2ZJ3A

Isomerase domain of human glucose:fructose-6-phosphate amidotransferase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
MKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine--fructose-6-phosphate aminotransferase [isomeriz
publication title Structural analysis of human glutamine:fructose-6-phosphate amidotransferase, a key regulator in type 2 diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj3A02
1NRIA 1M3SA 2PUVA 4DR5B 1I94B 2CB0A 4JI6B 1HNXB 4B3RB 3J80A 4JI4B 1WIWA 1DQRA 3Q88A 2ZJ4A 1HOXA 2CXQA 4X66B 4LF8B 2J6HA 4JI5B 1T10A 4AQYB 1X92A 3BCHA 3FJ1A 2E5FA 4DR2B 5BR8B 3M5PA 1C7QA 1U0FA 1IRIA 2O2CA 2PUWA 2V4MA 4DV0B 3OOJA 1N8TA 2CXPA 5LL6P 3CVJA 5IWAB 1TZBA 2UUCB 5LMUB 2VF5X 4JI0B 5FLXA 1N33B 2CXTA 3OTOB 2UU9B 4NXMB 1MOQA 1IBKB 1NUHA 5I01A 1JXAA 4DUYB 1MORA 2XBLA 1JEOA 2X3YA 3HJBA 1IATA 5IT9A 3JAMA 3HBAA 2E5LB 4X64B 1HM5A 1C7RA 4LFAB 3J7AC 2POCA 1X9IA 4M0DA 4DV1B 1VIVA 1VI6A 3IFSA 1XMQB 2HHHB 4X62B 1N32B 3G68A 3PR3A 2VQFB 4NXNB 4DUZB 3LJKA 2VQEB 4EM6A 1XNQB 3TRJA 2I22A 4X65B 3FKJA 1KOJA 1GZVA 1XNRB 1VIMA 4JI2B 2AMLA 4JV5B 4DV7B 2CXOA 1IBLB 4LF9B 4DR4B 4KHPB 4B3TB 5A2QA 1X94A 5BY2A 2VF4X 2CVPA 3NBUA 4YY3B 2A3NA 2I2WA 4LF6B 1B0ZA 2Q8NA 3TBFA 4LF7B 4TOIA 2UXDB 3T1YB 4GKKB 1X9HA 1J5EB 4LF4B 1G98A 2XHZA 4GKJB 2DF8A 4B3SB 4LFBB 3ETNA 4S1WA 1N34B 1TK9A 1HR0B 1FJGB 2CXSA 4LZJA 4JI3B 4DV4B 1N36B 2YVAA 4OX9B 3FXAA 2ZM6B 4DR6B 3I0ZA 4IVNA 4U6NA 3ODPA 1U0EA 4DV2B 4DR7B 4LFCB 2UUBB 4JYAB 1U0GA 3QKIA 4JI7B 1IBMB 1XTBA 4S12A 3EUAA 4DV5B 4DV6B 1JIQA 3T1HB 1HNWB 3Q7IA 1MOSA 2CXRA 2DECA 2ZJ3A 2UUAB 4JI8B 1VI5A 4YHHB 4JI1B 1ZZGA 1JLHA 2PUTA 2PGIA 1Q50A 4B3MB 1J5XA 3JX9A 4DV3B 2F4VB 2UXBB 2UXCB 2O2DA 4DR1B 3SHOA 4K0KB 3J81A 4DR3B 3BJZA 5LMNB 2WU8A 2CXNA 3C3JA 3KNZA 3UJHA 1GZDA 2CXUA 3FF1A 1XMOB 1TZCA 4AMVA 1HNZB 4LF5B
chains in the Genus database with same CATH superfamily
1IOVA 1M3SA 2ZSAA 4K7JA 2GS9A 4EX7A 1Q7BA 5FAKA 2BSXA 3MAGA 2XNSA 4N3GA 1BFUA 2D1RA 1QGOA 2P6PA 4PPNA 4F3NA 2PS9A 2FUNB 1TECE 1UQTA 2PPLA 1W4BA 2LNDA 2WFAA 3WLRA 2FPMA 2ZTSA 4AG3A 5IAOA 1P1CA 1X92A 1P9WA 1YB1A 1B4DA 1XLTA 3TTUA 3IVAA 2D7CA 4IJVA 3TSCA 4DMMA 4M9SA 1DP4A 3TNLA 2P90A 4KWHA 2JZNA 4UEQA 3DMDA 4BC1A 4Q4CA 4JI0B 3NNDA 3BE4A 4KZPA 4LMAA 4LYEA 3LK7A 2JLSA 5FTWA 1Z83A 4TSFD 3L79A 1K06A 2F43A 2R6FA 3AY6A 2C7QA 1FA9A 1XZJA 4YROA 2XLBA 4CQMB 4EUKA 4KPUB 3ZJ5A 1SVLA 3D5QA 1EQ2A 3UN1A 1UJBA 2JZOA 4QIHA 2G40A 3VHLB 3NVMB 3ZKWB 5EMHA 4LJ6A 3D3WB 3IOMA 1YFJA 1BVHA 5CT6A 2YIVX 1EFHA 1I3OA 1QHHA 3PL1A 2F3UA 5T7BA 4WAUA 1TM4E 3T54A 3KQWA 4W7IA 1P4SA 3HABA 4HUQA 3DMGA 2VA8A 4A2WA 2NU9B 1XIVA 2WUDA 1INLA 4QAQA 1T9BA 4A5OA 2XF2A 4ZDWA 4BFVA 1T5HX 3FMGA 1SKMA 1J1UA 2O8DB 1MTOA 1JTVA 3AKEA 3Q2KA 1K98A 1SA0B 2XGOA 3FRJA 3SBDA 1RIFA 3SSMA 3F4KA 2FPXA 3BX1A 3M3DA 4AKEA 3IHKA 3X1WA 3MTGA 5C4MA 4A36A 3UCEA 2E4AA 2V59A 3AJ8A 4BO6A 3GK3A 1JQJC 4IUBS 3WYGA 1JLKA 2BLNA 4DLBA 4DG5A 2AFVA 1E2EA 2RKBA 1ODLA 3KJHA 2QJRA 1F14A 2PD3A 2XMGA 2WHRA 2ZUEA 3RAGA 3AZPA 2FXVA 3CMCO 4O4LA 1VZ2A 2FU5C 2GZ2A 3IQGX 3SYRA 4JC8A 2MSDB 4IFTA 1U9JA 4PZCA 1C7JA 2Q2OA 3I9LA 5H83A 4B6GA 3QEBZ 3QE3A 2PSJA 1LS1A 1VKRA 5REQA 4EPXA 3PTAA 1PZMA 3A0UA 2AXPA 3DFKA 5LB2A 4TKVA 3SM3A 3FTQA 2C9YA 1KH1A 2VIIA 3IEIA 4HFMA 3ILHA 4TXJA 2J0SA 3C5CA 4U6QA 1A2QA 3GVPA 3EDQA 4GOJA 1LCIA 2B0CA 2ZRDA 4XW2A 1DPFA 4YJ3B 4DSTA 1C41A 3F9CA 3UT0A 2HQBA 1AN0A 1KQPA 2B5VA 4XCXA 4L3WA 3TIVA 1C8BA 2V4UA 2JGNA 2VDRB 3E5RA 2WFMA 4L0DA 5ALSA 2EQ5A 5ARDA 5HDBB 1G8PA 4BFUA 2B1QA 3MRSA 2DBRA 2GEKA 4XRGA 3VR0A 3U7HB 3E8MA 2ODPA 4NICA 3R75A 4BLTA 3BB3A 1Y6GA 3JWPA 5DTQA 1LY1A 1EM8B 2NO1A 5HMMA 3QVKA 3UJHA 1XBTA 4BIIA 2MSCB 1GZDA 1V35A 1LVGA 2WWWA 4IDFA 2V7QA 1H3FA 1UBLS 4L2IB 3WC4A 4JL8A 2H7YA 3C8DA 1E96A 4TMKA 4N7RA 1FFHA 1RAIA 5SY4A 4KQ1A 4BP1A 2HRCA 3TQIA 5IRCD 1AUQA 3KJNA 3E84A 2AX3A 2VNJA 2ZJ4A 1VHTA 3L93A 3O4RA 3PHBE 4ML3A 3CC8A 4S3MA 4AVYA 1X0VA 4U8HA 3DM5A 1L4KA 2Z5LA 5CNKA 5TPWA 3I2YX 1Q1BA 2PTGA 2Q6LA 4MUJA 4MVJP 1JILA 4X94A 2JGAA 1FTNA 3GP8A 4HXEB 2A59A 3L4BC 1VG0B 2IEDA 1FOEB 3QBDA 3U17A 4CIYA 1N33B 1PQWA 1HY3A 2F00A 3N28A 3OWOA 3EZLA 4EZEA 4TWZA 1Q1GA 4EB0A 4BRWA 4I5DA 1NW5A 2CD9A 2V98A 2VPTA 3ESRA 3PGA1 4MITA 4N8SA 1U80A 3RQSA 4UPEA 4DDHA 3H65A 5KOHB 1ZX1A 2IHNA 4FE7A 4C6RA 1HRDA 1SXIA 4H6XA 4NE9A 3QOXA 3SEFA 4C03A 4BJ3A 4C88A 2V0GA 1J25A 1GGVA 2O3UA 2YWXA 5E1BA 2QD2A 3SZGA 1H2FA 3LUFA 2ECOA 5DISB 3RROA 4B40A 4YV0A 1G6Q1 1MJ5A 4YJGB 4HADA 1QQ6A 4IUYA 4P3NA 4KAJA 2X2FA 4M3NA 4DEVA 4RETA 1ODTC 3ZU6A 3NALA 3JTMA 3GW8A 2LCFA 1XNRB 2JKZA 3DWFA 4GP6A 4YLGA 4MEBA 4ZVMA 2ZRPA 3WGUA 1BCRB 1NASA 5TT1A 4GFDA 2OCXA 4XZ3A 2F62A 3LC1O 3JRXA 5DN9A 1J0DA 5KX5A 1J1ZA 3QLUC 1W25A 4F3CA 3QHPA 4F2WA 4NCAA 2NP6A 4H16A 4IXWA 4N6NA 1XTRA 3Q9UA 4BGDA 5K0ZA 2O8EB 3LQ2A 3VR3D 5FYQA 4AMZA 4RVOA 3QV2A 3V1LA 2SKDA 4K05A 2EWMA 3S99A 3BDIA 1FTQA 1Z6QA 4LNHA 2BJWA 3HKEA 1VJ5A 1Z7EA 4HRXA 1DAEA 1I0IA 1LF0A 4CQLB 3IAM1 4HNUA 2RC5A 3Q40A 1K6IA 1LDEA 1NW4A 2WJYA 3G88A 4KO2S 3W1VA 5FUQA 4DV4B 3ENWA 3EIFA 1E5VA 2MU1A 4D0SA 1DZIA 2AJTA 1G63A 