2ZJ4A

Isomerase domain of human glucose:fructose-6-phosphate amidotransferase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
365
structure length
365
Chain Sequence
MKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine--fructose-6-phosphate aminotransferase [isomeriz
publication title Structural analysis of human glutamine:fructose-6-phosphate amidotransferase, a key regulator in type 2 diabetes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 135
structure length 365
sequence length 365
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj4A01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2zj4A02
1MORA 2CXSA 4X64B 3G68A 4B3SB 2CXQA 2CXUA 3FXAA 2UXBB 1T10A 2ZM6B 4LZJA 2X3YA 3IFSA 5LMNB 3J7AC 1JIQA 5FLXA 4DV0B 2A3NA 3OTOB 4JI6B 4LF6B 1NUHA 2CXRA 4DV1B 4DV7B 2UXDB 4S12A 4DR6B 4DUYB 1IBLB 2I2WA 2UU9B 4EM6A 4DV6B 3T1YB 1IRIA 1X94A 4GKJB 4LF5B 4X66B 4DV4B 5BY2A 4DR3B 2WU8A 2CXOA 4U6NA 3SHOA 4JV5B 1HNWB 2VQEB 1Q50A 3TBFA 2PUWA 3HBAA 4DV2B 4S1WA 2POCA 4DUZB 3ETNA 1J5XA 4OX9B 2UUCB 4LF9B 4TOIA 4DR7B 1X9IA 5LL6P 2O2CA 1JXAA 3LJKA 1I94B 3J81A 2HHHB 1G98A 4LF8B 2O2DA 1HOXA 2PUTA 1IBMB 4NXMB 2UUAB 1XNQB 1XNRB 2I22A 4B3RB 2PGIA 5A2QA 5IWAB 4JI3B 1HNXB 3CVJA 1KOJA 1HNZB 4B3TB 1XMQB 3TRJA 4JI0B 1TK9A 2CVPA 5BR8B 3FKJA 4JI1B 2CXTA 2YVAA 1JEOA 3T1HB 4B3MB 2ZJ3A 2UXCB 1VIVA 2VF5X 4DV3B 3I0ZA 4AMVA 4LF7B 2J6HA 1VI5A 3QKIA 3J80A 4JYAB 2PUVA 1C7RA 4LFAB 3Q88A 1MOQA 3BCHA 3OOJA 2E5FA 4X65B 4DV5B 1HR0B 2F4VB 2UUBB 2DECA 1X92A 4GKKB 1B0ZA 4YHHB 1N33B 1GZDA 4JI8B 4JI4B 1M3SA 1N32B 5IT9A 5LMUB 1HM5A 1J5EB 3Q7IA 4M0DA 4DR2B 4DR5B 2AMLA 4K0KB 4LFBB 2E5LB 4DR1B 1U0FA 4LF4B 4JI7B 3FJ1A 2Q8NA 2ZJ4A 3C3JA 1U0GA 4JI2B 1C7QA 3FF1A 1U0EA 1TZCA 1ZZGA 