2ZJ3A

Isomerase domain of human glucose:fructose-6-phosphate amidotransferase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
MKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine--fructose-6-phosphate aminotransferase [isomeriz
publication title Structural analysis of human glutamine:fructose-6-phosphate amidotransferase, a key regulator in type 2 diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A02
4DV2B 1DQRA 3IFSA 4AQYB 3C3JA 4DV4B 1GZDA 2O2CA 4DV5B 3T1YB 4DR6B 4B3RB 3J7AC 2X3YA 2CXRA 4DUYB 1WIWA 1HM5A 2POCA 3Q7IA 2CXUA 2HHHB 2VQEB 2UXDB 3FXAA 3FF1A 1XMOB 1I94B 1FJGB 1B0ZA 3FJ1A 1X92A 1HNXB 1JEOA 1JLHA 2CXNA 2CXOA 4DV0B 4LF7B 2F4VB 2DF8A 1VIMA 1GZVA 2VF4X 2UUBB 4GKKB 1C7QA 4B3MB 4X64B 4DV6B 4DR3B 4YY3B 4TOIA 3FKJA 3EUAA 4B3TB 4JI0B 4LF5B 4JV5B 5IWAB 1Q50A 2CB0A 1XNQB 1IBKB 2UUAB 4S12A 1JXAA 4DV7B 4DR1B 1MOSA 1NRIA 2A3NA 2AMLA 4U6NA 1XMQB 4JI7B 4K0KB 1N8TA 1X94A 2PUWA 1C7RA 4AMVA 1IRIA 2E5FA 2CXQA 5LMUB 3JAMA 4JI8B 4LF4B 2YVAA 1HNZB 3J80A 1M3SA 2VF5X 4OX9B 1XNRB 2UXBB 2WU8A 5LL6P 4GKJB 1IATA 1NUHA 5LMNB 4JI4B 4DV1B 1IBLB 4X65B 2UUCB 1N33B 1HNWB 3BCHA 1TZBA 5BR8B 1N34B 3Q88A 1J5XA 3G68A 2I22A 4DR4B 2Q8NA 2E5LB 1MORA 1TZCA 1KOJA 5BY2A 5A2QA 2CXPA 2ZJ4A 4LFBB 1X9IA 5I01A 3T1HB 2DECA 2CXSA 4IVNA 1MOQA 4DR2B 1TK9A 2VQFB 1U0FA 1VI6A 2PUVA 3QKIA 3J81A 2XBLA 2O2DA 4JI1B 1HOXA 3JX9A 4LFCB 4DR7B 3SHOA 2PGIA 3ODPA 3BJZA 4B3SB 2J6HA 3LJKA 4JI5B 1X9HA 4DV3B 1VIVA 1U0EA 2PUTA 5IT9A 3KNZA 1J5EB 1JIQA 4NXNB 3TRJA 1N36B 3OOJA 4YHHB 3CVJA 2V4MA 1U0GA 3OTOB 3I0ZA 4JI3B 1XTBA 3HJBA 3NBUA 4X62B 1IBMB 4LF8B 4JI6B 5FLXA 4DR5B 2UU9B 4KHPB 4M0DA 4LF6B 4DUZB 4LZJA 4S1WA 4LF9B 2I2WA 1N32B 2UXCB 2ZM6B 4JI2B 1T10A 4EM6A 4LFAB 3ETNA 2ZJ3A 2CVPA 3PR3A 3M5PA 1HR0B 1ZZGA 4X66B 4NXMB 1VI5A 2CXTA 3HBAA 3TBFA 4JYAB 1G98A 2XHZA 3UJHA
chains in the Genus database with same CATH superfamily
2EX1A 3IJPA 2BKVA 4BN5A 3QFCA 3TG2A 3RG2A 4YRSA 2R5FA 2ES4A 3MRSA 1V0JA 2OP1A 4S2EA 1DO8A 1MQAA 1I9CA 5JJKA 1UFQA 2UYYA 1HPLA 2PKYX 2VF8A 3Q7IA 4JL8A 4KK3A 3ZE2B 4C2BA 1D03A 1DQSA 3ENZA 4ISCA 5T4FA 1UK7A 3B5IA 3E81A 2DP4E 4KE9A 1JXOA 4Z3OA 3KT3A 1NFQA 4A2CA 1Q1NA 3MWGA 2BFCB 4K9LA 4RCVA 4MV6A 1XCOA 2FQWA 4YAJA 2DF8A 1JDBC 4U7WA 4WERA 2PJUA 4IWXA 4BLTA 5ALWA 1E9CA 3AUXA 2AJ8A 2DCMA 1Y6FA 3KTAA 3T3MB 4PGMA 1LBSA 4K9QA 4DLSA 3IA2A 3LV8A 3H0CA 4B85A 1JQAA 1QH1A 3Q8XB 2RCYA 4FXOA 4F60A 5CXSA 2C84A 3T7IA 1O0BA 4KMRA 3FPCA 1MB0A 4P35A 3IBTA 2B7LA 3K73O 3TQFA 4EHNA 4KSBA 1XN4A 3UMFA 5I7FA 1DPFA 8AT1A 2ZEJA 2DT8A 3B8HA 1AZSC 1CR6A 1X7XA 4JBWA 5EAIA 1Z3IX 1SCUB 3M6IA 1JKXA 3EDQA 1EJBA 2RGCA 2G4VA 3ICQB 3K1AB 1SXHA 5G1PA 3HXKA 1EXVA 4DLAA 2VK4A 2VXYA 1FYDA 1V4NA 3L0OA 3KAKA 3SEFA 4A2WA 4JL5A 4F4DA 4P80A 1ZL0A 3DLBA 3A1TA 4V38A 4R3NA 5T4EA 4B7UA 5JTUA 1M54A 2XBMA 4KO8A 3ZY5A 2G72A 3F7TA 1B8OA 4P3XA 1NOKA 1RWKA 2FPSA 1DFIA 3DDSA 4I1IA 3HMQA 5F1YA 5GWXA 3SHTA 4RMHA 5EPUA 3ZZ0A 5LZ4A 3I1FA 4NICA 4NVRA 3WWCA 3HB0A 4DC9A 2JI8A 2HU2A 2P65A 2C29D 2O6HA 2X0FA 3K5HA 1KZYC 1YR1A 3C6YA 4CM4A 4JUIA 1GZSA 3A32A 5FBHA 1WXQA 3CEHA 3G82C 1LFAA 1YJBA 2QZJA 2BN4A 1QTNA 5DWDA 5BQOA 3QUCA 1A69A 2VK8A 4Q3OA 1FFGA 4KJZA 1JHOA 1MD9A 3BXFA 1XP5A 1JFSA 1KZ1A 2Z5GA 5EN4A 1JVBA 1K98A 3M1LA 1FNBA 4E32A 4AP9A 1KVTA 1JH8A 3G8AA 4G25A 1UPAA 2E89A 2B30A 4ZCTA 4S3MA 2X15A 1JQEA 4K5QA 3QMPA 4XZ3A 1GL9B 2X6RA 3OEHA 3P52A 1IJFA 3IDFA 4KVZA 5CMLA 2HY7A 3C48A 3CH5A 2IBTA 2WVHA 3UQZA 1U8UA 5EJ4A 1ORHA 4MIYA 1V8PA 4ENRA 1TJ5A 4UAGA 4X8HA 5LQDA 3VOTA 2RARA 3HJCA 4D99A 1BIFA 1OI3A 1ZNWA 2FDRA 4WD3A 3KR2A 1IM8A 2ECOA 4V39A 2IXDA 3PXEA 3VBEA 5FBVB 1R4MB 3TLCA 1TQHA 4MQLA 4CT5A 4Q18A 1Z22A 3D1VA 2BPOA 3ZJVA 2JS7A 2VDQB 4EJ2A 4TWIA 1YHZA 4BQFA 2GPNA 1AG9A 1PWYE 3G2LA 3K8QA 3LVBA 5LIRA 1QSGA 2C9CA 2E1PA 4NAHA 4J94A 1CULC 4RTKA 2DQKA 2ZM5A 3G6KA 4DLUA 4PAGA 2G76A 4DG8A 4L28A 2UXDB 5L3ZA 2SCUA 2Z8YA 3WRXC 4FYVA 4LUCA 4IOMA 4ZCLA 1D6JA 3BBPA 3L5OA 5HZHA 3BWMA 4MV3A 5CHEA 2FW7A 3C6KA 4JQSA 1RWXA 2GDJA 2LZ0A 4D41A 1AMNA 4C5CA 1BXZA 5AW6A 4QDKA 4H17A 4KLRA 2EP7A 4ZYYA 3G8CA 4ZDWA 2PBRA 2IIBA 3MD0A 4FD2A 5DWQA 3D54D 3CRMA 4DZTA 1P17A 1VLMA 2JFNA 2WT4A 4HDSB 3T7SA 1JXAA 4N40A 4C7BA 4NYJQ 3WLOA 5GAJA 5E0OA 3HEAA 5C8YA 3VJRA 2NYAA 3E23A 3WJAA 4JA0A 4M1YA 2V5VA 4NCJA 4A73A 2DBVO 3PDWA 1UKEA 4XE5A 4EQ6B 2WDPA 5EPEA 5LYJA 1Q22A 3GJXC 5CDUA 4UE6A 4MUYA 1VSQA 4UU7A 5HZMA 1GPNA 4Q1FA 4JYCA 4B6RA 1UJCA 4ESEA 4FU0A 1BO6A 3K20A 1QF6A 1VL6A 4N0QA 3BL5A 4U2CA 3KJQA 1M8PA 3W8FA 4MEBA 1MTOA 3T5CA 1X42A 1G21B 1YQTA 3ENVA 3PFCA 1MNAA 3P27A 2Z04A 4ND8B 5B3JA 5F5NA 2JCVA 4C03A 2FZGA 2YC2C 4HYTA 5LOVA 3KWFA 5KNCH 3EMKA 3BQ9A 2M6SA 2LR0A 1AV6A 2RHHA 3F3MA 4H16A 3LYHA 2ZJ0A 5B3AA 1GKKA 3WYDA 4QU9A 2Z58A 3OX1A 4LCJA 3IUSA 2R4TA 5D5QA 2FR1A 1IXKA 4P5EA 1VIVA 5AI8A 2XNDD 3ORQA 1V4VA 1O54A 1O9GA 1WCXA 2W6JD 3I12A 4UEJA 1SUWA 2JLSA 2W7TA 1U0HC 2JZNA 4BVAA 4G81A 1CR2A 1T5DX 2HFJA 4DKXA 5JAOA 4LJRA 1K5GA 1JSLA 1CUIA 3W0LB 2OCXA 1E61A 1JKJA 2VYNA 4RU1A 4ZC8A 1LBIA 3HO1A 2CXHA 3LF2A 4B75A 2RH8A 1Z0KA 3WLLA 5JD4A 4KHPB 1TCBA 2JGMA 4Q3DA 