1SUWA 2VJOA 2R6CA 3U3JA 5EHZA 1XRPA 3HA5A 4B7XA 5B12A 2P9HA 4JT4A 3T3GA 3ZLVA 5BSWA 1GZUA 2XVMA 3CF0A 4LC9A 1XROA 3VKFA 2ONZA 3H42B 1X42A 1EVIA 1JLLB 2GBCA 1NQUA 3IUYA 1FQKA 1KDYA 5BNIA 4FKMA 2JLUA 1JJFA 4IILA 3WQBA 3U4QB 1RZRD 2QUKA 3HNRA 3DZIA 1H1LA 3Q7IA 1LTHR 1DAMA 4MB0A 4NV3A 2P68A 3ROFA 1YRLA 5C0OE 3USZA 1VTKA 4EGJA 1MGPA 1Y5NA 3WGTA 3TTWA 3WHKA 1LWOA 1JTEA 1ZO8A 4GPZA 3VGPA 1N2XA 1O58A 1TFUA 2VEOA 4DV3B 4HTAA 3KZ1E 4DIBA 1JQLB 2XEXA 2Q1SA 2I6GA 3SQWA 2XYRA 3K8ZA 5LP1A 1U7XA 1YBFA 2P75A 4J0EA 2AZTA 4JROA 1CUHA 5J5CA 1EAMA 3QITA 4MS4B 1MENA 4I9HA 4OQNA 2C2OA 4X7MA 1GNLA 1DEHA 1QH8A 5E2IA 2PUHA 3RS7A 3TXXA 4ETNA 3LY5A 3CO5A 3RG8A 1DAGA 3F90A 1AV7A 1LUAA 1NQXA 3C4JA 1NMZA 5F3DA 2XDQA 4M8LA 2P6UA 1M2HA 1NBMD 2Q3LA 1CY8A 4HWOA 3V4LA 3LO5A 1RQRA 3HDHA 4XB2A 4R5MA 4A9AA 1W6RA 4CTNA 2F7SA 4IIHA 3VR2D 5F7XA 1KVTA 5FTLA 3INGA 1TU4A 1LPOA 4KN9S 1YZHA 2HA6A 3CVWA 1FDUA 2A0KA 4LC0A 4FXOA 3STXA 3ZVLA 4QQKA 3WZ2A 3VDRA 4CE6A 5EJIA 1XQ9A 4Q9LA 4DSZA 5K3OA 3PIIA 1XT6A 1D2MA 1RYNA 1SVMA 5H5JA 1PR4A 1RM4A 2OC9A 1EWTA 4C7BA 4RTNA 1V11A 3TLJA 2NVOA 3DHYA 1IBKB 5A4MS 4CXMA 3LDAA 4D9HA 2GH1A 2ZIVB 5E3JA 4TYPA 2D4AA 4LCJA 2FMFA 4XYEA 4DIOA 5GGYA 3A1VA 3EISA 4QYIB 2H4YA 3H2ZA 3EZ6A 2C0QA 4XOIA 4AYXA 4C06A 2BSQA 3IHLA 2E5LB 3I9JA 4XM1A 1YE5A 4UJ5A 1JSCA 5EIFA 3RH0A 2QVYX 4KRYA 2EXXA 2OK7A 1O96B 1XMQB 4HTFA 1SC6A 2VP5A 3RF6A 4JT2A 4P22A 5KVQA 2JIZA 3ZWCA 4ZN6A 1IAQA 1Z5UA 4J9UE 2VDPB 2OXCA 4TGLA 3PFGA 3KEMA 3T38A 1YUNA 2GOYA 2I3AA 2ZU6A 1CE8A 1JG4A 2EERA 4RDCA 2BF7A 5JSFA 5DYNA 3HBNA 1T3ZA 1T6ZA 4HWTA 2VJMB 3VHQA 4BP9A 1CEXA 1ECGA 1KETA 2A88A 1SC1A 5TT0A 2BKAA 1YNSA 4RA9B 3TXYA 1R4MA 1XDUA 3RC7A 1NFRA 3KUDA 3N8KA 3AYXB 4KBFA 4QXMA 4Y8VA 4BX2A 1M7HA 1MJHA 2JFPA 3G13A 2XTAA 3RSQA 4D57A 3AXTA 5IVPA 1DXQA 1PKEA 2ZP1A 3G2QA 1V48A 4II7A 2C8LA 4FYVA 1KPHA 1HT0A 3VH1A 3ZGVA 4J75A 4L9AA 1B7GO 3KOOA 4DLPA 1TO2E 1MH9A 1SBNE 1XZCA 5F35A 2BFMA 2R3SA 2O57A 1MNQA 2NTEA 1GRVA 4EG8A 5GOTA 4E51A 3JD2A 4AJOA 4M1MA 1LPBB 1U2EA 3TEMA 4DR7B 4D25A 2OLJA 2VHUA 1G2OA 3U4CA 6REQB 1ZL2A 3PZBA 4MW9A 4JVMA 3MS2A 3A8TA 5U4XA 1WZUA 1Z2EA 5BV8A 5JS1A 3ZWVA 3EDCA 1MRNA 1Q3TA 1WKVA 1JHPA 3TR5A 1Y3AA 1H8ED 1UBMS 5NULA 2QN1A 5EHNA 2QD4A 1QIMA 5JARA 2HRQA 2PMFA 5SZJA 5K0TA 2J67A 3SHQA 4HNTA 3QH4A 1YZQA 4HDRA 3AEYA 4QJBA 3VO1A 5L7WA 2P6OA 4HLCA 5KYNA 2E4ZA 1YB2A 3CLRC 4NYMR 4CWAA 1P9NA 3PQCA 5JQGA 1JFTA 1A97A 3ELBA 4AP5A 1E2GA 1OFGA 2AN9A 4GOND 2VTEA 2NU8A 2BMVA 2VK4A 2PMEA 2WIBA 4FDLA 1QWOA 1JWLA 4PO3X 2IXTA 1LNZA 3LUGA 4QAJA 1CIJA 4G0PA 3BL5A 3LLMA 5JD3A 1SGWA 2FZ4A 2C7OA 3LQ1A 4Y3UA 3GYGA 4O4IF 2WAXA 1P4HA 1MDFA 3GF4A 4NMMA 1LPSA 1XJ5A 3PUKA 4G9EA 3GFQA 1S2MA 2JRCA 4LXUA 3K0SA 3LC0A 3RWMB 1H9CA 4L8LA 1LDGA 4HDKA 4PQRA 3UWMA 4QT0A 2GZMA 4TTPA 3PZRA 4PGMA 1F3LA 2ORIA 3ITNA 3O1JC 3H05A 1K75A 3OUUA 1JYFA 1VRVA 3RRMA 3ONDA 4X8MA 4ZEMA 1UFKA 4UM5A 5IX8A 3ZDRA 2HSEA 3O8CA 4QREA 5D8DA 2CF6A 1ENOA 2F17A 2YVQA 4PG7A 1NC3A 3IJRA 1YB6A 4L6CA 5CEEA 3HM9A 4TLLB 3WICA 1TM1E 1NOJA 3BIOA 1VDMA 3FFXA 3F96A 1R0KA 3IURA 4AS3A 3L7YA 1TUGA 2DFNA 3BH0A 2XT9A 4CMEA 5B64A 3UAYA 3ZIDA 2CVHA 3PQ7A 4RIGA 3W9YA 1FUYB 2HQSA 3N2NA 4IDDA 4QGGA 5JAQA 4A0RA 3RYCB 2ZSEA 3SICE 4W8OA 5AOAA 3N0XA 3QVUA 1H6AA 3BCSA 7YASA 1AKUA 4XUCA 5KEIA 3FYCA 4FOOA 4G41A 3FWKA 1A50B 2FI1A 1H66A 3QXJA 1FU8A 1E0JA 2CVPA 2XBUA 4KVFA 1NYQA 3BXOA 1JFFA 3BRCA 4IF6A 4RQTA 2VSXA 1SXGA 2G7MC 1Y3DE 1NU8A 4TL8A 2PBLA 1YBAA 2WG2A 1M2JA 3Q7SA 4OBBA 2GFHA 5FWYA 3PXBA 4MV6A 4U5QA 3L05A 2ZAIA 4M1QA 1EUZA 2GN2A 1JHAA 5LKAA 4YWHA 4QO7A 4KFRA 1KJJA 1XZKA 3DP9A 3WR5A 3X2EA 4BDSA 2HXSA 2VFAA 2YWJA 4IH9A 3UWPA 3FFBA 5B6JA 1UBCA 5EJEA 1XZFA 1YR6A 1EA5A 4OXNA 1Y0BA 3DZGA 3ED1A 4D9FA 3HU2A 4WZZA 4I8XA 3MVEA 1FFCA 5C1BA 3DBHB 4TYMA 1LTQA 1SCIA 1MP0A 4FJ1A 3TNDA 1A0OA 2G5PA 4I5FA 5HOQA 4BJHB 3T5BA 2W2XA 2XWBF 4LX8A 3R7LA 1POWA 4CM1A 1MB2A 4ZI5A 1UMBB 3ZDXB 1LC0A 4LJ4A 2RHOA 4Z8YA 1TLFA 3RK0A 5K6AA 3ANSA 4HNVA 1UKYA 1KI2A 1LH0A 1WKCA 2A6PA 4IDCA 2I0FA 1YMVA 1NLZA 4NZ9A 3C1AA 2OFXA 5F51A 3L1HA 1QX4A 5ALIA 1DCFA 2J5KA 3IV7A 2PH1A 3GPLA 1IULA 2C8VA 3SNHA 3EGXB 3A4NA 3NV7A 1V25A 4MR8B 4XPIA 2V7QD 2EFEB 3OQNA 4BO7A 2DG2A 7AT1A 3DBRB 1VLMA 4F5WA 4EYQA 3ZGXA 1KKUA 2KI5A 2PMWB 3B3AA 4N5LA 4UREA 3RVRA 3THWA 2YHIB 1MO6A 1O08A 2GQ0A 2YFKA 4WN3A 3DT8A 4CEJB 3RTGA 4YMVA 3AIIA 1U02A 4ZANA 1SHUX 1H9AA 4BLRA 2QRVB 5T57A 3TMAA 4ZKDA 3K32A 1I7QB 3NHSA 2GAJA 1M6NA 4TLBA 3BKWA 1XHFA 5ALOA 1S8FA 5KC8A 1DJNA 3PWSA 3TAHA 4E11A 1XLWA 1YAJA 1BC5A 2HHAA 3N2KA 4Y2XA 3U62A 1VBMA 1C8KA 3LHDA 1TUIA 2X14A 1W2HA 3GZ4A 3LP6A 4URHA 3AXSA 5FPQA 1N6HA 2HCBA 2VNIA 3LIIA 3MCZA 1QP8A 3AJDA 5JZSA 2B8TA 5CA0F 3G8AA 1JFLA 4KLRA 2ZE7A 1UQRA 3ZDYB 5JUWA 2C5LA 3WNDA 5DLEA 3SYLA 3I2GA 3ZXUB 5JT1A 3C5VA 2PDAA 3D6HA 3F0TA 1J9EA 1M74A 4Y2TA 5C3UA 2RC6A 1BH2A 2XD9A 1JEOA 1XF1A 3ZTTA 4KB5A 1PRYA 3KJGA 1QZZA 2ALJA 4AKSA 4Y2JA 4O2AF 1R0LA 5L4SA 3GA5A 2D54A 3PL5A 1WM1A 2ODWA 2RGUA 1CY7A 5B1DA 2RIRA 4BKMA 3OETA 1GD1O 1WBJB 1SH7A 2XYGA 5E6SA 3ZZNA 5A05A 4C87A 4J6EA 2GX6A 4QVIA 3K09C 1OZHA 1IIBA 5HA5A 