3M5PA 4DR4B 2CXNA 1NRIA 3BJZA 2XHZA 1WIWA 2VQFB 1N8TA 4AQYB 4X62B 3NBUA 2CB0A 2DF8A 5I01A 1VI6A 4JI5B 4KHPB 1DQRA 2CXPA 1JLHA 3JX9A 3UJHA 1VIMA 3ODPA 2V4MA 1IATA 1XMOB 2VF4X 1TZBA 3JAMA 4NXNB 2XBLA 3EUAA 1IBKB 3HJBA 3PR3A 1N36B 4IVNA 1GZVA 3KNZA 4YY3B 1FJGB 1N34B 1XTBA 1MOSA 4LFCB 1X9HA
chains in the Genus database with same CATH superfamily
1JAXA 1M83A 2WJ6A 4I6GA 1TK2A 4E07A 5CBPB 4LSZA 3GNLA 3CRVA 4L15A 3T9FA 4QM7A 2ZP1A 4ONEA 5HBGA 4ME6A 1I6KA 1NF2A 3J7AC 4KGVA 2JFHA 1T3HA 4R8RA 1N9KA 3WYNA 4MYHA 2WT4A 4IOKA 3IIMA 4CCSA 3Q1KA 4QFBA 4IGIA 1QO0A 3AI3A 2IXTA 3LZ6A 3C39A 4LE1A 1YJQA 3SK0A 4BIIA 3TQRA 4GKJB 1Z6YA 3KQOA 5DP1A 1I7DA 1YA4A 3H6HA 1P3Y1 4JFAA 4CKBA 4D0GA 1Y8RA 2FRXA 1KJ9A 3M34A 5AO9A 2IYYA 3GFRA 3ILHA 1XEWX 4M7WA 4PO3X 3T3MB 1YMQA 5JCXA 1C50A 1PYOA 1A5TA 1HSOA 2LV8A 3K20A 3F3SA 4MRMA 4ZRMA 4CLHA 1XZAA 5CFRA 4DLLA 2Y71A 3M9XA 1JR6A 1N5IA 3QVTA 1L3IA 1PBNA 2CLMB 121PA 2PS1A 3V97A 4UMFA 3E1GA 1G63A 4FHDA 1QS0B 1JSRA 1CY1A 1PJ8A 4LA4A 4QICA 1QVRA 4XUGB 2JZOA 5ARCA 2P4EA 4F5WA 1JJAA 5EUQB 1Z45A 1PR9A 3RFTA 4CT5A 1QO7A 1IVYA 2A5LA 2ES4A 1NVFA 2WA2A 3NETA 2BKUA 4YPFA 4IGEA 2GSWA 2Z3WA 5EJMA 2FWAA 1OFIA 3D3JA 3V7FA 2FSSA 3NQ41 2FWPA 2TRSB 2YVAA 4GLBA 3HBLA 1JB1A 4RFVA 5U9CA 2UKDA 2ATEA 1GYPA 1ND6A 4K9NA 3MUOA 1SVSA 4J1SA 2FMTA 3EFBA 5KKAA 2YIDA 1Z56C 1N5DA 4YBRA 1ZESA 3JU3A 4KLAA 4ZHSA 1YE5A 4CG3A 2IYQA 3DWIA 4E31A 1C80A 1C8LA 1HQYE 1M34E 1RJGA 1TMGE 4KTTE 4EGSA 1U8CB 4R2WA 1WUKS 2IV7A 1YF3A 2QUKA 4DHEA 4RMNA 3W2IA 2B83A 4NCBA 1K8RA 2ET6A 3PSHA 3VKVA 4UBKA 3GQBA 2B25A 1P1BA 2PKRA 1TJ3A 3WK8A 5EUBA 2AOWA 4BCDA 2A4MA 1N3IA 2ILTA 2ANBA 3CUKA 2E49A 4OBWA 1SBHA 4Q7KA 2R4TA 2PX2A 3FF1A 4OBEA 5L45A 2XYVA 4ON9A 5COBA 3S1AA 1E1YA 4J1QA 5F9MA 