4RJ2A 5JRDS 3BRQA 3BYZA 1EX6A 4QDXA 1NMYA 2QAGA 4YT4A 4B6PA 4KUGA 3WQHA 2H11A 4AB1A 4D80A 2FWMX 1JE0A 3T7RA 5HP4A 4ZKEA 1PSZA 1RQRA 4BNWA 2BI4A 3REFA 4RA9A 4MGIR 5F21A 1M6EX 2IIQA 2GAAA 4Y1RB 3FGOA 1P9NA 5I9MA 3QLUC 3DTYA 2FE4A 1XD2B 4Y30A 3VUFA 2NT3A 5DEIA 1JEYA 2EQ5A 3I1JA 3RVJA 4KREA 4L8FA 2EJBA 2AJBA 3KDSE 2R96A 3A0UA 4QFBA 3VPFA 4OQEA 3PIIA 2PQMA 4AZVA 3CUUA 5FUMA 1DX6A 3FIJA 1KZ4A 1P81A 3AYXB 4LJ8A 2MSWA 2A1UA 4BX8A 1FYWA 3F90A 5JYCA 1NJ6A 1PR9A 2IP1A 2GO7A 1GUAA 3OTIA 4HFRA 1C7JA 5FOSA 5K0ZA 5CITA 1M73E 2BP7A 1SU7A 2DUMA 2FN7A 3FNHA 2H4XA 3O2JA 3UH0A 2Z6QA 1MRNA 3KQUA 4I55A 1YQGA 4HT3B 4UAJA 1C3XA 1MX5A 4OHRA 3T7JA 3BHNA 4B5LA 3ECSA 3GGGA 1XCPA 3VNRA 4B8WA 5D2CA 1CE8B 4G8JA 4IGIA 1AKUA 2QTCA 1H5NA 1YR6A 4V0ME 5LSAA 3U19A 1H05A 4NYMR 2R11A 1VLQA 3IUJA 1T5SA 3D5TA 1KJ9A 4MVJA 4PR3A 3CMCO 2FPWA 1G9SA 4FKBA 4U6NA 2FRXA 3EEQA 3AUJB 2FSPA 1IK4A 3QV1A 4IICA 2BGNA 2ICAA 2RDMA 2B0JA 2GZMA 1QIDA 3P94A 4FDVA 5F77A 3RK1A 5KTOA 1C2TA 5ALYA 1BH6A 1YT5A 4B6SA 1ZCFA 4EKGA 1X1BA 4EFDA 3OIDA 1SB8A 4ZMRA 2BZ1A 1RRPA 1MC5A 4MMXB 1IQPA 3JVIA 4HJRA 5GJWC 4CLEA 2HGZA 1H8EA 2GBLA 2P9ZA 5L3QA 2C3PA 1EHYA 3AVPA 3QKRA 4FOOA 4RDXA 2IYZA 5A03A 3AB8A 3HV2A 2P9EA 1SKMA 2BHRA 4ZAWA 5LQSA 2F1IA 2VDNB 2ZB7A 3OIFA 5I7WA 10MHA 4QJIA 3AEQB 3PUYA 5C32A 3NDBB 2D7CA 4JKIA 2NXEA 1E1QA 3ZVKA 1HQCA 3PE3A 2JFOA 4EYEA 3GGPA 2DECA 4JVMA 1HE5A 1KQNA 1RWBA 4BRSA 3QA9A 1PK9A 4JR0A 4G41A 1N57A 2C5HA 5L7YA 2IU0A 2ZS9A 4P4TA 2O7QA 3X2SA 2NVUA 4YJFB 4YDSA 2HXGA 5EXEA 2NV6A 3E3NA 4K9NA 3LY7A 3WYFA 4B6FA 1GM5A 4Z4FA 3KU1A 4M60A 5KOJA 3EXG2 3UV7A 2JJ2D 4MB2A 5CDSA 3L84A 3IE2A 3NMUF 3FNFA 1B0AA 3BERA 4AKTA 5DN6D 1S8NA 1JBQA 2YC4C 4FR0A 4KJXA 3THXA 3OE5A 2QTZA 2GEUA 3HCWA 2OC4A 1A8PA 1VDMA 1BGVA 1N9KA 1YZNA 1SVIA 4HRYA 2CJXA 2F90A 3WAGA 1IBMB 1EWTA 5KYGA 1LW7A 2GHRA 1QQ5A 4YJGB 2O1SA 3FG9A 1RM0A 3U26A 5A3SA 4FBMA 5CJ2A 4RY9A 2GYYA 2F6RA 3LC0A 2C03A 1GTL1 4WDQA 2VEOA 1CQIA 2FH5B 3P4XA 4P3NA 4AICA 4W5QA 1W48A 5KEIA 3DEHA 1CIJA 1E96A 2B1IA 2XODA 1TX4B 1QDEA 2ZLBA 5HQJA 4EW6A 4EVQA 2HLNA 3X2FA 3GAMA 3V1MA 1AQNA 1BX0A 3NALA 1X7YA 1QUFA 4Z4CA 1JPUA 1ZOSA 1U3FA 3B85A 4AYXA 4B3HA 4YO7A 1E5XA 3FOEC 1UBOS 4A0SA 3NVKI 2D0PB 3QVSA 4QUGA 4HB2A 1PNRA 2VBGA 3EC2A 2NO9A 5JZ9A 2O8CA 2C3UA 1FK8A 1A9PA 1ZLYA 2I2BA 4MWCA 4NH0A 1NDUA 1ZO8A 2FGJA 2WYIA 2ZBPA 3E61A 2HWUA 3OFVA 4J9VA 2ACVA 3GDFA 3LTNC 4LZWA 3FVQA 3JAWA 2IITA 1WOYA 1L5NA 2H3EA 1RSZA 2QL7A 2PG3A 1FQWA 5CA0A 3P9KA 2CXNA 2ODTX 4GRDA 4E7OA 1MW8X 1R12A 1Z26A 2I78A 3DOOA 4RHTA 3AEXA 5HRUA 4RTLA 5IUKC 2Z2XA 4S1NA 2ZJOA 1JDUA 4XYGA 4WINA 5EJFA 4QM7A 4K8OA 1IZ8A 3VR4H 4MQFB 3KDPA 4CKCB 1XMSA 1JHAA 2OUIA 1QIMA 1ONBA 3JD3A 5M04A 1HT2E 1UOQA 1F8YA 4E14A 1ESNA 3SVLA 2EW8A 2H65A 5HM6A 3EOZA 4EDFA 2DLCX 1DC4A 1DINA 5FPQA 3HG7A 1YUMA 3AJAA 1T2UA 1LPAB 1XQ9A 4PLGA 3IJRA 4HEJA 2PD4A 3DMDA 2P27A 3BJRA 5E6RA 5KS2A 2ALJA 1L5QA 4U7GA 4ZCIA 5IBCA 3II6X 4AN1A 1ZIDA 1Y4ZA 4HZUA 2PYIA 3RIHA 1Q1QA 4K6OA 1GRQA 3QQPA 3V4FA 3VR6A 3DHWC 3JARA 4YDRA 4JJGA 3S5JA 3SLKA 4IH1A 4JEHA 4C0LA 4X44A 1XQXA 3ZGOA 7REQA 2MCFA 3UXHA 5I01A 3I6IA 2VJBA 3MUFA 1E2FA 1UBMS 4AY5A 1BROA 3B1YA 3FMFA 2XZLA 2Q99A 3RO7A 1JDVA 5DBHX 3WSTA 4YH1A 1P3Y1 4O2BB 1NC3A 2J5KA 3I04A 1WPGA 2CHFA 2W2QA 4FXPA 4Y6QA 1PU2A 3LT0A 3SI7A 1UBNA 4IQ4A 3ZZ1A 3HB1A 5C4GB 1DCFA 4TQAA 3TYXA 1T3SA 4WZAB 2JHCA 5KAPA 4RNDB 1Z5NA 4F8YA 2GZDA 2LDXA 1F17A 3RYFB 1J8FA 5JRJA 1Z68A 3ZY6A 1WBBA 4ZQCB 1MGOA 1XTJA 3EHDA 1R8JA 3EZ2A 1QTRA 4YRDA 1ESEA 2YZ2A 3P0EA 4KODA 5EUBA 3SX4A 4U7DA 1WMAA 3FZEA 4KGDA 3I9FA 4BGUA 3A6PC 4TTPA 3SF0A 1CLEA 2J4DA 3OOEA 1V8ZA 1XTZA 3PXBA 1NYTA 1E2KA 1FJHA 1VHTA 3CLSD 5FI0B 5P21A 5BOSB 3KJGA 3ZGYA 2XITA 3VH2A 4UFPA 1JZSA 4FBGA 5KC9A 3PLAE 1AC5A 3B6MA 2IPNA 4PS0A 3TW8B 3VDXA 2CKMA 4D3ZA 4PWZA 2FLKA 3PXXA 1OSNA 3O74A 4WFJA 5TQJA 1QE3A 2XVYA 4GRAA 2IY8A 1HE1C 1ZJWA 4LJ7A 2AC4A 4RE6A 4B7AA 3D6HA 2QVBA 2G04A 2QZ4A 3DEAA 1N1DA 2PKQO 2ZRQA 3H9JA 3R6GA 4IFEA 4QQ8A 4PBRA 3UWDA 3IGFA 4FWTA 3ECCA 1TPZA 4M87A 4O2BF 3ZI7A 1EE2A 2AI3A 4IRMA 2GWHA 4UTOA 4WLNA 3PWZA 3P20A 1DEXA 3U4CA 1RYDA 5FPTA 3OHPA 4NWIA 4YQFA 2VQEB 4LDQA 3FHCB 1Q1GA 4PYJA 5L6LB 4WTOA 2PR2A 3JVVA 2DX7A 5TMEA 3RCBA 3JRNA 3S2UA 4CW7A 4DCTA 2ZVQX 2YYYA 7ADHA 2RKOA 3FWKA 3TEMA 3UHAA 2V9ZA 4L0QA 5DLEA 4H6PA 1BVUA 2VPTA 3IV6A 1C0LA 4BWYA 3ANTA 4Q4AA 5CIQA 5JANA 3Q12A 2HHLA 4QNMA 3REQB 1EFDN 2ZJ6A 3L6OO 1UMDB 4K05A 4R5MA 2BFWA 1FQKA 1P2GA 1EWYA 3DLCA 2I7VA 1IPFA 4JUCA 5BP7A 3AL0C 5IWAB 2HWKA 2W00A 4IDBA 4EYKA 1IXRC 1XL1A 2DCUA 3L7OA 2ZYRA 2IF2A 2ZU6A 2JJ1D 1BD3A 4YRQA 2OXCA 2E4UA 2G67A 2CVQA 4JI7B 4CFYA 5DHFA 3WWYA 5AKZA 4B46A 1KYQA 2XYPA 3L7DA 3NPAA 3MFYA 3BA1A 2B3TA 4YTEA 3WB1A 4C4TA 1W8DA 1JGTA 2AHOA 2WPNA 1P7YA 3JWEA 3OTGA 1D6NA 3PENA 4DLZA 4R2LA 4B0OA 2W43A 5CA1F 2PV7A 4TYWA 2G8NA 4J0CA 3B6IA 3E82A 3RIEA 1C3OB 1RQXA 4JMPA 3JQCA 4BO7A 2IP2A 1VP3A 4J1TA 4V0RA 3BE6A 1DDIA 3D6VA 4FJ1A 4NS4A 3RH0A 2ISQA 4EOGA 1XTTA 4ND5A 1RYYA 5L4SA 3HDTA 3KYCB 1ZRSA 3MWEA 1W29A 2O50A 3Q88A 1L5GB 2UUOA 4Z4EA 1B1CA 2I80A 3PEEA 3U56A 3FDZB 1U94A 2BHSA 