2ZJ3A

Isomerase domain of human glucose:fructose-6-phosphate amidotransferase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
b'MKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine--fructose-6-phosphate aminotransferase [isomeriz
molecule tags Transferase
source organism Homo sapiens
publication title Structural analysis of human glutamine:fructose-6-phosphate amidotransferase, a key regulator in type 2 diabetes
pubmed doi rcsb
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A02
3BCHA 4KHPB 1M3SA 3Q88A 4DR2B 1C7QA 1KOJA 2DECA 4U6NA 1WIWA 4JI0B 4JI6B 4B3TB 3LJKA 2VQFB 2F4VB 3HJBA 1DQRA 3KNZA 2E5LB 4LF8B 1X92A 1XMOB 2AMLA 1HR0B 2I2WA 2O2DA 2DF8A 1GZVA 1HM5A 4TOIA 1U0FA 2E5FA 4DV5B 2CXSA 3CVJA 2UXDB 2PUVA 4JV5B 1X9HA 1VI5A 2I22A 3OOJA 2A3NA 1HNXB 1XNRB 4B3RB 4LFBB 4DV4B 4LF9B 4LF7B 1HOXA 3NBUA 3M5PA 4JI3B 4JI5B 4DV0B 2YVAA 4JI4B 5LL6P 4X66B 2VF4X 2PUTA 4LFCB 1IBKB 3Q7IA 1VIVA 4EM6A 3OTOB 4GKKB 2CXUA 2UUAB 4AQYB 1J5XA 4K0KB 3TBFA 1FJGB 1TK9A 4LZJA 2CXOA 1X94A 4DV2B 1X9IA 2CXRA 3T1HB 5BR8B 4JYAB 1MORA 2UXBB 1TZBA 2CXQA 2J6HA 1N34B 2UXCB 3HBAA 4X62B 4X65B 1C7RA 4DUYB 3T1YB 4M0DA 4JI8B 4NXNB 4AMVA 1N36B 1G98A 5IWAB 3C3JA 4DV6B 4JI7B 4LF4B 3JX9A 1N32B 1VI6A 4DR3B 5I01A 5A2QA 3J81A 1U0GA 1XMQB 2Q8NA 4LF6B 2UU9B 3FKJA 1Q50A 3I0ZA 4JI1B 1U0EA 3BJZA 2CXTA 3FF1A 5FLXA 4DR1B 2UUCB 2VF5X 1IBLB 2CVPA 4DUZB 2ZJ3A 2XHZA 4DR7B 1MOQA 4S1WA 2V4MA 3UJHA 5IT9A 4B3MB 5LMNB 1MOSA 3QKIA 3ODPA 5BY2A 2CXPA 3EUAA 4DV3B 2XBLA 2PUWA 4DR4B 4YY3B 3FJ1A 1XNQB 1HNZB 1NUHA 1HNWB 4OX9B 1NRIA 2VQEB 4DR5B 1I94B 4DR6B 3FXAA 4NXMB 4S12A 2UUBB 1JEOA 1VIMA 4DV1B 1T10A 2CB0A 1GZDA 4JI2B 1B0ZA 4GKJB 1JXAA 3JAMA 1IBMB 2ZM6B 1J5EB 4LFAB 2HHHB 1XTBA 4LF5B 1N33B 3TRJA 1IATA 1IRIA 2PGIA 3ETNA 3PR3A 3J80A 2WU8A 1N8TA 2O2CA 1JIQA 3J7AC 2CXNA 3G68A 5LMUB 4X64B 4YHHB 1TZCA 4B3SB 1JLHA 2ZJ4A 1ZZGA 2X3YA 4DV7B 2POCA 3IFSA 3SHOA 4IVNA
chains in the Genus database with same CATH superfamily
1F0KA 2AXPA 3WWCA 3BORA 3NAMA 1MTZA 3GGDA 3GP8A 2LW7A 4O2AA 2Y68A 2BI4A 2B25A 1COZA 1AUXA 5JH7F 3OTGA 2FLKA 3R8XA 4OFWA 5T3UA 4V0MA 4PHGA 3PDWA 4RE6A 4Z7NB 2B8TA 4J0GA 3OFSA 4D3YA 3GUVA 1VB3A 2NADA 1RLJA 3THXA 4PZUA 3UMJA 2VSQA 2DPGA 3EWSA 3R5SA 1SUFA 1Q7EA 2IF2A 5BN1A 1JAZA 3DH0A 3RHFA 4OJTA 5DWVA 1GYPA 3PD7A 5LOVB 1KMMA 4FDUA 1XCGB 3ML1A 4C3ZA 1H2BA 2GM9A 4UXIA 2G6TA 2HFKA 2WJVA 3NV7A 1E4VA 2FFHA 4HNHA 4JT8A 4GMKA 1W5FA 3TB4A 4CL8A 1YHNA 2QMQA 3NCHA 4P80A 4X71A 1CZNA 1JEYB 4JLJA 4HEQA 2HLDD 1U7PA 3QQ5A 2FZGA 4BECA 3R0VA 2J4FA 1QPBA 3JATB 3FKSD 3B85A 4EUSA 5IJ9B 2XWPA 1D7OA 4I1SA 1P19A 1N6RA 2JLWA 3TLCA 1Q7GA 2VPZA 4ZI7A 3LHFA 4WHMA 4ZVTA 5B1DA 5JVDF 1FTGA 1VLZA 3E7XA 5EP1A 1GDDA 3L7MA 1TZBA 4EJSA 1W5AA 2AOUB 2I9PA 3QENA 1N8KA 3HEAA 2ATXA 3PQ4A 1Z7YA 5G02A 2H18A 2RH4A 4ND4A 2G07A 4AY3A 1V7CA 1J1ZA 3O8LA 2JHCA 2OPHA 2YN0A 2AFIA 4J7AA 3T9DA 4AW9A 3HZOA 1MJ5A 4INOA 3NANA 3PI7A 2C7BA 4ZJPA 4JELA 3SJCA 3ICQB 2ZRGA 1GPYA 3CPHA 1QYWA 4BGEA 4H7PA 1WPRA 5JXJA 4KN8A 3PT5A 1MC5A 5BNWA 4MUYA 5H59A 3SF0A 3Q2OA 2A7QA 1YR1A 4OAQA 1Q77A 1EE9A 3LQ4A 5CYOA 5JZ9A 4D56A 1HTWA 3BSFA 3NT2A 3U13A 5I5EA 4YT2A 5J58A 2P9JA 4JXXA 1Z15A 2PTHA 2QQ0A 4OAPA 4NE9A 4OI4A 3UHPA 5BVHA 4PX3A 3S2UA 1P17A 1QF9A 3AR5A 4A4DA 4HNQA 2YMPA 4W6ZA 4WI1A 3VOSA 4C6TB 4ZYVA 2Z95A 1EH5A 2EG9A 1VKNA 2GN9A 3G2MA 2E1PA 1XV5A 2AJCA 2OGWA 1FQJA 1CB7A 4C6TA 5JYCA 2W2NA 1GR1A 4DR5B 3UVEA 5HKBA 3K8YA 2RBKA 3CQ9A 3I01A 1USVA 2FSIA 2VQSA 4DIOA 2OD2A 1EFPA 1DRWA 1YVDA 1T8RA 2AG6A 3N2EA 1D6NA 1J5EB 2V74B 4D99A 3SDZA 4DIBA 4DT1B 1KDTA 3E18A 2G72A 4JMPA 5JMPA 3LY5A 4QOSA 2FWIA 3AB3A 3QYJA 3CF4G 4UEKA 5AM2A 4Z2AA 4QXRA 3A4LA 4PNPA 3CNHA 5AKEA 4AUEA 3PEEA 5AQ1A 2NZXA 2P77A 1U8XX 3ZV3A 1GNQA 4L5IA 1Y7HA 3B51X 3H1TA 2NXNA 3WMRA 1NF9A 1GVHA 3D7NA 1ODIA 1E2EA 1O9BA 2ZU0C 3PQ2A 4BV8A 4B73A 5LN1A 1PZHA 5EJGA 2VSXA 2GK3A 5CHEA 5E6RA 3CEAA 5D87A 3TE7A 3UPUA 2V5UA 1RZ3A 3ROKA 1ULSA 5F7ZA 1IWBB 3EBPA 4O0MA 1MEOA 2BCJQ 4CE6A 2FSGA 1U7TA 2X5NA 4Z4FA 3DXZA 1Z08A 1ZIXA 2ES4A 2WKQA 3FSRA 1E3QA 1FU8A 2O8NA 4Y2TA 3ZDEA 2QYHA 2QUZA 3B6ZA 1Q1QA 2Q6KA 4W82A 5EJAA 1NJ5A 4OA5A 2BP7B 4FOOA 5SZJA 2CK3A 3OZEA 2FUNB 2BY4A 1Z9BA 4XIGS 4B6RA 1JKMA 1WP4A 1P9LA 1U0TA 2WA2A 5EMLA 4IXWA 4B31A 5K05A 5LQUA 2WWGA 1FDSA 1UBTS 5BW5A 3AVYA 1F12A 3KDSE 2F8MA 4BJ3A 1BCRB 4MDHA 3FUCA 4ZT5A 3MS2A 4C0XA 5JZSA 1Q7RA 2XI4A 3V42A 3NR2A 3LBIA 3LTEA 2FYTA 2QRQA 3D64A 3OPXA 2BH2A 4LYEA 4EUNA 3EASA 5K0LA 4IBOA 3FAZA 1R6VA 4A0GA 2KBFA 4KXXA 5AUNB 4BKUA 5ALFA 1REQA 2H59A 1D3AA 4CHGA 1IUKA 1BE0A 1U9JA 3LXRA 4IL5A 5HYVA 3W78A 1MA0A 2B0JA 4L4ZA 4P1ZA 2E4YA 4Q4HB 1IXYA 2GHQA 3URMA 5HA5A 3TSAA 2FDCA 2B98A 4MI3A 3SM9A 3EXEB 1A2QA 2EFHB 3CTPA 3FE2A 5DN6A 3VPSA 1DVRA 5DYGA 5EHGA 2B8EA 1JEDA 3ZW8A 3ER8A 2AYZA 1SZJG 2HK9A 2V8OA 1H0RA 2Z3ZA 4ZDKA 2DQSA 4R9RA 1XEXB 3MPUA 4MQ4A 4FEEA 5KPDA 1TGYA 5L3QB 3GIWA 4HGNA 3U1TA 2PL3A 1XZAA 4GOJA 5I9BA 5ITVA 1A50B 2Q3LA 4TRMA 4EA7A 1SBIA 5ALJA 3QXXA 4UHFA 4BKOA 2YY7A 2FE4A 4XQ0A 3EFBA 1JTFA 4FKBA 1OXKB 3U1VA 4URWR 1XJCA 3UKDA 1NBWB 1J2YA 4ZOLB 1JT9A 3A9UA 4FN4A 