3UJNA 4UEWA 3KE9A 1YC5A 3BPSA 1C9JA 2ZRHA 3BXEA 3OQMA 4YP0A 2DFVA 2V7TA 1E4YA 4E5VA 3EZGA 2JRLA 2PKXA 4PG6A 3UBMA 4UOZA 4YMLA 1WG8A 5JAIA 4ZT4A 2Q5EA 3WB2A 2X2PA 4YQZA 3X44A 1Z63A 2XKBA 2Z4SA 5DGDA 5FXMA 4M1TA 3PDIB 2HHJA 1EGQA 2YV1A 4Y2HA 3A26A 4CMGA 2Q5FA 5I7EA 2CV1A 2ACKA 1VQ1A 1YJQA 3K5HA 4KQEA 5BO5A 5CA1A 1YDGA 1Y1PA 1US8A 1M5UA 2I6FA 3FMPB 4Z3DA 421PA 2OZPA 8GPBA 1UBSB 5CVCA 3HCAA 3WKCA 3JATB 2OD2A 3OX2A 1NBHA 4G5QA 4MZDA 4Z51A 1UOQA 4HFNA 1NW9B 3BKXA 4P93A 4Z2YA 1BQEA 1PJTA 2IV3A 2RHWA 1V4BA 3N8IA 4EI7A 3MFYA 4D8WA 4D4HA 1WY5A 1Z36A 1RPJA 5EXPA 4E1VA 1QFSA 2VATA 4WGFA 1D2NA 3W7VA 3ZD9A 2CL0X 1U3CA 1Y37A 3OJEA 1U9IA 3BRSA 3HNPA 5EZYB 3RREA 3VR4A 4ZYVA 4GLOA 4XGKA 4I1YA 1K4YA 2Y1KA 2IYTA 5H8WA 2A67A 2G1KA 3EA0A 3F9IA 2PLNA 4NK5A 3G89A 5H68A 2FYTA 3Q41A 4YT4A 2BAGA 4CN9A 3IMKA 4DQ0A 1WMBA 1R66A 1YQUA 3H5VA 3K0CC 1Z2NX 1F6DA 3GDOA 4RD1A 3KSZO 5KJ6A 3R9IA 1JI3A 4LN1A 4E5KA 2ZTUA 1PGOA 1JZSA 1LA2A 1QYRA 1YVRA 2BP7A 2YVUA 3PDHA 4G8BA 5DEOA 3JX9A 1E3EA 4G24A 2NMVA 1W34A 1ZONA 3AHDA 3MWEB 4LDQA 5F2KA 5KSYA 1Q1QA 3T7KA 1YFLA 2K4MA 4OBEA 5ARBA 1Q0TA 5F73A 5HQTA 4IQ8A 3OFJA 5AIAA 1N2CE 2JH3A 1Y8RB 1DGQA 4GBGA 2BFBB 1AK1A 1T6YA 2B9EA 4OEHA 4ZU1X 4AJ1A 1DQZA 3IQFA 2A84A 1OXTA 3W1EA 2BBSA 1I5EA 1TTPB 3DCJA 1WEKA 2P79A 3A4MA 3CPHA 4R1MA 3FNRA 4RO0A 4NIMA 4GPIB 3WRVA 1KYYA 1O87A 521PA 1DUIA 4CGZA 1BMTA 2X13A 4KNVA 3MCAA 3HNOA 4U6SA 1C3OB 3RJTA 5C2JB 4DR2B 1PT8A 4FYKA 3IEXA 5D5PA 2X5NA 3DVSX 4A6EA 5AKGA 4KX3A 1M34B 3HLKA 4TLEA 3L8CA 1EXDA 3OLWA 4OKNA 1GQFA 1HOTA 4IV8A 3H19A 4LV8B 4M1WA 1VRCA 1ILEA 1VYTA 3OPVA 2ZJBA 4KR2A 4PZPA 5ECDA 2XYVA 3WK5A 3E4DA 4LX0A 4GX0A 1J24A 5I8PA 3VA7A 4N5MA 1LU9A 2GBIA 3C3DA 2VYCA 2JB9A 3DWIA 3OQIB 4IRMA 5J2TF 1E8NA 3SIWA 3SSAA 3H11B 3ZZMA 2E87A 2O6HA 3NEJA 3TRFA 1C7RA 5J1TB 3TQTA 2ZSDA 2B1IA 2JIZD 4B2PA 1Z2DA 2B5OA 4ARIA 1VKZA 3ZDZB 5DI9A 4P3KA 3EVNA 5A03A 2C97A 3KXIA 4NE2A 4HB3A 2PS0A 4Z53A 2O06A 1QANA 4X85A 1QIJA 1FP7A 2O0LA 4KPUA 4K2AA 3VPXA 5JI2E 3O5AA 1PQUA 3L7NA 3T4EA 4B4KA 5JATA 2FOIA 2HWWA 4ZKEA 2I3GA 1WBDA 2E7ZA 1NOIA 1X94A 2JA1A 3B82A 4RYLA 1U7WA 1XP5A 2QMHA 2QTZA 3LOPA 4I1SA 3T7IA 4E70A 3D3WA 3EVAA 1K8ZB 1N2EA 4HYQA 1RLOA 3D43A 3GJSA 5DWVA 4BNVA 4LECA 1T29A 4CLRB 4ZJYA 2VDVE 3T1QA 1LI5A 1LRJA 1QDEA 2G9ZA 1K9VF 1PJLA 2G0AA 3E3MA 1G2IA 3EOZA 3MWDB 4HAWA 1X1RA 2X0NA 2AXNA 2NU9A 4N0EA 2RCNA 2ZUUA 3HS3A 1ZMRA 4EG7A 3O6VA 4ZFNA 5B6PA 4F8JA 5JTTA 4XIIA 5EPEA 3WKEA 4FW8A 2FUCA 4L4RA 4F5EA 3FOZA 4DZRA 1IIRA 1IHOA 1LVHA 2WJ4A 1SA0A 3PNVA 4K26A 3GI1A 2P2YA 4N12A 1QYCA 1ID1A 4K87A 1E92A 1EKXA 3SBEA 4DSNA 3EAGA 4RFSB 3R3WA 4DLNA 3ADPA 1ISJA 1PO7A 1GTG1 3C7CB 4R1UA 3OO1A 4LZZA 4ROSA 3AF6A 3SYNA 4W99A 5FRDA 4C0KA 4F6LA 1TAUA 3DCNA 3Q5GA 4HJRA 3A4TA 5ULLA 3UY4A 3ZWMA 3CVYA 4C3VA 3RO7A 1I8TA 5CT4A 4FNOA 1YQWA 1EB8A 2VDLB 1H8HA 2XWJI 4G4IA 3WRYA 4MWBA 4A0FA 1JEEA 3ICOA 3IE0A 1BSVA 3KAJA 4FZVA 4LW8A 3SX0A 4I5EA 4AY3A 1G7TA 3Q9LA 1BXZA 3H5LA 4IDGA 1U8XX 2QLNA 3KSRA 2GWRA 4P35A 3O1HB 5CVVA 2D7DA 2RAUA 2FSGA 1VFNA 2GSDA 5LCXA 1L5LA 1XXLA 3BYZA 4MTLA 3ESDA 1C29B 4YONB 2E3JA 1G8YA 3IE1A 2Q0QA 1P3DA 5H16A 5CVJA 3FVVA 2BVNA 1JQBA 1TA4A 3KZOA 3ZLTA 1QKJA 3TDNA 2WYVA 1RXYA 4HMPA 1LV8A 1U7OA 1RHRA 1H2XA 2YFYA 5T3YA 4ZI3A 1JSLA 3QW2A 5A7HA 1KJYA 2W7TA 4OLAA 5IT5A 2VPQA 1HE8B 1OT3A 3DE5X 2AJLI 3G2OA 5HE9A 3ZE9A 3STYA 2I4MA 5DWDA 3WLMA 1QIEA 1P31A 2WFLA 3G7NA 1GKUB 1PGPA 2FWMX 5F3WB 1PFWA 1NQ5A 1VB3A 2H3HA 2UYCA 1EM8A 1VJTA 4DMUB 4E4YA 1AKVA 1YR1A 3IQEA 2AQHA 2IF0A 1W35A 5FNVB 4TMXA 5IYZF 3COVA 3NIBA 1V7QA 4L2IA 2EL7A 3H1BA 3JWEA 4R01A 3EQ8A 2C4WA 2IELA 2ZJFA 4FDAA 2CDCA 2VXYA 2Z5FA 4GXNA 4A15A 3RBAA 2F9FA 1T0PA 4GKVA 1THGA 2ZYTX 3E3OA 4IOKA 3PFWO 4LDZA 4LBYA 2W93A 5J58A 3A2KA 3ETJA 2B94A 4IOJA 2DU8A 3I30X 3NVKI 2OBXA 3RJ9A 5JQWA 4R31A 1TF7A 2V54A 1U8AA 2AXEA 4FKBA 5AKZA 3Q8MA 3HACA 1XQXA 3VDMA 1DIBA 3JY6A 1E2MA 5I48A 4DNXA 3KZVA 1DWQA 2W4MA 3HLTA 4PX9A 3QYAA 4C3UA 1T2AA 2WOJA 4DNQA 1FRZA 5IS2A 2I8AA 1ECPA 4K9KA 4C78A 4JNKA 4WADA 3A1NA 2XCRB 1Z26A 2IU4A 3GFPA 2GTPA 5JMOA 5KOHA 4YUVA 4HXYA 3D0QA 3DG9A 3TVYA 5LLDA 1NXTA 1ZK4A 4XAQA 5JJ5A 2JHFA 3SIXA 2P9FA 4V2IA 1L8XA 2WNHA 2DX7A 1YDWA 5E3HA 1HDOA 1NG1A 4ZRMA 1ECCA 2E4WA 5EIHA 1OLUB 2HJSA 4FOLA 4QXPA 2RDMA 4YJGA 3O75A 1A4XA 3Q8KA 2AKYA 4BNTA 4DIFA 3CLHA 3IC5A 2GAFA 1ZCJA 4PM4A 3S70A 5M5BA 3OFVA 4IFIA 3CNNA 2CDAA 3WIBA 3D8TA 1DV2A 3QMPA 1K4KA 1PYOA 4JEMA 5L9AA 4W7HA 5G3ZA 1JR3E 5IBRA 1MTZA 4ATNA 1MB3A 4M6WA 2DR3A 4FN5A 3TFWA 3FTCA 3JV7A 2O8EA 1M8PA 1QAMA 3JQFC 5KOYA 3IV9A 4QXOA 3WLQA 3S55A 4M55A 1NN3A 3ED5A 5GP1A 4OQFA 5CK4A 5IM5A 3TZHA 4F2HA 1H5NA 2YCLA 4MV9A 1DAPA 1NVFA 4QHTA 3UAZA 4CQLA 5DBEX 4ZVQA 1IUNA 1U3TA 4FYIA 5IXJA 3GU3A 3NGXA 2OESA 1JEJA 1DIGA 1I1OA 1M1UA 4JL5A 4Q3LA 2BGTA 4TTTS 3W78A 3M9XA 5JDCA 2ZB4A 3MCTA 3P9ZA 2GF2A 1NVXQ 4JEUA 5EIAA 4H0CA 4C7OB 1P62B 4TT8A 4WVFA 3ZBQA 4IAOA 2D1YA 1D2EA 5EE0A 3S7TA 4FFMA 2P41A 1G21B 3G9QA 2IUEA 3A9VA 3ZCXA 2JNWA 2IZZA 3LA6A 3K6JA 2Z9CA 5EVJA 2HJHA 1UBTS 5CIWA 1P0IA 3TDKA 2Z6UA 2N42A 1WXWA 2R79A 1E3WB 3FGPA 1H1TA 2PZFA 