3I9MA 4RXUA 2FWRA 2QRVB 3HO8A 4WCFC 2OV8A 1N6HA 1YTLA 1IFXA 2QS9A 1DJNA 3LX4A 3OP1A 4G2TA 2VTVA 4XWYA 1H9CA 4OHBA 3CY6A 1G0NA 2G9VA 5FOXA 1W76A 2IYLD 2KYRA 2C0PA 5REQA 2JRLA 3F8SA 1YB5A 1GUFA 1KF0A 1P9OA 1QV7A 5DSTA 1Z7BA 1T2NA 4ZHQB 4JI5B 2HADA 3OSUA 3S2EA 1ISHA 2P9GA 1KQ3A 4BO8A 3KLBA 4I4IA 3VR1A 4JC5A 2VHJA 4KVFA 2NAFA 2LE0A 4ZGBA 5AM4A 3S7ZA 4CG2A 4LW8A 1E79D 4ZOCA 1BFDA 1ABBA 2AHRA 5FR1A 3I83A 2ZUBA 2HUPA 2RK4A 1FF9A 3CUSA 5FLXA 4ALJA 2LCIA 3GZTB 3HKBB 2HN9A 3HR4A 3MMXA 1Z38A 5EMLA 3RS2A 2V3WA 1LTKA 1Q0QA 4EZBA 2HWYA 1DZ3A 1C4XA 3L77A 4FJ0A 4ZKDA 4CEHB 4KVGA 2O0LA 1MV5A 4FZJA 4TTQA 2AJLI 4KIJA 3CXRA 5JJIA 3SBEA 2B2NA 1X19A 1C3VA 5GQSA 5HXAA 1RHJA 2UVPA 4J49A 4K3VA 4X1IA 4B1FA 2ANCA 3P4UA 4Z9YA 4FDAA 4ZU6X 1T9GS 1LX7A 2Z2YA 4NMWA 1QB8A 1UK6A 3PUKA 1OCEA 4M0UA 2YYZA 3FWNA 3Q3EA 4JDPA 1SBHA 3HACA 4H35A 2DUWA 4URUR 5H4HA 1DJLA 5K01A 4KTTE 1VPVA 1X87A 2C4TA 2F17A 2Q8PA 3E5MA 2C31A 4YXWA 4C30A 3SD7A 4MAAA 4AF8A 5EGSA 4YJHB 4ZVOA 2FFBA 5LR6A 3SU8A 3TM4A 4ZHQF 5LP6F 3C8UA 4ROTA 3L7MA 2A1IA 4H6XA 2FP3A 3FNRA 4K9OA 2WF6A 3M1IA 1JWAB 3TX2A 4IP0A 3W6OA 3P1JA 2VWPA 1EXNA 2M1XA 2XJ4A 2PHZA 2PZFA 4X6UA 1IDOA 5HMLA 4DXAA 4DE5A 1BMFA 2E48A 1ECGA 3EEFA 1LWOA 4Q3EA 1JMVA 3W9SA 4BBJA 3LKDA 4IYRA 2IYNA 3LD9A 3SFVA 3P9RA 3PQDA 3IIEA 2Y2UA 5EINA 5G02A 1TUBA 2CB0A 4L5IA 1OYOA 1PVDA 4H1UA 3VI4B 3UT6A 4BECA 1IBKB 2Y66A 1Z6XA 1ZIXA 2IHUA 2V1XA 2VK2A 3OTQA 4F5EA 5CYGA 4HGPA 1XMQB 3H7AA 3N2EA 3ND9A 4RF3A 2HHCA 1GN8A 1ZJ4A 1QJCA 2ZIGA 5AVJA 2PM8A 3TLMA 2HNBA 4E2FA 2E4YA 5LMUB 2RGNC 2Z9DA 3BKXA 4QDOA 3WHIA 3WP0A 5H83A 2HHJA 5FQOA 2PVPA 5AXCA 1YDHA 2YJNA 3EFHA 5H80A 1MQSA 1V43A 4JMLA 4Y67A 3HJGA 4YV7A 1YA4A 2I3ZA 4Z4HA 4PYRA 4J6FA 3HSKA 5HIIA 4QASA 1UF9A 3GLSA 4GLOA 2HKIA 3RSHA 4TMXA 5ADHA 3L3BA 4Q12A 1GLVA 2WR8A 3TR0A 2QNRA 2G40A 4GLLA 4DC1A 5D51S 4M1EA 3IUQA 2GKSA 3OJCA 3F3KA 4Z0PA 4AMYA 4BB5A 3P97A 1L8LA 4GDFA 4AJJA 3GD5A 3BL8A 5MFPA 1EGMB 1ZJ5A 3OETA 2AYXA 1GDHA 4Z0NA 3BXPA 2BFCA 1KI2A 1SVNA 1DLIA 5DHPA 1TVMA 2AOXA 4R69A 1RXWA 5A4DA 2DKFA 2E6KA 3CFYA 1RI2A 3C3AA 2ZK7A 3GJYA 4JI1B 5FOQA 2A1TR 4GFDA 1LKZA 4C1BA 4KVAA 1G6Q1 2BHNA 1RJ9B 4WA7A 1M1NB 4RANA 4M3NA 1R5OA 2H2WA 4WZ6A 3WHPA 1UJMA 1NBME 3FMPB 4YLGA 2NMVA 3DEFA 4O1MA 3TFQA 1RPJA 4WADA 2J4CA 2FLWA 3AVOA 4KP7A 4ZI5A 4OXIA 5KSZA 3C6ZA 4BN0A 1I01A 3HFSA 5AICA 5D5PA 2X13A 4D3SA 4FZ3A 4JZYA 5BPHA 2YOFA 3QUSA 4NC9A 4RZSA 1QGUB 3MT7A 3O9ZA 1GEEA 2VUHB 3K1AA 3OM9A 2FXIA 1LB1B 2ADFA 4GR9A 4MGZR 3RRJA 3U4HA 5ICGA 1Y8AA 1R4AA 1F2TB 2FZLA 4HXEB 5HE8A 2R65A 3SHQA 1IY2A 5CCXA 2G07A 3IE1A 1BSVA 2OB2A 4KWIA 4I8IA 2Y9MB 2ZJ3A 1LNQA 2RHCA 5DLDA 4A1OA 5KTYA 3A4VA 4OMCA 3OEHD 1YC5A 2NZ2A 3FSJX 1WV0A 1R64A 3CKLA 4BDSA 2XXAB 3RI3A 4FLFA 3U2QA 3GEBA 4Q3BA 2CLSA 4R3WA 2GEVA 4CGYA 4ARZB 4KAJA 1XZEA 4GLJA 4V0QA 4UDOA 5TC4A 1FS6A 1SC4A 2ZJ1A 3C7CB 3NDJA 5E4JA 4NHOA 2HV8A 5EOVA 2Y3IA 5A3QA 5JUWA 1D4OA 2PX0A 1GILA 1RFLA 4QUKA 2QQ0A 2XYVA 2YY6A 3DDNA 3L8CA 3WKCA 1NSFA 4BJ6A 5T3YA 4OEHA 1X92A 1RXCA 2NZXA 3HA7A 5CT9A 1GR1A 3FPFA 5DE3A 4EKIA 3OKAA 3SIWA 3RT1A 4JVOA 3BGOS 1OVMA 2VCYA 4JD5A 4KPGA 3DL0A 1CW2B 4MS1B 5AK5A 4X64B 2XB9A 3HM2A 4CLRA 4OK3A 1ZU5A 1CCWA 2RCNA 4H31A 1M72A 3SGLA 1MO6A 4JI0B 4MO2A 4CETA 3GUZA 3UK0A 2O3UA 1UUFA 2QTNA 3H5RA 4FZRA 1Z6GA 4QNRA 2LWIA 4Q7KA 4R5HA 5JR3A 5KTMA 3T3HA 4WGGA 4I9NA 1QMPA 3IKJA 1BRMA 2QENA 1P4SA 3KHKA 4IF4A 5DBFA 3WBBA 2PANA 2X8BA 4OH7A 3VDRA 1YRYE 1HA3A 4DCPA 2PBZA 3R3UA 3QENA 1N2EA 3OIGA 3DAPA 3H17A 3K96A 3EIFA 2P6UA 5E1OA 5JQGA 1G38A 1M6VB 1E3SA 3ZXYA 1R4MA 1Z8HA 4UVGA 3AUUA 4G8DA 1HLDA 4P0QB 3NIFB 1CV2A 2RHDA 1H8HD 1JJAA 2PKEA 2WNIA 3B1VA 2ZYWX 3BIFA 4W5WA 3WFZA 4ZVKA 4ARSA 4PN7A 4UOQA 2CT8A 1G7TA 3GP3A 3K6JA 2CDBA 3UJPA 5KJFA 1NZDA 2B83A 2JKVA 3FRJA 3OPXA 4ZGWA 4U9IS 4A7PA 5ADVA 2F8SA 2OGUA 4QXRA 2G1PA 1N5RA 1BDMA 2E87A 2ZI3A 4AD8A 1PYDA 4X85A 4D44A 2F55A 3ZLBA 1ESDA 3MJ4A 4MAMA 3QSYA 1NA5A 2RGUA 4NBUA 2ZYHA 2OYRA 2BMAA 5DTJA 1IG0A 1ZRMA 4F5YA 2OCKA 3FETA 4HF7A 5FTJA 1ILWA 4HDRB 4HHEA 2EZ4A 2Y1LA 3AP2A 3GFQA 3NC0C 3TD2A 1UJ5A 1UC5B 1VSBA 3UZUA 3SXUB 1UEIA 3CPJB 2XRYA 4CKZA 1U9JA 1MXFA 3DUWA 2R6ZA 4UUQA 4G4IA 1U8ZA 2IYPA 5DBGA 2W4MA 3ZCQA 3N86A 1WMDA 1ZOPA 2WI8A 5JBNA 3X43A 4EJMA 4NXNB 4XM2A 4EHKA 2G80A 3AYZB 1ACMA 3OF5A 3T3NA 3GNTA 4NJMB 1H66A 2VNSA 3HRHA 4FJ2A 5DH9A 3V80A 1N3IA 3THWB 3N5KA 3HFJA 4DLWA 4GICA 1BU5A 4U00A 2WU4A 4IIVA 4WN9B 1C8BA 1BWPA 1P0FA 4PHTA 4MICA 4XVRA 2XQJA 3UWOA 2A57A 2GM3A 3WGHA 1VSVA 3CINA 1UH5A 1N2ZA 2HTFA 3ZWKA 3ACCA 7ABPA 5COAA 3G5UA 3TZEA 2ZU0C 2RE8A 1Q3KA 5I9LA 3BCUA 5DP2A 5C81A 1Q1ZA 3NNNA 1EP9A 1XKXA 1UC4B 2B36A 2Q5FA 3ETNA 1OJ7A 2CVPA 2VYND 4KDFA 1WXWA 3VHLB 3W9UA 2X14A 4JP3A 2AF4C 3ZDBA 4FGLA 3U4IA 1ZZGA 3EE6A 4DFDA 4DQKA 2BELA 2DTEA 2ODNA 2CXOA 2DUJA 5AOVA 4AJNA 3NOQA 4MVXA 4HAYA 4BFVA 3VH3A 1U4SA 1C3LA 4GYJA 1SUBA 2VFAA 2Q4EA 4P81A 2XRFA 1F1JA 3UEOA 4F21A 4L9AA 5CRIA 4I2VA 5EIOA 2HA6A 1RXSA 1AUXA 3DBLA 5F5XA 3I37X 4I2NA 1KAMA 2NVBA 3O26A 4LIPD 1TM1E 1CP2A 3M2TA 3Q7QA 4BFUA 1G5IA 4JEUA 3BD8A 2MR5A 1LPBB 3AJ8A 2MJLA 2RIPA 3JWJA 4ZJUA 