2JGLA 1I7DA 4GMGA 3C3XA 3R3VA 3DR5A 4A8JB 4TQAA 4ENPA 2XTZA 3CB2A 1JHOA 2M98A 2LWIA 5E2BA 1BW9B 3EDRA 2GDZA 1GA6A 1C0EA 3TS1A 4G9BA 4MYCA 5DW0A 3T4XA 4GIBA 3PQDA 4DMGA 5ICEA 1AH2A 1FL9A 1M2NA 2VTKA 4MW4A 2Y66A 2R85A 3M4XA 4MB2A 4YXFA 1SHKA 3OE7D 4A0RA 3TVTA 3IDSA 2CKMA 3QH4A 2J0QA 4NBUA 1VL5A 1Y6ZA 1TKBA 2BBWA 2OXTA 5A3JA 2C96A 2PZLA 3N0XA 4PXAA 2B9EA 4NOJA 1XHEA 1GFSA 4RLFA 1MG5A 3F1LA 5HG0A 1CIVA 5JO0A 1RD4A 1P9WA 2IOYA 2ZJ4A 1WVIA 3I1YA 5DPMA 4ZYWA 3LHIA 1AKRA 5KTRA 1ABBA 3LT1A 5BV1A 3A6ZA 3VV3A 3H1PA 1H1TA 3I09A 2QLBA 1XPOA 5EVJA 3GIDA 5CMLA 4Q18A 3J7TA 3W2FA 4MROA 4LTDA 3PNYA 4LHXA 3TUIC 4EAQA 4O4LF 3GLIB 2F1KA 1ONNA 2OMEA 3UMRA 1WZUA 2PXCA 1CUEA 2VA8A 1C1HA 4HRXA 2R6CA 3H9UA 4RS4A 5GMOA 3M3DA 3RC1A 4FWIB 5JSZB 3TH5A 4R69A 2Q5QA 4PM4A 1PL0A 3HN6A 3QW4B 3Q6IA 4IJ6A 4NAUA 5D3MA 2MJLA 2OQVA 2EKQA 4KB5A 2WAOA 3AI1A 4XCVA 2DLDA 3I45A 3U4AA 3ED5A 6ABPA 1WPQA 3OJEA 3NOVA 4TMZA 3AT1A 3CNEA 2ZKLA 5CDFA 2ZBGA 1ZMXA 3W2HA 1MO3A 4X41A 4PRLA 1QWOA 1H6BA 4N49A 4R2LA 2XUJA 2H29A 3QJ5A 3HQ4O 1WOYA 3V4OA 4BN4A 3NBYC 4UMEA 2LR0A 5K2OA 1DAIA 1HV8A 2I2XB 1MT3A 3EZ9A 2RBGA 4JNKA 2WD9A 4K46A 4OATA 4EKIA 2DSNA 2XKKA 1I2AA 3HKCA 3KZVA 3RASA 2D1SA 3H4TA 2HA5A 3KQYA 3SQOA 4DSOA 4UASA 1A5TA 1BCRA 1PJZA 4ARZB 4C1NA 2O3TA 4R01A 4PNEA 1Z8NA 4CGYA 4QRHA 2X15A 4PQYA 3UFBA 4CF6A 2GBCA 2H1FA 3BWYA 2ODTX 1E6UA 1UFRA 2PJDA 4LVCA 2Z2XA 1Z2OX 2JLAA 3GFSA 4MCHA 5AKIA 5DLDA 5JEDA 3JXEA 1M6EX 2CD9A 1GKYA 5M2QA 2VHEA 4CL0A 5AT1A 2PXAA 3OZ7A 5KHLB 2WKRA 5ICFA 2BMAA 3TMYA 1JG7A 3O90A 4FE3A 3SEZA 2PBLA 3F71A 3GYBA 4W5TA 4Z1OA 2Q6TA 2A33A 1C3JA 3ZHBA 4JXKA 5AVWA 1L4LA 4ZVSA 1PG5A 1THGA 4YCDA 1DTSA 1YMUA 3JQ7B 3IULA 5MDHA 2OECA 2ANBA 2SBTA 2E4ZA 2GDJA 2JPDA 4B3JA 3ZLUA 4B6SA 3HPRA 2OHIA 4DUZB 2PUAA 4NU8X 1YZKA 1E2NA 4RPLA 1PNTA 3IP8A 3GXOA 4O0LA 4Z1MD 4KX3A 1U9IA 1SRRA 2F48A 4NMLA 3AI7A 4DLNA 1FCJA 1LPAB 4E13A 4W5HA 4EY8A 1AY0A 1UFVA 4F91B 4PSKA 3PGJA 3I2IA 1GPH1 1K3FA 3OA2A 4FFDA 3CWZA 1Y8RB 1X7YA 1X80B 3IOYA 3OWOA 3P0HA 4HJXA 4GQBA 4DG5A 1RFGE 2I65A 2D54A 1VJRA 4JA0A 2CV0A 1R66A 5FNVA 3QG1A 1XYGA 3K2IA 1E7YA 1YC2A 2DTXA 2AHOA 2ZYVX 3UJ9A 3WYGA 4AKEA 4I7EA 1ZK0A 4FTWA 4D79A 1L1QA 2XEDA 5BQFA 2HYIC 1IM5A 2GHIA 3FY4A 2O8CA 4U00A 3LLVA 1HA3A 3MN1A 1NSFA 4HDKB 4TTVA 4CDGA 2BCEA 2XOKA 4QL3A 3J7AC 2BGTA 3W3AA 3KZ1E 4Q4CA 1OREA 2WK1A 3U9LA 3EGEA 4MPPA 3JPWA 1PHRA 4CMEA 1E2QA 2I4TA 4GMXA 4OGGA 4AYWA 1FS6A 2FW6A 3BSSA 4PAQA 4KHPB 1M3SA 3DTVD 2GTPA 2HJGA 3KR1A 2AJTA 1T9CA 4B2YA 1DEXA 3M2TA 1GV1A 3S7TA 4XVUA 2YJ5A 1ABEA 3IBGA 1FBTA 3GRVA 1LRLA 1SXHA 1A9YA 2BMEA 3IVMA 1WLSA 4OUKX 2G5PA 3U19A 5F23A 3IAM6 4YJHA 1DQRA 2V6MA 3RFXA 3M4JA 2JFFA 3E7PA 1B8VA 2C8VA 2IELA 4EITA 2Z3VA 1FP4B 1JHVA 5DRYA 1QWSA 5CXXA 3WIOA 4U8GA 4IQ4A 1SM4A 2B4KA 3W9YA 5IF9A 2JCXA 2PUBA 3KYBA 1X1BA 3PVZA 3NAZA 1T26A 2ZRFA 3CF2A 3JASB 1TZ2A 2OAQ1 1WHSB 4RQAA 1K4MA 3M3PA 521PA 3RH0A 4H7HA 2PX4A 3CT6A 4TVSA 1LPBB 1HNXB 2OHVA 6YASA 1NSYA 4EX6A 3SZ3A 3TW8B 4HTFB 4E70A 2Y27A 3CYFA 2QMOA 3VYRB 1AHHA 1H1DA 3AF4A 3UBMA 3LIPA 1HKHA 3AJEA 1BA2A 1QV7A 1GLGA 3B5JA 5LQCA 1N1MA 2A9VA 3PRYA 3K0AB 3TZQA 3A1NA 3K9LA 3LW7A 3T3IA 4HEHA 1AK1A 2AL7A 2CF5A 5JNLA 3B5EA 2WWIA 4DLUA 3SF8A 1HSOA 2OAP1 4EMSA 3KZKA 1SKBA 3PFHA 4FHCA 2I4OA 4FYKA 5B2FA 3DC7A 4PBTA 2HU5A 4Q39A 3QMPA 1BOOA 4DV2B 4EEXA 4Q4DA 3GFOA 3VDMA 1BDMA 3SYRA 3VR5A 2ZUFA 2EXXA 5CR9A 1JHDA 3Q7SA 3GF4A 4ENUA 2DTDA 4OH7A 4RHXA 2N46A 5F2EA 2I54A 5LNK6 1H4TA 3W90A 1N5JA 3OJ0A 4W9NA 3N58A 3GC6A 4QOIA 3VR4H 3U6KA 1RM0A 2X0IA 4F4IA 1RZRA 2W6ID 2Q2NA 4WEQA 3BCUA 4GM4A 4YAGA 3KJZA 3MGCA 3H5VA 1XMQB 1L4EA 4GSLA 6Q21A 4GP7A 3QX3A 2EW1A 5ITWA 3GFPA 1FDOA 2WSMA 1EQ2A 1MABA 4IMJB 2I3BA 3TSZA 4NPCA 5PGMA 5I8PA 1YJ8A 5KYXB 1TK2A 1YDMA 2CLEB 1QIJA 3HYSA 3NC4A 4AC9A 4C89A 4XGRA 1BEUB 1N1EA 1VE9A 1P6QA 3F6EX 4G8BA 4ZO4A 4Z3KA 4IKPA 3JQFA 1OWPA 3KZXA 1XD8A 2PXXA 3EQZA 4FKZA 3WNBA 3I9KA 4WDRA 1FU4A 1ZBQA 1QKJA 3DLAA 3F0TA 5H3CA 5BNIA 2K2QB 1UJ2A 3W4KA 4H0CA 5HNKA 4DB2A 2R4UA 2J6BA 2NV6A 2TRSB 1GTVA 3O2NA 4NBNA 3T5CA 3DS8A 3ROTA 2B1QA 3MA0A 4I99A 2C98A 5KNCH 1F38A 1PNQA 1U2DC 4K9RA 1KQNA 4FMCB 3TE6A 1M1XB 5JPIA 2R1TA 3CZMA 3NFRA 4IRMA 4F45A 2VHJA 3USES 5ADHA 3MCAA 3N8HA 4M0MA 4WASA 2HLDA 3STTA 1HYBA 2VPYA 2QYOA 5EWJB 2IV7A 3IMGA 1BE8A 3NTXA 1ESEA 1OHHD 1M1NB 1TZCA 2XMZA 1NI3A 1FDIA 4K3UA 5GY7A 1KAGA 2B7CA 3GRFA 4G0YA 1IN4A 1CZRA 2VNHA 4O29A 2RONA 5KVSA 1K88A 1QDLB 2Y92A 3LK7A 1M2WA 2DR0A 3IQDB 1SK8A 2WILA 4MVJA 7YASA 4YP9A 1MIHA 1BN7A 3R7LA 3THOA 1WDTA 3E05A 3P9NA 1AS0A 4EQZA 1EDZA 2HH9A 4KWIA 1T1EA 2C5BA 4Q7MB 1IJKA 3UW1A 1H1LB 2BGRA 2WHPA 1O6CA 4AO6A 2WQ7A 2DRIA 3TNYA 1ZRSA 2Q3CA 2NN3C 3I5MA 1KZ1A 1POXA 2POQX 4L27A 2GKSA 1YUNA 3F4BA 3PEYA 2O9JA 3DEZA 4TGLA 2EHJA 2UVPB 2VPXA 3ZCQA 1G0NA 1K2VN 3M34A 3NWOA 4HAVA 1QHFA 1A9QA 4WXYB 4PXYA 4H2DA 4LE0A 2PN1A 3MGBA 1CUSA 3V2IA 3AF5A 3IUYA 2JHFA 4NF2A 4M9XA 2E87A 1S2LA 1SZDA 2FGKA 3H19A 4FSXA 3UIEA 1JEQA 2P67A 4G84A 4D57A 5HJ7A 4UNQA 1GLVA 3ENNA 2X4DA 1YDHA 3NXSA 2Z56A 4L50A 3SP1A 3RT9A 1FMFA 1JKIA 3CX6A 4DLYA 1HO3A 3PENA 1UC9A 3MMXA 1QQTA 