2Y0DA 3WLLA 3FDJA 1K6MA 4HNHA 4BFWA 2GO1A 1YZNA 1N8TA 4MLDA 4EHFA 3ZIAD 4ZREA 1UK8A 2PLAA 1BMTA 1MB3A 1ZK2A 4BN0A 3PFBA 4I6JA 1O58A 2GJ9A 2RHHA 3MERA 1X87A 3PVCA 4JP8A 4DMLA 3CF4A 2A1UB 3RUEA 5MFZA 3U56A 1VZ2A 2ZU0C 3AZPA 1VL1A 1HE5A 4XFJA 3C3YA 5JLAA 1H4QA 3EFOB 4DUGD 3SS8A 3NIBA 5GJBA 1TQDA 4TROA 3BK2A 3QPWA 1DRVA 4CG0A 3KVVA 1BDBA 3CZMA 3ZWCA 1VJ1A 4CEHA 1J2EA 1EDEA 2FPWA 1COZA 2FEOA 2PGAA 3H9CA 3I9FA 3PXGA 4TVBA 2BFWA 3ONDA 4MQ4A 1Z3IX 5I7RA 5JAOA 3S8MA 3KHSA 2WOJA 1GGJA 1HZZA 3EC7A 4XAQA 4I4NA 4QYIB 1CE8B 1XA4A 3BWXA 2HHCA 1PD1A 3ETHA 4J49A 2C57A 3U7JA 1DRWA 1KRHA 2HFJA 1I4TD 3O9ZA 5EMJA 1NU8A 3WLIA 4BV9A 4U4AA 2XUFA 5ECDA 2D54A 3T1VA 3CWZA 4LKRA 4J3JA 1RLOA 2ZJ7A 2O2ZA 3NKLA 2H4XA 2D6FA 2Y05A 4NRDA 3U5ZB 1UP7A 1CJCA 5AVKA 2P40A 4RCVA 4BJ1A 2UYCA 1GLVA 2WIAA 3WGJA 4KIJA 4L16A 3CNLA 1OMOA 1AXEA 3COSA 3EMVA 1NZJA 3TQSA 3Q40A 5MN4A 3ZDAA 3PUKA 2DJIA 1I8TA 4EEKA 3IVCA 4FX2A 3CX7A 1Q7TA 3UMYA 1WLYA 4TKLA 1E6CA 1Q3HA 3HPQA 5FEUA 2BGNA 1FZQA 3JAWA 4JP3A 3OLCX 4M1MA 4CM5A 3O2QB 1QBGA 3Q5EA 3BMNB 4JHLA 4UCFA 3OUZA 3OEHA 5BPHA 4L28A 1PWHA 2CMGA 4B3FX 3HVRA 1W4ZA 2IP1A 1JEYB 3VKHA 5C1BA 1JS1X 2BIFA 3K0CC 1DBQA 4Z3DA 5CAEA 1MNQA 2Y1WA 5KYGA 2HQRA 5FHRA 1P8JA 4GBMA 3L3BA 4BXOA 1PJLA 5LM3A 2QNBA 1T9GR 4BQNA 4NZOA 4DZRA 1M34B 3KVRA 3INYA 4BGEA 5DJ5A 4EJFA 3EARA 4J0GA 1P2TA 4HF7A 1BXRA 1JU9A 2JCGA 4Q4JA 5AESA 2GBGA 2N9UA 2XT0A 2QD3A 2FZ5A 2ECFA 1BWSA 3UPDA 2DFPA 1B4DA 1FXUA 1VPVA 2QN9A 4EY8A 1AMUA 1C7ZA 2R6JA 5JFOA 2WABA 3GBSA 3Q88A 1HFKA 2RDMA 4YRDA 1TQ2A 3PQ6A 5E3IA 5ENZA 3A6GA 3D8HA 3MIZA 5CDFA 3V8NA 3QNMA 4EFNA 3EIWA 5CCEA 2H3EA 1RHUA 2LWIA 4H17A 4HK4A 1XKQA 2WFLB 3L1HA 2P9HA 4IIGA 4R1MA 2CLKB 5KO2A 1U0LA 4JI8B 2XTJA 1UAAA 3MRXA 3WKBA 2BSAA 