3FYHA 1E92A 1T3GA 5HTOA 3A28A 4JUAA 3WYBA 2V96A 5JSZB 4O1HA 4OYLA 1WZ2A 2HD4A 5EJEA 1W94A 3RRBA 4NMLA 2AN1A 4FYJA 2HI0A 3MTDA 3WQSB 4C4YA 1JMYA 2JGDA 4Y0VA 5EUMA 1O8CA 4HNUA 4UVEA 2GHQA 2IXBA 2VHXA 2DPYA 1DADA 3CB2A 2IOHA 2XT6A 4FD3A 3GAFA 1CJCA 4BWVA 1C14A 4UBOA 4DF3A 3EXEB 4G1EB 1IIBA 4FMDB 2ZWIA 1SCIA 3OO1A 4HYQA 4FYYA 2XH8A 1XAHA 2GAIA 3TXAA 1IQUA 3ZU3A 1G66A 3IDSA 5CB4B 1DAPA 1K8RA 1PL0A 3H5WA 4OHKA 3ICVA 1CHDA 2G36A 3SICE 1T1RA 4E5MA 1CT9A 1GU7A 1I4DD 3HQ4O 4MVJD 5CHYA 5FPSA 3X1YA 2WD7B 3X1ZA 4NK5A 5J2TB 3CCCA 3K0SA 1P9RA 1EP2B 3A31A 3CH4B 4FOLA 3WLEA 2UYHA 3L6EA 2JAPA 1U9YA 3KL4A 3F6PA 3G7UA 4EI8A 2D2XA 2Z1NA 1NWCA 4XGRA 5FAXA 4FILA 3UCFA 2QX9A 4KFCA 1JYSA 1GPJA 3S4YA 5LKRA 2J3HA 4CQLB 4Q37A 3F6EX 2LNDA 4MGKR 1UKAA 1EDEA 4LCBA 5ALVA 2G63A 4N0MA 1H8ED 3THYB 1K0FA 2CNKA 4IDQA 3IHTA 3OVMA 1TF7A 5EE1A 5BMVB 2AG5A 1I7LA 4WOJA 2DQSA 2YS6A 3L7AA 3WKAA 1JFTA 2UVDA 1UOEA 4TMFA 1NNSA 3D3NA 2ACEA 3KUKA 1JG7A 1EX1A 1YK0A 1YE5A 5CYPA 2RGWA 3DSRA 2Q4BA 3ETCA 3R0VA 3IP3A 4Z7JA 1Z29A 3WQQA 5DLQC 3V3TA 1E1QD 5D84A 2COKA 5AYVA 1ZFNA 5KC8A 2BFBB 4RK0A 3SYTA 4BBZA 1MDBA 1RS0A 1S3SA 1T4DA 3HE3A 4XUGB 3G0IA 5LQUA 4RSMA 4F97A 3TG8A 1L5OA 4ZAZA 1AHPA 1NVWQ 1NU8A 1U5CA 3UXMA 5CB4F 3GVIA 2V4MA 1NU6A 2VLBA 3O2NA 4HDMA 1ZGHA 2PLAA 2Q9BA 3EA4A 5AKKA 3ESQA 3OU6A 1IQRA 4R2KA 2HNAA 3RVOA 3LL4A 5J2TF 3V4ZA 2HZ7A 1KEEA 3GJRA 1X38A 2XB2A 1Q3TA 5DHTA 1P33A 3AVQA 1Y1LA 1LS1A 4HQRA 4B0PA 1UL1X 2E2WA 2G83A 5DDIP 1OIXA 2D62A 3RVQA 3Q8MA 4B48A 2CVFA 1YIAA 3NYRA 4DJ5X 4BVFA 1BHO1 3NNDA 1Y8RB 1G5QA 3BXOA 5JO9A 4LAFA 3O8OB 1V3QE 1WQ1R 1KP2A 3PHCA 4GGPA 4TT8A 5EIBC 2BRUA 2HF8A 2Z1DA 1YVPA 1U0OC 2JVJA 1I8TA 1JQBA 3T34A 2J6IA 3AU9A 5BMVF 4YNBA 1W44A 2O20A 5GPBA 3C3JA 4IUBS 2EL7A 1E18A 4XI9A 2EFCB 1KL7A 5YASA 1MMFB 3QE2A 5F73A 4YCBA 4F72A 1CIVA 2HSWA 3O90A 4D9BA 3P2MA 4DL9A 2J9FB 1LTQA 3RHTA 2XIJA 5KMGA 2RBKA 1J0EA 3NUQA 1WM1A 5C31A 4IGFA 4I08A 4OI0A 1PR4A 3VYWA 3AGQA 1CB7A 5ALOA 4NNPA 3M5CA 4LYEA 1G8KA 1W73A 3FB4A 4R8LA 1IMOA 2MYUA 5AHOA 3VKWA 1DJQA 2O8FB 1N0VC 3SX0A 1P73A 1GZ7A 1M1YB 1ULAA 3PYXA 4TSRA 4WT7A 4YEDA 4W63A 4C0SA 4EARA 5CB8A 1JR2A 3IO3A 1BGXT 1KJIA 1JR6A 3T0GA 5IXJA 1T29A 3SJAA 3AFIA 3MJDA 4CF3A 3L43A 4LRSB 4E3WA 4Y2JA 4XLTA 3ZVMA 1AK2A 3L0ZA 3QVWA 1GTVA 4PC7A 1Q0PA 4O0LA 4AMUA 3C3KA 3KCNA 3W9BA 5C18A 4WH0A 3TM5A 4UE2A 3SZOA 4CV2A 3PQFA 2HTEA 5K6RA 1GY8A 3C98A 3TD9A 2OCLA 5JWRA 3L07A 3U7EB 3DLIA 2D1QA 5LC1A 4F06A 4GU5A 4WSOA 2P2SA 2PO5A 3BBLA 3WG9A 3KJIA 4ENWA 4IX9A 2NACA 4MVYA 3AF3A 5CLFA 3UKOA 1A88A 2I2XB 3LPNA 3FNGA 3V55A 1EFAA 1I5RA 4TLDA 4HDOB 3G23A 5KKCA 2EERA 2F67A 3KYBA 3G7SA 3RVKA 3AOEA 4M0KA 3DT8A 1QK4A 4M7OA 1CJBA 1UPFA 2QM0A 3ANNA 3GPCA 3OIWA 1Z5GA 3OMXA 4GE0A 3BB3A 4J4TA 1I4LD 4LVUA 2D5IA 4UE3S 3AUAA 3FI9A 3L4BC 1AMOA 4I3FA 2Z6UA 1IYZA 1GNSA 2QUAA 2CXPA 3PG5A 3VZDA 1E2EA 1R16A 1J1IA 1F20A 2CDNA 1KO5A 1P5HA 2IHVA 1JIKA 2IZ5A 3BZUA 3CX8A 3NHLA 4HBGA 5HOEA 3E2PA 4IPTA 1SG6A 5ULLA 1YF3A 1M8FA 2V7UA 4D96A 4S35A 1JKIA 3BSYA 3KKOA 3NOXA 2QN7A 3PXDA 4G0YA 3LMKA 4RUKA 1LU9A 4IKOA 3VR6D 2B1RA 1ORWA 3ODPA 3K6KA 4R8MA 3IDZA 2BF7A 1M2HA 3B6KA 3KZKA 2QDXA 2GEDA 2Q8QA 3GPLA 3KNZA 2GXUA 2ZJ5A 3TH5A 4GMKA 1EFUA 4ZAXA 4WBNB 2JJYA 3TTSA 4AYTA 1LSOA 2ODWA 1RRGA 5H81A 3R6LA 3VHXB 5AVXA 3BJIC 2H9IA 4QOIA 4I9GA 2O3TA 3EEYA 1CVRA 2AA3A 1UXGA 4HWPA 2OFFA 2FZKA 4B71A 5B4VA 1WDWB 4MS3A 3TMYA 1QFZA 1QO9A 2GLUA 4E21A 5LDGA 1ZD5A 3KV1A 4UNRA 2PFGA 2QTRA 2FMIA 3GA5A 4P4SB 2B92A 3DKIA 4RJLA 2LCQA 3SQDA 5I8WA 1J39A 5BUQA 4J0IA 4DSTA 3Q10A 2WJAA 1GL7A 4NRDA 1E9BA 3FDXA 3PFNA 3IPAA 1UT6A 1UPTA 2F48A 2H07A 2PXHA 2V58A 2YXBA 3AQ4A 4RVOA 2QUZA 4CG1A 5A4MS 1P0IA 3HDJA 3NM5A 2WWRA 4AZ3A 2ATEA 1RNLA 3H05A 4TGLA 4CIAA 4NNJA 4F9GA 2H1VA 4O2BA 1OWOA 4I9UA 4RHFA 4D9NA 1ETUA 1XMPA 2JCYA 3QOYA 5C8XA 1TT5B 3ABQB 5ENZA 3LUGA 3W6UA 1ZVKA 3OEWA 2O1WA 2J7KA 3JZIA 4WZAA 1TZ2A 1UBFA 2RAUA 3WJ2A 4WBNF 1DDOA 2C7OA 3NYIA 4UM8B 2YW9A 2BM1A 5JARA 2ZSFA 2NPIA 2CV0A 4CEIA 1I32A 1N2JA 2VF4X 2FUCA 2WKWA 2X23A 2XUDA 5ESDA 1KEZA 2EBUA 4QLAA 4JV5B 2JARA 4LSMA 2W37A 1SXIA 2HU7A 3AX6A 1OJLA 4JELA 1KY4A 2H2FA 3B52X 3LUKA 3HZRA 4E88A 2OZLB 3TGPA 2PFSA 2W6QA 1II0A 1UKYA 4WCVA 5IK2A 5F7XA 4HQKA 4IIFA 1YCDA 3EEBA 3D02A 1QK5A 4DYHA 1B16A 4HB0A 3UPTA 3OCZA 1WB6A 1KKLA 3DWEX 5HIKA 1EK6A 3FHTA 3PCXA 1C0KA 1HYHA 1D7AA 3TW8A 2DLNA 1J2EA 4HX5A 1P2BA 2Q3FA 1DOZA 3ADOA 3PRJA 2ENUA 5JNTA 1PT5A 3C7DB 4RPJA 3STHA 5LMCA 3FNQA 4HDKB 4PX3A 3O1HB 5EHIA 3VAYA 3M4NA 4HR7A 4ISBA 5KBYA 4CM6A 1KFKB 3HLKA 2B1JA 2GAOA 1X7DA 2IPOA 5HKOA 1NF9A 3RD5A 3GARA 5G0SA 3WGMA 1HZZA 2VQDA 3R7FA 4UCFA 1PHRA 4H2DA 4HDCA 4RQBA 1X39A 3VPAA 2B21A 2AH5A 2I22A 5LQAA 4NQZA 3LS2A 3GJ6A 4ECAA 3QE4A 4M1QA 3R5KA 1PEYA 1DV2A 2WP0A 5J2UB 4OJNA 2NO5A 4GNKA 3N8KA 1O5TA 2R7LA 1XZHA 3ISTA 4YS6A 2P9HA 4CM7A 5K8UA 4NEGA 4KQCA 4C4RA 2GBFA 2HSJA 3NBYC 1UMDA 3IXQA 1T2VA 1CUDA 2QKYA 5TJ9A 3X1MA 4IDFA 5ITWA 3FCEA 3BAFA 3OZXA 3VMFA 4R1MA 1XQWA 2A59A 1DTSA 3LO8A 1C29B 2CHEA 3QYPA 3STWA 4F56A 5LLDA 3SM3A 3QMMA 1KH2A 2POQX 3DBRB 3MSXA 2A5YB 3DFIA 1QGZA 3FMVA 