4G1EB 1R5JA 4LZJA 4NIMA 4ZOLA 3OPYI 3RIGA 1GPLA 5HTKA 3V00A 2X3UA 4FOLA 3VO9A 1FDVA 1KI9A 3AEQA 2HSDA 3UAZA 5ALDA 4LJ6A 4N9WA 1YL6A 2PA0A 2BUBA 2R11A 4D6YA 3L0ZA 5KNDH 1QRTA 1ECLA 1VJ5A 3SN6A 2TYSB 4RKEA 2LV8A 1EJ0A 1X7WA 4JFAA 1JPUA 5AXCA 3VV2A 2FKNA 2R66A 4BEJA 3LA6A 3AERB 4F4CA 2RB4A 1O5OA 1NOKA 3GAFA 1JSRA 1WY5A 4ZZ3A 1B76A 3VR5D 3SEFA 3NP9A 2C92A 3W04A 4D4JA 2C2GA 3D8NA 1R15A 1TU3A 3TLGB 2A5JA 1PJTA 4IKEA 4MV7A 2W90A 1A97A 3QSGA 3P9XA 4EFLA 5JWRA 4TYMA 2WJ3A 4M4SA 3DB2A 1YJ5A 2VSFA 4WD3A 3EHEA 1JG3A 5FWDA 1GQOA 2X0DA 4EWLA 1TIBA 4EEKA 1D2AA 3ANLA 3EH2A 3NHUA 1GL3A 4M1YA 2J0SA 2COEA 3C7DB 2CF6A 3KWJA 3RS5A 4JU8A 4R68A 2QY6A 2X4GA 1Z12A 5BN3A 4KLRA 3B12A 3V7WA 3X1KA 2HF2A 2C2OA 4RKWA 4IIFA 1DAGA 4NPHA 2DY1A 1SRQA 2LDXA 3H2SA 3KUCA 5JS7A 3DYIA 3AMVA 1Y5RA 4KDCA 5BW6B 1I94B 3F49S 4AF7A 4OV6B 3BICA 4GU5A 4Q15A 5ADWA 4U1RA 3V4ZA 4MIYA 4DDVA 5JBNA 2ZRBA 4QELA 2GJ9A 3OAAD 2FP4A 4Y0VA 4BMVA 1GQRA 3FPJA 2IKQA 4KSBA 1DC6A 2GPYA 3FDZB 2PEYA 2W2KA 3P0RA 4F3CA 1C3LA 1SKYB 1XDGA 2JBHA 2VK2A 4QQNA 4BKRA 1DUSA 1ZJ6A 3UG6A 5JU6A 1KYYA 2I80A 5CM2Z 3AEKA 3U7HB 1FDRA 3H5IA 1TVKA 3IBSA 1EFDN 1TOAA 1K5HA 1KKLA 1Q17A 1RRPA 3ZWNA 2FWAA 3M6LA 3ABRB 5EUCA 3GBSA 1Q7CA 3ETGA 3RCBA 3ZXUB 4XIIA 4B5KA 5P8WA 4LVNA 4B3HA 4UTRA 5IN5A 2I2CA 3A3KA 4JQOA 1YB7A 2NZVG 2VFAA 2BHSA 2RGXA 3LBAA 4O2BA 3GRCA 2JAXA 1ZKDA 4XOUA 1SXQA 1XRRA 1PT9A 2ODPA 3X1MA 3B9QA 5JASA 3DLCA 1JKXA 4MO9A 2C99A 4P3YA 1E2PA 1KS9A 2YJZA 4B33A 3IMCA 2RCYA 4OHXA 2ID4A 1JHYA 3FSGD 4Q00A 3UMMA 1B23P 1UKEA 4ZQGA 3V4RA 1QGOA 4ND5A 1U8UA 3CR8A 4G2NA 5LUAA 3ETJA 2BZSA 4YJGB 2DKNA 4KBFA 2BAGA 1AU9A 1EHIA 4HRYA 5ELLA 5G1PA 3MGAA 3SZMA 1I0IA 1V47A 1CYEA 2HDOA 3ZH2A 1BXGB 2OZVA 3FYUC 1Q92A 5EMKA 3VUFA 3WGMA 4BVFA 1V43A 1XZGA 3U7EB 1UXHA 2JBAB 3LP5A 4DUGD 3RRFA 2XCLA 1GARA 3MVEA 5E2AA 3R6LA 1DTWB 3O8OA 3CX3A 3F6CA 3NC1C 4FYMA 1F51E 5KAPA 2I0FA 1PJQA 2CLFB 3TBFA 3VJKA 2WD7B 1VG9B 2ZXEA 3G2JA 3VAYA 5IS2A 1KJWA 3DZJA 1SU8A 1M75A 4RD0A 5C31A 3EY4A 3EGDA 3QELA 4V0OA 5B1IA 3LUKA 3VAZA 1LFDB 1CRQA 3EW9A 1XROA 1Y34E 4RA6A 5HBRA 3DOIA 3KPVA 5E1BA 4H18A 1JYEA 2Z57A 4LMRA 4IVRA 5EIHA 3VR2A 5FWXB 1JP7A 1Y7PA 3GLGE 1TEXA 3H84A 4I9NA 3N7AA 4V0QA 3S1LA 3SJZA 2QJTA 3Q9UA 1CZUA 5JD4A 5DVZA 1FA9A 5C18A 1EHYA 2JLXA 2ST1A 1FX0A 1YZNA 2ZBVA 4K6KA 4DR1B 1R0KA 2X2FA 4RPJA 3R9WA 1GO2A 1ONSA 5ENDA 4BU1A 5KDDA 1UH5A 2NU6B 2H2FA 2OE2A 2VJLA 1YUBA 4GP6A 3TGLA 1V9SA 3FPLA 3JZAA 1DKMA 3U4GA 1Y5MA 4LY9A 1KDVA 5B36A 1DWOA 4W6QA 4IVPA 4DLXA 1IK4A 1WCV1 3EIOA 3E9MA 3G3EA 3PCXA 4RIIA 3KXPA 2ISCA 4CMIA 3KZNA 3GLFA 3A2KA 3M9XA 3STYA 1NDUA 1X1TA 3JTEA 1H5UA 4DJJA 1NIPA 4O4HF 2HJVA 1L4NA 2XKAA 2PVCA 3AQIA 1NP3A 1KEPA 4F3RA 1JR3A 4NMMA 4DLAA 1PTJA 3BRQA 4F9EA 3GLGA 1ADCA 4ZI7B 4UHKA 4OXXA 2GNOA 4LHZA 5CFPA 2R9VA 4MEBA 3GU3A 4DNXA 2OTCA 4L5JA 1M5RA 3B1KA 4M21A 4URYR 1JG4A 3IT0A 2P90A 1JQKA 3V6MA 2GM5A 2I3DA 3GBVA 4KIGA 2V7GA 1DFHA 1IUNA 1I13A 2AC4A 4R1UA 221PA 1QHHB 2B36A 3Q8WA 5LR6A 4BVJA 5KYKA 5DBGA 1KFCB 3QRWA 3GJ6A 2IV3A 5E0OA 2P9QA 2VEOA 4UPVA 3AP1A 3ICVA 3MAAC 4FGWA 1IM2A 4CJXA 4X6YA 5KNBA 1X6VA 4KKXB 3Q8XB 1IOVA 2BEKA 5KCZA 4RGYA 4Z99A 5J5VA 3SZGA 1BA3A 1SVUA 3QE2A 1N7GA 1XRPA 1FDWA 4G25A 3HVJA 2AN9A 2C9YA 1L3CA 2HO5A 1NA5A 2G1UA 2BFDB 3I9LA 5L3SA 4ALKA 2X8JA 4NCNA 2PGOA 4EA6A 3K0EA 2P91A 4TWIA 3HVIA 4CKBB 4N12A 3OQVA 1ODCA 1PEDA 1RRKA 2E5FA 4MVJE 4S1OA 4MVWA 1GWNA 5JXGA 2F62A 1C3EA 3K6KA 1RYHA 2PUVA 2RKWA 5DM0A 1E2DA 3IKMB 1X1AA 3JWJA 4AIIA 1VJGA 4YMTA 1BKSB 4J0DA 3LVBA 3BMNA 3S99A 2JJ2D 3MJSA 3A3PA 1JAXA 3UQZA 2I1WA 1VPWA 1Y81A 1GUDA 2H4JA 1L7MA 4X8MA 1L3IA 5LNK1 2UKDA 4YWHA 3F46A 4MS3B 2YMQA 4LFCB 4BFLA 4DNQA 4WFKA 5DKFA 2FDXA 2WYHA 1XCBA 3ONFA 5BRJA 2AWOA 2LD4A 2YFQA 1O58A 4PG4A 2R79A 3TB6A 3GLIE 3DYVA 2DWPA 4WKOA 4XSGA 4QYXA 3EOBI 4K87A 4DCGA 3RYHA 3OI7A 3KVNA 3QKRB 3ZCUA 2BLLA 5F77A 3LRXA 1JTEA 3T06B 3WHLA 5DNUA 4IDCA 5HF5A 2NZJA 4QTYA 5J5AA 1O9HA 4ICIA 2P2NA 1YQGA 3H9BA 4CUZA 4ZZ2A 4COKA 2HPHA 4WINA 4Z9FA 1K4KA 2WHYA 1LW7A 1KY3A 4NENB 4KNYA 4FQ8A 2A2ZA 2OG1A 3ES9A 2JJMA 3L8CA 1URPA 1RYFA 3GZ4A 1H2EA 4YAOA 5EIBD 4QUJA 3F3SA 4WZAB 2RK3A 3HP4A 3T7DA 1LF0A 4PR0A 1OWLA 3OZUA 2QE7D 2ESRA 4QXQA 4TL8A 4B7CA 4HV4A 4ZCMA 3PZRA 4MWEA 5GZ6A 2W22A 3ZD7A 3I05A 1HLDA 2ERCA 2J41A 1A9XB 3GQBA 1DGQA 1HRDA 3ECAA 5ECGC 1WBBA 1Q0QA 2DZDA 4MLPA 4Y6SA 3PXAA 4FUTA 3U2QA 3H2KA 5JJKA 4OD0A 3EVGA 4ZCSA 1QFSA 2JCVA 4Y1FA 4X5OA 1JDVA 3C7CB 3H6HA 5CD1A 2JH9A 1N9KA 4IHAA 2ECOA 1XTKA 3HMQA 4CFSA 4A0HA 2O8FB 3ZCXA 3C7TA 3ZWKA 3S8MA 4TL7A 4KQ1A 3EDYA 4G24A 2HGSA 3NBMA 2C5HA 1N5IA 1QH8A 2ROQA 1FNCA 1DBQA 1JLMA 3A4MA 4E1VA 4DLTA 4EO4A 1H8HA 5ERYA 3E6AA 2CSUA 3K9NA 2Q5CA 5KOHA 3HYRA 4PPFA 2PK3A 1V3VA 3VH1A 4LDPA 5J2UA 2VQ3A 1F9AA 2JLYA 4O3MA 2YH2A 3ENQA 2CJFA 3PL1A 5E8JA 3X1YA 5CCBA 3BT7A 4OQPA 3QE0A 3DVLA 3IP3A 2GCIA 4L16A 4NLLA 4R6WA 2UVQA 3OQBA 2J08A 3D7SA 5JD3A 4EJ6A 1G9TA 4R5HA 1A9ZA 2XAUA 5E0KB 5EZQA 1UJCA 13PKA 4I1IA 4AKGA 4RC9A 1I3OA 2IGBA 4O4JF 1C2YA 3N07A 2V03A 1ZS9A 3GJQA 4GLFA 2XZLA 1AS2A 2FUCA 4ZVLA 2VZLA 1IE3A 2R25B 2OPBA 2F9FA 3MWDB 1V3QE 3ETCA 