4Z8XA 3VNUA 5DHFA 2P3SA 1E9AA 4HGPA 1HE5A 3C5EA 5K3SA 3SR3A 4QUDA 5IJ0B 1UXIA 3CEMA 1EGAA 2IYSA 1OI3A 2K5UA 2UV8A 3N87A 1SCQA 4EI2A 3OE1A 3FWHA 5LXTF 3MMZA 1XQWA 2FMKA 2JFXA 4KDRA 3OOJA 3R0XA 4MUKA 3RVSA 5GJBA 4OYRA 2CJWB 3R7BA 1YQGA 1QE0A 1ODIA 1NW8A 3AB8A 4MS4A 3S2GA 1Y8ZA 1QP0A 1QZ3A 4KC0A 3I39X 1N6RA 2C0PA 3A1UA 2C96A 1KDOA 2PYZA 2XTJA 3KDSE 1O0CA 2VT2A 1PR5A 1G5FA 4DYHA 1OXMA 2EKDA 2C4VA 2LKDA 4OI0A 3ZDCA 2QTMA 5HSGA 2FEKA 4BY9E 1G60A 3CUSA 2R86A 4CQJA 2XB6A 4A8TA 1LGYA 1U0LA 2OFWA 3BVPA 4D6XA 4YMGA 1KYIA 1ZUD1 4RL4A 2NYVA 3GJRA 1G5TA 3Q9NA 1E7SA 3AI3A 1Q0QA 3N8NA 3R6LA 4LCEA 1EZ1A 4Y98A 1SUEA 1YVPA 4A0HA 3GPBA 4MVJH 3K72B 3CKKA 3MPOA 3OKAA 5CB8A 1U2QA 3DEJA 1HTTA 1NP3A 1Q7CA 2JHCA 3QTLA 1I33A 1E2HA 2FLVA 3RTCA 3OUZA 5CW1A 4R1OA 1SY7A 5JCXA 1X2BA 1VIYA 3VSEA 3HV0A 4DABA 3T06B 5A9SB 1KDTA 5FL3A 5CEFA 1RS0A 3I1YA 3LIPA 1J1IA 1EB9A 3NO4A 3AP2A 4ND4A 4ND2A 5BSHA 2ID8A 1RJWA 1I1HA 1K63A 1UPCA 3FYSA 4EKGA 2UZ1B 4YRDA 2B1JA 3NX4A 4I1VA 2WT8A 3RHTA 4EUSA 2ISSD 1O6FA 1G291 2PH5A 2Y0CA 3U3MA 1ENPA 2BMJA 3IPCA 3UAWA 4B6PA 1ZL0A 5C3MA 2ASVA 2P0EA 2R66A 1G41A 3KXDA 2AQKA 3R20A 3KR0A 4PAOA 5EPOA 2YW2A 1T2NA 4ZCPA 5B3JC 3MWYW 4P31A 1Z38A 2YNMC 2VZLA 4HMOA 4EF4A 3U7IA 3UKDA 5K03A 4N76A 2VXOA 1WUHS 5I9MA 3UAXA 3MPUA 1O5IA 3BXXA 4P5PA 4ITVA 4RA9A 2P4EA 1I3CA 3VR4D 1JIXA 4UZSA 3SJUA 4CM8B 5LFAA 2YINC 3ABSB 3BEDA 4RIFA 3Q3JB 5AUOB 1IBMB 1CDOA 5EP4A 1O54A 3AKCA 2RI1A 1WD5A 2EIHA 4LOIA 2ZS8A 4B80A 1SVWA 2VJYA 2BGUA 1IY1A 2YS6A 4JNCA 4EHJA 5FI0B 1P8AA 2GA8A 2DBZA 4RF5A 5FL7A 4J7AA 2Z98A 3A6DA 3P9XA 1T2VA 2HIGA 1Y7HA 4FB4A 5BWBA 1ETUA 1FYWA 4OFWA 4LVUA 4AXBA 5B2ZA 4II2A 2ESRA 3UM9A 3ZHXA 5JRDS 1UKEA 2X4GA 1V9CA 3HJTA 1D5WA 1TJ4A 2GFIA 1UDBA 3MLBA 4HEQA 4BPRA 2AX4A 5KKAA 2BM8A 2VDJA 1OE0A 2VTDA 1D3AA 5AW3A 4FX5A 3OF2A 1X8LA 2RBGA 4OYHA 3D4IA 3V8MA 2WU8A 1SMKA 3RJ5A 2ZULA 5K8CA 3JVVA 1EM6A 1T34A 3F7OA 2XZOA 4XCVA 2PFKA 4TRRA 1E7QA 3ZK9A 3WOHA 5LP6A 2AUMA 3WBJA 2VEDA 4MVJG 1A1SA 3VV2A 4CCSA 2LPMA 1R27A 3AF2A 1ZK3A 1FPQA 4RXTA 1W19A 3I0MA 4EMSA 4IMJB 3E1GA 4ID9A 4UUOA 3HR8A 4MUXA 1IEWA 2Z58A 4I9FA 1MEEA 3P0RA 2G1AA 4JIMA 4Q9NA 3GLHE 1GDDA 4Y2RA 1F51E 3ILSA 4G0UA 2EYUA 4MRNA 1MXHA 4BUCA 1BZYA 1SJ9A 3EMVA 4XWOA 1U0FA 3UYKA 3JZAA 4BL5A 4BNGA 3PQFA 3QE4A 2W4IA 3A27A 5TVGA 4TKMA 4ITRC 1NR1A 1VOTA 3VR5A 3CVVA 4UKDA 1MAWA 2PA0A 1O4WA 4B2LA 5CXUA 4FOTA 1B8PA 1DTWA 3RU2A 1N8NA 1Y6QA 4GUAA 2I7DA 4LV5B 4C0AC 1GARA 4W9RA 2BCEA 3K0BA 3WNCA 2NZ8A 4R71A 2JF0A 3DL2A 4LKOA 3HR7A 3NDIA 1EBBA 4K8RB 5FPHA 2GZ3A 1CQPA 1RADA 1QO7A 1WUKS 2CLSA 4PGGA 4CKBB 5DM70 5CFNA 4L5JA 1HT1E 4AROA 2RONA 2XVAA 3KALA 1H0KA 4ERXA 3QZUA 2ATVA 1UEIA 3SU8A 2C5FA 3Q8XB 1VIMA 1TUBB 2A5FA 2OQRA 1QQ7A 2LW7A 3ZXIA 1ABBA 4BNMA 5I4CA 4KXXA 2IX9A 1E77A 2YHBA 4NDAA 4XGRA 2JGKA 1E1NA 4YJ2A 1USKA 3I8SA 4ZCQA 4V3CA 3WMEA 1GY8A 4P4GA 1XCLA 1E2NA 4NU0A 1U4NA 3KKPA 4F6RB 1WZNA 4DA8A 2NUAB 3ABOB 3ZV6A 4TL6A 3MGCA 5TJ9A 1VPDA 2R1ZA 1IVSA 2QG6A 3B1FA 4KOAA 1Z16A 3RYCA 3CIOA 2I7CA 2GXQA 5IXYA 4FN4A 4HUTA 1EDEA 3GUUA 3FUCA 3HBMA 3MUOA 4G1UC 2P9BA 1E61A 3IUEA 2X1MA 2NQTA 3LNTA 3QM1A 2IPLA 1SCDA 4AKHA 1ISMA 3CLKA 4JMLA 1XN4A 2G25A 3D7MA 2WTAA 3PC4A 2NVUB 2OSBA 5BW4A 1FCJA 5ECWA 4ZEWA 4DLUA 4BX9A 1V8BA 3MLAA 1P77A 2QB5A 2M6LA 3QQ5A 1QHYA 3PQ8A 4M8KA 3X1ZA 4DQXA 2NQ8A 1ZINA 4YCLA 1K5DA 1H8HD 2C2XA 1QPZA 1CG6A 1LDMA 1BROA 3LWNA 2G83A 4RD4A 1JHVA 4CL3A 3CZCA 4J1TC 4BVBA 2W8BA 4FFLA 3ESCA 2F9LA 1NULA 4RCYA 2RGNA 4V3BA 5KJ1A 2R8RA 2QL9A 2ZQYA 3GZNB 1UJNA 4BMOB 4ZU3A 1Q3HA 4JT8A 4DWWA 3KB1A 2NPOA 3IKTA 3ZCRA 1OLXB 1M83A 3DBHA 5FPTA 4NP6A 5LQDA 3CG4A 4MPDA 1R0CA 2MYUA 1DKLA 2Q2WA 3EPHA 1MA3A 2HRBA 4C43A 4F8EA 1ID8A 2AK3A 1HE4A 3ETHA 3FUWA 4ZOLB 1JH9A 4KEAA 3ASVA 4JDUA 3G0OA 1M5TA 3T4PA 2WLTA 3DE7X 2OYRA 4IIXA 4ACAA 4EYOA 3GRCA 4IHJB 5ADWA 1CUCA 3MD0A 5BSKA 5KTKA 2XXAA 3H9GA 4PLZA 4CM5A 2N46A 3EIWA 2R11A 4JK3A 2H0RA 3KJEA 3OEEA 2RHJA 2QJOA 3NHJA 4G0MA 4NY1A 1ZXLA 3JQPA 5EA2A 5BPFA 4G01B 4MR8A 4ZC1A 4MJ7A 1CF4A 4MRSA 1T5OA 5BR7A 3PEYA 1IRIA 4R16A 1WV1A 2ZYSA 3ABQB 2FK8A 1X7HA 3BHJA 2MYPA 3DBRA 4FYXA 2OG1A 1W2WB 3HEAA 1IONA 2EVWX 3MM4A 2PHZA 4INPA 5KYXA 3PUYA 2ZJAA 4BNNA 4CEJA 3S5JA 4YCCA 5EJFA 4YB8A 4G5OA 2EDAA 5FWAA 2QRVA 5E1OA 3TQSA 5B7PA 4BDTA 3AESA 1QYIA 4UTVA 5IC4A 2C9CA 1NVVQ 2XMCA 3QYJA 4MI3A 1Q0UA 2YWHA 1COWA 5B36A 3LA8A 2RG1A 4TRJA 1D1QA 5CM9C 2FKNA 3UWDA 4MICA 3HDYA 4RDIA 1UFVA 2V0NA 5CM2Z 4YXFA 1UPTA 5C8VA 2QP3A 4NMHA 5FIUA 2R8ZA 5GADl 1U1FA 4E2ZA 3R2JA 3BWXA 3PXUA 3KLMX 1BXGB 1IWBB 1RXUA 2RGYA 3EUWA 3H9BA 1KE1A 3EVEA 1T3GA 1AH2A 4QOEA 1NUSA 5AM0A 1XKQA 3MTDA 1ZJZA 5KUTA 2NN3C 3VOAA 1GR0A 2OGTA 2PT6A 4QD3A 3I6YA 1RJ9B 2JIPA 4K6OA 4WT7A 1PTJA 3G9UA 1P0CA 1Y9AA 1PF7E 4IMIB 4R9VA 2FVYA 1IM5A 1CY6A 1MV8A 1QKIA 2C54A 2DFTA 4Y6OA 2WQ7A 3DDSA 3BMQB 4MA0A 4NE7A 1VSBA 3FFWA 5DO9A 3OC0A 4GP9A 2ZE8A 2N1MA 4S1WA 3A2NA 1JALA 4X6XA 5AUNB 2GEFA 5IZCC 1F0YA 4JA0A 4RY0A 4YDRA 4OLJA 3FWYA 1Z37A 1E3DA 1Q44A 1V6AA 3Q1KA 5KTRA 2EX0A 4EITA 2JLXA 5J40A 2JIDA 2ZIWB 5KTPA 3LGAA 4MS3B 3SXUB 4BFCA 3L82B 1CJCA 3K6RA 3L04A 