 4M1KA 2GJ4A 4GRIA 2G17A 4BX0A 3VFDA 1PT6A 3KIPA 1QFXA 1PP4A 2SKEA 1A76A 1WJGA 4LXUA 4DCGA 3OM0A 4NLBA 2A67A 5CLGA 3IJEB 3BZBA 2RGEA 2Y8EA 2QZSA 1Q1EA 5FEMA 4OIMA 5AKIA 2GF2A 4Q48A 3UYLA 3X2FA 3F53A 2QP4A 3KHLA 3IG8A 3ABOB 3PW5A 4RJJA 3WSVA 3NU1A 4MW9A 4BAGA 2FPPA 1PFWA 3RRXA 1Z4LA 3VOBA 1Z0AA 4NC9A 1JPVA 4HDKB 4LJAA 2MMCA 1DQYA 1AZLA 4EA8A 9ICQA 5D5HA 4LYGA 3TR6A 3NATA 4HR7A 2DKXA 5AYVA 4CCYB 5KT5A 1P8AA 2CW5A 1GA6A 1G4AE 4S0XA 4N3CA 2XD4A 2KS6A 1GITA 3QVJA 1YMVA 1ELOA 2KMLA 5TGTA 4AY6A 1SCUB 5IH7A 4MWSA 5HCIA 3REOA 8ICJA 5AXBA 5ES3A 1Q3TA 3D3WA 3SXJA 4DLVA 3KEQA 4H27A 4NATA 3DT6A 1ZRMA 4QWEA 1GZ7A 2DPGA 2WSMA 3VV3A 5EIOA 2BHSA 3G2MA 4B5KA 2VFAA 2HDOA 4G5QA 1ZH2A 1G98A 1YSCA 2G1UA 3UC5A 4BEBA 5B37A 1EHIA 1MOZA 5G0VA 1YKSA 2FKNA 4D0GA 5F7OA 2VP9A 3L4PA 4CG2A 2HU2A 1HYHA 1HDZA 3FD8A 2E85A 1UPTA 1YZ6A 3S70A 2B36A 3B13B 2LXNA 2I3DA 3QXJA 5BOMA 4F6RB 3TB6A 1ZQ9A 3M6VA 3CB4A 2OD9A 5BOSB 3KG2A 3LXXA 1ZU5A 3ADKA 4IJKA 1OY1A 1WXHA 1K68A 5C1PA 1J2MA 3WAJA 4KMMA 1Z8DA 1R5NA 3V8NA 3NGDA 3I61A 1JEOA 2WICA 3KT0A 3IV9A 1WSAA 4UHDA 1OXMA 4RA6A 1YQGA 2VDVE 5KFPA 3OECA 4Y6OA 1RYZA 1Z6XA 4FD2A 1FW8A 5L51A 2QZJA 1UDAA 4D99A 4EGCB 4TL9A 3KX2A 2J7PA 4FKZA 3QUTA 3C5VA 1BKYA 2UDPA 4TVKA 4AS3A 2ORED 2D1TA 3GGOA 1YUNA 2VJNA 3GRPA 1H9CA 1JXMA 1X92A 2EWMA 4J9MA 5A5GA 3EBLA 3RRMA 4CIAA 2BKUA 2UVPB 2JJQA 4YAGA 4JN6B 1ZH4A 4L4ZA 5KOIA 4WOKA 2Z1NA 2OGTA 4E11A 1VI6A 4IUBS 4JBIA 4E6PA 4JC5A 2YWBA 4TKMA 1YV9A 4MUAA 1YTLA 4YAUA 2ZSDA 2WM8A 4LX8A 3TQHA 3K6RA 1J23A 1B3RA 1SJ9A 3RJMA 1T4DA 1VI5A 2CFSA 2DWQA 3I2HA 4NJMA 4EEYA 2VF8A 2HR1A 3NW9A 3E2EA 3IS3A 1RJGA 3G9UA 2RAVA 4ASUA 1QOZA 1F3OA 5BQFA 2BUBA 1IXRA 2CE2X 1EXDA 3HFGA 1UXKA 1Y6GA 1U1FA 1NQXA 1LCIA 2VC2B 3ZGLA 1Z0UA 3GAFA 1WNFA 4HEA6 2FWPA 3EX7C 4TWBA 3K0AA 1ZXLA 2AOWA 4EPYA 4IRCA 2PGNA 2C5FA 3ZNNA 2JLZA 5FTNA 2HRQA 4X20A 4M1EA 1J5XA 2BF7A 5JHHB 5H7XA 1IN7A 2ZRJA 5FIUA 3AIIA 1G17A 2BKVA 2VBGA 4YDRA 2OXTA 1B26A 1NN1A 1B93A 4B46A 5KVSA 2V74B 3RDPA 3ZDEA 1T3HA 3DWGA 2OPHA 2NN3C 1MO5A 5JD5A 2GKOA 4XYBA 1NXXA 5DM2A 1F8GA 1RWQA 1PD1A 1AA9A 4MDFA 4ARAA 2PMZF 2IKSA 1D8YA 3RU2A 3E48A 1ETUA 3F5MA 2R62A 1S8FA 2FMIA 3EOBI 5CFQA 4C0BA 3DHVA 2NZYA 2Q28A 4L76A 1QPBA 4XA8A 3AMVA 2C82A 4BV2A 3PC3A 4XWAA 2O5RA 3LQ4A 4KN4A 4AP6A 2GHQA 5TPZD 3INYA 2QAGA 4GAEA 1RAFA 3H2KA 1NVMB 4K9SA 3LDAA 2HIAA 2XZTA 1PSDA 2RGNA 4GHWA 4E2YA 5B2EA 5LFAA 1JF8A 3SHFA 4C80A 3AW9A 3ZXSA 1TEVA 3GLFB 3N7SC 2HREA 1J7JA 1I14A 1T9DA 3PA8A 4UOZA 3SLRA 4OCZA 4CL8A 1FRQA 5E4TA 5CBPB 4ZOLF 5JMOA 2ZJYA 1EB8A 1K97A 1N3LA 5KTNA 1D9XA 4XQ8A 5H4GA 3HJBA 4C88A 2IZ0A 1CUSA 1N33B 1E94E 4B3SB 1FSZA 4MARA 1SBIA 3OCYA 5ARDA 2C2ZA 3PQEA 1D1TA 2GJAA 3O1LA 1Y34E 4KO3S 1NATA 1JEYB 3TAHA 4D4MA 5E79U 3SR3A 3T5AA 5F7ZA 1MPXA 5HK8A 2BR5A 5DDMA 3PQDA 1NJ1A 2F3TA 4K6FA 1TK2A 1MOSA 4C2UA 4P3NA 4UUBA 4OYHA 3ED1A 3LNCA 4L4UA 2BTQB 4CEHB 2FFBA 3N70A 1KYVA 4JOCA 3N8GA 3PR5B 5IYZA 2R6R1 3ZDAA 4D4HA 4ID9A 1Z5GA 2B1GA 3NONA 1MX9A 2WWVD 5EUQB 1BE8A 5J0RA 2H4WA 4J9PA 1Y37A 1N48A 4G89A 2TYSB 5JAIA 2ACVA 1DGJA 2BGIA 4CCHA 2OFXA 5LB2A 5JR3A 1OOEA 1QKIA 3VPDA 2QJWA 3B3JA 2OSBA 4KX3A 4GDMA 5LSAA 4NCAA 2IWHA 1PZMA 3ZD9A 2HVIA 3PIIA 5KYXA 4AMBA 4RQ8A 2HWXA 4HLUC 3H42B 3TGPA 1DNPA 1X15A 5FI1B 1U63A 5JISA 4FC6A 3C85A 4M76B 3KTOA 1XV5A 3HC7A 2RAFA 4H3KB 1Z56C 2ZIAA 5F7JA 3SQLA 1AUVA 5L7WA 1KC1A 1D3AA 2FEPA 3NIWA 4RHUA 3BA1A 1K0FA 5GONF 2TMYA 2C98A 2R1ZA 4HRXA 5LWQA 1UP4A 4MYSA 4O4IA 1C81A 1S97A 2XUOA 3EGDA 3TKLA 5A0VA 2J41A 1G0OA 5L3QB 1OAOA 4EF4A 2CL0X 4LVCA 2Q21A 1G59A 2E6UX 2Y68A 1OIXA 1NXQA 8ICWA 1IN4A 4GSLA 3KJFA 4Y0VA 3WYBA 1ZPDA 2RGUA 2QRMA 2YXLA 3B1FA 3SM3A 2ET6A 2HI0A 4D3DA 5D51S 5CG2A 2IZ5A 3R23A 1HYBA 2G1AA 3L06A 1WDWB 4BRWA 3L1IA 4D98A 1SM4A 2OHFA 3HFRA 1CF2O 5IM5A 3WOVA 3QY0A 3ICXA 2GJ9A 2AWNA 4RQ4A 1Z33A 3THXA 1HZJA 3JQFC 3TN7A 1KQFA 1GA1A 2I2BA 1G8PA 3I9OA 4Z8YA 1MO4A 2DBQA 1JPUA 5DB9A 3A04A 4N6GA 1YZQA 2J7KA 5H9WA 2ZI9A 3DLAA 4PLGA 1DBQA 5DQHA 3LL7A 7AT1A 2V7VA 1NP7A 1KI7A 3N05A 4KODA 4YV1A 3AGPA 