3N6RA 3VPGA 4YCMA 2EF0A 2JKYA 1YQXA 4WECA 3W7BA 4H0FA 4FB4A 1R0XA 5H9WA 3HMKA 2MYUA 2GEJA 1W0JA 5ALOA 1XYYA 2QMUA 4IMRA 4YLYA 2XQFA 3ADPA 2FPWA 5ETJA 5I6DA 3CJQA 5JLAA 1KHTA 1ELOA 2AOVA 2R6GA 1IM8A 3Q2IA 4UVHA 3TQRA 2SKCA 3NHJA 3HY6A 2DFPA 1RADA 1WV0A 2I22A 2V9PA 3U4QB 2HXGA 1FQOA 4ZI5A 1LSJA 3OP1A 4HLNA 4YC7A 3AVXA 1ZVJA 4YACA 3PA6A 4G8CA 3ZGVA 2IOFA 1V8OA 3FNRA 3FTNA 5DGCA 4PLPA 4YV1A 4MP6A 5G0UA 2QLLA 3RSHA 2ZE5A 3IA2A 1SQGA 3P2KA 5C1OA 2IEAA 1MRNA 1NFQA 1S5PA 2ZS7A 1AGXA 2O3UA 3WG9A 2AE2A 3D31A 3FB4A 1Y8RA 4H31A 5CB0A 4TZ6A 1G2IA 4ZVRA 5CT8A 3OZIA 1D6JA 2XMSA 2AA3A 2FR0A 4ARAA 1P3JA 1TT5A 2FGJA 4KZKA 4LHWA 4NNOA 3IE0A 3C97A 4KSYA 1OIXA 5KTKA 4OEHA 1AUPA 1I01A 4QLAA 1O77A 2VNSA 4PNZA 5JAIA 3LBNA 4P5DA 4QXOA 3AP2A 3FPKA 5KB3A 3B1ZA 3TG8A 4HDAA 1RJ9B 1SUIA 1C8VB 2IYVA 2UZ3A 3PXCX 2X42A 4U6SA 3TQTA 1QFYA 1Z0DA 1VI6A 4GX5A 4Q1VA 5DXAA 2RIRA 1V16A 3PC4A 3PICA 4AG5A 1Z39A 4LCEA 3HJFA 4QX6A 1IY8A 4AFNA 4B2IA 3NTUA 1ZVVA 4EY5A 2Y1DA 5AH0A 2EZ9A 3D6MA 3FDIA 3O8DA 3BAZA 3OKFA 2DX7A 3QE3A 4BAUA 4DM7A 4MITA 2B6NA 2XUGA 4DA9A 4E94A 5ALNA 2FMTA 1C14A 1JA9A 1YI0A 3BE5A 3RU2A 1OA0A 2P68A 3AESA 5ALHA 3SIXA 5T4EA 4MR7A 4C7KA 1VHDA 3A25A 3QOYA 1B6SA 2GN1A 5BY2A 1ZH2A 2CXPA 4O2BB 5KNDA 3WIDA 4M7OA 3MMZA 4FQ7A 4HADA 3VFDA 3WGQA 3AJRA 3DLHA 3NEYA 2IVZA 3U3MA 4AULA 4OX9B 1E7QA 2GZSA 1Q0UA 3Q98A 3IDFA 1GXSB 4G23A 1PYDA 2XCIA 4RY0A 4B43A 1VIMA 4IDGA 2GRAA 3FPCA 3K0FB 5TDHA 1Y4UA 2MCFA 5ALLA 5CA1B 1GGJA 3EUFA 4NFHA 5LBUA 2PSDA 4MV6A 2DP4E 5I48A 3PQFA 2ZM5A 1TF7A 1YK0A 1BMQA 3A6JA 3O47A 4DCNA 2OXIA 4EUKA 1RW4A 4MWBA 5LMUB 3BL5A 5NULA 4DPMA 4HG2A 1HX7A 1TFUA 3QEOA 3C15C 2HCTA 5AKJA 1LC3A 5K51A 4QREA 1NPDA 4IVNA 3TTYA 3GMIA 3UK0A 3REGA 1M0WA 1QTIA 1H2XA 3KFLA 2B78A 4KMMA 3IUPA 2QM0A 1KOJA 1DE0A 3ZGOA 1WIWA 3STHA 1QGUB 4G0WA 1USIA 1BWQA 3TO5A 1E2MA 2BGWA 2JFNA 4EQ6A 3PG5A 5DJ5A 1NUTA 1ID8A 4DLKA 5DIZA 3O26A 2D2EA 2JKVA 1JHMA 1US8B 3P5SA 3TLEA 1TO1E 3UKJA 1L9KA 1TUGA 1XEWY 1S01A 2X14A 4ZTBA 4BQQA 3CVOA 1MTOA 1X39A 1Q0RA 2BTQB 1ST3A 4D02A 1YFZA 3ZWDA 1G7TA 4Q5IA 1QOQB 1JG1A 5FYQA 1JH8A 3ZWYA 2O4CA 3OO1A 1E79A 1EZ1A 5FL3A 1YKFA 4ZI7F 1NW6A 3HWWA 1IHPA 1RFLA 3GJXC 3LUBA 1D2MA 1YUMA 5DYIA 4UFPA 1VL6A 2F17A 2D0IA 3O8QA 3D1LA 3A7EA 4DVGA 3B6EA 4YTEA 3RVJA 3K7EA 3QJGA 4YAUA 5JPCA 3GUCA 1MC1A 4G2TA 3FYUA 4XVRA 1SOWA 4MVYA 4AQYB 4ALNA 4FB5A 3SSMA 1VIAA 4UUMA 2NNWB 3WL8A 2NGRA 2O2GA 3H2YA 4TTAA 1D2EA 3CKMA 4JC4A 5I3ZA 4BJ6A 1RAAA 3SCZA 3DP7A 2PCLA 5AFSA 3PE4A 4I46A 2OQ2A 4RVGA 2D7JA 2ASVA 3FDFA 3WO0A 4ER5A 3ADCA 2XYGA 1W1WA 2AUMA 2ET6A 2PRJA 3I4FA 1SK9A 3ZQ4A 3GN2A 2IC5A 5T6BA 1DKOA 5BQ5A 4ROSA 5L9AA 4IYJA 3LYLA 1IHYA 1KP3A 4P98A 1EJ6A 2R6AA 4JAVC 1Z3CA 4X1IB 5BMVF 4BTLA 5AKYA 3ROMA 1JG2A 3GGPA 3AO0B 1GG5A 1W4CA 4X93A 4ZOEA 2RFLA 3DL7A 2AC7A 1N7JA 1W0KD 4WCVA 2R4TA 5AJWA 5AKXA 3ANSA 5EPOA 1E94E 3GDGA 3UJ8A 3FA2A 1FMTA 4DZZA 2AH5A 4H08A 3QLJA 1ZWKA 4LHVA 2V1XA 1L1EA 3OCCA 4GRAA 4NPAA 4Q4HA 5D8DA 3U9TA 1XTRA 2LBPA 5DBEX 1JI0A 4IHKA 1ISIA 1G5FA 1SIUA 1WPXA 4DM3A 2FX3A 2B1JA 2DBYA 3GZNB 1VLJA 2VH5R 1W46A 3IP7A 1FLDA 2X13A 2Q99A 4G89A 4H6WA 5ILGA 5IHPA 2DQ4A 1I3KA 2LVBA 2VTVA 3BWBA 4M60A 2HWKA 2C9OA 2YC2C 1K6EA 3IC5A 1JJIA 1G21E 3PVSA 3Q5GA 4OHFA 4AVYA 3TFQA 1TLLA 1EBUA 2RG1A 5FLEX 1II8B 1AXGA 5ED0A 4RV5A 2G06A 1UJMA 4MW2A 4XDZA 2IH5A 2HMYB 3WGIA 1KEWA 3HU5A 3RFUA 4HATA 3C8MA 1EVZA 3RK4A 4KQIA 2C94A 3RO7A 3TRJA 1E3JA 1JFRA 1GHTA 3NDPA 3WAGA 3W6PA 1TYAE 2ZYWX 1C0PA 1SJ9A 1WQ3A 3P96A 4R16A 3HNRA 4MAMA 3VSDA 1D2NA 2XR1A 2X8BA 3TM4A 4QULA 5LXTA 4CIVA 1I3CA 3NDJA 3KUDA 4IWXA 1MB3A 4GZLA 1STOA 1TVKB 2BUAA 2DC1A 1VSQA 1N2ZA 3NBFA 5F21A 2GBGA 2XZPA 2NT3A 1GIAA 3GFGA 4Q1BA 4NR0A 4CM6A 5CB4A 3T4UA 5CLFA 5AJTA 2FA9A 4U63A 1IN6A 4LCJA 1L4BA 1AJEA 1GUAA 2NTYC 1JL3A 1OMOA 4ZO7A 4HLQB 3HFGA 1I36A 2C2ZA 3C4VA 5EXXA 1P2DA 2VA9A 8MHTA 1PX2A 4KXVA 1ZHFA 3I01M 5CIWA 1LNQA 1A2KC 2ZDGA 3CNOA 3IDQA 2W4QA 5AW9A 1U8CB 2JI8A 3VZDA 1NV8A 2FUG6 3PQ5A 2INGX 4WLOA 5J2UF 3EC7A 3PE6A 4AZSA 4FEGA 3I1IA 3C4JA 2QWXA 3BE4A 4TLEA 3ADKA 2BSAA 3KB6A 4MV0A 1PT6A 3IIIA 4YJDA 4D0SA 3GVPA 4CRWB 4F3KA 4F4JA 1LJLA 2RGYA 2ILTA 5FORA 2XUPA 4D4GA 2QZZA 4IG4A 4DB4A 4Q4LA 2OCPA 3R0IA 4OUDA 5IASA 1GN8A 2W2QA 2WYVA 1SUSA 3TRKA 3WVNA 4I2VA 3KOYA 1YR7A 3CVWA 3AWDA 1OFUX 2H7CA 2SHKA 3JAWA 1MVOA 1F3LA 2DKFA 2ORYA 1ZL2A 2WA1A 3IP6A 4G5HA 4LN1A 2R47A 1PUXA 1O4VA 4HXFB 4L4SA 3ZV6A 5IULC 4C3OB 4LHSA 5FNZA 4G85A 1FXWA 3NHYA 4O2RA 1DNPA 3GDWA 4PHCA 1OKKA 1Q11A 4H7DA 3ZI4A 1OH7A 3E03A 2WJWA 1TM3E 1YBHA 2I99A 2IVFA 3T3NA 1W30A 4X90A 3RODA 2ARKA 2HJHA 2IU6A 5BYJA 2E5WA 2GBLC 4P81A 3F4LA 4J9UE 1XOIA 1J90A 3NGLA 2Q9CA 1C80A 5G53C 3PNBA 1B74A 1WX1A 1KU6A 3B8EA 5ANRB 3FNGA 1FJ2A 5IG2A 1IZZA 3ROZA 2JLZA 2ZANA 5SV2A 2FWMX 3EPJA 2HHLA 1QKIA 1UKZA 2QW0X 4NVRA 3B60A 3OLYA 3ZUGA 2GCNA 5BOSB 1S2IA 2QD3A 3O95A 2EYUA 3KPUA 4IYRA 3WB2A 4K86A 5FOTA 3H1GA 4K6FA 4RKQA 3KWMA 4ZAFA 2A1UB 1WW3A 2R8RA 4MKHA 3WV5A 3D4NA 3OJLA 4TRRA 4ETWA 1CIJA 4CCWA 1BW9A 5F1PA 1P2GA 1Y9EA 4WOJA 5F4BA 1ZSNA 4PTZA 2AZDA 4HDSB 1QRAA 2C9BA 5DGDA 1MA3A 1T4BA 1W1UA 