2N47A 5FX2A 4RF5A 4Q4HA 2HW8A 2LRHA 2XWQA 1RPJA 3DMPA 4FSHA 4FHEA 1P9NA 4UHKA 5IT4A 2G1KA 4RA6A 3I6QA 5E1OA 3W9SA 2R6ZA 2LNDA 3JD3A 2IV2X 3RBZA 2FOXA 1M0WA 4FN5A 4QQRA 1VDMA 4NFYA 1Z4NA 1NVDA 3D7LA 5I9TA 2FP4A 5KNCH 3V6LA 4HDRB 3GPBA 4KZPA 3V80A 3TO5A 2IXDA 1LWOA 3EA5A 3OQPA 4OGGA 1E7YA 2YFYA 5DBGA 1WIWA 2EQAA 3TR6A 2B7CA 3QE2A 3OE7D 2OQIA 2V7BA 4R83A 5E7IA 3V7YA 1KAGA 4Q7MB 2BCJQ 4M8NE 4G5GA 1T8WA 4JQSA 5D5PA 4L8VA 5BN3A 1JHAA 4R7GA 4RVDA 3ACDA 4K9MA 3OKAA 1ONNA 3OAAA 2WUGA 1O77A 1U8YA 3KOZA 3P1JA 4JLUA 2X7JA 4Q39A 4YUWA 2PMFA 4LYAA 3UH1A 3GUHA 1XEAA 3OCWA 1ZQ1A 4IV8A 5A5DA 3B6MA 3L6EA 3NGXA 3U3OA 2QT9A 2B21A 3N2GA 4ZZ3A 3WAJA 1BS1A 1WB5A 4R8KA 4C3ZA 1R88A 1KEZA 1KETA 2JRCA 2H1SA 1LQ2A 4CBVA 1Z82A 2ANCA 1V5FA 1QTNA 1U4OA 2ZCUA 3DUWA 5KQRA 5A02A 1D6MA 2BFPA 2MSNA 4KXQA 2VAMA 4QATA 3RD5A 1CUAA 5JC1A 1MDFA 5IULC 5JISA 2X19A 4HAIA 4MVYA 3ZHOA 2Z8ZA 3OSZA 1JDNA 2QPTA 1JG3A 4JKYA 4LC0A 1KEKA 4EYOA 1BE8A 3EIFA 1JILA 4CL2A 4E09A 5IHPA 5F1YA 4KREA 1O1YA 1PCXA 1GPMA 5DXFA 2WWHA 2HU8A 5JQGF 1H4SA 3C3DA 4MLPA 3AONB 3NLLA 1Z4JA 4FKBA 1SQGA 1WPGA 3R0ZA 5FYDA 4BNIA 3ESAA 2K5UA 4DABA 4C5CA 1GY8A 1L8XA 3LT1A 3VR5D 5BUSA 4ENRA 1UQRA 4IDPA 1WDLA 1KZ9A 4IJWA 1W2GA 2CWWA 2AG6A 2GAJA 2QZJA 3TDNA 3KQHA 2XE8A 4L51A 4P4GA 5E95A 4ROSA 2GPNA 5KJ6A 2DLNA 5BV1A 5CA0F 1R3DA 4M6WA 1Z4OA 3OICA 4WCFA 1ZCBA 2DERA 4IUCS 4JHXA 5M2QA 4PANA 4CF7A 4RENA 3OLQA 4OM7A 4UHBA 4G9EA 3EVCA 3SC4A 3ZGOA 5IC4A 1PX0A 2Q5QA 3HFRA 1EJ0A 2GD6A 3MN1A 3IT1A 4YRJA 3U62A 4MEJA 3ISTA 4LHVA 1KVTA 4Y8VA 1KI6B 4JVLA 3SLRA 3Q7PA 2AUNA 3I30X 2CV2A 1I1NA 2F00A 2D3WA 4I9HA 1I9GA 1RDFA 2PH7A 4DV3B 4G1BA 2UZ0A 3UFXB 4KQWA 1W5SA 3O7WA 5AI6A 4AJOA 1UIMA 3ZY5A 5EHZA 4GLFA 1ZO8A 4YRFA 2EL7A 1OGJA 2XEXA 5DZSA 