1NOJA 1U8XX 1FMTA 4KKVA 4ZYVA 5BW5A 5CFRA 3PEWA 3TQOA 3DOCA 3CVVA 3B1XA 3M3HA 3O8RA 2H48A 4YMIA 4H18A 4NZYA 1X6VA 3H6HA 3H2YA 1LPOA 2MDTA 1N0UA 2PRJA 1C3OA 4UW9A 4A26A 1OW3B 3UN1A 4WZZA 2O2HA 1C1DA 1SBQA 4ZOLA 3NKVA 1A4UA 2B7CA 2OBMA 2PWPA 1JKMA 2ZUCA 3KYCA 4LFAB 5FTNA 1QCYA 2W9XA 2GERA 1FEZA 3T0FA 4IIBA 4HFMA 1NJ8A 5J2UF 1Y5IA 1I1OA 1PFWA 2CMDA 2XUGA 3QOWA 1VLJA 3R8CA 3HCPA 2XMZA 4RZ3A 4EPXA 3EEOA 3KFVA 2ZRPA 1SMKA 4AUEA 3TMAA 2FOIA 3EXHC 4PYMA 4L7VA 3HYLA 4O4IA 1JLLA 2PZJA 3IPRA 4LE2A 1TU0A 1T6ZA 2B8NA 2HHHB 5HF6A 1KMMA 1J0CA 2GPSA 4X90A 1I6KA 2YW2A 4AQDA 4ZHQA 5JZOA 3STUA 3HKEB 2ESRA 3E9RA 4BLSA 5E4FA 2XE7A 4O4JA 4RF2A 5A4JA 2WZCA 2ZIWB 4GEKA 4AY4A 4DWOA 2P62A 1YFLA 4BHTA 2HIAA 4JUFA 1J22A 2FMKA 2ZR9A 3BILA 2AEMA 3LKBA 1JMKC 2FPUA 3UXEA 3ZIDA 4B47A 4GKKB 5HCIA 2XTNA 4BQSA 1FNDA 1TKCA 3AF6A 2P35A 3O7WA 2FNAA 1MVNA 1GGVA 5FJIA 3NTQA 1AM4D 5EP3A 4X3OA 2VT6A 2AXQA 3UIEA 6CHYA 4ZRDA 5IFLA 1BZYA 4G0UA 1BWQA 3QUBA 4MYSA 5HFNA 5FA5A 1YB2A 3CVWA 5DHAA 8LDHA 3LQ2A 4W99A 1BMFD 1OFIA 2J85A 2P5SA 2F62A 4OBXA 2IV7A 1EVLA 4A1FA 4WJLA 4N0DA 4QDZA 3RGGA 1WCIB 2EATA 2MT9A 4UOEA 4CDNA 1TF5A 2DY0A 4JK3A 4MIKA 2GI4A 4OLHA 3THSA 4U9UA 1XX6A 4GBJA 4HX9A 4KQ6A 1PS9A 3LX6A 4FVTA 2ZI6A 4WUTA 4YJHA 5KNDH 5LWHA 4H15A 1JHQA 1NAIA 2IDJA 3D9QX 3L0SA 3DZ8A 4RXMA 1VHQA 3VVLA 2C8VA 2ERYA 3OD1A 1L7PA 2EGGA 2PZ8A 1SUCA 2WSMA 4GPD1 2Q5EA 5K3EA 4HNAA 3AFHA 3BWXA 2R7AA 2GSWA 4IAOA 4QXAA 5B1SA 2WK1A 3DMGA 3DHYA 3DPUA 1ORRA 2P2YA 1LRLA 1CS0A 1RLTA 3LZCA 4MPRA 1AZTA 1GNPA 2VT2A 2R8XA 3VMMA 4QNNA 5IF3A 2WHRA 3CLTC 3UW3A 5EZ6B 1GPUA 3HJUA 3L06A 2Q0HA 3EG5A 3E18A 2GCOB 3M4JA 3RU7A 3RLIA 1FYVA 3E9QA 1KI7A 3ZWBA 3QPCA 1BGWA 3LJKA 2Q2OA 4WOKA 3SLGA 1I1HA 3L82B 1YNSA 4BOYA 2RG7A 3WRVA 2ZIAA 4DLXA 1I6WA 1NIJA 3LRTA 4YP7A 3SDBA 1AGXA 1J70A 1Y9JA 1Z07A 3BJEA 1S02A 1VBMA 2J31A 3H9BA 1XOIA 3I9KA 4K2AA 3VFDA 5BN3B 3FDIA 4JLSA 5I3CA 3MBIA 5DGTA 5CBKA 3ITEA 4QSHA 5ENDA 2CLDX 4B87A 1BWRA 1EIWA 1CDZA 2MSDB 1DS6A 1O96B 2B82A 3Q6NA 2LGJA 4L4UA 3NTVA 4JHXA 4WGFA 3G2KA 1GTMA 1L6RA 3EFBA 2NSLA 3M1YA 4LS3A 4KR9A 1M5RA 3PWKA 1EBBA 1H22A 4I4TB 3M3PA 4IXDA 4BLUA 1Z63A 1XROA 1F60A 3G9QA 3QXCA 4JZKA 1T3ZA 1T2CA 2C1XA 3AFMA 2J0UA 4D4KA 5AIAA 3SR0A 4TLEA 5IPFA 1DBPA 2MTBA 2PD6A 2W4IA 2A0UA 4JSRA 4DNPA 1NXSA 2VNIA 2Y1OA 5TPWB 3K9FC 3G2HA 4Q1AA 1YOVA 1YKSA 3K4PA 1WMBA 3N76A 3AQIA 4JUDX 4XUCA 3AV0B 4IY1A 4D79A 4BLOA 1KY2A 1QAQA 2J67A 3R2JA 4ZCRA 1ZW1A 3FJYA 3VGJA 1B6TA 1I0IA 4ND2A 1OLSA 4PYNA 2WTMA 4RLFA 3I9NA 5KDLA 4LVCA 1Q0HA 2CSUA 2VZ0A 3PDHA 1VBNA 2VQ3A 5F1OA 2ZJ7A 5ALTA 3HRIA 1C9EA 2OKCA 2I7TA 4ES6A 5CW2A 4DUGA 3VDMA 1O1YA 4O4LB 3FN4A 4EI7A 1KSJA 4YMGA 4WNIA 4XXHA 2I4OA 4NIMA 1C9KA 5GV7A 1YVRA 2RJOA 4I4TF 3C3DA 2DQ4A 5H5JA 1GTG1 3EF3A 4QATA 4BIMA 4AULA 4EMTA 4QBIA 1JLRA 1UMBA 4YBZA 5J4KA 3ZDEA 5F12A 2DFVA 3K9HA 4FYHA 1WB9A 1O6BA 2QIPA 3HCCA 3Q5GA 2XA1A 3JAMA 1RCUA 1EZZA 1U1GA 1U3GA 2QE6A 2HSEA 3HU2A 4N82A 3AR3A 1Z36A 4QTTB 4DCJA 1M8GA 2XBUA 1IK6A 3HEMA 4FFSA 3P32A 5KWIA 2HF7A 4B32A 3KQPA 1STOA 2HLPA 3CSUA 4Z4GA 4JGIA 3ZLTA 3TF5A 3V8MA 4JJIA 2WJ6A 2OECA 3K0CC 1XVAA 4L4YA 4ZODA 4PVCA 3VZSA 2MINA 2OMEA 1EM6A 2BH2A 3DAGA 4XIFA 4UNQA 3VYVA 5KB3A 2PMEA 1HMPA 2XZDA 2FW1A 3GQBB 1V47A 4R9SA 4DMRA 2AR0A 2AQKA 1K9SA 1OWPA 2WMNB 1GADO 3PEVA 3IODA 3NGMA 4IQ0A 4KSCA 4WK2B 3L8FA 2ONJA 1ETHA 1TVCA 2HBZA 2QLJA 3PT9A 4IVNA 3FB1A 1I10A 5C4IA 1IBCA 1Z6PA 1TK2A 4MS1A 2EFGA 4ND3A 1A8UA 1BRTA 3OLQA 2VRBA 4O4LF 6NULA 1VKZA 1Y4DE 2ZBQA 2WFLB 2PMFA 1PUJA 4I5GA 1D3AA 1UJNA 2JBAB 3AHDA 3EQ2A 1D2EA 4XQEA 2PTGA 4Y1EA 5JNLA 3Q8LA 2PS1A 3NBFA 1TVKA 3MB5A 3OZEA 2XE6A 3JCZA 3SBOA 2X5OA 1MP0A 1SKYB 3GYBA 4LXXA 4G07A 3CYFA 5AI4A 3EIHA 1CVLA 1AGRA 2A0FA 3QX8A 4KAAA 3CW9A 4TL9A 3T38A 1RIIA 1VMIA 3G9ZA 5EJIA 2AQ8A 3TB4A 5HW0A 1QQBA 1M6VA 1OASA 2XUJA 2YINC 4C06A 3EWIA 4H1VA 4CIYA 4E6PA 2UU9B 4AJHA 1NLZA 1X8KA 2M9MA 2QD5A 3QU4A 2R60A 1WHSA 3FDFA 4ME6A 4E5VA 5F98A 5I5EA 2AK3A 1ZH6A 2G77B 2LRHA 3N9IA 4X60A 3KU4A 3BGWA 2CGEA 3SBXA 3F49S 1XRPA 1YDGA 2VNHA 3TCXB 5AVSA 2JI9A 1CF4A 2P6RA 4G5FA 1V39A 5IASA 3RWOA 3Q5DA 1XHEA 3LI2A 1DQRA 1BA2A 3PR2B 1I3CA 2O0HA 4CMCA 2ODAA 1M2OA 1DFHA 2I33A 4UHJA 3TEJA 1QHSA 1XLTA 3IOBA 4I8XA 1GVHA 1CHNA 3RTEA 3FPEA 4RTPA 1YB6A 4M99A 3PD7A 1T6XA 4XB2A 3B8EA 1ZNYA 4BVBA 3GLQA 5CPFA 5DXFA 1E5QA 3PXUA 2Z2IA 3V6MA 3VVBA 3HB4X 1WUKS 2IUFA 3PLRA 2L82A 4HFJA 3H5IA 4EATA 3MWDB 1ZVQA 1JJIA 4C0WA 4WDRA 3CLRD 3LPMA 2PWYA 3ZGXA 2JPDA 1V7ZA 3A1EA 1QYRA 3EVTA 3BGDA 3DB2A 2N47A 3THWA 4KB5A 3DMNA 4I4NA 4F4IA 4WN9A 5K3DA 3IRUA 2BD0A 3AZOA 3JD2A 4BO4A 4OM8A 3ZE9A 3DV2A 1ACJA 1XRSB 2HPHA 4FK8A 4X20B 3JYHA 4TV8B 5LXTB 2Q1WA 4OBBA 1HEYA 4BFWA 4KMSA 3EAQA 1JWBB 3LCJA 4N8SA 2A5DA 1A9YA 4P0TA 3PNOA 2WFAA 3O4VA 1NXVA 3M7IA 4Q6BA 2YHUA 1MU0A 1X8XA 4Q39A 3AI1A 2AC7A 3S28A 4Y6GB 4OBWA 4YJKA 2VNKA 3N75A 3PBKA 5T4HA 4OHUA 1IWOA 1XTQA 1DKQA 4TZ0A 2M6KA 2Y0EA 1AN9A 1LQTA 3OCVA 3L2OB 1ZD1A 4EG6A 4NJEB 1HTTA 1SU4A 3FGNA 3UB3A 4INJA 4MIEA 1Z0ZA 2C94A 4HUJA 3Q6MA 1R4NB 1WCWA 4EF5A 4GKAA 1TZCA 1XBTA 4PBTA 1OYYA 3CO0S 3FSEA 3H1TA 