1WD7A 3EDMA 4RENA 5COQA 3FFAA 1BWPA 3L8MA 2D4AA 2GM4A 1XDBA 3E1SA 4PQEA 3WKEA 4EELA 1TM1E 3AY7A 3BDIA 2X8LA 2FN3A 3FYCA 3JZIA 3L0BA 3UZUA 1S2NA 4DJTA 1IPHA 1MAAA 3GV0A 4K9QA 4NL4H 4HDOB 3BWMA 3ZWBA 4BQPA 4TUYF 4EA9A 3MINA 1Z4IA 1I3NA 4G07A 3MMSA 5AKZA 3ZJ5A 3OWXA 4L3WA 1KBOA 3VOTA 3ZXSA 4PWZA 2OC9A 1QVVA 5BNTA 4PC6A 5I4BA 3Q72A 3QBDA 2W93A 3TK1A 4UQPA 4JJAA 4RKFA 5K0SA 1YRLA 4LS3A 3DBIA 2AN1A 3V2UA 2FI1A 4J49A 5HQ3A 3OEEA 5HKKD 4KIWA 4KPGA 1ZJ4A 2VUSA 1FFDA 2ETXA 3COZA 4R1MA 5U4QA 4PIVA 4QUHA 1F2UA 4ASUA 3D3JA 5AI0A 3UKOA 5LYJF 1GRNA 3HB7A 4DCUA 5A4KA 3ON5A 5AW7A 2VHQA 1R5OA 2C2MA 4WBXC 1J00A 3NMUF 3T12A 3QV2A 3N2GA 2O2DA 1IZ8A 4D8XA 3RUEA 2HMWA 5DNAA 3AUJB 3PV0A 3ZKWB 4LYFA 1I6KA 5FP0A 3WJAA 4UM7A 1CY0A 1JQAA 3R9XA 1A2BA 2C2KA 4R41A 4DSAA 3MINB 5H81A 4IDBA 2GN2A 3LF1A 1RXUA 2I6GA 1K2WA 2OKGA 3CIFA 3SZRA 1IXKA 5K3AA 2ZIAA 1EM8A 3BBPA 3FWZA 3WK9A 3INTA 5IZCC 1OXUA 4OM7A 3U3ZA 4E4YA 1T6YA 2YWRA 4DMFA 2EOAA 3QXHA 2VAWA 4RUKA 5EPEA 5BOSA 2D0DA 1JZQA 3I2FA 4OY3A 5BSHA 4YO7A 2IS4A 3O4RA 2ZW9A 1I9CA 3PJEA 4MQEB 3R74A 4RJJA 5ITZB 2EKBA 16PKA 3LXXA 1D2GA 3HCRA 3ZE6A 4GRDA 1KYWA 1UEIA 1NW9B 4U7JA 5GV7A 3KC2A 4FI3C 4HH0A 1O8BA 4FSHA 2O0MA 3BGIA 4JBHA 3OJOA 4TM7A 3QVWA 2Y1OA 4BO5A 3S2EA 3HA3A 1GEGA 1ZSYA 2JAPA 5D6OA 4NCJA 4JEHA 2AXNA 3V3KA 3V8RA 3PD1A 3Q9NA 2XW6A 4DKJA 4JVMA 4YUWA 3BOSA 4HL6A 4ZZ0A 1P1HA 1JQDA 3BS4A 3EQ7A 1CUFA 3E9QA 5FTKA 1SXJE 3GLQA 6ADHA 1C4OA 2Q0XA 2XMRA 5DGIA 3MS4A 3U3JA 1OXBB 2JFVA 4QFDA 3AFMA 4WWHA 5G1NA 4DARA 4YALA 5IWCA 1RAEA 1WP9A 1VXRA 5DHUA 1EDOA 3JQCA 1M6WA 3I1FA 4FJ0A 4X92A 2ONJA 1NW7A 3OEHA 1K7EB 1QYRA 3TW8A 4DDWA 5BSWA 1TTTA 2I7DA 2Y1CA 4W8HA 5LQRA 4ZXFA 2DETA 1DCFA 4DV3B 1S1MA 4EYOA 1ZW6A 1UZMA 2PT9A 1PWXA 4RYLA 4MRSA 4ZAGA 1R4NB 5HIMA 2WKWA 3K2EA 4AY4A 2P2CA 1PLLA 3EQ6A 3V1TC 3IUBA 2ZB4A 3REFA 3KSMA 1PZGA 2XNHA 5AVQA 4GLLA 4M38A 5EQJB 4AJKA 5AM5A 4NV3A 5K0NA 3ZXYA 5JSYA 2FB9A 4QUAA 4OHZA 3AJ9A 3H6GA 3STUA 3EX7C 1CJVC 5A7FA 1WWKA 5HWSA 5AI9A 3SBXA 1IIRA 1UFOA 3T4PA 3PR3A 3MIIA 4G0MA 4RGBA 5I47A 1PR2A 5TMBA 1E77A 2GK4A 1YB1A 3NEAA 1HYEA 1Z34A 1FVOA 1V6SA 3M6FA 2P1ZA 2F59A 5TVKA 3WK6A 4BCDA 5DM4A 3K70C 4HEJA 4U7GA 1KSGA 1H42A 1XTUA 2N42A 1VBFA 2EEZA 1JQJC 3FSEA 3KPWA 4G1CA 4IHJA 4NFLA 4V0RA 5E4JA 1DXHA 1N2CB 2QSZA 3UY4A 3ZG6A 4GP9A 4BMCA 4DLSA 3E84A 1FE8A 1MX5A 4BLRA 3CUYA 4M1OA 3UBTA 3H3FA 1FEZA 4FLFA 2EFYA 3G9UA 3AKDA 5G0SA 3U0BA 4CNQA 3ZYZA 2ZVJA 5K0CA 2YRXA 1E64A 2KMLA 4JLWA 3G0BA 3M3HA 3ZVMA 3SM3A 4P54A 1XMOB 1CY1A 3X44A 1YTUA 1K98A 2AXEA 3G9QA 2YL2A 3IQZA 3PWSA 4FMCF 2IXTA 2DH5A 1M2OB 3D02A 4XAQA 5CJ2A 3RVSA 5CD9A 2MMGA 3NH9A 3BKXA 1CRZA 3FOBA 1Q0HA 1DMRA 2ODWA 3OCJA 3RVMA 4DCJA 2G8LA 3EWIA 1JR6A 1ZVQA 2PJRA 1LI7A 1EFHA 3H4MA 1MCZA 3FHLA 3SXJA 5BSVA 2A5YB 1EX6A 2YBEA 1NLMA 1I3MA 1VBNA 1HOXA 1Q6YA 2QTWB 2RC6A 2Y99A 3NHBA 4RETA 1QB7A 2GBIA 5L3SB 3C6KA 1FYWA 1XEWX 4AWAA 1UDBA 1KR2A 1UBUS 2J5BA 3HFJA 3MJVA 5H1YA 4LV5B 5JS6A 4P83A 1R74A 1KY5A 2UUAB 1EGVB 4DMLA 1QOPB 2JIMA 4RV4A 2GAFA 4RZIA 1ZM3A 3LCRA 4M53A 5C8YA 3SZOA 4V03A 3ZWXA 4F2DA 2CHQA 4F8EA 2AG5A 4FIZA 4U39A 3RROA 3ZK7A 1QHHA 3ZPXA 2DFDA 1SKUA 4NICA 3HCDA 4EAAA 3RIXA 2QG4A 5CAEB 2B4TO 5JBIA 4M1WA 4YQZA 1G6KA 4XUDA 2UUPA 4PCVA 1K8QA 4ZCTA 5DBFA 3U4DA 5T6MA 3MRXA 3MT9A 1W0KA 2JIPA 1N3IA 5IC5A 1WCWA 2QTRA 2PANA 3IEKA 4NBRA 2NLOA 3RNOA 5G1OA 3VR4D 4ZYXA 4HQLA 3TSYA 1NXSA 3GVCA 1E66A 1RP7A 3ZJUA 1IB6A 1NNI1 5EP4A 5GM1A 4ZI2A 3WYEA 2NSLA 4JCCA 5FLXA 1A88A 3W2TA 3BQMB 4HDQB 4Y9RA 2RGEA 1SD1A 1ZINA 2ZRNA 3KJXA 4G4SP 3ZDQA 1Y6FA 4NDNE 5EXTA 4F38A 3EVAA 3K4PA 1NX6A 5K3SA 4TQUS 2XKBA 4D8TA 4GDFA 1YCFA 2GILA 5L3VA 4RLQA 1UK6A 2ODBA 3JARB 4N0QA 4F4DA 4KFUA 3RTDA 3OCVA 3S70A 4ZGBA 1M7HA 3A4NA 3LM8A 5K09A 5EZ6B 1QCYA 2VC2B 3H18A 1Q57A 2WU0A 4AM8A 5IF3A 2VDVE 1ISSA 3G7SA 3KM0A 2XAAA 1N5RA 2QP4A 4D42A 1GRVA 2IXAA 2VOEA 1H4VB 5BQPA 1FC0A 2FEWB 1NW8A 2Q1WA 4Q37A 4YQYA 3RTAA 3W8DA 5AD1A 1F3OA 2A78A 3JQ6A 3MB8A 3T5PA 3T7JA 3AR9A 2Y1KA 1E9VA 2Z2KA 4MS4A 3U4HA 1KQGA 2XNJA 3B7WA 1VJ0A 3T7CA 1RCFA 1CEYA 2WSBA 3FYSA 3NEPX 4DPLA 4WA7A 4O1HA 3GJRA 3UOWA 4JP3A 3WGGA 2AI1A 4DRXB 5C46F 5JAUA 1QH8B 1ODSA 1V8DA 4FK8A 3S68A 4CI0B 1G4AE 5EAIA 4PN7A 2WLSA 3N2GB 3PEFA 3VYVA 4IY1A 1NM5A 3OICA 5JCJD 1DARA 4UAGA 3KQTA 4R1SA 1JEYA 1C9EA 1P1FA 4R81A 1XTZA 4P93A 5EJ6A 4MRNA 2I4RA 3QITA 3LSYA 2GPNA 3B78A 3DDOA 4YCAA 3CNBA 1B15A 4N40A 1LDMA 2NSDA 4KO8A 5DCUA 2QLJA 2AZTA 4BZPA 3EN0A 4I55A 3GUHA 3T9AA 1S8NA 1NVMB 5HQ3B 3ND6A 4HB3A 2M9MA 4BNXA 1NJGA 2DM6A 3O3NB 1E4YA 3WISA 4LF8B 2ZIUB 1C4KA 1OY1A 1RRVA 4HH1A 1XFDA 2OC4A 4BKPA 3R0QA 1FFXA 2ZSBA 3FH0A 3JQ7A 2XRFA 4II3A 4B4WA 3SI7A 1VMDA 2DF8A 3U44B 2F3SA 2P79A 2ICAA 2W4IA 2YMLA 4F9FA 4MRVA 3G2LA 1SNYA 3G2PA 3R6TA 1ZBDA 2PZMA 1LRJA 1DO0A 2ZI7A 1C9DB 3HG7A 1ULZA 3QU5A 4TUYB 2TS1A 1CUBA 3R77A 1G64A 1RXIA 5JNWA 2IIBA 1LDEA 4MR7B 3AIKA 4WDQA 2GZDA 1TQ4A 2QE7A 1LDYA 3EIUA 3ZVLA 3NLLA 5HCIA 5LP6A 1VP3A 5JR3A 3DHNA 4QSMA 5BV2P 2Q1TA 2JIRA 2WMOB 4IR7A 3MT8A 1SA0A 4S24A 2BGNA 1FS5A 1PW5A 1Q0PA 3VC1A 1V71A 1ZESA 4FHDA 3F7MA 4BTEA 1Q1GA 1DC7A 2C29D 2DBZA 