5D2CA 4HUQB 4HKTA 3DYVA 1MJNA 2XI4A 4RKEA 1XLTC 3TLYA 1YQQA 4W8HA 1ZQJA 3K3PA 1FL9A 1PGJA 2X7XA 5IDYA 2FSPA 5CPFA 2V7BA 1T5IA 4JNCA 4EX7A 4G23A 5EMHA 3M1AA 1W4LA 1ZYUA 2TRSB 4LHXA 2QUZA 1Y81A 2CJWB 3BKWA 2IH4A 3T1YB 4FE3A 3C7TA 3T7EA 2IOFA 3ZQUA 1R8XA 4RKWA 1F1BA 3TG8A 2OMKA 3WLOA 1T29A 4TXMA 3T5DA 1MC5A 4OQFA 2FYTA 3SDBA 4MRSA 1CK4A 1NF2A 1X7YA 4QT4A 5CJPA 4L5JA 3NB0A 4BS9A 3ZI7A 1T3ZA 3E9RA 2B92A 4JI8B 1ES9A 4QM6A 5G0TA 9ICEA 4EYEA 2VP3A 5JBIA 5G53C 4D97A 1JIJA 1QG6A 1YBAA 1NI4B 2XDQB 5A3VA 3K70C 2FX2A 4JWTA 2EZYA 4UEKA 3OURA 5HK9A 3TRJA 1QIFA 4DJTA 1KAEA 1LDEA 1M0EA 5BQ3A 4BTLA 1K5HA 2GZ2A 1R0BA 1MIOA 3LG2A 1X86B 3A27A 4C0XA 1KOFA 5AMXA 3MMNA 3NDPA 3DCJA 1YAJA 2KB0A 5U9CA 2VAXA 1X1SA 1H6DA 3OSPA 3HM2A 3RQIA 4UB1A 3KKOA 3M6ZA 5FOUA 1N0UA 4NVRA 1DBRA 2GHIA 2FLVA 1OB2A 2G7MC 1UJBA 3GV7B 3OPVA 1HFWA 3NIDB 1EFVB 2HO5A 5CGQB 5FWAA 3DR5A 3RRYA 4R7GA 2P6MA 4IMJB 1B8NA 4YMOA 1JJBA 4MV9A 3GJ5A 4FFRA 4OTZA 4AKGA 4FBLA 4K7JA 1H22A 1J8DA 1UWVA 4UUNA 3RE1A 4OQDA 3ZWYA 5HWSA 2AN5A 2VP6A 3BX1A 4LGMA 2PWAA 3N8NA 1V1RA 2FX3A 1PLJA 1WHSB 4UDOA 4YC7A 3RIGA 4RVOA 1KKMA 4E51A 4L73A 4D79A 3AUTA 1S8NA 1RMTA 1E18A 5JYEA 4WOJA 3RVJA 1XVIA 4QBTA 2A6PA 2I6QA 2N1RA 2OQ2A 4KFCA 1JB9A 3WKBA 3NC0C 4QELA 5EMNA 4PG4A 3IUPA 4LX0A 2HZ7A 4IL6U 1J2RA 4BWYA 4QAJA 2KHQA 2F43A 5DQGA 3HRDD 3IEIA 4L4XA 1W2HA 2W0SA 3L04A 2C7BA 2BBOA 4QTUB 2HF7A 4JT8A 4B2PA 4X7MA 2Q5LA 3FDSA 4BY9E 2A1TS 2Y0DA 1L6RA 1LTHR 4NPHA 1FP7A 2IZOA 2GZMA 3L8GA 4KWCA 1XTRA 2JEIA 2PXXA 9ICLA 3L01A 5JNTA 4NL9C 1VHWA 2VQFB 4LBZA 5LKAA 4W5RA 1EFPA 3ILYA 1M1NB 1UFQA 2P8SA 3NMUF 1YGPA 2OQVA 3GA0A 4YTEA 1O5IA 1W36B 2RHGB 1OPRA 3L7IA 3SQXA 1M8JA 3VYWA 4F04A 3FETA 2ONKA 3K5PA 4Z4QA 1SL1A 5FBLB 2IS1A 4FHDA 1KZ4A 2FW6A 1WU7A 2RGCA 4MLPA 3F46A 1E2HA 1JR4A 2QD2A 4KW7A 1DX6A 5KTPA 1ACJA 1KP9A 4FBMA 3HWRA 1ZQBA 2HXYA 3RGWS 4D9EA 3R0XA 2KZ3A 4QVGA 1XZIA 2VP5A 5JS6A 2JVJA 3MWEB 5DOZA 3KR9A 4G1EB 1O96B 2IBMA 3BBPA 1KU0A 3SKVA 2J6IA 4TTVA 5DCWA 1ZESA 5CK5A 5BYKA 1YCHA 2E0IA 1FYXA 4HPXB 4WGFA 1KZ9A 1SHKA 4ZQCB 4TYMA 2M32A 5I8PA 1OX5A 5IABA 4MPPA 5KVCA 3PGXA 4DC0A 1ODCA 1QF9A 1YVUA 2GK6A 4B6JA 4YCSA 1Z2OX 4NCHA 4F2GA 1ULHA 4ZQEA 4LF5B 5AIBA 1K4KA 4D8YA 2B9EA 1QK5A 4Q24A 1A1VA 3A14A 4TTRA 1CUHA 4HYYA 2OO5A 3DXZA 3O5AA 3BFKA 4I55F 1V8ZA 5F98A 1R4AA 1X8LA 2D3TA 3IHLA 5T41A 3TZLA 1QP7A 2JAPA 2R3SA 1U9JA 1ADBA 3GQBA 4EH1A 4A03A 1IOZA 3HLKA 4UULA 5A5FA 1SOMA 2WAMA 4RMIA 3CGWA 4IDGA 5EIWA 5AK4A 2A2ZA 4DUGA 2B1IA 3MOGA 4C9BA 4E7OA 2XOKD 1OXUA 2PUFA 1FYVA 4NIMA 1CQWA 3CH4B 1G5FA 1DP4A 5CCXA 1LI5A 3HA5A 1SV4A 4G4SO 3SOZA 4AL4A 1M5RA 3SZ2A 3T7KA 3L7AA 1R5OA 2IDKA 4XB1A 4BZQA 4Q00A 1UL1X 3KQMA 4X94A 3SY8A 5COBA 3GPLA 1Q2UA 3TSWA 1IFXA 3UN1A 1C9KA 4PVDA 2HCTA 4BKPA 1DRJA 4OHXA 1Z35A 1MNQA 1X94A 1MVOA 3QMPA 1ULTA 3L8YA 4KSBA 2FGJA 1NW3A 4YIHA 1UANA 4X93A 5K0CA 1EFUA 1FFDA 3EXAA 2FWRA 1ZN9A 4G24A 3UYKA 1V5WA 4JD5A 2YFQA 3TVTA 4M9NA 2VH2A 4EDHA 3SLGA 5FWNA 1LJUA 3Q85A 1MO2A 4J3NA 3MWFA 1U9LA 1N1EA 4JBXA 3KUKA 1ZQYA 1DWQA 1W5FA 4CLOB 5DPMA 4EJ6A 1EGMB 3ZWXA 1U2DC 5KWJA 4MEAA 1XZJA 1PKEA 3DMNA 1P9NA 4CG1A 2O5CA 5C8VA 3DA8A 5FL7D 1AGPA 5G5HA 2PI5A 1E5QA 1NBEA 4BX9C 3EULA 4KQEA 5CVJA 4C0LA 2Y1OA 4ZPXA 1FB5A 4DG8A 1ZH6A 4W1SA 1V6AA 3WVNA 4UASA 4ND8A 2LVBA 2C92A 3TBHA 4LRUA 4ITVA 2HXSA 3PQ3A 3PFFA 1Z28A 4HP8A 3BK1A 5AVQA 5H02A 4U2FA 1A8SA 3VI4B 1FTYA 2XVTA 3AVQA 4NI5A 4Z49A 4K6MA 4FLMA 5FYDA 5D1NA 4KWIA 2HLPA 2RKBA 3TARA 1QFYA 1MGOA 2X4LA 3DBLA 3GXBA 3D6TB 5HBGA 5JO0A 3QE3A 3CGGA 4YD2A 3DL2A 1KSJA 1FE8A 1L7VC 4FEAA 3EDOA 1PEKE 2YWEA 3G0BA 3CSUA 5AVRA 1ZQPA 5IUNC 4PX2A 9ICRA 5LZ4A 2LWIA 1ZSYA 1JYFA 4B09A 5J0XA 3RB3A 1FUEA 3PVSA 5IVPA 5IILA 1AJEA 1GSAA 2N42A 1P9LA 3N8DA 3NVYA 2JZOA 3SAGA 1ZQEA 4ZI2A 4FNOA 1E2FA 4MS4B 2GEKA 2GI4A 3OZRA 3W5AA 1ODJA 2VBFA 3WHPA 1D9DA 3RJGA 5IC6A 2QR5A 3PDCA 2DR2A 1IOWA 2BPFA 3ITNA 5AJHA 5AI8A 2WMYA 1T4CB 2AMVA 3RKRA 2F1KA 4QICA 3VSAA 1P0FA 1J42A 1W44A 2R8JA 3IOBA 3GRYA 4PWYA 1Q3UA 4LECA 3X1DA 4YFKA 2JA2A 5FBHA 2EBWA 1WUHS 