2C8KA 5FULA 3WDKA 5K7SA 1SD2A 2GARA 3ZCVA 4E46A 5AIBA 1O89A 5JSZA 3AVWA 2Q49A 5ARDA 4ALIA 2JLVA 2ZVJA 3F2VA 4IZ6A 4Z9BA 3SZGA 3EYAA 2WJVA 3ZQUA 1PD1A 1THZA 3P2JA 5DGDA 3PQ2A 1JYEA 4TV8F 5LXTF 4QTUB 2WWXA 3VC2A 1N3LA 5B6PA 4Y9DA 4LEIA 5BXQC 2LUOA 3O82A 4ZCPA 3EXEA 5F2KA 1V37A 2AE1A 2E0IA 4C2AA 1N2GA 3LY5A 1CRZA 3WIUA 4R31A 4QWMA 1O87A 5SZJA 5KYKA 4WCDA 2XD4A 2UYQA 4HAZA 3BA6A 4M9QA 4ZIRA 1VFNA 1NW4A 2DPLA 2QIOA 5J2TA 1CNMA 3ICPA 4TRJA 1ABFA 4GLBA 3ROKA 3A58B 1SXPA 3GLGE 2IUYA 3I39X 2B37A 3P9IA 2EU8A 2IEIA 3RTCA 5KINB 3DLPX 1MDFA 4F6CA 3SYKA 1GQRA 3MLEA 3PKZA 1FBNA 3DC2A 1HR0B 1EH5A 4I1OA 4CQLA 1Y4UA 4MW0A 1JWLA 2NADA 3RREA 1HXHA 4ZI7F 2ZTSA 5HRCA 5CNMA 3CF2A 2ZRLA 5ERGB 5A0TA 3THYA 2QQGA 4EVSA 1WXHA 1ZHOA 5BMVA 4RKFA 4DV5B 1GRVA 3T1YB 4G3XA 3ZD9A 4IS3A 2GVZC 4AO7A 1DAIA 5FPKA 3G0CA 3WZMA 4N8DA 3E1KA 1J07A 1SJ9A 4KG7A 3FFTA 4XM1A 1TK3A 2NSJA 5TT1A 4PC2A 1WXFA 1CD5A 1JR3D 3LUJA 2BFBA 2IYFA 3BDIA 4BU1A 1KYIA 3T9FA 2BFEB 3U09A 3D8SA 3QOFA 4J9UE 2WF9A 1E2NA 1W4AA 5CTAA 3BKWA 3OZSA 3UK6A 4U2GA 3VZQA 5KSOA 3MGCA 1UZNA 2PNFA 3LDFA 4PXYA 4AN4A 3PYMA 3FTNA 3S1AB 3AUSA 3DKRA 1EX7A 2YMQA 2X22A 3COWA 3GGDA 3L1JA 1H2YA 1T35A 3KLOA 1RI4A 4GLFA 3PCTA 1YB7A 2X86A 3VSBA 4M86A 4RSRA 3RUEA 2VSOA 1XAGA 3MJVA 1L0BA 4Y9RA 5A06A 1P2VA 1Y8RA 3KOZA 1GKLA 2AI2A 4MULA 2HK8A 4BCBA 3PHIA 3E53A 1W7AA 2ZBFA 1N6LA 2G9RA 2VJAA 2X2EA 2WP8J 3DZHA 3LZDA 3OKFA 3RFUA 2AZ4A 1SUDA 3MQFA 2BHTA 2R7NA 3A9WA 1M7HA 4AY6A 1E7MA 3O0DA 2E4XA 4MI9A 2WU8A 1L1FA 1V8OA 4RKWA 1MGPA 2CUNA 3JS5A 3K09A 4NONA 1WW8A 3V1NA 4FCWA 4BNXA 1BCSB 2AFIA 1ZPDA 3O1JC 5HVNA 2DEUA 4OREX 2ETXA 3GOHA 4QRIA 1NQWA 4HAOA 4MTLA 1RYBA 1O0SA 5CPBA 3Q11A 2I7DA 2YWDA 5ALJA 4A36A 3KXKA 3ZJTA 2GEBA 1GDDA 5TVKA 5A2QA 1E8MA 1SCNE 2XUKA 3IP1A 1GR0A 1ZGJA 2QT0A 2C4KA 3EEIA 4R7TA 5JI3E 1ZH8A 2RHBA 2ZBRA 3CQ9A 3OURA 4I1VA 2NGRA 3MGGA 4RENA 4CEJB 2O8FA 3MS7A 3P2EA 3GNSA 3JQBA 1V5FA 2X0KA 4NABA 4LFCB 3ANLA 1TFUA 1E1CB 4ZT2A 2GD2A 3G89A 4XEUA 4BO9A 3J7TA 2VJPA 3OT1B 5CJPA 3VZRA 2I65A 4Y1RA 3RBXA 2I6XA 1L5FA 9GPBA 1IOWA 1PR0A 3HBJA 1PWEA 1FS5A 4GRIA 4Z8XA 2L2QA 3G8BA 1ODKA 3I1YA 2XECA 2QDKA 4NFHA 4N47A 4MKZA 3WV4A 1DEOA 2KB0A 4DWJA 5K0GA 1QGED 1BKDR 1HC7A 3JTEA 4R05A 2XDYA 5J59A 4C3OB 1G64A 2EJWA 2C2GA 4FFPA 3KT6A 1MJFA 1DAHA 3GY0A 1YZTA 3I73A 3OO0A 4KN5A 2X9QA 3E0QA 4KX5A 1H2FA 3KV3O 4OVKA 5K8LA 2QN1A 1HDCA 1JEEA 3DE5X 1KEUA 3ELYA 3OBBA 1R6BX 4BYGA 1U04A 3I01A 1AS3A 2CNOA 4D4MA 2CHQA 5CX4A 4D4LA 3X0DA 1X1SA 2ZT5A 1H85A 1MVOA 1QFSA 3ESAA 1VI2A 3IAS1 4HG2A 4OK5A 4WZBB 3TNJA 5HKAA 2ECFA 5T7BA 3IAAA 1QFMA 4RGYA 4WV3A 4B35A 4E5DA 4TWZA 4Q4JA 3C7TA 5F3DA 2QRLA 5H70A 1WABA 3C3BA 2Q6IA 4MHSA 1XZGA 3IOMA 1G2QA 1NJFA 3QPUA 2PWAA 5IARA 1V7QA 1NF8A 4X97A 2E9SA 3EQZA 2QTWB 3LP5A 1VJDA 1X74A 4IH4A 3DAYA 1EXMA 1XZJA 4HMOA 3FTDA 4N4AA 3V4SA 2CFCA 4L78A 3T12A 1A82A 1LF0A 1L8AA 5K0TA 2VZ9A 1XRRA 1LCIA 5B37A 2RGAA 3JD4A 4JWKA 3SOPA 3V1KA 3N2IA 1VLLA 4N8EA 4Y6SA 4WBNA 3KXDA 4J4HA 1QDUA 3X1XA 4EGQA 5G4KB 2WPDA 3ZTTA 2C9YA 3OPMA 2CC2A 1KRXA 2WINI 3M2PA 1WSWA 3NRCA 4QO7A 4JIMA 2GM4A 3ZVNA 1FDUA 4QFDA 2JLUA 2JHPA 3A3PA 1Z6QA 2OHJA 2UUAB 2ID7A 3HU3A 4ABTA 4FR2A 3F6CA 2A3NA 3WYAA 2YWJA 5CXQA 1YD7A 5JAUA 1U0NA 2PUWA 3GGJA 4D8XA 1GA6A 1EFKA 4RVGA 3O1LA 2XMPA 4C78A 1SXGA 2X1HA 2W2KB 2XT0A 5KQSA 4Q7QA 1I2BA 2Q1YA 2QY9A 2IH5A 1M2NA 3QX9A 4MTCA 4P4UA 3P7MA 1CX9B 4E3ZA 1XF1A 3PHHA 4JLPA 3JATB 5C1IA 5IK2D 3RC8A 3AERA 2UXBB 3UPUA 1NG1A 2HAEA 2C4WA 1J4AA 2QVYX 3LHKA 3MQ2A 5JISA 5JQGB 5DK4A 1ZD9A 4V0SA 2H92A 3CRVA 4P0PB 1Y1RA 1VE3A 5ER9A 2FRDA 3SBDA 1UKCA 4BLVA 3HDGA 1TT5A 4F84A 2XVXA 2BTEA 3BFVA 1E4VA 1GQSA 1QE0A 2G08A 2BONA 3EF1A 3WLAA 4EY4A 1BDHA 5K3FA 4KYTA 4L6CA 1W6RA 1G9TA 2WJ4A 4LZPA 3HB7A 5B1DA 4EPVA 5B12A 3KEGA 4R2IA 5I7EA 2IW3A 2ZRJA 2R6AA 4DA4A 3E22B 3S44A 4FYWA 3MOIA 4PTYA 3WLTA 5JHGB 2FDXA 2WTNA 3HHPA 2QMZA 4NX2A 4F2HA 2FGKA 3FF4A 2ZUFA 3ZJUA 1UADA 4OK6A 5J23A 2CNWA 4A91A 5J4VA 3OPQA 3KVOA 4WLEA 3GI1A 1V2GA 3QMWA 5HKBA 2GF2A 2O06A 2C2YA 5HF5A 1SB9A 2O7SA 3ANSA 3KOYA 3BMCB 3LA8A 5BSRA 4XASA 1DSSG 2C7BA 2DPHA 2FW0A 3DL2A 3QVTA 5EP1A 2A5FA 3LDAA 4W8HA 2JZOA 1QOPB 1E69A 2RHWA 1TADA 4R6WA 1K8ZB 1IOLA 2VAWA 2L17A 1TLTA 1TO1E 2P79A 3KQOA 1ODSA 3R3VA 4X0EA 5CVCA 3H2GA 2FW6A 3AJDA 4IVQA 5A4KA 2GX6A 5LU9A 3GRVA 4Q24A 1IDN1 4LV6A 4OU5A 1U2PA 3E2IA 2CN1A 2ZB4A 4RH3A 4Q7LA 3R3JA 4CHTA 1OILA 2J9GA 1G8FA 2W42A 1RWVA 3WQRA 1NXPA 3TBFA 1KEKA 3K0FB 4UBIA 2ZAOA 3LYUA 4Y2TA 3D2AA 3R7WB 3RAJA 4BMDA 4KIUA 5J2UA 4EY6A 1XCGB 1KO8A 3GCXA 1R5JA 5AFSA 1A1SA 4HNQA 1E2JA 5J5VA 4ZVTA 5JPDA 3PQ3A 3WLNA 4XJXA 1SU8A 5FI1B 3KWJA 5H82A 4YRZA 1PHPA 1Z16A 1C9NA 1KAOA 1YDFA 1NUUA 2V4ZA 4TVOA 4XVHA 3EGOA 4OI1A 4DTIA 4L6AA 1B4DA 5CM9C 1DQNA 1VYTA 1T0HB 2Q6KA 1OZ0A 1SOUA 3EVAA 1NPDA 5DRYA 2B5VA 3R3YA 4NFLA 4CFZA 4MVJH 5FI3A 4NY1A 4Q34A 3TN7A 4I81A 4FCTA 3DBRA 3LY9A 5AW3A 4XVUA 3D8UA 5EE3A 5H1YA 1JR4A 1EUDB 1KNXA 1H6DA 5K3CA 2C95A 1U8YA 2Q3DA 4CUJA 3MF4A 5HZKA 2X1VA 1TUEA 2PX8A 3KQWA 3KVRA 2VUTA 3BFJA 3TRFA 2I29A 1C9JA 2OZPA 4X00A 2H1FA 3QG1A 5FFFA 1PTJA 3H18A 3HWSA 