3I5AA 4DPKA 4R0NA 3FHOA 3B6KA 4KXFB 2GAOA 5LB2A 4ENVA 3GPCA 2OB1A 2W2XA 4FJ2A 2ZAMA 4JYAB 4AKHA 2Y3IA 1QVAA 1V37A 2XGOA 4WERA 1DXYA 1Z6QA 1JHQA 1HDGO 3HB1A 2WC1A 2ZIZA 3DQQA 4KCGA 4N01A 3HC7A 4F2PA 3AYXB 3JVUA 4WUTA 5FBQB 3CLUD 2ADMA 4V38A 2MHCA 4FYVA 4G1MB 2MR6A 5FWYA 3FVQA 4XLLA 1M1ZA 1SCKA 1DS6A 1GG2A 3KLOA 1PN3A 5G2OA 1J9ZA 4EX7A 5LQDA 3OLWA 1CJSA 2P0EA 3F8WA 2VUIB 3C8HA 5DK4A 2OOSA 3VR5H 4O2LA 4AY5A 3ZQKA 4XLTA 1IY1A 2RB5A 4I4TA 1WZNA 2FK7A 1FUUA 1DB3A 4GKBA 5D3MB 3C5EA 5JRDS 3T1TA 4LC0A 1ZNXA 4RDCA 1N6PA 2XMCA 4YP0A 1LJUA 3EGXA 5EY5B 4JLVA 3D5QA 5HS6A 1XCPA 3N6VA 3LQYA 2X8JB 5I7SA 1YGPA 3UC9A 4D43A 1NJSA 1P39A 4O4HB 1NBMD 3RTBA 2GFHA 3HCCA 3QOFA 4KRFA 1YVEI 1DV2A 2XCQA 4CL3A 4IHQA 5CDHA 1P6XA 1UXOA 5F9FA 1FTSA 5LQAA 2XBLA 1EFKA 1PK8A 1R5BA 2W2LA 4L1KA 1H22A 3ZHXA 2OP0A 1ZFNA 2VT7A 2YRFA 2E7ZA 1CCWA 1E1CB 4DGSA 1JSZA 2B4YA 1N9ZA 3IOEA 2EGUA 4Q4JB 1N9GB 2GVDC 1B93A 3NOXA 4M3NA 1YK1A 3D6VA 1RWVA 3WRYC 4CIBA 2JZOA 4P58A 1KVQA 4O1MA 1YA6A 4NNJA 2OVFA 2PKQO 2H5EA 1Z75A 4MWTA 1NVBA 1WHSA 4B3CA 2V54A 1UK8A 5EC8A 3GLGB 1N3LA 2OV6A 3ZDRA 3PUXA 2J9XB 3MFYA 2ECFA 1CE8A 2P2LA 3ZDDA 3I2JA 5EJEA 1TD9A 4JJ7A 2GA8A 4F4FA 1LDNA 1S3IA 4Z3DA 3EVDA 5DTQA 1SH7A 1IZYA 3SKVA 1L5OA 4F5DA 4YMLA 2PY6A 2NO4A 4RIEA 4Y6OA 3OOYA 3SBEA 3VA7A 2PU7A 4KAXA 4JKIA 3M6IA 3WGKA 3U7QB 2J5QA 1RM3A 2PWPA 2XDAA 1WUTA 3CKYA 3P52A 3TCXB 2H1RA 3DV0B 3FZEA 3SX4A 2L18A 1GU1A 2LXNA 3N5KA 3I4CA 4TRJA 2VDWA 5DHTA 1K3TA 3H1FA 5KQGA 4M9RA 2HA7A 1JWLA 1V4NA 3T9BA 4LW8A 1M0SA 2VDUE 4D9IA 4RTLA 4FCWA 1WD5A 2WIKA 1U9YA 2J3MA 5H82A 3V1KA 5IKPA 2XGSA 3UCXA 2ZAYA 5AOVA 4BFSA 1OR8A 3RWOA 1MD9A 3GW8A 1EM6A 4HJRA 2PX0A 3DL0A 1N3YA 4UTXA 4CYMA 4YRSA 4G1BA 3IPCA 1Z8HA 2R4QA 3C85A 1KEZA 1OI3A 4E88A 3U39A 4X8HA 1NXTA 2GESA 4F21A 1RXVA 1QIFA 2GARA 4E6PA 4C4SA 2Q5JA 1EYZA 4NYIR 4R7GA 4HH3C 1QK5A 2NWQA 2HNBA 2F2TA 5EJFA 4EM6A 3TAUA 2QDXA 4A73A 3QXJA 1ZAYA 2IHJA 2FPPA 3WGYA 1VFPA 4HOYA 3FVTA 1FPMA 5E6UB 4BVAA 3LGSA 5EWLA 1R3UA 1MX1A 3CG4A 4Z7OB 4HDNB 1NUPA 2WJAA 3WNVA 2GCGA 1JDNA 1V3TA 3G0IA 3F7OA 1OTYA 2J6HA 3ASYA 4K9PA 1W0JD 3ESZA 2PLFA 1KMHA 3A4TA 3UJCA 3WZMA 1L7DA 3BQNB 3KCNA 1QB8A 5B37A 3C2QA 1X19A 2IZ7A 4EB3A 1UT8A 1J24A 1K8RA 3WHKA 1BYIA 4M8IA 1K86A 2WNHA 1N0HA 3BD6A 3EEIA 2EBUA 3IJEB 1XMJA 1N25A 3VI4B 1Y9AA 5FRDA 1YDGA 4RM2A 1KAEA 1WNFA 2AG8A 3AEUA 4LYYA 3U3XA 4B6QA 1SZPA 3R75A 4ER6A 3TZLA 1EE1A 3BIFA 3M82A 2PMKA 1J22A 4L9RA 2ZJ3A 7AT1A 1GTZA 3UOAB 4IDPA 1V41E 1V5FA 2ZSEA 4UMDA 1PR6A 2NG1A 3T7EA 1NY6A 5D5PA 3LDUA 4XDYA 5LOVF 4KNVA 4HYQA 4JT4A 4Z0HO 2BSXA 3D0QA 2CDCA 2GJ4A 3KVVA 3RYHB 1HETA 3PRKE 2FPKA 5G4KB 4E5KA 4FZVA 4YPVA 1KOFA 1ZGCA 3CLKA 3CLTD 4MDFA 5AI5A 4GYYA 2EJBA 4BX2A 1KZ9A 1VE7A 3R3XA 1ZD3A 4IDQA 3TQQA 2RI0A 2QOEA 1RBYA 1Z0FA 1XXLA 2VYVD 4HYYA 1UAYA 1JDSA 3S29A 4YBRA 3GJSA 5JW6A 4MJLA 3B7GA 3SHWA 4RJIA 1U99A 1ZG3A 3P4YA 2AVDA 2HA2A 5LSAA 3OIUA 3DO6A 3CGGA 1ENZA 3PYXA 4QDUA 3OHMA 3QUCA 4JVNA 5IDWA 2C5SA 4X7PA 1BD3A 4OF4A 1H2AS 4GGMX 5GOZA 1THZA 3TDKA 5F64A 1C3VA 2COKA 3OT1B 2QTVB 4H6XA 4OBWA 5KYUA 5CH3A 2H4XA 1D2HA 4L07A 4WJKB 3AILA 2X3YA 1CPYA 3K9QO 4Y8VA 4IEIA 1GT6A 3ROQA 5B55A 1EGAA 1ZP6A 2XXBA 1SU6A 1JLSA 3K3PA 2ZGVA 4ND8B 3PXXA 1YT5A 2NIPA 3BTVA 3N76A 2P2YA 5I7VA 1C8LA 5LC1A 3RV3A 1R6AA 1OT5A 3HLYA 5FF9A 1BSVA 5DWQA 1QZ3A 4FZRA 4Q82A 5L53A 4LECA 2VTBA 4KPYA 4POOA 2ZUTA 5JBQA 2XIJA 1B8PA 1D2RA 3BGWA 1JYFA 5GJVC 3PLNA 1OYYA 4AF6A 3N86A 4GD3Q 4UBOA 2GMWA 1HE3A 4D2IA 1E58A 4LI3X 4LWZA 3UB4A 4C4XA 4Q7JB 3TR5A 4C7MA 3LXUX 4GZ6A 4U2BA 3ZCTA 4ME6A 4CT5A 1N2EA 4JV5B 3SDSA 3AVWA 3TIGA 2Q3FA 1DCKA 2C4MA 3WLAA 1IXRC 3C8ZA 2XCTB 1GITA 1QKKA 3H11A 5KWIA 1W44A 4R6XA 1TF5A 1R0YA 1I4EB 1KZ6A 1W8DA 2B8NA 2NQTA 2OZLB 2VF2A 2YZ2A 1N0VC 1FFSA 1SWVA 2KB0A 1KJYA 3AEQB 8ABPA 4MI1A 2WRZA 4ZVNA 2VDPB 1FJGB 2QMZA 4NOLA 2A0KA 4B6EA 4QPJC 3VR4A 5C0OE 3IGFA 2EF1A 2H2AA 2V7PA 2X41A 1SN7A 3WJ2A 3EODA 4TXHA 3FTEA 1QCDA 4W5JA 1Y4AE 2ZJZA 2GXQA 3IS3A 3H75A 3PITA 5I9SA 1ADGA 2HQSA 3T3MB 1X1SA 1U2TA 2YMMA 1TUIA 3OLCX 4ZT2A 3KL4A 4PLFA 2H1IA 1DT3A 1KBZA 4JR1A 3BSYA 1IZ7A 3DAFA 3A27A 3GP3A 5ALVA 2AEFA 3BZBA 2FOLA 3D5TA 1XK6A 1W47A 2VP2A 4KAFA 2I03A 4URVR 4FD3A 3RG2A 3BGSA 1HEIA 3L8DA 1AKVA 3KKMA 4FINA 5HOEA 2R5NA 2J48A 3RKUA 1RT9A 4UXHA 1OC4A 4FCCA 4JJ8A 2XZOA 3BXOA 4I3HA 5JAOA 4C4AA 1RQXA 4IGIA 4IEEA 1GA1A 2IIPA 3ST7A 2PWBA 3ZHOA 4UU8A 1UBKS 1G8HA 1G8MA 3ONEA 3CLHA 4LNHA 4NZYA 4OJNA 4Q6BA 3OZAA 5I9NA 3A6KA 2DHQA 1GZSA 2A9QA 2WD7A 5EE9A 3HTXA 4TKUB 4PIPA 5T4HA 2Q7DA 5JADA 4MWDA 4N4AA 2FMHA 4X6XA 1GFWA 1BX0A 3B9RA 2B37A 3FNQA 3JVVA 4E2ZA 1KPHA 4X1IA 4A15A 4O6VA 2I4NA 2C82A 5CX1B 1UMKA 1UPUA 3IEVA 1BS9A 1L6RA 4Z8XA 5G3YA 3PTLA 1I8TA 3CKKA 2IWRA 3GBPA 4BO6A 1XWFA 1DRKA 4IRUB 3FBGA 2K5UA 4PINA 1UP7A 1U7XA 3LCMA 3FZNA 1Y5IA 1KSJA 4QAQA 4RFVA 1N4AA 3WQRA 1GZ3A 1XFAA 3ESCA 1S3FA 5C8YF 3C74A 3SQXA 3PPYA 4I9HA 5CDSA 4L8VA 4B4DA 4B79A 4DDMA 3HXKA 1MABB 1J09A 1G5QA 2WSSA 4PRZA 3L1UA 4MVCA 3NDBB 4RIGA 3K8OE 4S1PA 2Y1WA 3RAJA 3QLUA 3ABIA 3V3TA 1PVVA 2IX9A 5DM1A 4BP8A 2ZVDA 1ORWA 2FHPA 4FHGA 4E6EA 3AEKB 4DLVA 3OTIA 