2NUTA 2QWXA 4EUKA 1C1XB 5L6MB 4Y2YA 5AVTA 1FP6A 3TW6A 3NDRA 1W0CA 5HRAA 2ASJA 2QG6A 3B52X 1SBQA 2VJOA 1I7NA 3TDNA 1QGZA 3C24A 3CX6A 5JPDA 4O0MA 1SOAA 4PYMA 1A2KC 4Q4AB 2Z83A 4YGXB 4RMNA 3G7SA 3V4OA 5K8LA 5ESRA 3P4UA 4UM9D 5EL0A 1QYWA 3C5FA 4MFCA 3SC4A 2EJCA 4CM9D 1XRPA 1G6OA 3F6YA 3WL3A 3H5IA 2AX4A 5IJ9A 2AG8A 2FZ5A 1Q0HA 3EVAA 13PKA 1JMYA 4Y0NA 2WTEA 4XLLA 4CEJB 2LNDA 3H2SA 2GM9A 1QX4A 4RJIA 3L7YA 1J8MF 4KLOA 1JXLA 3VR6H 3E7WA 1M6WA 1AS2A 1IMOA 4FONA 5BN3B 4PAQA 2P69A 4ZJZA 3KUUA 2X86A 1PW5A 3PX4A 4OMUA 4P0PB 1UPXA 3GK3A 1SEPA 1C4OA 2AG6A 4MR9B 5CDTA 3AF0A 4LZOA 1TB4A 3AZPA 2AUTA 3HNOA 2P30A 5KTSA 1LB1B 1SL2A 1HTBA 4QWCA 4GPAA 4IQ4A 1E2PA 5AM4A 5BSRA 3ZOKA 2OV1A 3ZK7A 3OE5A 3QELA 2YJTD 4NU0A 4Z5XA 4DQ0A 5IWAB 3FJ1A 3NCHA 4J2HA 3K53A 1CNMA 4C5CA 3A2MA 4CMGA 2QRPA 4B3RB 4YP6A 1QE5A 2HHJA 1JBEA 4YCBA 3A6DA 3IB3A 3ME5A 2VDOB 2YBDA 1OFUX 3RBVA 4ETWA 3ONNA 1N9KA 4AP9A 1KRWA 4LNAA 1PDOA 1HYQA 2G1PA 4UD6A 4R1QA 3TNDA 3E23A 3R3JA 4K6GA 3N28A 1RE0A 4JOBA 4RZ2A 3DUFA 3GMIA 2J85A 2Z9DA 3L82B 5FNVA 4YJGB 1COZA 3SXUA 3GFRA 4LYDA 7GPBA 4NBTA 3NOVA 4IIUA 4RADA 4DL6A 1TYDE 3VJKA 3KKAC 2CL6X 2XEXA 5KG4A 4HAIA 3ONFA 1Q0UA 2R2AA 3BWXA 4G01B 1U6JA 4Y18A 1ISFA 3AEQB 2I7VA 2W6JA 1L4FA 1LK0A 1KI6A 1CEYA 1JPJA 2EFYA 5CHGA 2YVUA 4ZO8A 5BP7A 3V34A 4CL3A 3K8OE 9MHTA 3EDYA 1UIRA 3D3QA 3AYZB 1FFBA 3ENZA 5D3MA 5JSHA 2P40A 2VYND 2N9UA 2XITA 1I10A 2QLFA 3IT0A 4OXYA 3UJHA 2BCQA 3O94A 1EE9A 3BS7A 2VNHA 3LAWA 3H75A 4DDKA 4HNUA 1IXRC 1M2FA 1R27A 3THYB 1U7TA 1AQYA 2NPFA 4R05A 3LLUA 2FK7A 3C8UA 4PO3X 1NMEA 3EC1A 4I5FA 3PPXA 3HUDA 3KJHA 3TEFA 3ZY3A 4KQ9A 4S1OA 4CM4B 4ND2A 3TX6A 2QLJA 2E3TA 3WDLA 3JY6A 5TS2A 2C7VA 1K3UB 2X76A 4RS3A 4ZGGA 4ZZ0A 5I4BA 2WTUA 2R1UA 1TKAA 3CB2A 4XASA 1Y9EA 5KIAA 4CV0A 4Y98A 3HKEB 4Q9IA 4S12A 3QW2A 2OZLA 1ML4A 2X0NA 4CL2A 2QX8A 1XJCA 4FVTA 4KSYA 2X3UA 3T1TA 1XE3A 2DQ4A 3DL4A 1X19A 3SHWA 1E3MA 3GLVA 3S4YA 2JARA 4XB6B 5T3YA 4FMPA 5TPWA 4YNBA 5KT4A 1C2TA 1B0AA 3L5OA 2QPOA 3LDHA 5A5DA 4JBWA 3G0IA 1ODLA 4EW3A 5GV8A 4KAXA 3O3MB 3V00A 5ER6A 1WCV1 1WM1A 3L05A 4YRCA 2J3IA 3L8CA 4YCMA 9ICAA 4QVIA 1FX0A 5IF9A 3H65A 2WHXA 2QAGC 3NZEA 3C4JA 2YOHA 5IAGA 1I24A 3ZTTA 5KWEA 4NF2A 4JMLA 1JAYA 1M0WA 2RGNC 2H3IA 4L9RA 3UG7A 2C9MA 2QMHA 1PJ3A 2FZEA 1M1YA 3I1FA 4K9PA 2H52A 4ZP1A 1NC1A 1NGSA 2N47A 3DL0A 2ZG6A 4ETMA 3DDNA 2CXYA 4YMHA 4UHBA 3Q0TA 4AWAA 3OT1A 4Z6EA 2XQFA 4AJ1A 3QSYA 1CY0A 3H5LA 4BUJA 3TEJA 3OCWA 5K0LA 3MGVA 3D7LA 3IAAA 4ZK6A 3DFUA 4GQIA 5T4EA 1TKBA 4YH1A 1ZBDA 2ZJOA 3GDFA 3VHXA 3ND7A 1M2OA 1MJHA 3U4HA 4DG5A 3AESA 1XO1A 1P2DA 3NHLA 4CQMD 3DTYA 3W04A 2HM7A 3H9QA 2O8CB 1TW3A 4EABA 5EUCA 5FB3A 2XKAA 2BP7B 1SC9A 4Y9UA 2P65A 3K9LA 1S0NA 2PFNA 4H7FA 1T24A 4EGJA 2G88A 2K7FA 4GC7A 4RGYA 4DWIA 5IASA 4MF8A 3BREA 1M1YE 4DV4B 3I2YX 4RSHA 1W75A 1NQOA 1MW9X 5BUCA 1A5TA 1F2TA 2W6ZA 3AF4A 4JXXA 3P0JA 4ARSA 4FC7A 3AWIA 2XY6A 3F2VA 3U0VA 4H59A 3Q9LA 1G41A 2JKZA 2ZIZA 2ZDQA 1Z16A 1ARZA 1D4AA 4B9EA 4YP1A 3UAGA 1CUUA 4Q7QA 3WMRA 4L51A 1NT4A 1NI3A 4B4KA 5C7LO 4MA4A 2W4QA 3V3KA 1SZPA 2WOOA 1TM3E 4DUYB 2JJ2A 3H0MB 1H05A 3HJNA 1GKKA 1H4SA 2WJYA 4Z9XA 4P93A 3BQNB 4XQCA 3UJ9A 1Q50A 3NO4A 5C32A 4RZSA 1OFGA 1YRLA 3FZEA 1WMEA 4QNLA 4MLZA 1FVHA 4OEHA 4JT4A 3KSAC 5TC4A 4AUNA 1FNNA 5DF1A 2VJ5A 1R18A 1Z1BA 1YR8A 1BXKA 3QU2A 5CLJA 5HILA 4B3TB 4PCUA 4P7FA 1G21A 2R8ZA 4YV7A 3NRBA 4KOEC 1BGWA 1DOZA 4DL7A 1P5JA 2PLFA 3UHPA 2H6EA 1NW8A 4DZRA 2BONA 3BXFA 1OAOC 4K9QA 3UUFA 2NV2B 4Z86A 4LWQA 1RXSA 3GJXC 1E1RA 1W0KA 1UJCA 3CF6R 2RGYA 3GUUA 3WO1A 4BX2A 2RDIA 2AN9A 3CTPA 4FHFA 3ZCXA 5F9LA 3LQ1A 1MRSA 2P78A 2ODBA 3IOEA 5F3DA 1YOVB 4X8MA 2AF3C 2EWVA 3KD3A 2B3TA 1X1QA 5LPNA 2KBEA 4Z2YA 4X1KB 1EP2B 2WWYA 1EWKA 1A97A 3UZUA 3C3JA 4R84A 4UVGA 3PUWA 1U8CB 2GM5A 5F51A 3SPXA 1W88A 3AVYA 1MAVA 2ISSD 4XVUA 2GUWA 1G21E 1LDMA 2QTHA 4HGRA 1U2ZA 3HWWA 2VHXA 1G16A 2WYWA 4QWDA 4M7WA 1DBSA 3A1CA 4AJ2A 5KVQA 3E18A 3COPA 4LV6A 5KYTA 1JSLA 2W4MA 3I52A 3LF2A 3RYHB 4CTJA 1RI4A 2Y2VA 5AD1A 3ROQA 5BSVA 5DCLA 1VG9B 1E0DA 4P0QB 1JRPA 