4O4IB 4R69A 2O05A 1XTBA 4U9HS 3PDIA 5DBOA 1T0JB 3ASYA 2P7HA 4B8ZA 3A32A 2MT9A 1ZD2P 5JD5A 1POXA 2Z43A 4POAA 3JQ9A 3MJHA 3BREA 2FE1A 1NWCA 5IULC 2Y68A 5A3JA 1JI0A 2IOYA 2BM1A 1R4NA 2AFIE 2RJ3A 3QUQA 5BR4A 2GZHA 1DAIA 1SKYE 2D2IA 3MBKA 2KHZA 3RYIB 1AQJA 1VCMA 4DLKA 1VMDA 3U4MA 4TWAA 2QUIA 1ZH6A 2HJGA 1M1ZA 1XNHA 4ZDKA 1L7PA 5H70A 3FPLA 3QFRA 1QWSA 3IPRA 1L4GA 1TKRA 2IXBA 2PYIA 3A06A 1SIUA 5EZYA 5IW8A 5HR5A 3FCEA 4FGUA 2JBAA 5AKHA 3F67A 1HG0A 3PKZA 2EF0A 3KQLA 3VSAA 4XDZA 4DCJA 1OA0A 2C8JA 1A72A 2DWPA 2XAUA 3B3FA 3T9CA 5KNCH 3O90A 3P5SA 1IPHA 4AJNA 1WVIA 3TVTA 4DLSA 1PFUA 5D2CA 4JH0A 2O8CB 3E03A 4LVOA 3BHIA 1GTVA 1JEYB 3MYYA 3PEEA 3VYUB 5JAOA 4TTSA 2WKRA 4JLDA 4MR7A 2BKVA 5ARCA 3MWEA 1XMVA 5BYKA 3PDCA 4RS4A 3T7JA 4QJ3A 2EG9A 3QI7A 4P0PB 1I4LD 1WXIA 4BN5A 4G26A 2XODA 1GP2A 2PSSA 1E0KA 4DZTA 2PBFA 3GEMA 4EHBA 1ESCA 1Z5OA 3DVRX 4I8IA 3PICA 4GPTA 3EMDA 4BJ6A 1Q19A 1CQWA 5JPCA 5LC1A 2EL9A 3ZBPA 5SYNA 3ER6A 3SZOA 3TPZA 3SWWA 1R4ZA 1IATA 4AB1A 4Z7QB 2BR5A 1V3QE 4X6YA 4AY5A 1WHSA 5JS8A 1C3OA 5IT9A 2WJZB 1X1TA 4R3UC 5FPYA 3D6VA 1BGVA 3BXZA 1W73A 2JATA 3HXKA 1DKQA 4FE4A 4Z2AA 1ZUNB 3KWJA 3ZQKA 3I6MA 4KWTA 4LRWA 2XY4A 4DC9A 3PR3A 4Q03A 3ER8A 1XZBA 2REQA 1QNFA 4XPZA 5GONF 3SQNA 4A0QA 3TRJA 1MC1A 2NXCA 2RI6A 2PL5A 4WASA 3UH0A 4HNSA 2I7XA 4B35A 5K20A 4NAHA 3GAFA 2HFJA 1A7JA 4WCFC 2HZ7A 3UB3A 3L46A 2G8LA 2FMTA 3MRVA 2NZXA 3MRTA 2D2EA 2O5RA 3OQIA 5IUKC 4MQ6A 1YD7A 2H3EA 3HA2A 4H7PA 3ZWXA 1AS3A 1LK0A 2COUA 1ZN8A 1X39A 3AEUB 4OQPA 3ZI0A 1V47A 3RSLA 4TKUA 4DLYA 1E7WA 1XP8A 4XWTA 3UMSA 5AM5A 3IEVA 4OP3A 3V3TA 5JXWA 4AQ7A 4JBIA 3WJAA 3LUJA 3PGKA 4HWSA 1GGMA 5SICE 2WSYB 4HJXA 4HQOA 4J0GA 4LYFA 1N9KA 2PWYA 3QPVA 1NQAO 1XTPA 4MVJM 1HR0B 4LE0A 5A1JA 4PO1A 1J21A 1RKBA 1Q20A 4H59A 5L3SB 2NXWA 4E0BA 4FFRA 1PWZA 2WHQA 1QONA 4NBSA 2NZVG 3VHRA 1IU9A 4HBZA 1ZI6A 3KKKA 1RJFA 1T1JA 3RSZA 4DV2B 1JKXA 1ZCAA 4YRRA 4B6JA 1DE0A 4LOLA 2IU0A 2C04A 4KN6A 3NANA 2X4LA 1V16A 4CLRA 5IVHA 2BPOA 3MWDA 4FDVA 3PCXA 4AG5A 3GT0A 3T1VA 2OCGA 3D8BA 4I55F 1FY2A 3CUUA 1DO8A 1DDOA 3OA0A 5FL7D 3BK1A 3TUIC 3Q7RA 3HXPA 1XTSA 2NUPB 3WNQA 4H7DA 4B2YA 1QFYA 2NTVA 3EG5A 3RFUA 3T7CA 4FSXA 3FPJA 4BVLA 4JUBA 1GU7A 3BTSA 1NVDA 3WLFA 3PHHA 1ZEJA 1QJ4A 2VI5A 2Z5VA 3V7NA 2AF4C 4XQ9A 1PT9A 1VMAA 2ZYVX 3AZOA 1VM6A 5CA0B 2GILA 3K9CA 5C1PA 4LHYA 1PJQA 2FB9A 3OUTA 5AXAA 5E6RB 1N2CA 2NVBA 2M6KA 3FETA 4I3FA 4UASA 5KAPA 2DEUA 2HSWA 1Z6PA 3R6WA 1OZGA 3C43A 4UHHA 1NDHA 1UKZA 3P9IA 5K45A 3R9XA 2JBHA 4QBHA 5L40A 4NCBA 3EY9A 4ZOQI 4CCYB 1E3MA 1YQQA 5JD4A 3O73A 1FIUA 1A77A 1V6CA 2GCOB 2OV6A 1Z2OX 2QX9A 3CNLA 4FCVA 4JWTA 3AO0B 1JHMA 1IEQA 4OXXA 3WLIA 4B33A 1RHKA 4LRXA 1DLIA 4EVRA 5CFRA 4QM7A 1C7FA 3KV1A 2P6NA 3G0IA 3M8KA 2MCFA 3X1XA 2VOJA 1MPXA 2JFBA 3L0YA 1WV0A 1U1DA 2XB4A 1R00A 4XGNA 2HCRA 2VSOA 2PNJA 3VR5D 2PZEA 1K97A 3AR7A 3F7TA 3C1OA 2BRUA 2B9VA 4RLQA 3M1LA 1EAYA 4ZVNA 2JD1A 4ISBA 4ZT6A 3VAAA 4Z4FA 1KVRA 3I5XA 1VJGA 5KYYB 3T4UA 5TARA 2H1WA 1LQTA 4JOQA 5FADA 3NHZA 1OMOA 1QS0B 3FWNA 2QRKA 1DKPA 1G3UA 3EGOA 1SHZA 5CDSA 2QJTA 1J2UA 4Q12A 4XEHA 2QQ5A 1YDEA 4QXQA 4X7BA 4DMHA 4MS1B 2VPPA 4WGGA 2YIJA 1KRXA 1VSVA 2PMCA 4RAOA 4DEYA 4TXNA 2DHDA 3DUFB 1SFRA 4C07A 5AXCA 3EIUA 1BYUA 1TC1A 1F2UB 3BSFA 4REMA 5DNVA 4P08A 2VPIA 3ISJA 4LHVA 4CHGA 4LAFA 5HGXA 3EVDA 2EJUA 4CEHB 5JZVA 3HVUA 4ZOCA 4L22A 1CUGA 4G2NA 3U4GA 4DMLA 4S35A 4MARA 4FMDF 3IUPA 1VHDA 2ZCVA 2O8VA 4RD0A 1I80A 4IUDS 2RJOA 2J32A 2J3KA 1LRKA 3WWPA 1N5JA 4FD3A 2VYQA 4NBWA 3ZWAA 2IY7A 1V5FA 2XKKA 1SOVA 2R2AA 3LE8A 5ALXA 5LBTA 1HDGO 2NTYC 3HB9A 5D3MB 2P1RA 3CX3A 5LOVF 1JDJA 4GP7A 2FPPB 721PA 1HG1A 2FPSA 4Q3DA 3QSGA 5BWCA 1MX3A 5EKTA 1YQXA 2E18A 1SU8A 2Z30A 1IJFA 1ND6A 3UOAB 1XZPA 1U3GA 1MJNA 2FSIA 3NBFA 4MGKR 1GO2A 4WFIA 4E22A 1ODJA 4B6QA 2HY7A 3M2PA 2WG0A 3P26A 4NFYA 3SX2A 4BNJA 621PA 4XLLA 4XUDA 1ZLYA 3B6JA 1GAWA 1N3BA 3A1TA 3FYHA 4D0GA 1F12A 2HREA 1T9DA 3R1IA 2GCGA 4K0RA 1CTQA 2QNRA 1UDRA 4HCJA 1HT2E 2FUEA 2FE4A 1OLUA 2Y1XA 4JVNA 2IBSA 3SEZA 3O74A 5FPKA 2ZBFA 4JJIA 1YHZA 1W9HA 4FGJA 1JN0A 2WE7A 3I8OA 1MAVA 2RSLA 3HV2A 1MJGA 4O4HF 3O8LA 4QDTA 3T1OA 1SHKA 3KKEA 5EIBD 4RKYA 3KEFA 4UFPA 2YV5A 2E21A 3I9KA 1B6SA 5CTJA 2HB6A 1IZ0A 2EJCA 4IDAA 3CYFA 3EZYA 2YRWA 2X5XA 4TV8B 3ZE1B 3P71T 4P0QB 4E7PA 1AGXA 4HRAA 2BZ1A 1MIOA 1R0RE 2PSFA 3QVGB 4FCWA 2LE0A 4PZLA 3SCZA 3VC3A 1S4MA 5I7OA 2EW1A 4EKNB 5KQPA 2J6BA 3PU6A 4WCFB 2IU6A 9LDTA 5AXDA 2A7XA 3F6RA 4H4EA 2V7GA 4YRLA 1XD8A 1SVSA 2VBIA 3KZMA 3OEED 4NHEA 3RTDA 5AHWA 5CDHA 5AJWA 1VMEA 1YZUA 4DN6A 4JCOA 4F1JA 3HCFA 3OZTA 1TU0A 2YFQA 2ZRIA 5JPDA 2A4KA 1H4SA 1PDVA 2IHYA 2CE7A 3NDPA 2AC4A 2GBPA 3ZXSA 2PIDA 1UM9B 5DX1A 4YR7A 1U8UA 3HA7A 4BEBA 1GEGA 3UCFA 3BMXA 4S1TA 3AR8A 2AEEA 5DI3A 3DXZA 5EZ6B 4COKA 1W0KA 1Z56C 2XOKA 3SR0A 1G21A 2AA3A 5FA8A 4N18A 2Q1YA 1R0SA 3EDYA 1ZGCA 3KU4A 5EP3A 4PYOA 3TTTA 3AUSA 4OQMA 1IB6A 4WXPA 4ZT5A 4KQWA 5ITVA 3S5UA 5AR1A 3RODA 3UQZA 2FWPA 4MHOA 1DKMA 1NKSA 1COWD 1YDHA 1GV0A 1ZFNA 5IJ0A 3HZRA 3H5TA 4M0CA 2I78A 3W5VA 3VOTA 1CNFA 1QKKA 1SCKA 3H7AA 2CLDX 2QTAA 1DEAA 3QVMA 4DJDC 4EENA 3I53A 4HWGA 