1A95A 3HB5X 4B71A 2OENG 1RC8A 3MWDA 1L7PA 2FSHA 2WF6A 4RHCA 4CVNA 4URFA 4F9TA 4JI0B 5FUWA 4CWAA 4GE3A 2ATIA 1CY7A 2C5AA 5J2TB 1NAHA 5HE8A 3U16A 1ACLA 2WE7A 3ET4A 3LCUA 3AR8A 1ARZA 4J4BA 4HYTA 2D2IA 4EHBA 1A5SB 4I6GA 5CK5A 4I55B 1YQUA 3TZKA 1E9FA 4C4TA 5CX1A 5F7OA 1MAWA 4NSNA 5JD6A 3IUMA 4EY3A 3YASA 4R51A 3W8FA 1N0UA 4OXQA 3BFVA 1JLLA 1XRJA 5CP8A 5K7SA 4D9EA 5EWLB 1T13A 4XM2A 4KIFA 5JDCA 3GRYA 1DEHA 1SBQA 3K0CC 2IHZA 1JU4A 1MJGM 1WMBA 2B21A 1WXGA 3E5MA 1DELA 4N5DA 3S0JA 1WXWA 3GOQA 3HH8A 3OU6A 1RJDA 3PX2A 3QWHA 2MYTA 1QS0B 1V9CA 3FPEA 3JVDA 4ZQCB 4ZDWA 1KFBB 3IAS6 5AW4A 2BKAA 1T2CA 3HKBB 3AR6A 2F1HA 2EFEB 3ESDA 3KYCA 2A4MA 2VJMB 4ODIA 3RSZA 3SC2A 1QGUA 2A0UA 4XSVA 3WAKA 1XA0A 9LDBA 2DQYA 1VLHA 3PDCA 5HDBB 3VR3D 5KZMB 4JJEA 2QBYA 2XB2A 1KYIA 1J7JA 2JRLA 4MV8A 3P9CA 2IYWA 5CCDA 2ZYRA 1VL1A 4MARA 4IF6A 4NP6A 5IAKA 5KKAA 1U2GC 2CNDA 4HWKA 4CMAA 4DRYA 1L7XA 4RTJA 3VKHA 2X0EA 2B4QA 4B6OA 4R8RA 3L0SA 1NULA 3C3YA 1KYXA 5PNTA 2OV2A 1QF6A 1WB5A 5JAQA 1Q19A 5HCNA 3KTOA 4IZHA 5IDVA 5CPBA 3T7IA 1MO5A 2P3QA 1LW6E 3GPDG 4WUVA 3ZX4A 3DE1X 4PVDA 3DG9A 2O8DA 5KIAA 4N0PA 4TQ9A 1TJYA 2OGZA 3GN1A 3TNDA 3V7NA 3LLUA 2WMYA 3IELA 3LUHA 2FPUA 1IN8A 1QUFA 3KKPA 2R65A 3E9NA 1A04A 4JI1B 3SC3A 3W5IA 2IEDA 3EFOB 3K0BA 4GX2A 2A9JA 3AR4A 3OOEA 4GZ3A 4ZXPA 7GPBA 3PDUA 1CE8B 1L0BA 3H2HA 3RVRA 5BYAA 4YB8A 5C53B 1XAGA 5JDIC 3UOGA 3OFKA 5TPZD 1E1QD 3TNLA 2ZBPA 2ZU6A 2FPGA 2C3YA 2V0CA 3WWYA 4DJAA 2JH8A 1OI2A 4MO2A 3CLTC 2DUUA 3PU6A 3RIMA 4E7OA 2EG5A 3JV7A 3K6SB 1M34E 4BQEA 2J9ZB 1IBCA 2PX5A 2C20A 4LIPD 2XQJA 4UQLA 5L3QA 4X97A 4YXWD 1UKCA 1BXKA 1F8XA 1H1LA 5B6IA 1CDDA 1VA4A 3PC3A 4XUCA 4XJXA 5AW5A 4F0JA 1GGEA 4G9EA 1Q12A 1JJBA 3UB3A 4HUQB 3T99A 4CMJA 2ZPTX 2OBLA 1UWKA 4OP2A 5I7FA 4IDHA 5KBYA 2BR4A 2P6PA 3AEXA 1TZKA 2HTFA 2ZSHA 1YQQA 1NJ8A 4BQOA 4OYLA 4DA0A 2PQMA 1SR8A 2CXNA 2Q46A 2JFHA 4F86A 4IQ8A 1NQOA 1C7EA 5DN9A 1BX3A 1OXSC 5DCYA 2QX4A 1UMCB 2IPLA 1DG3A 1CUVA 1YOVB 2B3DA 4Q9NA 2HC9A 1WNTA 1XNHA 4W7HA 3U26A 4Q21A 5BSEA 1CQIA 1WZEA 1KQFA 4TVBA 4RFSB 3CVXA 3LO8A 1T5OA 1AQ6A 1ECGA 1H2FA 1H0HA 3LBHA 3W4JA 1GPWB 4EF4A 4QQKA 4D5GA 2OG2A 3PUVA 4BO3A 4KMRA 2ZCJA 4ZVOA 1XRLA 4BDTA 3VC2A 1E1MA 1AKUA 2FZWA 3BE6A 1UUFA 1EUZA 4EK9A 4XQGA 1PW7A 1TVCA 2QQFA 5E4FA 4LJLA 1PQPA 2C9DA 1V35A 2NO5A 3UENA 1KZ4A 2JAQA 1UBMS 1GUZA 2I66A 4L51A 4ZRNA 4YQEA 6AT1A 1YR6A 3WYDA 4YBZA 1K63A 3PJDA 1Y33E 4PYRA 4BFVA 1QIKA 4Z4CA 1A9OA 4DSTA 4DE5A 5SZIA 1A7AA 1NBMA 1QK3A 3KHSA 3BCRA 3B8HA 4OMFG 4RHUA 3IB6A 2VYQA 5G0VA 1TAQA 3O9MA 4IIDA 3M49A 5LVAA 2E4AA 2NUPA 1ZJJA 3AR7A 4HZGA 3FWNA 3DE4X 3E61A 4G0NA 1XUOA 2ZTVA 4RELA 2BTEA 4ANFA 5SY6A 1EGHA 1MP0A 4NARA 1K7XB 1J8FA 3VOBA 6PFKA 3KSZO 4FOTA 1US8A 4CKBA 1DIRA 4GT1A 4YRMA 3TTXA 1V6CA 4IFEA 4KV9A 3EC2A 4PE5B 4DMCA 1X7XA 4H3VA 3G85A 2QQEA 3PDIB 4OB7A 1VHWA 3DUWA 5I8ZA 1N36B 4KE9A 3L5KA 5B5SA 4QHSA 3WLPA 4I4NA 2EW2A 1NY5A 2G4CA 3EA0A 4AQDA 1MC8A 3A14A 3GG2A 4CCSA 4DR3B 1BTOA 5AK4A 3UO8B 1LSUA 2ACEA 1N2XA 1T5LA 5TQ2B 2D74A 1F9EA 5DHFA 1UBSB 3ABOB 4OHRA 3U7GA 4V1CI 1F4VA 3FR7A 2UZ1A 3HCAA 3PXGA 1Q3TA 3VHLB 4D4KA 1SB9A 4B7UA 5IM4F 3DZGA 4H7FA 2E0IA 2A86A 2C78A 2NM0A 3IV6A 4Y6QA 1TU0A 1LNZA 2EKPA 1Y6JA 1MOSA 1Z4JA 4LXGA 4NH4A 2P27A 4LG1A 1T9GR 2NQ2C 1IDN1 4PQRA 3B3AA 3M4YA 2XTNA 4LRXA 3LX6A 5GM2A 4ONEA 1J1IA 3KU4A 4K6CA 4X20A 3A70A 2QNBA 2QZ4A 1IZ9A 3KR9A 3KZCA 2VJKA 4UW9A 4UCQA 2EBFX 4NK4A 4URXR 1P2TA 2ZR9A 3AFIA 3PD0A 4KXYA 4JASB 3R7WB 3CV3A 3TL2A 4C03A 1KYZA 1M8FA 5I7OA 4RVSA 4Y18A 4HGPA 2HHHB 1EGQA 3K0CA 1P5JA 3GRZA 3JQQA 4Z86A 2X4LA 3OP4A 1Z0ZA 3RFTA 2P2DA 3QFFA 4FCTA 4IMIB 1N6LA 1QIDA 2VPTA 4H3HB 3U0VA 3KOWA 4H1TA 1LPNA 2O3JA 1NNLA 1DHRA 4C07A 2Y2VA 2NU6A 3LU1A 1MB0A 4LSGA 3AUUA 4DCVA 4R83A 1J99A 1VG1A 3SIPA 1U28A 1Y1LA 3W0LB 4X62B 1UPFA 3ZD9A 3ZBQA 4FJ1A 4MYRA 2QGNA 1M8PA 1FYFA 2VJCA 3Q88A 5EWMA 3RUIA 4QGSA 3ANTA 2CD7A 2GZRA 2O2JA 1F0PA 1TADA 3JD3A 2FFBA 4FFOA 4GG1A 4TMVA 4UPDA 3DHEA 5HGXA 1TT7A 3H5TA 4B82A 1W36B 3LBYA 5DCLA 1WB4A 4AO7A 2CNNA 1UEJA 4JYCA 1PKXA 3AHIA 4RGVA 5HDQA 2QTCA 3AIMA 3DW1X 3EJ6A 3U80A 4EJFA 3ESRA 4YMVA 4YUYA 1DC3A 5FNVB 5BMVB 1CZOA 2HPVA 1Q1ZA 1DL5A 3KAJA 2MSWA 3LKVA 3LWBA 4L6IA 4M0LA 2G5TA 3QHQA 1P4HA 3KEMA 3PIDA 4ZVVA 3TR6A 1NUUA 2J7PD 2QMHA 1IY9A 3W5UA 4EI2A 5LOVA 1GNRA 1MO2A 1Y6RA 2Q0SA 3N2KB 4RZ2A 1OW3B 4B2LA 1SOUA 1XJ0A 2XHEA 5IK2D 1P60A 1B3BA 4JCOA 1ADJA 4OIMA 4JL8A 2BOVA 1Z83A 5IKEA 2ISQA 4G67A 4PGHA 1M73E 3B2EA 4LYHA 2PNFA 1RJWA 3PQEA 4YMHA 2CV1A 1WDWB 1ISMA 4XB2A 5CW2A 1BH2A 4J3NA 1YTLA 2GPWA 2W8ZA 1R4ZA 2GK7A 2W2VA 3O74A 2CE7A 4HNGA 4LBVA 1TT5B 4Y2QA 2XVXA 2WQ6A 5H9VA 2MSKA 4GKKB 3FJOA 4ZCQA 2OD9A 2FN8A 1T0BA 3BRWD 4QPCA 2HQ1A 3EXG2 4CN8A 4PC1A 2V45A 3SHQA 4UHEA 5ADVA 3QEBZ 4QDZA 3FTDA 1G5RA 4FZ3A 1QMGA 1I30A 2GD1O 1ZU5A 3T1HB 1HFJA 1OFVA 4ZPXA 3IKTA 4WCFC 3EPHA 3PE3A 2HMVA 1AHIA 2HQOA 3PFFA 3QUQA 4G4IA 4LBZA 1IDOA 4OYHA 5J59A 3TZ6A 4AIRA 3QXCA 5KMGB 4FWTA 1P4GA 2HBZA 5CXQA 2YUTA 4L08A 4U2EA 2YYAA 3PWTA 4II2A 4WBSA 4DBLE 4BXOA 2IXGA 3C3JA 1L5GB 3FPFA 5DHPA 1SXJD 3PTZA 4WN9A 2NX2A 3PHGA 3G5MA 1K97A 2AK2A 1RI5A 