1PAUA 3PC4A 3EVNA 3JCZA 2BPGA 1GNSA 4H7IA 1TVAA 1OHHD 1MA3A 1RFLA 1THMA 1UODA 5JRZA 4K4GA 3NANA 2LR0A 4MXDA 4O2LA 5AT1A 5LP6B 3V9AA 4AZ3B 2HSJA 5I4IA 1M3SA 3GLHA 2QTBA 4LQCA 5LLTA 1ECWA 2VK1A 2XQGA 1K1QA 4L28A 4Q3OA 4I3GA 3HR8A 4B7UA 4M6WA 2LIVA 4S2UA 2D74A 3RSHA 1JJ7A 5J4LA 1H9AA 2HQ1A 1Y7LA 3FNBA 3G1UA 3WWCA 2C7OA 4UBOA 2ZAGA 3EEBA 5CRIA 3GCXA 1NRXA 3GGJA 3L7JA 4HVAA 3JAMA 1L5UA 2GCNA 3OAAD 1CJMA 2EAUA 1ADJA 3L7MA 4CPDA 2LYAA 5HUJA 2C8JA 4J0EA 3C2LA 1K3TA 2P5TB 3AR9A 4DSNA 1W4CA 3DOEA 1IK6A 4LOLA 4CUJA 2BBSA 1A5AB 2CC2A 2WINI 4GYJA 2K87A 3G13A 1DZIA 4OBEA 4C4SA 2R60A 3GLHE 2H00A 2PV7A 4RESA 4L2IB 1B6GA 1Z2AA 4URVR 4NE7A 1RPNA 5IH3A 3PC8A 5EJGA 4UVIA 4DV5B 1U0NA 3D2NA 1EX9A 3B6IA 4IP0A 3ZCQA 2XKJE 4BPBA 3HUFA 5I7FA 1UKVY 4XGRA 4EYOA 3SSAA 4GKJB 3FKSA 1C7YA 2M1ZA 1ZOPA 5L1KA 3S1SA 3LWLA 4YT5A 4RAQA 4UCXA 3ZDFA 4MF2A 1OASA 2FMSA 2OBBA 4DQSA 2W0MA 2XUQA 4GICA 5ESXA 4ZO9A 3N87A 3A6ZA 5FP0A 4WOPA 1HFJA 1XNSA 2H3VA 5BYBA 4GP9A 4HTFA 5HZMA 2CDRA 2ID9A 4JV5B 4YXJA 3KJIA 2JAQA 2J0EA 4P38A 4F93B 5H70A 3O91A 3ANSA 1CE8A 4GGPA 2H2HA 1DV2A 4KLJA 5CCBA 3EUB2 4UUAA 1RACA 5G02A 4ZT6A 4XRHA 1K0UA 4WOBA 3D7SA 2B94A 2QK4A 8ADHA 2X7JA 1BQ4A 4ZZIA 1MO6A 2AYZA 2HWYA 3DDZX 3QFSA 5LYJB 4L5YA 2QL9A 3L49A 2ZWVA 1AZWA 2Q6VA 3BE6A 4JJZA 2J3JA 1KS9A 1I0IA 2Q5IA 4JUZA 3O3CA 1T9GS 2MIIA 5FD8A 4NCIA 1N9GA 4JI3B 1Z63A 3Q5DA 4G8CA 1E79D 4DV3B 3ZJUA 4GZ6A 4DR6B 3W5VA 3GN1A 2Q3FA 3IIMA 4DKJA 4MI3A 3PRJA 1C7RA 3BJIC 1B1CA 9ICXA 3E9ZA 4QAQA 4O1HA 2W9XA 2WU4A 4JYPA 3FTQA 2IH5A 2WIJA 1K4MA 3F8SA 2PX2A 2GOYA 4QUEA 1XI2A 5C51B 1T8TA 3GUYA 4MMZB 3EY4A 5C8XA 1R6DA 4WN9B 5FOSA 4MSUA 3DE7X 4D5EA 2HEGA 4JR2A 4U7CA 1T5DX 1EA7A 2P3SA 4RE5A 2AL7A 3HJAA 1OLSB 2ONZA 3FTDA 1AV6A 3BGOS 5AUNB 3PEFA 3SSOA 1UMDB 4L57A 4PG6A 2JV3A 4QUIA 5LA6B 1QVRA 2MOKA 2CYCA 1HPLA 4TT8A 1JPNA 4BP1A 3Q12A 3O84A 1NUHA 5KFQA 3FLEA 1NRIA 3RCBA 5K2MA 4EG5A 3NIFB 4ZT4A 4PLWA 1WSDA 1RQGA 5E95A 1ZC4A 2QEQA 3OJ0A 5HFAA 4OQNA 3SE7A 2JLVA 3X1KA 3MJSA 4CTKA 2ZRNA 1S1CA 4FEGA 4X63A 2D3WA 2AQ4A 4AP5A 4X62B 1OWNA 2ZRLA 5F2OA 2EL9A 3EBPA 3YASA 5I7OA 2OO5C 3VBEA 1YZKA 4B9VA 3SWWA 2HN9A 2AR0A 3H1BA 2VK4A 1X9SA 1E60A 2DTXA 5C8YA 3V46A 4LCBA 3F98A 3FCOA 1OT5A 5IAJA 5KQLA 1SKBA 4ITRC 1KZ6A 3LY9A 3UCXA 4QOEA 1W25A 3MHPA 4PGYA 4BVLA 3LV8A 3O21A 5K3FB 5D8DA 3RBDA 1PJ8A 2UVRA 4ETNA 1W4AA 4JLPA 3IAM1 3WLEA 1GL7A 4IV8A 4JT9A 2UZ1B 4EO9A 5T7BA 1YDHA 4DADA 3FF4A 1OBCA 5C31A 1UZLA 1DOHA 4A82A 2FXVA 4BNMA 3G49A 4YQWA 1I3MA 5IULC 4TZ6A 2CZGA 2XDAA 6ADHA 3NEPX 1YRYE 1ZHOA 1K66A 1CZHA 2I8CA 2ADFA 2SHKA 1LVUA 1E2LA 3UIEA 5FR1A 4Z4GA 3WB0A 1WMAA 1K4YA 4CIBA 5HF6A 5BSFA 2ODQA 1AZSC 3OQIB 1I33A 2CNLA 2KI5A 1NK0A 2R68A 4AK9A 1VP3A 4G1FA 5ENZA 2C94A 2C1EA 1SUDA 2X58A 4UTXA 4B74A 3ROEA 3RVNA 3GPIA 4WNAB 1FNDA 1SK8A 2FOIA 5KFHA 4RKYA 3HN6A 1ECBA 4KQIA 3TTTA 2VI5A 1SQ5A 3ONWA 1YUMA 2XCQA 3JAWB 4FYJA 1T10A 4BC1A 2JLQA 1XTBA 2ZTVA 1TQHA 4KWTA 2X1VA 1C7ZA 5IBQA 4Q44A 2FPGB 4RYLA 4AJJA 5EPUA 4HGYA 1VCIA 3WIEA 2QAJA 4DN6A 1B6TA 3MGKA 2FSVC 3PUXA 3KAPA 2CNBA 5G2OA 5AUPB 3HP6A 5ED0A 4OPMA 3FMVA 4BLQA 3SS8A 4OH7A 3TQOA 2QGNA 1C29B 2HA7A 4KN5A 4FYHA 5GP1A 1ZVMA 2KEYA 3MRXA 1IZ8A 1HQKA 8ICYA 4N5DA 1G5RA 5EGNA 4JDPA 3ROXA 2ETVA 5B64A 1QFJA 2WLTA 3SI8A 5AKGA 1CRQA 2I2DA 2LZ0A 5FBRB 3B9RA 4BRUA 1J2JA 2HIHA 4LBWA 3U48A 2PGIA 1V5IA 2B2XA 4Q05A 4UM5A 1SPXA 1P18A 2YHIA 1SXDA 1E9FA 4KVFA 4H1UA 4KJZA 5KFIA 1Q7RA 4YLYA 1TMKA 1M6NA 1GHTA 4WESA 4QQFA 3IR5A 5B12A 3U3DA 1CLEA 3TZBA 4O4HA 1P5FA 4TMZA 2A1IA 4EKYA 1ZICA 1USKA 4CKCB 2FTKE 3NEJA 2GETA 1UDRA 1NBWB 3DE2X 3LX6A 3IVCA 4OMCA 5E7IA 3PEEA 2YUIA 5KI6A 1EFRA 1O9GA 3RSFA 4TZ0A 3SG0A 3JQAD 5CYPA 4AJHA 4BU1A 4DRXA 5K3OA 4OAPA 4ZC1A 1QF7A 1EFLA 1CKEA 4JBLA 2O5VA 3AR2A 3IGFA 2X1HA 1G8GA 4S1PA 1JKJB 3QVOA 4INJA 4LDQA 1RADA 3LL4A 3EF3A 3P2KA 1SXIA 5LXTB 3KVYA 3DS8A 3ENNA 4N5LA 1NVGA 3OKAA 4GI1A 1M1UA 3VPBA 2CGEA 2BQUA 4M0UA 4I1UA 3DDOA 4QNNA 5CB4F 4C0HA 5D7NA 1NW5A 4X84A 1XU4A 4WK2B 3PFBA 2B1QA 1SUCA 3QVTA 3RC2A 1KO1A 4C21A 5EJ7A 