4OG2A 1MO3A 4Q3CA 4G0QA 2ZUEA 2I71A 1V3VA 2PUHA 5AVQA 1FP2A 2I8AA 1GPBA 2M2IA 2QRMA 5AK6A 2Q5HA 3VTAA 3NHAA 4LISA 3GH1A 4Z7OB 3DHVA 4WK4B 1OUMA 2GVDC 3G2OA 2MMCA 2J45A 3BE8A 1W9HA 3CLHA 1XCMA 5KZMB 1ECFA 3QIVA 1R9MA 1FSFA 4KQ9A 2HEGA 1GLGA 1Y48E 1Y0BA 1ZK4A 1FMCA 2PN1A 4M55A 4DNXA 1FTGA 3HDVA 1AE1A 1XMIA 3EW7A 5BYKA 3RABA 3H3XA 4GKJB 3CZ4A 1A4IA 2C4MA 2NUAB 1J6UA 1WB4A 1DO0A 1IAQA 3RV4A 1SD5A 4YCSA 3AKYA 2B61A 3AM5A 1J0XO 2G70A 2J1LA 1XZBA 4ZYLA 2GNPA 3EVBA 3LGAA 4HWTA 1GAQA 1W1UA 2AEFA 1QX4A 4EUFA 4CV3A 2HCBA 3HPQA 1C7FA 1FSSA 1JSRA 2OK7A 4DJEC 1JJ7A 3ZU6A 3IMKA 2JHFA 4IIYA 3VISA 5BO5A 4CLOB 5BVGB 3NHKA 1Z0IA 2C78A 3HUEA 4J0KA 3UM9A 5HJ7A 1F51E 1UC8A 4N5HX 821PA 1X7GA 2XZOA 2ZQZA 5HRAA 2FPKA 4G24A 2ZIXA 1QRTA 4EL0A 5BQFA 4MWZA 1E4YA 1PFUA 3B3JA 3DT6A 2QBYB 4B4VA 5E6SB 4CF7A 1BWSA 2QJWA 3AWIA 2X6TA 3GA7A 4M0CA 1RPTA 3BXZA 5DYYA 5IW8A 3IAHA 5I7HA 2P30A 1I5OA 1WY5A 3H75A 1FDOA 4K1XA 1DOAA 4U3JB 3RAEC 1YZHA 4OM7A 4XFDA 1QUEA 2VUUA 1A77A 3PNPA 1QNLA 2J87A 2XF2A 4Q66C 1DKMA 3ID6C 4BZZA 2NT4A 2PT9A 2ZDHA 5BN1A 2Q5IA 1DBQA 4XSHA 4U7PB 3TSYA 2IUSA 4WA8A 4MQ5A 2YFKA 2IS2A 2W6MA 4MS4B 4OAQA 3LT2A 4UASA 1F7UA 1OAAA 2R3SA 3LGXA 1Q1EA 2J3QA 2ZCJA 1FLVA 1G20B 1VPLA 2YWFA 4EAQA 1E0AA 5BQ3A 2CVOA 1K2WA 1VCIA 3OQIB 1I14A 4MLPA 5AK0A 1T8TA 4OUKX 3RSSA 4TTVA 3U4AA 4BJ5A 3ZIUA 5JYDA 1GQYA 2RI1A 3AHFA 5KX5B 4JYMA 2X3UA 4BO0A 1W4CA 4UUAA 3EZLA 3RHFA 1EVZA 3F6SA 1Y1PA 2ORWA 2P8SA 2UZAA 4LYDA 3G1TA 3WX0A 4CMIB 2WIJA 4H59A 1XDSA 3W7VA 2PIDA 4KO3S 5BN3A 1W5AA 1O95A 1SR8A 4BVKA 1KIAA 3WFIA 4UZFA 3GW8A 3CR7A 3GNLA 4YWJA 2QX4A 2QI9C 3ZWVA 4D9FA 4TXNA 3D81A 5EI5A 3OJ0A 3A4LA 2EZ9A 1BQ3A 1A76A 2WHXA 3RG8A 3UOWA 3LW8A 2L69A 3HCFA 4HMQA 4RESA 3EUAA 4UBNA 2FJ0A 1K68A 1O96A 1KC3A 3JQEA 4S12A 1VKNA 5E2BA 4C4SA 4DTCA 1M1UA 3OF3A 5IUJC 3JTMA 2D0OB 2ZJYA 2OBNA 3VKVA 5BUSA 2KW5A 2W2TA 2GAJA 3P45A 1RYNA 2H52A 3OQHA 4I4TA 2IX3A 4RIHA 4XYLA 5DCUA 5AOCA 2UKDA 4NOJA 4PRZA 4BEVA 4BZQA 4DUGD 1II8B 3LXRA 621PA 5KOJB 3GLIB 1ES9A 3LH5A 3VR6H 1QGYA 2CFTA 3KFXA 4WOPA 4V3BA 1XU9A 1HG0A 2X0EA 1YRBA 2HJVA 1KPIA 5KX5F 1R0KA 3N0RA 1AA6A 4YP9A 3SQNA 1NDQA 3HXQA 5I47A 2R1ZA 1UMCA 1E98A 2WNHA 3H84A 4QFCA 5EKSA 4DSAA 2VBFA 4X65B 2R751 3ULKA 1GNTA 5IVKA 1Y7HA 3IDQA 1Q17A 3USES 1D2CA 1QP0A 4NZZA 2VRCD 1XZQA 1BDJA 2J07A 5J43A 2O5CA 1E0KA 1Y6QA 4FSDA 4MWOA 4YN3A 3SFTA 3SVTA 2OORA 4OKNA 3FOFC 3HL0A 4KGVA 5SZHB 5K6AA 1SVWA 1P3DA 4O4LA 3H2BA 4QXQA 4Q16A 1T5OA 4I19A 2IYQA 5TGDA 4XGIA 1KY5A 4QGSA 3KVNA 4BWGA 1ZGBA 1YMUA 3TVTA 2QTFA 2WYWA 3C4QA 3M83A 4GQAA 3K70C 1DBIA 4JU9A 3L79A 1MRSA 5I4BA 3VGPA 1V41E 1CUCA 5B55A 1NN1A 4P5DA 1EG7A 4QDUA 1MJGM 1ZUWA 4HSGA 4MWDA 4WFKA 4C7JA 3QJGA 1ZCAA 5IXSA 2Q45A 5A4IS 1IHDA 4EL5A 3QSGA 1BFUA 4JX9A 2PVSA 2HMUA 3GJSA 4V03A 2PUGA 3CZAA 1XQVA 4ZYZA 4A10A 3HYSA 1Y9EA 3VSDA 2VDMB 4RFSB 1NN0A 3WY9A 3U4MA 4X66B 1FTSA 1ZXXA 1K27A 3W2GA 4WXPA 1V6CA 4L4XA 5FPHA 4G5OA 1YL5A 2PSHA 3DC7A 1I4OA 3D8RA 1YONA 3BIJA 3QLTA 4WCFB 3KE8A 5HKKA 5HCUA 3KXLA 3NHBA 4JJAA 5D3KA 2O8EB 2G88A 1ZISA 1ZSNA 3JYQA 2P9QA 2YY7A 3MAAC 4G0ZA 5H9WA 3X3HA 4PWYA 3P96A 4P92A 1G1MA 4DVGA 2VHZA 1GZ5A 5C0OE 5IHXA 1MZPA 3WNQA 4RIEA 1W85B 4OMUA 5A7GA 4R8KA 2WICA 3T4UA 2YDYA 3W2IA 4GZ3A 5HE9A 3AHCA 1FJXA 3WB9A 1N3BA 4EY3A 3V4RA 4D98A 5AK4A 4ENPA 2V9CA 1FP4B 3LFHA 5IRCD 2A9FA 3R5JA 5J5CA 1KQFA 4I6JA 4LPKA 1B3RA 2EBHX 4CZ2A 3BAZA 2WWTA 4YACA 5KTRA 4FHCA 4JQYA 3MG9A 5FA6A 5ICFA 3BMOB 2QSZA 1Z2PX 4BNDA 1E1YA 1KERA 4KDRA 4BE4A 2ZI5A 2DRIA 5FA8A 5FTKA 3DYVA 2IFTA 3RAPR 1AU9A 3GLRA 4LY9A 2ZAMA 1R50A 1IHOA 3FYUA 2OHOA 3WISA 1DFGA 1OPRA 4YP5A 3TFWA 1XLUA 4FCVA 1ECLA 3FMOB 4RZHA 3FVWA 5NULA 3U7QB 4AF6A 1CKEA 3FZGA 2IDMA 4PX5A 2HF2A 4MROA 3P9XA 3IS3A 1PDVA 3QBVA 4YGYA 1DC7A 1ODIA 1Y5MA 5K4GA 4PO3X 2K6GA 3TBHA 1I5EA 3GR6A 1BKSB 3VKUA 4N1AA 1ZM4A 4EEKA 2VDUE 2A0WA 3UJ8A 4BCCA 3AESA 4EG1A 4J90A 4CUKA 2Y77A 4KK4A 3LBHA 3W1VA 1Q57A 2WD9A 5ALXA 3FR8A 5ALZA 4HGYA 3M6UA 3OQVA 4PRKA 4B8YA 4YV0A 4D26A 1KI8A 1G3RA 1NHWA 3BFPA 1TC1A 4KR0A 3CZ9A 1SG9A 2QORA 3DBHB 4OUDB 4PNPA 1E9FA 3TLZA 1GXSA 1CDOA 1J09A 1CUAA 1FX0A 3ABIA 1UAAA 3GBPA 3PQCA 5CFMA 1KR2A 1KDPA 1A9ZA 1PT6A 1IU9A 2P69A 1NL3A 2XYHA 3AR8A 3CZPA 2WY2D 3O4RA 1U8CB 2J9XB 1EDDA 2ZB2A 3DOFA 4LJ5A 3Q2KA 4LGYA 4ILKA 1G8JA 1KI1A 3SHOA 1JP7A 2XEXA 1KU6A 2CUKA 2XAUA 5K99A 1ZUNA 3U16A 2C2HA 1IULA 2GEJA 4G2NA 4LYYA 4P4LA 2GRJA 1Q0LA 2O4UX 1R18A 2PUTA 3LLMA 2VATA 4QEDA 1CUZA 2G1KA 1UDRA 1Z4MA 2HL6A 4GI7A 4OV6B 1JLSA 4FEAA 4G63A 3QU5A 4HQ0A 4UBMA 1G8PA 1H9BA 3DYIA 1RKXA 3WHKA 4R1QA 3CVOA 1QIFA 1A9XA 2C57A 1W59A 2HJGA 2O2SA 4FOTA 1X2EA 1NURA 5CG1A 3V1YA 3L8EA 3COPA 5A5DA 1CR1A 3NTUA 4ZOEA 2DSTA 5IABA 4DCSA 2OFXA 3OQJA 1FMLA 2CFSA 4NCBA 3AY6A 2J7PA 2ZSIA 2BBOA 1VCMA 3PKIA 3TUJC 4OH1A 1PR3A 1R4NA 1E59A 1B76A 3VR3D 4ABYA 4EJSB 1K88A 1Z4KA 1K4KA 1FC0A 3EPJA 2P4QA 2OB1A 3O9VA 4ZI7A 1P1HA 1WWKA 2MU1A 3O9MA 1NF3A 3VKGA 3OOWA 2XWSA 3OEEA 2IY7A 3Q85A 4V24A 1E32A 4XJVA 5ED0A 2ZG6A 4BNTA 2Y1FA 3BSFA 2H85A 2B25A 3KG2A 4UDNA 5JO0A 5SZKB 3I6QA 3PNSA 3D1LA 1CZUA 2G3YA 5IJAA 4CKEB 4IMRA 