4DV1B 3EIHA 2CJWA 1KK0A 4CLDA 4E1AA 5AI8A 3LBIA 1IK4A 4CLHA 5HZMA 2C9MA 2XZDA 3AV3A 1Y82A 2HRRA 4QXAA 2BDEA 5KVSA 1K9SA 2C4UA 2ORVA 2Q46A 2WAAA 3DMPA 3GCDA 3O0DA 4RSHA 3TQFA 1HDRA 1KU0A 1U9ZA 1Z5VA 2O2YA 2R00C 4IDQA 1F4VA 2AMLA 6NULA 5IDQA 1ZHHA 4CKZA 1BWQA 3DEHA 3IDOA 4K5QA 2HM7A 1YS9A 4DYVA 4QQRA 4RFVA 2AFRA 3PXGA 1X77A 5I4IA 3LTEA 1NU6A 3PEFA 3QELB 3WE7A 1L7AA 2FWIA 4WBNF 2IPOA 2ZBQA 4QUAA 4WACA 5CGQB 2VTBB 2HMTA 2IWHA 1X3LA 2Y77A 3CLRD 3A10A 1U28A 1GNTA 1L7BA 1XCMA 2HK8A 1TEZA 2QD1A 1HRKA 5LZ8A 2I66A 1U9YA 4HG2A 4RAQA 4GRIA 1ML3A 1RWWA 2RFLA 4IIUA 4BV2A 5ECGC 4UMEA 1P29A 4PN7A 1JR3A 2B8WA 4HLUA 1KBZA 4ZO8A 3TLCA 3TG8A 1AKEA 2XRYA 3A4LA 4IJ6A 4X1IB 4EVIA 1BDJA 2C7PA 3S3TA 5A9SA 4EA7A 4NULA 4F0JA 4I4CA 4RNDB 5E7JA 2EC5A 1NJ8A 1U7UA 2NAFA 1PZGA 4QNNA 1QV6A 3LDGA 1XDSA 3QUTA 4BLSA 3DEKA 5A4DA 16PKA 1XAIA 4MKFA 4R8MA 5CPBA 4M8IA 1ZD5A 1E9CA 3DKVA 1UQUA 5A3QA 5FA6A 2GZ1A 4IX1A 1QCDA 3SY8A 3ZJYA 3F9RA 3MEQA 3S8EA 3MLEA 5CBKA 4LI0A 1KFKB 4P4NA 1P2UA 3VKVA 4L1KA 4JLSA 3PYXA 4HFRA 5IYZB 1A04A 1Y33E 2JH9A 1S1CA 3TPFA 1KAMA 4CM8A 4EO7A 4RUKA 5CYGA 1JQ5A 3C3MA 1PD0A 1WABA 3LCUA 4EECA 3VO9A 1CUFA 1QQ5A 1FP2A 3P2JA 5IKOA 2DB3A 4MUAA 4TTRA 2QVLA 2CT8A 2CLMB 1F8YA 2TECE 1ANKA 3T3PB 1JUDA 5KWJA 3DO6A 4GQIA 5IT0A 2JGMA 3AL0C 2IP1A 3NTXA 3AQIA 3BBLA 1HNXB 3HCOA 3KR2A 2ZBVA 4YO7A 3NBQA 2XDYA 5G3YA 3TR0A 1JSRA 2IPAB 1II9A 2LCIA 4FR5A 4E4TA 3T6KA 5GIOE 4UBIA 2X41A 3L0SA 4C0QC 1RYEA 1O97D 4UOEA 1L6RA 3TI7A 4E32A 4L5CA 5E95A 4KO8A 4CCAA 1G8FA 5A6SB 4DMCA 3DVQX 3ZHTA 4TZ0A 2UYHA 1E5LA 4JSYA 4H7EA 4HYYA 4OU4A 4I08A 5JJCA 3PHGA 3EGDA 3GEEA 3QHAA 1E7MA 4PPYA 3NU1A 3QF4B 5CLQA 4EHHA 3HM2A 5EZQA 3UMVA 3PC6A 1WQ4A 3GUVA 1E1KA 3K73O 2ZB3A 2QLFA 2CCGA 4NJMB 2WTNA 3HYNA 4FSDA 5JVDF 1U2DC 2QRGA 3T7AA 4C4TA 1A8SA 1DG9A 3QNUA 3PF9A 1F6BA 1YL6A 1F7UA 1Y5LA 1U6JA 1PL7A 1MQSA 3KSUA 1VE6A 2VRBA 2CNNA 3GA7A 4U7FA 4DBZA 4TUYF 3RS0A 5JXJA 3SMQA 3P94A 5I7WA 1D03A 5G41A 1WA5A 5ICSA 4KXNA 1C0KA 3D6JA 3SM9A 4B4VA 3IILA 4LZNA 1TJNA 1NVBA 1NBOA 4H60A 1J6UA 4US1R 1I4EB 3GP3A 3LPCA 1CS4C 4X6UA 2H17A 2H0AA 4Z1MA 3M0EA 1Y34E 4AMYA 5ILOA 3T7EA 2QMZA 1Z75A 4ZJZA 2W2NA 4O4JF 4POOA 5K3FA 2WIAA 4PC3A 4RQUA 1C7IA 4NS4A 3IP9A 1SXJC 3P9KA 3DUWA 2FRVA 1Y1LA 2YWGA 3AKDA 3MB8A 4EPYA 1TEHA 2JLYA 1R9NA 5BV7A 4JJGA 4HKTA 4CKBA 1FNCA 4N9QA 5B4UA 3GQBB 1VI2A 4AWBA 1TI7A 4KE9A 3U5ZB 1AKYA 2QRQA 4IBOA 4QOJA 4OH1A 3SXJA 3QOYA 3K1TA 1DU4A 3GV0A 4CLOB 4QEKA 1ISIA 2VDWA 3B2QA 5FLYA 3FY4A 1DTEA 1ZR2A 2ODNA 1UXHA 4XSGA 1HFKA 2VP4A 5FPSA 1PN3A 1Y6RA 3VKHA 2ZYHA 1THZA 2IBTA 3OE4A 1KA9H 1A2OA 5TS2A 3GOQA 5ALWA 3OICA 3X1MA 1KFEB 2NUAA 4X3PA 4PX2A 3LT2A 2H2FA 4G5FA 2DQKA 5AOBA 1Q1EA 2NX2A 4G1FA 2Z6VA 4OI2A 3EFBA 2UZ0A 3DPSA 4BO3A 1KHTA 2JDIA 3AFOA 3FDJA 4U1RA 4BMXA 3Q0TA 2DERA 4MYDA 1WPXA 2DUUA 3LUCA 4UFNA 3RVDA 3MWLA 2QZPA 4S1VA 1VE1A 3BE5A 4JLVA 1Q5PA 1TJ5A 3G8DA 5CAEB 1KAHA 3ULKA 5CB4F 1EUCA 4Q4DA 2FY8A 3DVAB 2KJQA 1CF2O 3C87A 4GGOA 4Y6PA 5AW4A 2YMMA 3CVUA 4D4MA 1RBZA 4GLLA 5BUSA 3IMCA 1KI8A 1XFDA 1G17A 4UTNA 1VCHA 1E2KA 3JASB 2V5VA 4L73A 5JROA 1GA4A 1LZLA 1Z0AA 2EJBA 3JAKB 1SOMA 4P8RA 2Q5IA 4O2BF 1I94B 3GZNA 1QAQA 1E3SA 3M49A 3KFXA 4FC6A 4JC4A 2G5GX 4DVJA 1TMOA 2C4KA 4OHWA 2WJ6A 3Q4GA 1KR5A 5L3ZA 4UXIA 2OCPA 4H9GA 3I23A 3U39A 4XASA 4HSEA 4Z4GA 5KYWB 1GTMA 4RMJA 2YWRA 2GJAA 3WLJA 4LWPA 3ZH9B 3K0KA 5IJ9A 1YK1A 2CKDA 4AECA 4CHTA 4C0JA 1FP1D 2HV8A 2K6GA 2QQ0A 4KYUA 1YVDA 4NDZA 2G6TA 4RK7A 4ZOLA 3ZE0B 2DWCA 4A0GA 1K6JA 3T0GA 3OOEA 4A03A 4I1PA 4D4KA 1AY0A 4KR7A 1W1WA 4IHJA 3CQ9A 1IEXA 2ZZNA 2UU9B 2GPJA 3B8HA 5CJJA 4DJAA 1NBWB 2Q2VA 2BUCA 3WBKA 4WECA 4XWKA 2OBFA 2PBRA 5CDFE 3AUYA 3HJBA 3IUSA 2COKA 2WM8A 4P1ZA 2GYVA 4E14A 1CZRA 3H2GA 3I9V6 3F49S 1X7XB 1K5HA 3K1AB 3QYPA 5B1IA 1KJIA 1WETA 1TT5B 2BF4A 3H87A 4TTAA 1OAOC 5B3JA 5LQRA 2OVBA 1TAGA 3NKFA 2Q5HA 3G5LA 3NTUA 5KNBA 2NV2B 2Z1DA 3EIOA 2QYSA 4MJXA 3A6ZA 1EFKA 3B5JA 2ST1A 2WABA 1M7BA 4UZFA 3PUHA 4MGZR 1PT6A 2P9GA 4ZOBA 5KSZA 3T3EA 3U5TA 3IB3A 1XGKA 1MKYA 2HXYA 3EZ7A 5EGSA 1CRLA 2AYZA 4HO1X 1QC5B 3VJMA 4BEJA 4ZZ3A 5A5DA 3RAEC 2Q27A 2RARA 3HY4A 2AWOA 1GSHA 3HSYA 1DBIA 4XDGA 1QVVA 1W36C 2OGWA 3ZGZA 4KPGA 2IYNA 2O7SA 1WCXA 3VPDA 2IXEA 5HFAA 2UXDB 3R41A 1SBHA 2OY0A 1V5EA 2OUIA 3MERA 1HSZA 2P2SA 3SEAA 2WLSA 4BP3A 5JADA 1QTIA 2EDCA 1NAIA 3PUZA 1BXGA 5DHQA 2BFEA 3HYTA 1SN7A 4BASA 3B6EA 2ZSIA 3A3YA 3OPYI 3VC1A 4D9BA 1ULZA 1RJ9A 2IU3A 2J85A 1XHLA 5AJYA 2IY9A 1PJBA 2PUGA 1I6LA 5E2BA 4YC7A 4GS5A 3RUCA 1QYDA 3C6ZA 1P4AA 3ZTYA 2HPZA 4AICA 4AX4A 4B79A 3FR7A 1P7CA 2Q2NA 3QWIA 2BEUB 4TN1A 3QKIA 5EIXA 3BMQA 3KXPA 3DNMA 1IMOA 1DUVG 2AVNA 3KB2A 3LKZA 1VLHA 3G0DA 4GG1A 3RS2A 5BXQC 2HCJB 1U2PA 2J3QA 3TM5A 3VH4A 3ROMA 5IWCA 4IHAA 2WEKA 1VB5A 2EW8A 3BFVA 1MOSA 3W2GA 3KJFA 3NYRA 3MTBA 2Y76A 1JWBB 4O4JA 3U80A 1RZUA 3PXAA 1FVHA 1Z17A 1KFCB 1ZI9A 3EF3A 4JI1B 4Y2SA 3AVYA 3V7YA 2VT3A 4ZODA 1YS2X 2XVYA 2FLKA 2BE7A 3NFYA 3PQ2A 3HGMA 2WC1A 3W7BA 3OQHA 1JA9A 2FXIA 4DXDA 3CIFA 4Q82A 3C3JA 1HDIA 4HZUB 1JV2B 1IY2A 1O95C 1YBHA 4FCCA 5TS3A 1Z68A 1MC8A 1U4SA 3UTDA 4C4PA 4H27A 1EXWA 