4NICA 1TD1A 3A9TA 2GYUA 1H69A 1T91A 2DWPA 4G8DA 5HMLA 5CU7A 2AC4A 3EPHA 1NBHA 4EA6A 2XCAA 1G6KA 4R9VA 4PCAA 4M86A 2GR9A 1QIGA 1BRTA 1ZQCA 4C89A 5C5CA 1GUBA 3EGOA 4NSNA 3FTNA 1VCOA 1SIBE 2XCRB 2Y0BA 3UXMA 1DFGA 1LJLA 4UXIA 1P1JA 1GGFA 3O03A 3UXOA 3EPGA 4RQ3A 3HO1A 2CEKA 1M73E 3MF4A 5IM4F 4LJ8A 3ZV5A 4MIOA 2JAHA 4MGZR 2JKYA 3O73A 3WTCA 4E70A 2KQUA 4QZVA 2H1FA 5DM4A 1PFVA 1Z45A 3HBNA 1DBWA 5KB3A 2MSCB 4PQYA 5UKDA 1YDEA 2VHJA 4EUSA 2FW9A 1AXEA 2NXCA 4CKEA 2WJVA 4PZNA 2LKCA 4RUAA 1UC8A 1ZC3A 4TMTA 2CBGA 1C0PA 1KC3A 3M6XA 3EWSA 1KVSA 4S3MA 3NDBB 4OKSA 3HCPA 1BDHA 5BWLA 4K46A 1P6XA 4RD0A 4QGSA 4C5AA 5JXGA 1U0RA 1Z4NA 2ZJAA 2E1EA 2ZRKA 5BUQA 3I9MA 1V3UA 3F6EX 4QDUA 1GDTA 1Z6GA 1OQAA 1TGYA 4PNHA 1MH1A 1O7JA 1J07A 5DASA 3VX3A 4WZ6A 4J7AA 2VUIB 3HBLA 3IAS6 2BQ3A 5AW1A 3UXNA 3NH9A 3WIOA 3FYHA 3KPYA 5T67A 3ZK9A 1M10A 1URPA 4H9GA 1PEDA 5L3RA 3OHMA 2C8KA 3CEMA 1J8VA 3DVAB 2OCLA 2WYOA 4IHJB 4K9RA 1DEKA 4DREA 4GPIB 3NJ8A 3TQIA 5JSZB 3PR3A 4UJ5A 3NTOA 1TTQB 3ZLJA 4QDKA 3KXDA 3KC2A 4G4JA 3DTVA 4PXAA 2COUA 3V6LA 4UPDA 3I73A 3DQPA 1KDOA 4UBMA 4D42A 1E77A 4IZHA 1P33A 1EFKA 3TEMA 2K4HA 3AR8A 1TF2A 1S5LU 2XE7A 4IH1A 1YR1A 2CDCA 2QMUA 1FS4A 3EQ7A 2EGUA 2DXIA 5I7SA 3VJRA 2O14A 1MAHA 3L8DA 1P62B 4LQDA 2WTNA 4Y6PA 1D8BA 4HX2A 2OCBA 4DJEC 1MQSA 3W34A 3RS2A 4E4TA 3NUQA 1REQB 4C22A 2D0IA 4U63A 5U1PA 1E8MA 4F4WA 3KZ1E 5FV4A 1KS2A 2ALZA 1Y98A 3LPMA 3NOQA 3UC9A 2IYSA 2JG3A 3LT0A 3EPKA 3CKMA 1IPFA 4IR9A 2Q5QA 4INOA 1ZJWA 3EAGA 1E9BA 3LVVA 4Z7QB 5D3KA 3CPJB 1YMQA 3RGGA 4Q5IA 3V1NA 1NJGA 3VTFA 4QW8A 3LX4A 5JVDA 4QPNA 2JLWA 3LCRA 2P2GA 5SZHB 3K0FB 4YXFA 2QTFA 3K09A 5HS4A 5A2QA 3H99A 4KLTA 1WYGA 4K03A 4ED2A 1WPGA 2COKA 4B4WA 4O29A 1T2FA 3R41A 3A0BU 3V4LA 3WFJA 2OORA 4MV7A 2F44A 1DKRA 4PG8A 4DMCA 3DE6X 2HPAA 4ZQFA 3ZXYA 2PD6A 1IOLA 2WM2A 3X44A 1WUDA 1KBZA 2FN4A 5JRTA 1ODTC 5DZSA 1DTSA 3MTJA 1V35A 3QIAA 5CX4A 2CDNA 1UOEA 1GRRA 1NLYA 5CFZA 2FFQA 3AL0B 5CLLA 4LZNA 2HV9A 1YHZA 4TLEA 4RDHA 2SCUB 1QGOA 4P3YA 3OOYA 1ZU4A 1YZGA 3B6KA 1EZ4A 3UW1A 4XQEA 3GRCA 2BFFB 4C14A 1EI9A 2X6RA 3UJPA 1K75A 2AGOA 3AF3A 4OJYA 4J7UA 3Q6NA 1MQ9A 3OPQA 1H4TA 1Z29A 5IP5A 1DQZA 4Q1BA 3AP1A 3SEZA 4TT3A 2WJJA 4G8JA 1K88A 3GJ0A 2Y1JA 5I01A 5CM2Z 3MCTA 5KNCD 2CLCX 5I5EA 1NM5A 2IPOA 4K88A 4X6XA 2RI0A 3FPHA 5KFRA 3GEDA 1U8AA 1CWUA 4WQMA 4GGOA 2E9SA 2ONYA 4OK3A 3PCXA 5HGXA 2KPOA 3PF9A 4OAQA 4M9HA 2ZVQX 3HCAA 1P7CA 2OXFA 3OLYA 5C80A 4C06A 2B5WA 3NRCA 3MYYA 1GTJ1 4RHEA 5FADA 4OJ6A 1YL6A 1X7ZB 4B82A 1GZ4A 3KZVA 1B8UA 1LPAB 3PVCA 1D7AA 5C4MA 4XUCA 1JLHA 4JGIA 2HMAA 4KX5A 3T7JA 2E1RA 3U39A 3ETEA 1HSZA 2OQIA 5GM1A 2O0MA 2ZEJA 2YS6A 1NNEA 3ND6A 2XDWA 3KSMA 1QE3A 1FW6A 4QKQA 3U4AA 3AK4A 3D6AA 4OA5A 2YC4C 2PKWA 1ABBA 3LHDA 4I5EA 4WI1A 4BNZA 2PUVA 4U2GA 5LUBA 5LN1A 4GXTA 3NJRA 4F7DA 2CVOA 3K2QA 3VVBA 1DX9A 3VMMA 2JFQA 1U98A 3DCIA 5L40A 2AE1A 4NOLA 1C1DB 4NBUA 3BSSA 2R9VA 1Q7CA 4RS4A 4FDTA 4AROA 2FCAA 4A6PA 4LQ4A 3REQA 1MP0A 4OFXA 2CMKA 1JI7A 2NU9B 1X0VA 2D13A 4DA4A 4TWZA 4A0FA 1A27A 1V4NA 2HDWA 4NOJA 4CF5A 4B4VA 3RUEA 1W2WB 5EHGA 1QGED 5HQJA 3IIJA 4JQSA 4IJVA 2ZUSA 4S1NA 3L7CA 4WUTA 1NVTA 2GZ1A 4ZV9A 1SC3A 5JNSA 4QBHA 1F5SA 4JIGA 5TS3A 4X65B 4E22A 3C6BA 5D1HA 4ZYUA 2ENUA 2ZREA 4IGIA 4EARA 1W48A 4ED0A 1UBGA 3IYLW 2JZNA 2EW1A 5KHLB 4P7KA 1RS0A 1DC3A 1VBKA 3P9NA 2M1XA 3NHAA 3SHOA 1XBTA 2VDWA 2YY6A 4EECA 3V2UA 2HNKA 4Z53A 1S4MA 5E8RA 2OWEA 3MRSA 5FUQA 1UWCA 5LKRA 2C78A 2O9JA 2KICA 4P32A 4IF6A 3BS5B 3NP7A 3Q2KA 2VHCA 1PWYE 1E63A 3NALA 1TM1E 3WMWA 2C31A 2WUGA 4HK4A 2FR8A 1PDWA 3E9CA 5KYGA 2R5FA 1XTPA 4XGKA 4FCWA 5FYQA 2I5HA 4FQ8A 1OGIA 1T0HB 4I8DA 2JRLA 2SKCA 1W49A 3IAUA 1NMXA 3C3BA 5HXAA 4CKBA 1OI4A 1ZHFA 3GJQA 4XIJA 3N2GB 4QEZA 1HUOA 2LE0A 4ZT2A 2GPTA 3ZW8A 3P2OA 4ZAXA 3RJKA 4QSHA 4ECQA 4R40A 1OYYA 3FDZB 4NOMA 1SKWA 2ZVJA 3BICA 3MERA 4NDZA 2VWHA 3HH8A 1DJNA 2FZWA 1QUFA 1P44A 5A0FA 1TAQA 3QITA 4V0QA 3IVAA 3U17A 1I8TA 5EZYA 3CA8A 2AQ0A 3A2NA 1V9LA 1E89A 1VZ3A 5K0EA 3WLFA 4YRBA 4O1IA 3MGGA 4A23A 3MWLA 4I9GA 1MGPA 1KWGA 1U6KA 4EOGA 