2XGMA 2H48A 3KKOA 4AYWA 5IPFA 3HTXA 2G7ZA 2GA8A 4NEHB 3MLBA 3F98A 3U31A 1AUQA 2F9MA 2TS1A 3GQBB 3OCZA 4W1SA 1BHO1 4FMPA 4E08A 5P21A 4W5HA 1FFAA 3GRPA 3D81A 2IWRA 2Q9BA 1T91A 1TM5E 4D79A 3Q0TA 3UB4A 1LBTA 4YR9A 3DEYX 5AVVA 3VDRA 4QLAA 1FNBA 2C3PA 3DLTA 4J0QA 3AJRA 4XQCA 5H9WA 2JIZA 5C46F 1UEIA 2XQFA 5T64A 1T5HX 3D2BA 1RM0A 4TV9F 4ZXPA 4DBLE 4I2NA 2VKQA 2Y4OA 3D7MA 3JQAD 1I0IA 1NSYA 1A04A 4B6RA 1GFSA 2JLBA 3FNGA 3TLGA 1P45A 3DOFA 2FUCA 3TLKA 2D2XA 3CPEA 3PUWA 3JX9A 4YV0A 1Y9EA 2X9LA 3VHXA 5F5LA 3UMMA 5EJ7A 2J4FA 1DZIA 1U2GC 1IVNA 3CZRA 2EFDB 5CW1A 4QBIA 1N5MA 4IDOA 4Q3CA 7ABPA 4BKOA 3Q10A 4JR2A 1D6SA 1CRQA 1Z29A 3MJSA 4HVAA 4OSPA 4QUKA 4R1QA 4Y2HA 5THQA 3OESA 3T7JA 3NHMA 3PLRA 5G3YA 4URXR 1GITA 3T41A 1IU9A 3A11A 2G5CA 1N6HA 4QVGA 4KPFC 4DDTA 1VSBA 3QUBA 5JUWA 4PX9A 3ETJA 4BN5A 4GOND 1BMFA 2AV6A 3CEAA 4BO3A 1XLWA 4PYJA 3FNEA 5GVSA 1YJ8A 3C5VA 3QLVC 2Q4TA 2P9JA 2WYIA 2YY7A 4MWSA 4OBBA 1CS4C 2AT1A 3ABOB 2YJ5A 3O4JA 1VJDA 1G7TA 3D3EA 2HIAA 1QYXA 4NATA 2H7CA 4U7GA 4B75A 5HYVA 1BAPA 4DV4B 2N75A 4Y1FA 3SHQA 5EWJA 2EFHB 1YZKA 1DLJA 2H2WA 2B30A 3JAWB 4NX2A 4RH0A 3OKPA 2VDPB 1Z0AA 3HVJA 4EO4A 4FYKA 1CNEA 4OMUA 3CR7A 3QMWA 1XD9A 4HDSB 4BE9A 2VF8A 1PHPA 2W6ZA 3IL2A 3M6UA 2HRQA 3QKRA 3BXHA 4J76A 1SKBA 2R1VB 1PK7A 3CF4G 3ONWA 1G1AA 4DNXA 5BW6B 5H8WA 2Q0SA 4LXGA 2WMOB 1U3CA 1Z34A 4G2NA 3LPLA 1YKFA 2O5RA 5L4SA 1NNSA 2HK8A 4QGGA 3WLRA 4B45A 3USZA 3CRMA 3ZN2A 1LC0A 1SHKA 3IAM1 4UJ5A 4CR8A 3IQIX 5ALKA 1BXRB 3OFVA 3LBYA 4JI0B 1KVSA 2ZI3A 1BGWA 1XP8A 5BR8B 1E66A 5AI0A 5JH7A 3D8NA 3VYRB 4KQ6A 2A86A 3CIOA 1PR1A 1SHTX 2G25A 8ADHA 1SOMA 1DP4A 2ZB8A 1K4MA 3KR9A 5TQJA 2VRNA 3EGIA 2V6JA 3N6XA 3F5SA 2BVNA 3O1IC 5FUYA 1Q3KA 2DBZA 4D0SA 1A1VA 1MO4A 1ST2A 4RYLA 4OX9Y 