2P5UA 3GJ3A 4FMCF 4FQ8A 3K71B 1BQ4A 1F2VA 1U7TA 1Y4ZA 1SXJB 2PD6A 4OQQA 4ZAYA 4AF6A 2AMJA 4D92A 4P38A 1XVUA 1CB7A 1Q0LA 3DYIA 4TWJA 3NMUF 1RHUA 4OJQA 1M75A 1YRQA 2RGAA 4G09A 4BAZA 4MI6A 5DXJA 4C5CA 3HRKA 2CZGA 3PFNA 2KSQA 5BYJA 1W0KD 1JDZA 2XOKD 3ZWYA 2RGBA 1OB2A 1N9ZA 2WY2D 1L1RA 4PSVA 5LL6P 3IOYA 1XPRA 3B7PA 2GBGA 1T2DA 1JYSA 1QP7A 1OJLA 1T36A 1A5BB 2I62A 4PSAA 4KUHA 4YJFA 4CF6A 4JCCA 5K0BA 1N78A 2ZK7A 3RYHB 4RGQA 2E9SA 1ES9A 4D8TA 4G4JA 2C3MA 3OCCA 5ITZA 2Z8YA 5CPFA 1ABEA 4A8JA 4Y2VA 1B8NA 1PEYA 1WSDA 3RAFC 2O8CA 3I12A 4JVLA 3P4UA 4Y9SA 1JEYA 3DHNA 2GO1A 2Q9CA 3PD7A 2DPHA 3EJ6A 3I5MA 1LV7A 2PGOA 2V9CA 5EVCA 5DYIA 1ORIA 3WY9A 4DT1B 3QU2A 4O33A 2OQVA 2DFKB 4U2EA 1JKIA 3LXMA 1BWSA 3WB0A 2OPHA 1Y80A 2ZWOA 4GKBA 2ZUFA 1YS7A 4EHNA 3WK8A 1GGNA 1FUIA 1AQYA 1GZSA 2A9JA 2CCKA 4UPDA 4DV7B 1XSEA 3U40A 2VK8A 1EUDB 3AKYA 3FMFA 1EPUA 2GM9A 2V0CA 3HJRA 4F5DA 4YCBA 2MR5A 4J1TA 5TIIA 3B6ZA 3I4LA 1JXQA 5ALDA 2FOXA 4BFTA 3IRVA 1H6BA 1S3FA 3K2BA 4JEIA 4LQDA 3V1MA 4M1YA 5A3RA 2NYAA 3E7FA 1OA1A 3F47A 3KS9A 4OJTA 4YRNA 1ZUNA 5EFZA 3GN1A 3IMGA 1WR8A 4YRSA 4C3OB 1JR3D 4FDTA 3FRIA 1PZFA 1XVVA 3H86A 3QUCA 4ME6A 3K9GA 1L8AA 4U2KA 3FTPA 3M81A 3NP9A 4OYLA 4LBWA 1M8KA 1P1BA 3CXRA 1QB8A 1WQ3A 1C9NA 5ISMA 3OU6A 1YCDA 2FFJA 3AYZB 4WDRA 5C46F 1EX6A 1LTKA 3N0RA 4NMWA 4CMCA 4D98A 1WP4A 2WFZA 1QE3A 3HDGA 4JDPA 1OI7A 2AK2A 2ZT6A 5B30A 5LQJA 1ACLA 2CEAA 3A05A 4UAUA 1S2DA 1XDDA 3HJCA 2IUUA 3NPAA 3V1UA 4RKQA 5A1TA 1Q3KA 1RU3A 4ZQGA 5JY6A 2AFIA 3P9RA 1CUDA 2E1PA 2AFHE 5D1NA 2A1TS 2FPIB 2Q49A 4XXHA 4XKJA 3V8BA 3ZVRA 1USGA 2D5LA 3OM0A 3FKQA 1TZ2A 3ZY6A 1RJGA 1H3NA 4V1CA 1SUBA 4U9IS 1HORA 3VPBA 2PL3A 1UK8A 3ILVA 5BVGA 2IKQA 1PDOA 3RFXA 1S5PA 1ZNQO 3VZPA 2D06A 2OZLB 5CIQA 1A9QA 2AL7A 4DR1B 3Q2IA 2IT1A 2W0MA 3O47A 3OTQA 2CLLB 4JOSA 2PLAA 2VCHA 4G1MB 2PWZA 4TTQA 5D3QA 2PPVA 3RBVA 3PF8A 5HUQA 2NP7A 1ZGBA 4R7GA 4EHKA 3U1TA 2YBDA 1I3NA 2H92A 3JALB 1NVMB 1U2SA 3QNMA 1GYQA 3T5AA 2VNAA 1UKBA 3ROKA 5J63A 4FYHA 4WXRA 5CH5A 3U9LA 1YR2A 1Z8FA 1HC7A 2KE5A 4IFBA 3UUGA 1RAEA 3A9CA 1HFWA 2GVNA 4NZZA 4AWXA 3B36A 1J22A 3MZ0A 2PZLA 2VUIB 1FTSA 3EGEA 2ECKA 4LMBA 5E6RA 3S4YA 2HK7A 3AIOA 3NBKA 3R4CA 1S2OA 4B3GA 3C4VA 4UM9B 3FPCA 3TEFA 1W46A 1HYHA 4JENA 4WCDA 5A62A 3EEOA 1Y8CA 4CCYA 4GVXA 4D5EA 1OU0A 2ID9A 1J2RA 1N57A 2GCOA 4MJ3A 4RM3A 3RASA 4RWEA 1RLIA 5FWXB 1KPIA 2I3ZA 2W6CX 5AW6A 5KKCA 3MTJA 4D8XA 5IAKA 1P4RA 1AQNA 5DYWA 4AG6A 1SZPA 4GHWA 1GL9B 1SQ5A 3F78A 1UXGA 1XE3A 3P4YA 4RZXA 4V0QA 3EOBI 2QRMA 2N1BA 1HUQA 3CNQS 1AKTA 1ZQ9A 2YWFA 1P2BA 5FULA 3S29A 1ATIA 1VIVA 2PAAA 2WSLA 4O1IA 4ER5A 1KZGB 1A8PA 3K5WA 4WZBB 4D02A 2DHQA 1JHYA 4Z1MD 1VG8A 1MNAA 2PMKA 4IOMA 5EMJA 5KYYA 3LTNC 1QG6A 4MH0R 5MFZA 3F4BA 1QS0A 2NZJA 3TKLA 4BNWA 5KC9A 2I1QA 2C2BA 1ULSA 3LCCA 2QVCA 3RVJA 2IBMA 2R84A 5EINA 1XCJA 4ZICA 1C4WA 1XCOA 3SGLA 1Z25A 3FHTA 3HMKA 4OBWA 5EY5B 2I99A 1WUJS 3V42A 3LS2A 1RE1A 1OBFO 1X7ZB 2ZJZA 4RMNA 4TTJA 3BF8A 3CLUD 2PLWA 4R5HA 3ECSA 1JR2A 1MC5A 1QR2A 2Z2KA 3JVEA 1MZPA 3BMCA 5LDHA 4JBLA 3A0RB 4O0LA 3L49A 2IDJA 4G0ZA 4LIPD 5ED4A 3A9SA 5DMXA 3O8NA 5DOZA 2VJAA 4C6SA 1GQOA 4QTUB 5T64A 4QJ4A 3K5PA 4HMQA 1GLVA 2A92A 2VHJA 3E5HA 4IVNA 4GW3A 3I83A 1NVGA 3BXGA 4UMDA 5GJVC 1F7VA 1L4YA 1C4XA 1BVYF 1ULBA 3KKNA 4MYRA 5E8JA 3B9RA 2JDID 4RHCA 5G0VA 4AP6A 1MAHA 2G9RA 4OMUA 1XZNA 2FFQA 4DC1A 2HNAA 2OWDA 4D99A 1VL0A 5IU6A 2BGWA 2ZS7A 3HE3A 3TNYA 2FP4A 3BGSA 4NI5A 3I1JA 1UWKA 4IWXA 2G07A 3SEQA 1U8CB 2NNWB 3CB4A 3DO8A 3WGVA 5KHLB 1I30A 1ZGAA 5AKIA 3I28A 4EB8A 4B84A 3M4XA 2FWNA 3P4XA 4J1QA 3ANNA 4NZPA 5DVZA 4OHPA 3LBHA 1FTYA 3WHIA 1N25A 2Q07A 4JIGA 3U4IA 6YASA 1UWCA 3M34A 3NHLA 4NONA 4BQNA 1G66A 3MGGA 4B8YA 1RXWA 1K8YB 4IIBA 1Z4NA 1HZZA 2OQIA 2QROA 3HB5X 3KE8A 3DFFA 1Y4AE 4HGOA 4KO4S 4M53A 4WXHA 3WL8A 2MYNA 5C8ZA 1L7RA 4NNJA 4QL3A 4C30A 4PIPA 4TV8A 3SIRA 1Z5PA 2X77A 2Z3ZA 3SK0A 1ISHA 3Q7TA 4HT3B 3QEAZ 2JIBA 2VP3A 1SVIA 2JFQA 1KEEB 1M66A 1HLPA 1PL0A 2C1XA 4AJPA 5BR8B 3M5PA 3SVZA 1FYFA 2OMKA 3I09A 3I3SR 4QO8A 4WCFA 1I4DD 1FJ2A 2GJKA 3G3EA 4NBUA 4RKRA 1A9XA 1H5QA 1J2YA 1NN5A 1NXXA 2YYZA 5L8VA 2P3OA 3THXB 4G2TA 3NBYC 2F2TA 4NMXB 4RZIA 3TINA 2C3UA 4KTTE 1CP2A 4LUCA 2YJTD 2H52A 4CDMA 2B8EA 2CBZA 4YUYA 2Q5LA 3K94A 4OHOA 3V2GA 5CP8A 1F8FA 1P91A 3G5UA 1WL8A 2E85A 1N0VC 4KBYA 2ZUDA 1P7PA 1SKQA 2AQ8A 2BKEA 2GHRA 1DBSA 2HWKA 3WKDA 2H4FA 1RYMA 2Q3HA 3KJQA 4PQFA 2ZUWA 3N5KA 1BJKA 2EGHA 1V5WA 5KNBD 3ITEA 1AUOA 3QJGA 5TQ0B 3JWGA 5MN5A 2Z2ZA 1A3CA 5K1ZA 5DU2A 1HO3A 2VJNA 1JJIA 4JUCA 1RCTE 2ODAA 3KETA 1KP9A 3I5YA 2ZANA 4K6KA 1O2DA 2YJ5A 3NG1A 3EDMA 2FX2A 4YQEA 4KH0A 1DG3A 3COZA 3GGPA 3RRBA 5KMGB 4QUGA 5E38A 4MVJF 4D74A 4RGYA 4I55B 3T15A 3WWOA 4DS3A 3D7RA 1P39A 2GBFA 4O0MA 2VF7A 1DAHA 1SCUB 1QRUA 1F4LA 4XYMA 2R96A 2H2DA 1UBKS 1LBIA 1DNPA 3AJEA 2HO4A 3GL9A 3PT5A 4TZ6A 1GUAA 2ZIXA 3U09A 5B4VA 4UTPA 4P7KA 5BNFA 3FTEA 3BB1A 4JS0A 4OKSA 2JLAA 2PVCA 1NXSA 2WV9A 3HWWA 5AVVA 2O0MA 5AM4A 2XMSA 4MKZA 3PP8A 5C51B 1R18A 4AMBA 3FSEA 2X8JB 4DCCA 1R1DA 2F3RA 4KN5A 3SQXA 1W4LA 3QX9A 1ZK2A 3M6LA 4BPBA 2K7ZA 2KQUA 3CTMA 2RH5A 1BS2A 2IEZA 