5SICE 2Q8NA 4Y2JA 1L3VA 4J0FA 1T5HX 3AWDA 3HCDA 4I8XA 1YU9A 2E4ZA 3F7NA 4U00A 1FJHA 3IV6A 5A9SA 3A4IA 1DXQA 2DECA 4JLDA 5L4LA 1MC1A 4Y2QA 1PNOA 4FR0A 2W9CA 1L7XA 5HJEA 9ICGA 1YJBA 5BR1A 4RTOA 3OJCA 3CH5A 4YVFA 4JZKA 2QTAA 1YVRA 4YHHB 4JLUA 5B4VA 2H3QA 1QIMA 1WPQA 2WNIA 1UJMA 1B6RA 4QA9A 1G7RA 3G2JA 4BVBA 4EFNA 4ARZB 2KG5A 1COWA 5AOCA 4C7KA 3C1YA 5I7UA 2QKQA 2GPJA 1T5SA 4D80A 2WJHA 4JASB 4LQLA 4XYMA 4Z3OA 4G4SP 4V1CI 3FYDA 2M2IA 3AKZA 2E89A 4BNWA 2F6RA 2G4CA 5ALKA 4C0JA 3MJCA 1YS4A 2X4IA 1M54A 2M6KA 2E5FA 3QX3A 1UZAA 5JI2E 1XZKA 3PC8C 1ENOA 4PW0A 1BYIA 4YUYA 1HDYA 3ES9A 5KT3A 1ACMA 1L2TA 3FG9A 2BBTA 3PQ6A 5C2JB 4EQ6A 3DE1X 1QH1B 1C80A 4MR8B 2O8EA 2AOXA 4YDSA 3WWZA 4ETIA 3Q11A 2J9FA 4F46A 5BWNA 1YZVA 4U7HA 4C7ZA 3V4ZA 3DD1A 3MCUA 2H2FA 2W04A 2VATA 5E6RB 4RHCA 3DMRA 4JQOA 4IV5A 2OXOA 5FEUA 1J97A 3BXPA 1C0IA 4ZI3A 1KFTA 4BP8A 3TQFA 2JH8A 2H1LA 2D7CA 3TECE 1E0JA 3R3VA 2UUCB 4EG8A 1MU0A 4RZ3A 3RFAA 3KEMA 3VKFA 1D7OA 2AV6A 4PZYA 5AKKA 4L50A 3ZLTA 2DERA 4F5EA 2M6LA 1PK1A 5BMVA 1WWUA 3Q8WA 1C7JA 4TKZA 2O48X 1LSUA 2HSDA 3L02A 2H2AA 3A28A 3VDQA 4CF4A 1I3NA 2I78A 1NUQA 5LDDC 7ICNA 1O58A 1YDMA 1LPMA 5IFLA 3UJNA 4J2TA 1JFFB 5DNWA 3RG8A 2Z3WA 2QNBA 4F86A 2L19A 3PENA 3HK2A 3HCWA 1JFTA 3AEKA 3PFGA 5GM2A 4IWXA 2H59A 5IZCA 1BVSA 3QI7A 2V45A 2VTKA 1XP8A 2GVZC 4BNVA 3PJDA 1DLJA 5C1OA 1JKMA 2PZFA 4MVJG 3OPMA 1LSJA 4HFMA 1TJYA 1QVZA 1NURA 3QE4A 2QARA 5GJCA 4LHVA 4AULA 2X9VA 3V2IA 3G85A 2ZUUA 1J1IA 1C3XA 4ZOEA 1VKJA 2LDXA 1K3FA 3DDWA 4TS3A 4PTLA 4S1VA 2IOQA 2E49A 1ORVA 2CY0A 4PLPA 1XEAA 3T9DA 1V1MA 4M55A 4IJWA 1Z3IX 4TKUA 3GAZA 2CLKB 4DM4A 1O2DA 4GOOD 1JNXX 3N2LA 5JECA 4HQ0A 3T4EA 3W8RA 9ICTA 2PUBA 4WKNA 1J25A 4DV6B 2Y3IA 3U13A 3KUXA 4R5HA 2AYXA 2Y0SF 4WV3A 4O33A 3SICE 4AKSA 3INTA 4XIGS 4NEGA 4UMEA 3C7DB 3N7PD 4JL6A 2HY7A 5AKXA 2NYUA 1DTWB 3ISDA 4UOQA 2BMDA 2HIGA 1U5BB 2H48A 1X7XA 2AE2A 3NUGA 4LHEA 4MVJI 4K1LA 4DEXA 4PPGA 1T3QA 4NJEB 2KHVA 2Q27A 2JHPA 4AX4A 3ZCUA 3ED5A 1PGNA 1MHPA 3AVPA 4Q6WA 3BTVA 3RFVA 4RSMA 2R6DA 2XNCA 1X1CA 7ICQA 1C8BA 2G9UA 2DT5A 4FFBB 1TE2A 4HNSA 5ESWA 1XMOB 1I2ZA 4HLDA 3PNLA 2XB8A 4O2RA 2XNJA 4C76A 5TQJA 1I51A 2J4DA 3PQ2A 5ADVA 4P80A 3T38A 3EQ2A 2IZ7A 4KFRA 5CW1A 1GYRA 4I50F 4BNFA 2PZEA 1A5ZA 4R51A 1SIUA 3R0JA 4EA9A 4OUKX 2JAWA 3BD9A 3K92A 4NP6A 1GQOA 1RVDA 4R63A 1RZRD 4P36A 3KKQA 3E9NA 4FW9A 1PE0A 3P9ZA 3U31A 1UKZA 3EDQA 3C0KA 1KMQA 1RRCA 3NYIA 4BFLA 1GZ3A 1JN3A 1DCFA 1BE0A 1U49A 2Q3JA 2YW9A 1Z07A 3TWOA 4ZQBA 3LY7A 2I1VB 4Y2RA 2ONCA 4BGDA 4WWHA 1CQPA 1EX7A 1JSZA 5AFSA 4L02A 2DCMA 2A5DA 1XX6A 4KO4S 2GASA 2A94A 4CNBA 3IILA 3L79A 3MDAA 2OZEA 3KL4A 2CDBA 3ISTA 2G4LA 2OYCA 4UHCA 1T8SA 5FTMA 2F76X 1U7PA 2ZK7A 3ZDCA 4IZ6A 1UBFA 2C2MA 3C70A 5DIFA 5ARCA 4BZPA 3Q6MA 3K9BA 3WGQA 3SS9X 3LHSA 4I3FA 3N76A 1BXRA 1EU1A 4R01A 3ILVA 1N78A 3THSA 4E2ZA 1XN4A 2NAPA 1YNSA 3D6FA 3LP5A 1P7ZA 4QFBA 4BEWA 2REQA 2C77A 2WTXA 4CIDA 3ZQJA 3BJEA 3ONDA 1VGRA 2BH9A 4TTQA 5I51A 4MRPA 4QPCA 2P9GA 4MB0A 3QXSA 4UAVA 1XMQB 3UY4A 3VNVA 4IDBA 2YWDA 2JLSA 2DX7A 5T4FA 5KOYA 3EGCA 1GAJA 2Q62A 4R64A 5AXAA 1Y1RA 1WCXA 4NYIQ 4EHIA 5SZKB 3V8MA 2A7XA 2BEUB 4QU0A 1Y9DA 2YHBA 1FF9A 4OKNA 4PC3A 3HEBA 4MMYB 4OQXA 4AMUA 4V38A 1NNUA 4EHBA 1FYDA 3UA3A 3ITDA 4NMMA 3KKPA 4B9TA 2HU5A 1KI4A 3O4VA 3IAXA 3VI3B 2VPIA 3EGEA 4O0LA 4PSCA 1TJ3A 3WJ7A 1QO0D 2UYOA 4LGCA 1ZJ5A 1VGVA 1YZFA 4J7XA 2ESEA 5JSUA 4BL5A 1ZWKA 3GB9A 3WLPA 1H1LA 5B6IA 5KNIA 2JFYA 4UMDA 3BQMB 1Z4KA 3LYAA 1FNSA 5BW8A 3SF8B 3BH7A 4Z6KA 5B7NA 1IQRA 1LGYA 3CM0A 1QP8A 2JGKA 1UOQA 3GU3A 4OF4A 5FPKA 4BXOB 2IYZA 2RD2A 3RRNA 4YUVA 3AHEA 1EAMA 2IU4A 3RAPR 1JIUA 1Y5LA 2I3AA 3WWDA 1KSGA 3E1GA 3BKXA 1AKEA 1PBTA 2ZT8A 3TSZA 1YD7A 3H2YA 3CNQS 4NBRA 1SXJE 3PHGA 3DJYA 1XFAA 3IO3A 4H1HA 2JBAB 2VXBA 2DFKB 4O9MA 1C30B 3IUBA 2JGDB 3TTVA 1ZD5A 4PYOA 1R8QA 1O95D 1JUDA 3SQDA 4DXDA 5C52B 1Q7BA 1H94A 5BY2A 1G9XA 2IA6A 2VJMA 1JEJA 4PRLA 1GNVA 1OH7A 5JMPA 1PUJA 1DFHA 1A71A 3HBFA 4RCZA 5H4HA 5BN4A 5F3XB 2JFBA 5INTA 1TIBA 4LMPA 4AYBC 3DM9B 4IPTA 3V72A 3A9RA 1OC2A 