4EG8A 1PK9A 4OFZA 1MV8A 4A23A 1QSGA 2DQKA 3OX3A 5TC4A 1D1TA 3RWMB 2C8KA 1G1MA 5A6VA 3KB2A 3TTSA 5HKOA 4UE2A 3AL0C 3NATA 2UUCB 1QAOA 2VF8A 3CLSD 4X7BA 1Z2EA 4P4TA 4AUKA 4XJVA 1JR2A 2JI4A 4IIYA 4FFPA 3DV0A 2FFAA 1ONOA 1CFZA 4E5DA 5MN4A 1JIXA 4W8GA 2CFCA 4CG1A 2GKGA 3EFHA 4NZNA 1KIAA 2OCBA 2B1GA 3G2IA 4NEGA 2VH2A 1X8XA 5CVUA 4MS1A 4CLOA 2C00A 2QTHA 3A4YA 5DU2A 3BPSA 2PUFA 1S89A 5JALA 2WJ6A 3CMMA 2CDRA 3EGCA 3RHSA 3GT7A 1T3ZA 4I5GA 4WNIA 2O6HA 2JGDB 1ENYA 4S12A 3D6NB 5IYZB 2X6QA 1ND6A 4DNOA 1MT0A 3WMXA 4F7WA 3AM1A 3GJ0A 3JRNA 2VBCA 4HXGA 4RXUA 1ZUIA 3EE6A 1QHXA 3OZCA 1JNYA 3M9LA 3VM6A 4MMZB 3PGXA 4L4UA 5IW8A 2IH4A 2P4SA 4U8HA 4RA6B 1EG2A 4IV8A 4XPIA 5HUQA 3BC1A 3QLUC 3RT1A 6REQA 1P7CA 4RD1A 1E1LA 3WZLA 4CM5A 2G8NA 2IHYA 5K4AA 2HRZA 4ETIA 3C43A 4WOKA 4XD7D 2ZFUA 5G0TA 1S9HA 3SJ7A 1KWGA 2XA9A 3RVDA 2QT0A 4V2IA 4M1MA 3P5BA 1P9NA 3NHRA 2QBYB 1NBAA 3H3JA 1YV9A 2VSYA 2ZT5A 3IAUA 1A7KA 2GD2A 4MVJH 4QOGA 5ARDA 1JDTA 4U3JA 2FQWA 1LXCA 2BEVA 1XCMA 1XE3A 3O4JA 2B5OA 3GCXA 3N8IA 1FSFA 2QRKA 4EPVA 3P0FA 4BMDA 2JD2A 1Y8QB 2A57A 1E4EA 2W6NA 3TPZA 2NTVA 4ZARA 3LE8A 2VNIA 4G65A 5HGJA 3E7FA 2HHJA 4OFBA 1S4QA 2YXEA 3EFEA 4KQMA 1L7QA 3MXOA 1GGNA 1EFUA 3KXDA 3O4FA 4JX9A 2XD4A 3KVYA 4MQUA 4WZ6A 5DZSA 5ITSA 3HZRA 3PWKA 5CDUA 5IBPA 3GLHE 5TMEA 1U7ZA 3BIJA 4J9VA 3KELA 3QLEA 1KH2A 2CL7X 1P2BA 2P9CA 2B6HA 1FJHA 2BKVA 4PYOA 4YI3A 4C5BA 5CA1A 1ZVKA 4J7XA 3FLBA 3Q4GA 1OXMA 4ZCPA 3L7DA 3MTDA 4LE2A 1GG8A 1LY1A 1CVLA 3GY0A 2I3GA 1OF1A 4MVJG 4QQRA 2OFFA 3VX3A 5LP1A 1GP2A 3GELA 1N0IA 1N2HA 3RAEC 4LZAA 1G7CA 1E9EA 1BU8A 1RU3A 4J8PA 2AJ8A 1U0NA 1TRHA 3FGPA 1TAGA 3WLFA 4YCBA 1U0OC 3CZ9A 1O03A 2CJPA 2J0VA 3KSAC 2D06A 3RM3A 2XOXA 2QRZA 3E3AA 4KQFA 3HDQA 4Q01A 4XIFA 1XF9A 1GSAA 2ECQA 3PHJA 1IU9A 2ZWAA 3EOAI 5F78A 3QLTA 3KG2A 2E3JA 2CLMB 3OZSA 5IH3A 5GVSA 5H7XA 4DHEA 1U0BB 3AVTA 3DVSX 4I5EA 1WDKA 2HSWA 3E1GA 3BJIC 3MJFA 4POAA 5EKSA 1CW2B 1NFRA 4Z9YA 4W1QA 3LQ1A 2WTNA 4LK3A 7MHTA 3LH5A 2WE8A 4QNMA 3TEJA 1OIWA 3ZJ4A 3JWEA 4L78A 5IVPA 3I6IA 4ZU6X 4HAIA 4F6CA 3K9FC 3NJ8A 3DL4A 2OFXA 2DU8A 3LX8A 3TG2A 3R8FA 2O3SA 4NV0A 2MU1A 1D4OA 1Q1NA 3EEFA 3GJTA 2H2HA 4G5RA 3K2BA 2KX7A 3UFXA 4G8DA 2DXIA 3K30A 2HT1A 3EF0A 1RYZA 1DG1G 4HHEA 1EK2A 1M10A 1OX5A 2HRBA 5A1JA 2JARA 5D6NA 4A10A 2BP7A 4O2AF 1CDZA 3IVCA 2Q1UA 3JRXA 3GPLA 4NU6A 1NVFA 4D4HA 4I55F 3OBBA 1YOVA 4N5NA 2IFTA 1J56A 3DL2A 3GLFB 1Y42X 2ZRKA 3ED1A 1GZDA 4Y1RB 4HTFA 3Q3GE 3VKUA 1D0VA 3OX2A 1HZZC 3AQ4A 3ONDA 3ANMA 3KD2A 4I4TF 4E09A 2P5YA 3CMCO 5JOQA 4Z53A 4FW9A 1HDIA 2K4MA 2CEAA 2BPOA 3WQHA 1EXNA 1DKUA 3G68A 3FWHA 1SKMA 2QZ9A 3S81A 1ETHA 1HL3A 1D8TA 4IOMA 2EAUA 1FMCA 1HQKA 1PD0A 3CUUA 3U09A 1VLLA 2WMDA 3QTTA 2CNWD 4TXLA 4BLVA 3A1CA 3SXPA 1P0PA 3COJA 2A14A 4Q4AA 4EB6A 4G5GA 1NHGA 4HN2A 3V46A 2QVGA 1TEHA 1YS1X 4N48A 1DQYA 4LZLA 1PZMA 2H4FA 5EUBA 5A4IS 2ZUWA 2P6UA 1O7JA 2G5CA 3ZU4A 3CUSA 4BU0A 4C0SA 1EVLA 3G0OA 3NAGA 1NXOA 5C4MA 5BMOA 3SC4A 4Y9UA 3QVJA 2ACVA 1TC2A 1WMSA 4FEYA 5AW6A 4J7CA 5TX7A 1YZUA 3ELDA 3DFKA 3BGDA 3Q9LA 2CFTA 3DVRX 4UCXA 4UFNA 4C88A 2I87A 3IIEA 4REQB 4V1CB 2ZIWB 3D8RA 2PGLA 3TCNA 1E0DA 1TYEB 2A58A 1ZK1A 3PJFA 1WXHA 4MI9A 5LYJB 3DZHA 3IRUA 2REQA 3IDZA 2DUJA 4RTKA 3IAS1 1SQ6A 5L7YA 1F8GA 4QFMA 5TJHA 3WHIA 3PNVA 2PGJA 4Y7DA 2O5CA 4GM0A 1E59A 3G2QA 3C3EA 3TWOA 3ZY3A 4W7IA 3ILXA 4F1KA 2ZJFA 1Y9ZA 2PUTA 4IIXA 2VDKB 2YICA 3HGQA 3NM6B 3H2ZA 4LV8B 2I8LA 1XMXA 5A5DA 4ZZ1A 5FO1A 4BAZA 1ZK2A 3OSUA 2VZ9A 1FTQA 4IO0A 2EERA 4U7WA 3O93A 1WCXA 4G26A 2AR7A 2ZI9A 3W1VA 2DWCA 3H86A 5GVRA 4D8VA 5SICE 5L6LB 3TM5A 4F1JA 4JJ6A 2Z43A 2ZVPX 5FFMA 2H1HA 3EXFA 3R6DA 2YHSA 4UTZA 5JYEA 3MHTA 1KP2A 2CKDA 4ACAA 2JDIA 4CDMA 5K8CA 3RLFA 3DEAA 2IZ0A 4ZA2A 2A5DA 1U0GA 3B48A 3PZBA 2DLCX 1LTHR 3BXGA 3C45A 2C1EA 3OECA 4ARIA 1XZNA 1T8YA 2YWHA 5KWVA 1ZY2A 3O8NA 1EGMB 3CCCA 2UYYA 3IR5A 3E9RA 2XGMA 3O92A 3RSFA 1KZYC 4Y67A 4R9VA 3TSOA 3BFPA 3DQPA 3OFNA 3F97A 2FPLA 3IBFA 2WP8J 3QV1A 1SC6A 4BMYA 1F2DA 3MCUA 4JLAA 4ZDJA 5CLIA 4IO1A 3OEYA 1FUIA 4OXKA 1UPTA 4YV2A 1UXJA 3ZKWA 4A8JC 2Z8XA 3QNWA 3HXLA 3HSKA 1AQLA 3PYLA 3QXGA 5EHQA 3QE9Y 3LZ6A 2QU7A 2K87A 1O5IA 1LLCA 1ZI8A 3P20A 1N2JA 3ZUPA 2RGRA 1AMUA 1FFGA 1HURA 1I0LA 5CLHA 3O91A 5FOQA 3JWPA 1SVMA 5FADA 2JLBA 3PFKA 5SYNA 3SSAA 3ZHUA 4H3SA 3R5TA 1ZMTA 2O20A 2EL9A 2CMDA 3FROA 3JAKA 1RCUA 2XVYA 3MD9A 4LOKA 1S8FA 4F3NA 1J33A 3COYA 1E96A 3ANNA 5K03A 4Y9TA 4GXRA 1AE1A 2JC3A 2PYZA 3NT5A 4YJFB 4RNCA 3A6LA 3FCXA 2NZ8A 5BSTA 4HNUA 2JVKA 3O0TA 4FGKA 1XMIA 4KWTA 4QPDA 4E32A 2Z6QA 2X5XA 5JXIA 4TPKA 2AQKA 4HDNA 5COAA 4YEDA 3O73A 4ZYZA 3LT0A 2HN9A 4C7BA 2VDMB 2ZXUA 4BVLA 2NT4A 4RX1A 4CODB 1I6LA 3L7LA 4QBTA 3FCOA 1L5QA 4G63A 4E3ZA 2ATEA 2V96A 1PUJA 4DTCA 3S44A 3UXEA 3P2EA 1DOHA 2QGZA 1AVTA 7ABPA 3ICOA 4UOEA 1VKHA 4BGDA 3FVRA 4NOMA 5TQ0A 1JIVA 2JHAA 1LK7A 2MTBA 5AHOA 2C77A 1K68A 1AS3A 2WPDA 4QUGA 1RRGA 4P7KA 2H4YA 3TLGA 3VZCA 8LDHA 1E7RA 1W85A 1EDEA 2JB9A 2NZWA 3MLBA 3ZW9A 3S1SA 4EZBA 2JFOA 4IFBA 5DOVA 4BWYA 1FLVA 4RABA 1RAFA 3WK8A 5EWMB 1UKYA 5BWMA 3EJWA 3MOGA 3ZZNA 4TN5A 4NEQA 5FCDA 2AXQA 3ITKA 2VDQB 3B3FA 1N6KA 4JLKA 4YX9A