1H3FA 5GV8A 2PUBA 1S8FA 4Q9KA 3H16A 1GGKA 5MFZA 1KAHA 2JFGA 3TQCA 4H0NA 5G4LA 4W4TA 2VOEA 1GZ4A 4B6EA 4CRWB 1DEAA 5K8IA 2CZGA 1AKWA 1N5JA 2XOKA 4AY2A 5BRNA 4FQ7A 4XX0B 1Q7TA 4B8ZA 4GYKA 4FFLA 3SZRA 4EK9A 2PUCA 1OXMA 3RVPA 3ONDA 5AHWA 1Y3HA 4YFYA 3U6KA 5DX1A 2DBQA 2FPIB 2J9ZB 2WG1A 2ZRNA 5E8JA 5FHRA 2MMGA 5CX1B 1D04A 2C07A 2EAUA 2FSSA 2A84A 1U3CA 3KQYA 4OU4A 4YALA 1ZD3A 4FW9A 4QBHA 3TI7A 3DHEA 4K28A 4K46A 1VKJA 3K71B 3AG6A 2CJFA 4BX0A 2PNJA 1XU4A 5L3SB 4CWAA 2GCIA 5AJWA 4PAQA 4KNYA 4BRZA 3QE0A 4CKBA 4JHLA 3PSAA 2HB6A 2IZ0A 2NOAA 1NUHA 1FNCA 1U4NA 2PRZA 2YCBA 3KL2A 5FTLA 3HK2A 4TXHA 3KFLA 4Q9IA 5LB2A 5F2OA 5F3WB 1NVGA 3DTVB 4G0PA 3BMQB 2VPQA 4LJLA 5FUYA 1CEYA 1P31A 2XMSA 5CIYA 4BO2A 3OFSA 2Q8NA 2AZDA 1SVUA 4XSGA 3K92A 4N01A 3KB8A 2HK7A 5BQ5A 1B6RA 2BFEA 3O4HA 1PLLA 2GETA 8ADHA 4PHFA 4IVPA 4HS9A 4F1WA 5BNTA 2Q1XA 2P11A 4UHHA 1LGYA 2VPWA 4L95C 2GJ8A 3T5GA 4CI0B 1S2DA 1E3TA 3U7JA 4GWKA 1QZXA 3AEKB 4WN3A 1WLSA 3PTZA 3PPIA 3HA3A 3S1AA 1C30A 1HDGO 3HN2A 3HBLA 3T7TA 2NLOA 1USKA 1ZITA 3NXSA 4KIWA 4ZCSA 5BWCA 2GHIA 4IM7A 3ZWQA 2VDRB 4LC9A 1BMDA 1DWUA 4RMIA 5JI2E 1SQ5A 2JLYA 3QKWA 5C7IO 3BIOA 1X0XA 4TMTA 3T3GA 2BJVA 3SN6A 2F8LA 1G6KA 2L19A 1OFHA 2PRKA 2XUZA 3EF0A 1QHFA 4FUQA 4A8JA 5A02A 4LWOA 2V3VA 3V8BA 1WDTA 4BE7B 4F3KA 2XSZA 2FMUA 3H87A 4E2WA 1I7SB 4JNCA 3UJ9A 4N3BA 3CONA 5KTPA 4DGQA 1THMA 3EA0A 4OD0A 3ND7A 4ACAA 1ZK2A 1XZAA 3W78A 2WQ7A 1BCSA 1OE0A 1VL8A 3CPHA 1IN7A 3SIXA 5EIFA 2R97A 3K53A 3RRXA 3C8DA 4P22A 3SHWA 3W5SA 3WYNA 4HSEA 1R0CA 1HT1E 4LXGA 1FJ2A 1T91A 2MWMA 4LSZA 1L3IA 3TR5A 4FINA 1HYQA 5HCNA 1BVYF 1LI4A 3O2QB 3PC8C 4TM7A 3S8YA 3FLMA 5IYZB 2B4TO 1AHIA 3GBSA 4XPIA 3UGTA 1XZCA 3ILSA 4Y7CA 1KFEB 1LBHA 4EA8A 2IKSA 4OQQA 4F86A 4RYLA 2JAXA 4ZHSA 1V95A 4L02A 2BMEA 5TVGA 3NC4A 1T6YA 3GQVA 2PUAA 3ZGZA 2VNAA 1EQAA 2YWEA 1NKSA 2HDHA 4E12A 3QY0A 5K0EA 4FT4A 1DBSA 1CY2A 1O5OA 5H3HA 1FJGB 3IULA 1EYZA 3D6AA 4CM8B 2GZ1A 1BEUB 1XZFA 2P5YA 3RUDA 3B7PA 3QTLA 2AR7A 3WMFA 4S1TA 2PXCA 4ZVLA 1U28A 3CXUA 1PV2A 1XMXA 4KNWA 4YCAA 5DW0A 2H3HA 5J40A 4ZZ3A 4DDVA 2IDZA 2ODBA 1J1ZA 2JFPA 2VP5A 5I6DA 2QM3A 3WLSA 2BEUB 4EHAA 1GZ6A 4WFQA 4KR3A 1PJZA 1DJPA 1V8BA 2UUPA 2X7JA 3LNTA 4OY3A 5F1KA 1B93A 2EV9A 3A36A 3OJLA 5L7WA 1SXJC 1UBSB 2WPDD 3QI2A 4OQYA 2XCSB 4B6OA 2I9KA 4WZBA 5IYZF 2WTBA 3AG5A 4MKGA 5TF4A 3J80A 3NJ4A 2KE5A 2A1TS 5E4YA 1IZ7A 4IQGA 2QRJA 3IMFA 5TNXA 4EHDA 3MBOA 4NE7A 1ZEMA 4OHXA 4QODA 1K2VN 1E7YA 2E18A 4E51A 1WZIA 4X7BA 3GN2A 3INGA 4Z1MA 2IYXA 3QELB 2RAFA 5K09A 2HIHA 4ZICA 4OXKA 3HU1A 4NKRA 3ROZA 1XQYA 4R8SA 3VU1A 5H8WA 1EVIA 1XMVA 4M1KA 1SHUX 2A7XA 4L5YA 5E6UB 4LY3A 4MVJI 1X80B 4PZEA 2FMHA 1WPXA 1AUVA 5C35A 1TDJA 1NG9A 4QBFA 2DHCA 4A27A 5DMXA 1XT6A 1JJBA 1CQWA 3N53A 5G4KA 4Y2HA 3T5PA 1GUBA 4G9BA 1CPYA 2LCFA 2WU3A 2FW8A 3A8TA 1XEXB 5EE9A 1QPZA 5AVVA 4LK3A 2J33A 5HEKA 2GN4A 4TV9B 4TWRA 3WGYA 4E7PA 1RJGA 1L5LA 3A1CA 3HZZA 2O8NA 3R9WA 1ZC3A 1Q3HA 4FM9A 3P71T 3VPGA 5A0FA 4CEHA 3ELWA 2DAPA 2QRGA 1WY7A 2BTOA 3E3OA 1WQ4A 3Q3IA 4GVLA 4HTFB 1V1RB 4IJMA 4IZIA 4C3UA 5BQXA 3WVNA 1OXKB 2BGJA 4IOLA 2IX9A 3ZQ4A 3U0BA 4WXEA 2W2KA 3IE0A 5KYUB 2GPJA 1PWXA 3ONEA 3R5SA 1OTYA 4PNZA 4RYDA 4X62B 3RDPA 1KJ8A 5F7OA 2NQTA 1GITA 3BH0A 2CNWD 4QEKA 5LLSA 1FRNA 3T06B 4OX9Y 4QQNA 4GI3A 1H1LB 3JYLA 3C8HA 3GPDG 3RS9A 5TQ0A 1PYGA 1V5WA 1T8YA 1VRWA 4RLSA 4UHBA 1GT91 1PR2A 3H2JA 3DJFA 4LNUA 2ZJFA 1NMZA 3TLYA 3RFCA 2IYOA 3D3QA 3OQNA 3UFXA 1P1BA 2NU6B 4P33A 4QU0A 5TF0A 4BBPA 5C8DA 3JQAB 1UAGA 3T7KA 1S4QA 2ZDGA 3GLKA 3JWGA 3QGMA 4XA8A 4AW9A 5K05A 2NUBA 2F1HA 2Q1SA 2YXDA 2Z3ZA 5D3ZA 1TGYA 4KUEA 5IAJA 3EUWA 3K9GA 2I8LA 3E22A 3IUPA 2V1UA 2QOEA 4HWGA 5KSPA 1QXSA 4DDKA 3WGUA 3DZFA 2ARKA 1Y9AA 3DCIA 5KDOA 4Z3DA 4JAVC 3BCRA 1CY8A 1TKBA 2CDCA 4IMJB 2R7MA 1DXYA 3K1JA 1D5WA 2FUG1 1V3TA 3LFTA 3E27A 3B13B 5D3MA 1U8TA 3S5UA 1G7CA 2RKWA 4D9CA 5BSVA 4L2IA 4TMWA 3AR6A 4ZRMA 3BMCA 1X3LA 1CFJA 4YAGA 2WVJA 1N78A 1JECA 1KK3A 2OV2A 1XEFA 3MMPA 4N5LA 5DHUA 2HLHA 1NMQA 1HL3A 1DWPA 3GEGA 3K5WA 1E77A 2NPFA 1OWMA 3DV0B 4ZXPA 1TYDE 2VBIA 3NH9A 4EHBA 1N2CE 3W4KA 2VHUA 1CF9A 3QXSA 4C1NA 3BWVA 2WU0A 2LKCA 4XYEA 1T3LA 2OP0A 1J23A 2DG2A 3WGTA 3HYCA 2JIOA 4YAFA 2AD1A 2JA1A 3VO2A 2YYAA 4TZTA 3BRSA 3VZPA 5FT9A 1UIMA 3FZYA 2D2VA 5ELLA 3R7WA 2I91A 4PVDA 3W7AA 3DVRX 4KH1A 4QELA 3NEPX 3VYRB 5MN5A 2H59A 1GTRA 4R1PA 4EO9A 3MWJA 4GOJA 3IIJA 4XR4A 5A9SA 5HYVA 4WLOA 3GFFA 5ALKA 2YV3A 5HX7A 1VLZA 1D5CA 4OHYA 3NS7A 3DVSX 1WDLA 1RXEA 3L1IA 1A7AA 3F1KA 2DR3A 1PFYA 1N7HA 4JJ8A 1Z2CA 5EWLA 2WYOA 5B2ZA 1MABA 5BY2A 4NSNA 2Y0DA 2YZ7A 3NV9A 3CV3A 3GL9A 2QSUA 1OQAA 2P4SA 3FOBA 2CBGA 5CFNA 3WRWA 3WLMA 4GZ6A 5SYAA 3DWGA 4JQZA 2EDAA 4K8RB 1JEAA 4ML3A 1KVSA 1U9CA 5G2OA 2F7SA 4N48A 1WDMA 2NXJA 3KZXA 3V1UA 2FA9A 2WUGA 4LWPA 1KA9H 2VKTA 3GVHA 5D85A 4ZZ2A 1JHPA 1LLUA 1P19A 1JE1A 1RAFA 3JQGA 3R09A 4GQBA 2DPXA 1ADFA 3ILVA 3RSQA 1D0IA 2VT7A 2JF0A 3C5WP 4MQUA 2HGSA 4ZQGA 3V9AA 4YI5A 5IH3A 2X9GA 3IUEA 3HUFA 3RT7A 2O8BB 1DAEA 4BNUA 5KTTA 5LDDC 4ZWNA 3AR7A 1X1DA 1KDYA 5FWYA 1CRLA 2OGTA 1I4TD 2QN8A 1X2BA 3EFOB 8OHMA 4Z7QB 1XJ0A 1L5RA 1CYEA