2X5KO 5L1JA 1DIBA 5DK6A 4J1TA 1N6NA 3EWIA 3SYNA 3UMRA 3N5CA 3UPQA 1J0EA 4TPKA 1J70A 4DWWA 4F9FA 3M49A 4TVOA 5LJIA 4GLBA 1YQWA 1LV7A 3OFKA 3PF8A 3QPVA 2JC3A 4ZTBA 3D7RA 2H3EA 1AIPA 1YB1A 5J29A 4X24A 3EVDA 1XCBA 5BR8B 1C50A 4DTCA 4PBRA 1YRHA 2WAAA 4LV8B 4ND1A 3PZRA 4TKVA 4TROA 2QVLA 4JYCA 4QGGA 1ZGGA 3SF0A 1LC3A 3EVEA 2ZTSA 4ZTUB 5KO2A 2J9YB 2XTZA 3LRXA 2HHHB 4P5EA 2H5XA 2VHTA 4HRYA 3RB8A 1LLDA 1XCMA 2AHRA 5ALWA 2R96A 3L7DA 2IEIA 1GYQA 4REQB 1A4RA 4W1RA 4OV6B 3K9CA 4JLBA 2PUDA 2DFNA 1BU8A 5CX1A 2JGNA 3DKPA 4RGQA 4PM4A 2HHAA 4RU1A 2QZPA 1DGSA 3EWAA 1GSIA 1FQKA 1NYTA 3BRWD 3MS7A 5TJHA 3W9SA 3I12A 2E4WA 3LHIA 3QE2A 4JCCA 4E5SA 2IHNA 9ICMA 3N6VA 4GR5A 3JS5A 3E84A 5EKXA 8ICTA 1P74A 4EEKA 1HT2E 2K6GA 4LISA 4MK4A 5DBGA 3KOUA 4TLBA 4IIGA 3C3DA 5HKOA 1D2HA 1FOEB 3AVVA 3OFND 1EFTA 5KQRA 5TQVA 3AI3A 2OVBA 3GCZA 5IXYA 3GJRA 1NBAA 5GGYA 4FFMA 2C04A 3PQCA 4G1UC 3HFJA 2K2WA 2WSBA 2PMWB 4QOFA 2ZSFA 1KU6A 5EZ6B 5DXFA 2C3YA 2Y6VA 2P6PA 4FEEA 5FOXA 4ENSA 4PPXA 3A4YA 2OBXA 4DJ5X 3W9UA 4KXLA 2GBLA 3DT9A 3D6NB 2V9WA 1A9SA 5KNDA 2WTBA 4N82A 4PZEA 3LVBA 1S2DA 3EQ8A 4GWLA 1S6YA 2E87A 1GKYA 3ZJ5A 4XUDA 3H5AA 3O9MA 4R68A 5B3KA 4X8HA 1WSWA 4FS1A 3RC1A 3WYEA 1OT3A 5KFAA 3A8TA 3ZWCA 5TB5A 1QH8A 3T3MB 3HN2A 5JARA 1AXRA 4MUNA 4JK1A 3I9NA 5HDBB 2G28A 3ELYA 4JLAA 4R1SA 4B8ZA 1WULS 2D5IA 4QO8A 3VC7A 1DLIA 1LLFA 2XGSA 2XIQA 5BPCA 1ND5A 4MWGA 2TMKA 4TLAA 3AEZA 1QCCA 1H5QA 3FFAA 4CQNA 4ZO6A 3TAQA 1T4BA 1NUAA 1A9XA 4O4LF 4A36A 3F8WA 1HNWB 3G8YA 3RYIA 3GEGA 4CJXA 3LHKA 4FNMA 1ZQNA 3ZC3A 2H85A 5FWDA 2C28A 4EPXA 3EA0A 3VX4A 3MWDA 1KQQA 2PRSA 4TL7A 1AH2A 3LUGA 1DUSA 3II6X 1QQ5A 5F21A 3ICVA 1KDRA 4R66A 2XECA 4L6AA 2VP4A 4X7RA 3G0HA 3M33A 5BUZA 1COOA 2IT1A 2OORC 2QVGA 1N4AA 3LBNA 3O1HB 1CB0A 5JNLA 1K2WA 4N7RA 2GEFA 4F1KA 4WT7A 5BQXA 3E2PA 3K75D 1LW6E 2W2NA 4MPTA 2RHBA 4OHRA 4ZOHC 2HCFA 1FPQA 1NJWA 2ACWA 4LN1A 1IWOA 3R6LA 5U4XA 2BISA 7ICLA 3RS0A 3K1ZA 1JXQA 1SVMA 1ADGA 3OETA 3U5ZB 4K0RA 5KYYB 1OH6A 3NV7A 4MWCA 1V71A 2WQZA 1DQRA 3RK1A 1ZEMA 3C7KA 2AUMA 1HM5A 1TGVA 3L6UA 4F21A 2OSVA 4KDCA 5IG2A 5J2TF 2WP0A 1TEHA 3S81A 4JOSA 1CUIA 4YMNA 1M1ZA 3NVMB 3ANYB 4GOND 2JEFA 4HYQA 4X54A 4EMSA 4F3NA 4PVCA 1NM5C 4PF1A 1BS1A 3IDAA 2Y67A 2QGFA 3NHMA 2HSZA 4EY3A 3N2NA 1BFDA 3PXXA 5DYIA 2B78A 2PJRA 2ABWA 4B3IA 2VJPA 4P3KA 2WOJA 1Q0PA 4IOJA 1MB9A 5LQNA 3JQ7B 3AINA 1JDSA 1PT9A 5BWCA 2IITA 6AT1A 3GIKA 2CJFA 4P84A 4QU9A 4ND3A 3RO7A 2HPVA 3G7NA 2OV3A 2B8NA 1E6LA 7ICUA 3RU7A 5J2CA 1KJWA 5GJWC 5KQSA 4X3PA 1ZMTA 4PHTA 2WZCA 5KNBA 3WGZA 3R3HA 3KDSE 1HTWA 3ETGA 2V4QA 4LE0A 2I80A 5AW4A 4HQOA 2CLOB 1N2SA 4WBNF 4AN4A 4Z1MA 4ELUA 4TOIA 1UZUA 3Q88A 1N6KA 2XMPA 3PTAA 2WU0A 5FPTA 2XX3A 2EFHB 3UQYS 3A1FA 2ZB3A 5H68A 1MZPA 4KKXB 1X66A 5JG7A 4NLNA 2R1VB 2BCVA 4HDKA 3G5MA 2XNSA 4YV0A 2YBEA 4HS4A 4F0JA 4CCYA 2LMRA 3O0FA 3K2IA 3FCCA 4KRFA 3WISA 5IAAA 2W2QA 5IJAA 3C1ZA 1V38A 4Q19A 1ZCFA 2J8ZA 1SCUA 3WL8A 2QXUA 4WJ3B 2PLAA 1RYYA 1I3KA 4A5OA 4FQ5A 1TTHA 1RBMA 2P9FA 5IJ0A 2WP8J 3VO1A 3LYSA 1RM6C 1ZD1A 3PBKA 2JLBA 1D2GA 4R8LA 3G68A 2GT1A 3ENQA 4YP9A 1H4VB 5LZ8A 3OEEA 3TM4A 1XZ8A 1CZLA 3QG1A 2OY0A 5DYGA 1G8AA 1GPWB 2JCXA 1ZQKA 3KETA 4ZVQA 4UVDA 4YWHA 4CMJA 4F6RA 1GL6A 3GFVA 1YT3A 3O47A 3WQRA 1JE1A 4BBJA 4R2MA 2EU8A 1E6KA 3EMKA 3L6OO 1MA7A 1DCTA 1QGUB 1SKYE 3DWIA 3BTSA 2EHJA 2WJWA 4PSAA 2EH9A 3OIFA 2IGBA 3KXPA 4RQAA 2VYVA 1FRVA 3WLSA 1ZUNB 5JSKA 1XU7A 4R31A 3RRBA 4DA9A 2H57A 3FZNA 3B6JA 2FR8C 3K6SB 4WY5A 4CTOA 5JALA 4FKBA 4D82A 4HN9A 3T5GA 3V1MA 1VL2A 1JXEA 1PT7A 3BMCB 3Q1KA 4ZMSA 3ND5A 4PIPA 2ZB4A 5DBIA 4FK8A 2OLEA 2LPEA 3TW8B 4RIGA 3BF7A 3E3OA 4FQ7A 4GPEA 1RI1A 2F7SA 2Z8YM 3T1NA 2YIVX 1RQLA 4B3MB 2HA5A 1ADCA 2QRZA 4FIZA 4MO2A 3MGBA 1GQFA 8ICGA 1SPBS 4Y0AA 5TGZA 1KEZA 3PUIA 4KEAA 5FWYB 2PMFA 2A0XA 1IXZA 2JAOA 5A06A 2C4MA 3QOXA 4TXJA 3O9VA 1JILA 3O3NB 3I1JA 1ZI8A 2IV3A 2O2HA 4F5WA 1XJ0A 3E0XA 3UK6A 2X8LA 3HR4A 1V6SA 4NV0A 4O25A 4TTIA 3LVQE 1L4UA 1NYRA 1N92A 4YDHB 1LLQA 2AZXA 5TMDA 3BC1A 1TPYA 4JC8A 2IHMA 4IS2A 4XTCS 4FB5A 1ZA1A 3ULKA 