3PHJA 4F56A 3CUVA 4UNSA 4F4HA 2OFOA 1CJBA 3BIXA 2RGXA 1N3LA 4BAUA 2ZGVA 1AHPA 4DV6B 1SUIA 2WU1A 3N2LA 5DHAA 2PS3A 4ZTZB 3TL3A 3ZTWA 3M83A 4IHKA 4DRZA 3HKCA 1U7PA 5H3HA 1E1QA 4FUTA 2VCEA 3G85A 1AT1A 3P52A 4I1RA 4X1IA 1FZTA 3IJEB 1KY4A 1NVKA 5IASA 1GR1A 4EY4A 3G0CA 4OUKX 5DP2A 5TRTA 5J1SB 2BY4A 3WLTA 1KZ9A 4EJSA 4TYQA 2GVZC 1BFKA 2AG1A 1BE1A 3QLVC 3AM4A 3H2KA 4OATA 4ESEA 3EZFA 5HM8A 3ZGOA 2IZ0A 4I2NA 1GDTA 1W4CA 4LE2A 3HLYA 3OFSA 4C7KA 2WAMA 5K5EA 3KQYA 7GPBA 1AC5A 1QIHA 1VLVA 1SG6A 1QHEA 2RHDA 3CWQA 4EFLA 3AL2A 1QORA 4YTEA 4E5SA 5AIBA 5J23A 4RULA 2ID4A 1EVJA 1BVRA 1UMCA 4I1IA 3IAHA 1FPMA 1VKHA 4WLUA 4GGMX 4YWJA 4F72A 2ENUA 1KXZA 3E3NA 3IGFA 5HKOA 2PUFA 1VPEA 2WINI 2EWVA 1LLQA 2JAXA 2W6QA 1EE2A 3AFHA 3JQEA 3H1GA 3P9PA 1KFBB 4H4CA 5CDTA 5IFLA 3FI0A 3KTAB 5DTEA 4WL0A 2FPUA 4B85A 2F3QA 3NAQA 1IHUA 2IHVA 2NW6A 5EHQA 3HKDA 5HKKA 1L1FA 5ICGA 3OOYA 3F71A 3W2TA 3BD9A 1FDRA 4YASA 1LBHA 4L6IA 4ZI7F 3KZCA 1PVDA 4FOSA 4OIFA 4QGHA 1TQHA 2XUIA 1N9GA 4FT4A 2OE2A 1EIZA 2C4NA 4N7JA 3JR7A 3L4KA 3IKLA 2CJFA 2GETA 1AXEA 3DVLA 3E0XA 3QGMA 5DTIA 3WFZA 4PFSA 9MHTA 2J3LA 3BDAA 3VZSA 3VYSB 3RS5A 1T1SA 5A6VA 3QF4A 4BV8A 3KVNA 4URXR 4PG8A 2CHGA 4JBWA 4JJ7A 5KNLA 1A9SA 3LWZA 3NRCA 3PITA 2FPRA 2IOQA 4NJMA 1KO5A 3K0HA 3X43A 2J45A 1ZVJA 1AQLA 1OU4A 4Y2PA 4RPKA 1IN1A 4MZXA 1YJXA 3B9BA 4RK5A 1LK7A 5AKJA 5B1YA 4C4AA 4O4HB 3TGLA 3MT9A 4OI1A 5J5VA 5I5EA 2JVIA 2O1XA 3A1WA 4J7CA 5IH3A 1KWKA 2JFNA 3M4ZA 3S81A 1FBNA 5T67A 1P17A 2OBNA 3ZHQA 5C4IA 5HPYB 1U94A 5LQSA 5F5NA 4BU0A 4Z3KA 1Z2PX 1YVUA 1R0XA 3PYMA 5GVSA 2ZSBA 3K0AB 4GOOD 1G18A 4JAVC 3GLVA 1UR5A 2NSYA 2XDAA 4R2XA 4NX2A 3WDMA 3WGKA 3SC4A 4C1NA 3M6UA 5EWLA 3BJMA 3STHA 1QGED 4JA2A 4RCVA 5K99A 1OX4B 1KBQA 1SBCA 1YU6A 2YCBA 4EDFA 4HYEA 5AD1A 5E1DA 1Z5WA 3CRW1 2I4NA 1UFRA 5CT9A 3BMNB 5HTKA 2PX6A 1MT3A 2M9MA 2BBTA 1LPPA 1O5OA 2YXNA 3LZDA 5CEJA 1L3CA 2FEPA 4L02A 3LKVA 3TLGB 2QN6A 3ZX4A 2PGXA 4L16A 1M2EA 1GSIA 1CVIA 5LYJF 4UEKA 2Z2YA 4YRTA 3NB0A 3MELA 2UUAB 1WCIB 1CJTC 2X23A 1WS6A 2FG6C 1PR6A 3EPPA 2Y9MB 3OHPA 3NEYA 1C2YA 1A5ZA 2GRUA 1VKNA 2GZDA 2BR3A 3Q7EA 4DAOA 4DNOA 3G1TA 1ZOSA 1OFVA 3ZZTA 4FFBB 1REQA 5E1MA 1V1RB 5C8DA 5JWOA 2DLDA 4PU0A 1SC4A 1PJ3A 3D0KA 3RR2A 3WVNA 1PK7A 2VRWA 3A1CA 4JB8A 1H93A 1NVEA 4CDNA 1EQUA 2IGTA 4KYVA 1ZOOA 4FU0A 3STTA 1ZOIA 4N5DA 4OK3A 3G79A 4ZVUA 5LZ2A 3GGDA 1TVMA 1FP6A 5CAEA 4NZYA 3G49A 4FQ5A 2VO1A 5EUQB 3OQ1A 3LBYA 4HVTA 1TCBA 2C8KA 2W90A 2YC2C 1FFWA 5KI6A 3DVAA 4UDNA 4NU6A 1KMHB 3G7UA 4GNRA 3ERCA 4IG9A 2O59A 4QOGA 1GPH1 3MCUA 2HWXA 4I3GA 1D6JA 1O5TA 2GHIA 3ET5A 4UHJA 3JAKA 3R0VA 3UB4A 3TLKA 5EEGA 1XTVA 4BXOB 3KFLA 4ZHQF 4XWAA 4X91A 1FFXA 5AVYA 1C9YA 2FLWA 1BD3A 1CHNA 1QIDA 4P34A 1ZH0A 5K0GA 3FZNA 5K09A 1I9CA 3GRPA 1KQGA 2HADA 3G0HA 4KR6A 2QV0A 1W87A 5DNWA 1UK6A 2EKPA 1L1QA 5GZ1A 3U0VA 1G5IA 1LW7A 3LO8A 3LBFA 4OAQA 3VOSA 4AZ0B 3KRTA 2W6NA 2V7PA 1ZM2A 2WQZA 1P1RA 3WTCA 1YMQA 2SECE 3CEJA 3CCCA 4HEJA 2HA4A 4IOLA 3NDBB 5KINB 1R7RA 4MGHA 4PXYA 4KQ2A 3ZI7A 1ZQ1A 1YMUA 4HNAA 1N7IA 4NBLA 4BKOA 3SYMA 5I7UA 1QCYA 3DZHA 3JSXA 4KXYA 3E9MA 3T3DA 4DAEA 3MTQA 4AKTA 2BTOA 4V0SA 4DB4A 1KYTA 2VS1A 2WK1A 2IH4A 3CF6R 4RMHA 1XOIA 3QX7A 2ZIUB 1OR8A 2OLKA 3KOMA 1UDCA 5BNZA 1A9PA 3K1AA 3NM5A 1X7XA 1ZWKA 2AMFA 4MVWA 1RP1A 5HJ5A 1A8QA 1TT5A 4W1SA 4YCDA 1ZC4A 2I4IA 1PS8A 1XYGA 2M1XA 3FNIA 2H9IA 1WE2A 2FZVA 3NJ4A 3PFIA 2JD2A 2DUWA 2PKWA 4KQMA 4QJ5A 4TQ9A 1VYUA 4BRUA 4DTIA 5KYGA 3RHSA 3KQKA 4GI7A 1GGJA 2WJIA 3LYLA 5ALHA 2DC1A 5CJPA 1CUZA 2XRMA 1KQOA 4Q3KA 1NR5A 2W6IA 4WVLA 3V80A 1AVTA 1QFJA 2O4UX 1MB0A 1QC5A 3W4IA 1BH6A 4C21A 1C0PA 4JJFA 5B53A 4TYNA 1AKRA 1F0PA 1MD9A 2LBPA 4P0TA 2RAFA 3PQ6A 2CJYA 2CKMA 1RYDA 2P8JA 2H85A 5DIZA 1H0SA 2QN3A 5FUBA 5CCEA 1UINA 4A6PA 1TLLA 3WHPA 4LGYA 3S1AA 3WTBA 5AMXA 4HB2A 3ASUA 3OECA 5JH7A 2C5BA 1X38A 2NYUA 4FD2A 4M36A 3W5IA 1S0UA 2DWQA 3DAFA 4OXKA 4V0RA 1AA9A 1PX0A 1DC6A 2L2QA 1N6NA 4NZOA 4Y9UA 1FFDA 2QL5A 5DLPA 1P72A 3CBQA 5AUQA 2B4AA 3WJ2A 4HWRA 3IESA 1DO0A 3IB6A 4L28A 1G8SA 4XGQA 3SC2B 3UXYA 3ZDFA 2PUTA 5G53C 2XB2A 3W9BA 3T3MB 3EXHB 1U2GA 5EZSA 5KQRA 3CKMA 1QQAA 2AYXA 2YICA 3DR3A 4F3YA 3WP1B 1WB6A 2XUJA 5ERGB 2VRCA 4MRMB 2PGLA 3PD0A 4DFDA 3ORYA 1B2RA 2QPTA 4K9NA 4Y2GA 1CR4A 1D4OA 3I0NA 2MYTA 5JVDB 3T5GA 4H1WA 1HNZB 2PXXA 1K89A 1Y98A 2DY1A 5CGZA 3OC6A 4K1XA 3DMFA 3LI2A 4TUYB 1ZD3A 3O1LA 2WVAA 4M99A 4RZUA 3VR4H 1Q91A 1Z06A 1ZRHA 2CVFA 2JFOA 4M37A 4MSUA 5F1PA 1IOZA 3ZI4A 1PJ2A 1PWYE 3NASA 1TQ6A 4GSYA 2XX3A 3MQ2A 4Q01A 1RBMA 3CZMA 4O25A 2RHLA 1HQCA 2PNFA 4KTVE 1SCBA 2IEBA 5EESA 3KUUA 2EJWA 2OYSA 4HZUA 1F9AA 1T4CB 2KW5A 3HUEA 5DWQA 3ROXA 2HRDA 1C9KA 3UNXA 4BZWA 3N6RA 5GJWC 1Z5ZA 1R2QA 2QPLA 5FLXA 5K8IA 3BEOA 1DPGA 1MXFA 1RWKA 3FCCA 1SXJA 3U3XA 5M04A 2Y1FA 5CDFA 5EGNA 3S8YA 3D2BA 3MXTA 2F67A 1UT6A 3D8UA 3P9CA 3GJZA 4ER7A 3LY7A 1NQWA 3PJRA 3MMXA 4KR3A 4KXQA 3FCOA 2XCIA 1OXVA 1WMFA 4AY4A 3I32A 2HEIA 3L2OB 4FI3F 4M88A 4B6OA 1DHRA 1RQGA 2W43A 4G86A 1FU7A 4JLKA 1LK5A 1BHQ1 3WNZA 4CKXA 4UUAA 4LJ9A 1H65A 4S1PA 5EKXA 4JU9A 3KWLA 3DNPA 4N1AA 4P3YA 2BTQB 2VOEA 4NC9A 2MINB 5AKEA 4QBFA