3ZIUA 3C43A 3T5CA 2FKNA 4DDHA 1K08A 1X2EA 2QAIA 3ZDFA 1E1QA 2XZPA 4CIDA 2OCDA 4F86A 4II2A 4RLSA 3I5UA 2D8MA 3UG7A 1LSSA 3VOBA 1SBZA 4Q4HB 4H7PA 1F4VA 3K71B 3H9GA 3BGIA 3LUPA 2O5VA 3EG9A 4G23A 1P1IA 4IJVA 1E0AA 1WCV1 4H7HA 1TOAA 2FP4B 1VBKA 5L4NA 3F6BX 1N4DA 1YBFA 5FR2A 1BQEA 3PWSA 4NBSA 3TW4A 2OP0A 1XXHA 2GZ1A 4PWYA 1Z08A 3UC5A 1M8PA 4AZWA 4C2UA 4YRNA 3JQ9A 4PLGA 1PQ4A 1SVOA 2DWQA 1EXDA 2XZOA 4TZTA 2HC9A 2DB3A 4PBTA 2JJ1D 5FBRB 1U4NA 5FFMA 1A82A 5BN3B 2HBYA 5IN4A 4D9CA 3GIDA 1XMPA 3QMPA 3I52A 4CUKA 2C88A 5C8DA 4M0EA 1DINA 3PWTA 2Z9CA 1FOEB 3KT8A 3VPAA 1KI8A 2CY0A 1G7SA 2OBMA 2W90A 2P9FA 1T3SA 4UE2A 4P80A 1YDGA 1C0PA 1DLIA 3KELA 1FUYB 1XHLA 1XRSB 2B4KA 3WXBA 4F8YA 1KO8A 3DZ8A 3ILYA 3M6MD 4KWHA 3FI9A 1KVUA 1CDDA 2WT8A 1BIFA 3UWPA 4H16A 3AUXA 4H59A 4BLUA 1V6SA 3DAHA 5KJFA 2PIAA 4INJA 2X58A 3PC7A 1W0JA 2WKPA 2XAAA 3Q3EA 1ESMA 3H2YA 3NHYA 1R5JA 4JVOA 4CIWA 4E7OA 4ROTA 1NT4A 3JZMA 1RKUA 5D1NA 1FFCA 3R1IA 2BFOA 3KZMA 3H4VA 1S89A 3MUFA 3LLUA 4QXOA 3WDLA 1B15A 1P19A 5BR7A 1D0SA 3CSSA 5A0TA 2CEAA 1SELA 3MEQA 1QYCA 1KF0A 1NKTA 3KU4A 4AXXA 2RAPA 1MRZA 4KSBA 4RXUA 1K7EB 1L4EA 2A5DA 3ETNA 4RA9A 1Z0JA 4L7VA 1F9EA 1A27A 4M6WB 4WCFB 3W34A 1W6UA 5IF3A 2BMAA 3QBEA 4EEXA 5JXHA 4G26A 1PYGA 2GTPA 3FCAA 4Q47A 4CN8A 3AHDA 2HSWA 2XWPA 4KJXA 4YRIA 2BPOA 4JEHA 1T1GA 4OGFA 3PITA 1Q1ZA 5BPFA 5GMOA 3WK6A 2XWJI 1GUZA 4FLEA 3PNLA 3LWZA 1E9EA 3KYIB 4OMDA 1KXJA 2EHJA 2J87A 1IM8A 2LBPA 3IP6A 5JASA 1TCUA 3FZEA 1BXZA 1JJ7A 2GHIA 3DDSA 3IAUA 4IG4A 4UU1A 5DHSA 3M83A 4XFDA 3V55A 3VI4B 2JKZA 1UBCA 3LT0A 3ZU4A 6PFKA 1X1BA 2ZIZA 1E3EA 4L5CA 4EGQA 1DAEA 2XDAA 3IOEA 3V4PB 1WD5A 2XUZA 2ZROA 4R0VA 4E3ZA 1QIIA 3F8SA 1LSUA 1CUWA 2ZPUA 4OJYA 4F2WA 4ALIA 1E5QA 1YZVA 3H75A 4JYAB 4CL0A 