4B3JA 1KIMA 2NO9A 3ASVA 4DIOA 4I36A 5IT9A 2QV0A 4DPKA 3SYLA 4MITA 4PO8A 1WZIA 1E1QA 5KFTA 3KLPX 4P4TA 2OXEA 5G1NA 4WKCA 3C45A 1UBUS 1UBTS 2ZR8A 4M53A 5C5IA 4EG4A 5J2AA 2WD7B 2Q1SA 2K2QB 3CR7A 3X1ZA 2I87A 1FPMA 3MBYA 1P75A 3IV7A 2Q7DA 4M7OA 3RC8A 4INAA 2BZ0A 1P4JA 2WKRA 2AOVA 2O7RA 5AWFC 5JY1A 2PSHA 5GOTA 8ICUA 4CKYA 3CYMA 1W73A 2Z3VA 5A3RA 4TUYB 2QOEA 2GXUA 2A1TR 3KYCB 2IPLA 3LUDA 3D3KA 3RK4A 1KRXA 4G0VA 2XA1A 4B85A 2QL6A 2HDHA 1CW2B 4IL5A 3EOZA 2XNDD 4JVOA 1ZM7A 5EJEA 4QHTA 1QO7A 3LD9A 1HDIA 5K09A 4CN9A 4P4NA 2ICAA 2GARA 4A91A 2QN3A 4BO3A 4F72A 3GCWA 1R6UA 3RRFA 1JH9A 1EQAA 4IIYA 2Z8XA 3EVGA 1LV5A 1SRRA 5JJIA 3CVWA 1E7WA 1Z00B 4JHLA 1LSSA 4FPXA 4BYMA 3CVYA 1IQPA 2RHRA 3L9WA 4XEUA 2QW1A 3W7AA 4A8PA 2JDIA 3D3JA 4JGBA 2Z6UA 3KHRA 4ALNA 2CMDA 2QRVB 3B36A 3K8QA 5KTMA 2I1LA 1ZGCA 1DRGA 1L7OA 1U11A 4K40A 5JQGB 1D2CA 5CBPA 4CT4B 3KKLA 3K9WA 3U26A 2R11A 2CV2A 3PL5A 2Y0EA 2ZULA 1NK7A 1KYZA 6YASA 4JLVA 1K7SN 5IKPA 3GRKA 3I6ZA 2OXRA 1TC2A 3RARA 3QNUA 4EVQA 5IVDA 1B6SA 3I6MA 1JDUA 3KTDA 5DXAA 2ECQA 2PZJA 2GXQA 1JEYA 2ZLBA 3H97A 2BWJA 2XYGA 4GQBA 5HX7A 3CNBA 1N6HA 4KLDA 3BXZA 2G5TA 3U9TA 3JZIA 1NJ6A 2E4XA 1SQFA 1EFDN 5CDHA 1DHTA 2HHQA 3FNQA 3QEBZ 4WZBB 4C7XA 3WMGA 4KPYA 2QA5A 4CEHA 3PMNA 4HNTA 4G9GA 2ZZMA 4Q7MB 1QIKA 4KQHA 3AHDA 3GZFA 4X44A 2C2KA 1OXVA 2RGRA 2Q5HA 3GP3A 5KHOC 1L3BA 3V55A 4M47A 3A3NA 3I2KA 5B4UA 1VJDA 2HBJA 2O3UA 3V4FA 3DCNA 4NZYA 3STYA 1E3WB 1UBMS 2FP4B 1NOJA 2EQYA 3R5TA 3SI7A 2I29A 3GO4A 4LRYA 2YVQA 1O4VA 2I6SA 2OWOA 2H9YA 4QNMA 1YGYA 1MAWA 3CF2A 5C37A 2YVLA 5JTIA 2CUTA 2MSLA 4X90A 1B0UA 4O5KA 4HZUB 1MOQA 1NVDA 3OU2A 2ZB2A 3DMGA 4NCJA 1K6JA 4DR5B 4KKVA 4MRNA 3PQFA 4OI2A 1NA5A 3G89A 3C8ZA 2VNIA 3ONEA 1CRZA 3UH0A 1HMYA 3ZEIA 2PE5A 2JGRA 4UUMA 1VE3A 2QNIA 4IJQA 4YRRA 3VZBA 4JWMA 3L0DA 521PA 3AETB 2FG7C 2R85A 2QTNA 1M2WA 2CWDA 4RQ6A 2G63A 5CA7A 3C7CB 4X6LA 3CLUC 3PPWA 1VPWA 1I5EA 2HB6A 1KXJA 4PLFA 4EVRA 4B71A 2A1UB 4I6JA 3QEAZ 1W6UA 2C9DA 3RLFA 2PYDA 5JDCA 4BO8A 5KAMA 4NBVA 1H85A 3KP1A 1PL6A 4TYQA 3A36A 1WW8A 5CDSA 4MKZA 2O0HA 1L8OA 4EGAA 1D09A 4JYAB 3U7FB 1VJGA 2OAQ1 1ZXXA 2R8YA 3NNDA 2A4MA 4NU8X 3OSZA 4AJOA 4ENVA 2OG1A 1OV6A 1C3VA 3D1VA 4JU8A 2EV9A 5JNWA 4URHA 2AG1A 4DSKA 2PX8A 1GCIA 3C6YA 1T8RA 4Z0HO 3KPWA 2VWQA 5C5DA 5ALJA 1PL7A 3AOGA 3D7KA 4IS7A 4YB8A 4L07A 3U3XA 2WBLC 3QIVA 2Y9TA 1V37A 1ODSA 3D4NA 4YUWA 1QHIA 5J2DA 4LHZA 4DGSA 1HDEA 1RWVA 3GJZA 2PU5A 2G5HB 8LDHA 3VSDA 4MYUA 4PFQA 1C9JA 1MG5A 1UT8A 1YQDA 4ZYZA 3JPQA 4FS2A 4A2CA 3LQKA 1YE8A 2O59A 4X8OA 4H3HB 3P9QA 1UA0A 1GTRA 3U80A 2WB1C 1RRFA 2PFSA 2EP7A 3T7RA 1VIAA 1Z74A 3UBMA 3UJDA 1EIWA 2I1WA 3DMTA 3G8CA 2XBLA 4YRKA 1HC7A 1DUVG 2PT5A 3O7MA 2HMWA 2GEUA 5ILQA 3RT1A 5BQOA 5JJ5A 3HPOA 3LU1A 2VJAA 1XXLA 2ZS8A 4XFJA 5CA1B 1A1SA 3LCJA 4FE7A 3QM1A 4DJAA 3LECA 4GOXA 4Q4JB 3OE7D 4AFNA 1PEAA 1TA4A 4H2DA 1BE1A 4XUSA 1Y9ZA 3W1EA 2C42A 2PXIA 3ZTYA 3UMBA 4RJTA 3R7NA 3CZMA 4M22A 2B3DA 1TT7A 4BVGA 2A1JA 1NI4A 2XDQA 3QH4A 3OQ1A 3NTXA 4YI3A 2D7DA 2MYTA 3SDZA 1WETA 2X0EA 1Y9AA 5JANA 3VR6A 4DSFA 1ML3A 3V4SA 1O03A 1JP7A 3ZWKA 2GD2A 3VDNB 3W2EA 1RZ3A 1H0RA 2JMGA 4UE6A 3BFPA 1O9BA 2BFBB 1I1QB 4U2BA 2ATEA 3U60B 2MDTA 3QJ5A 4PC7A 1EH5A 4LSZA 3WU2U 4MIEA 1DT5A 4FFLA 4LOHA 2W90A 4N3AA 3ACBA 3CZAA 3GLIB 5K8VA 2RHDA 4CF6A 3PJGA 1BQEA 1OZHA 1JDNA 3REGA 3E22A 1LWOA 3NHBA 5AR1A 1GGNA 1VKNA 1P7YA 2PY6A 2WFAA 4N4AA 1EWVA 1FFUA 3M6AA 4WJKB 1CS0B 1DMRA 4EUHA 1X87A 3MTIA 4CR6A 2JGLA 3PHJA 4ECYA 3U7QB 8ICAA 3RWOA 1XZLA 5IKMA 4IOLA 1WHSA 4V1CB 3L07A 5L6LB 5IIKA 2XWPA 5K01A 1Y1LA 3L8FA 1NQ5A 1NQUA 2ETXA 5HTOA 2H7XA 4M38A 2X23A 1TT5B 3HB9A 3V7NA 1C3OB 1KI9A 3GZ4A 1PVOA 1V96A 2NO1A 1NFRA 5CMLA 4BFYA 4K8RB 3TOZA 1JLSA 3HEAA 3ORQA 2O8DB 3H40A 3PGKA 3I8XA 3K35A 1YFKA 1U0LA 1M0TA 1TIPA 3BMNB 5FV7A 2C4WA 1W2GA 4OYLA 3BIFA 8ICMA 4Q4DA 3MMZA 3L3FX 4Z7NB 4QDOA 4Z0TA 3JATB 4NBNA 3AR7A 2MT9A 1L5GB 4LUCA 1ZEJA 3BHJA 4J1TC 3FCYA 2VJYA 3DB2A 1M1NA 2CHGA 3WK5A 3OZIA 3KT6A 4LW8A 5G4KA 4YAWA 2Q99A 4HXFB 4HMQA 1MB0A 3S5UA 3N7RC 4OM8A 2ASDA</