2HIHA 3CEHA 4HWSA 2VK2A 3L7CA 4EPWA 4NWIA 5B7PA 1HETA 4PSUA 1YZGA 2BKAA 1C3JA 1P44A 3OY2A 1X7ZB 2WTEA 3HHEA 1VCHA 1WV1A 4D4IA 1L5GB 3PX7A 4AJEA 5LSAA 1DKRA 3FE2A 4RE5A 4TVOA 4RNCA 3E61A 4XQ0A 2I4RA 1TRHA 2LP4Y 1HM5A 2K2WA 3RYIA 3KV3O 4DR2B 3BJIC 1L4FA 2NVWA 2ZIEA 1N2CE 3BGWA 2DLDA 4LXTA 4UBLA 1WW3A 2PZGA 5EXEA 4BP1A 2QRVA 2O2GA 3UK2A 3IILA 4LJ5A 1D4AA 3NBFA 3QV2A 1EWKA 1ZFNA 3FUCA 4FSDA 2LCFA 3DWEX 3TLGB 4CU5A 4D5EA 3CWQA 4TVKA 1LDYA 1OYOA 5LZ5A 5JATA 3VHXB 5GGYA 821PA 5GOZA 4F0JA 1EP1B 4J16A 4DJJA 2NNWB 4DM7A 2WINI 4LGMA 1EFAA 4QPJC 3WGTA 4TVSA 3U5TA 4LGYA 2RG7A 2E4UA 4MDFA 5L9AA 3OF3A 4YV1A 1C7EA 3U81A 3SQXA 1T8YA 3JWPA 1Q1GA 1TYBE 2QF7A 3ZHCA 3BERA 4G4IA 3EF1A 1FE8A 4V3CA 1EUQA 1JUDA 1PR5A 1RXUA 3EEBA 3OWXA 5E6SB 3WB1A 1ONOA 3LPCA 1NN3A 2G72A 2ID4A 1USGA 5C7YA 1CVIA 1H8EA 1QJ4A 1ZCAA 1AURA 1UZLA 2OD9A 4D96A 2WV9A 3ZJUA 5IVPA 4ND6A 1VJGA 2HADA 5TGDA 4AO7A 1VE3A 2OAQ1 4CL3A 1C2YA 4DFDA 2EFCB 3LA8A 3UA4A 4EA8A 5JW6A 4ETIA 1XF9A 3IUPA 5AI4A 1E9RA 2EKLA 2PJUA 5EHGA 2YNMC 3FYUA 4ZVNA 3RKUA 3T9DA 4BZXA 1TJNA 3E8SA 3B6IA 1GTVA 4MRAA 2GK7A 5JANA 3MHTA 4TSKA 1B76A 3FGPA 4HJRA 4BMXA 1ZSNA 5CGQB 4DV6B 1E5TA 4D92A 3IUSA 1J22A 3DKVA 3DR3A 3FUTA 2EZ9A 2IPAB 3QMVA 4JFRA 1IHXA 4MWEA 3O8OB 1G18A 3IJRA 4TS4A 4QTXA 2A88A 5G1PA 5B3JC 4PQEA 1FPQA 4BTLA 4QSHA 1PT8A 2VDNB 3TOZA 1D4ZA 1QGDA 2DR3A 1N78A 4OAPA 4PPQA 1R5OA 1O6BA 5IASA 4N5DA 1G98A 1L5KA 3PPXA 3W5SA 3PNVA 5KSYA 3PE4A 3DZHA 1IBMB 1HYHA 2QDXA 3F97A 5AVUA 3VJLA 1CUYA 2XECA 3EDYA 3GRCA 3ONEA 4WSOA 3ZDXB 3FTFA 3EOZA 4TSFA 1KKMA 1PL0A 2FFBA 2RAFA 2VP3A 4QPPA 5BSMA 1BH6A 4XB6B 3LIIA 4Z54A 3ASUA 1ZKMA 3ANNA 5L51A 2FU5C 1H65A 1IWPB 2VAPA 4RPKA 3IGFA 5A71A 4LBWA 1XZDA 4PGGA 1RM5A 2C59A 4HY3A 3JWHA 2WTMA 3AFMA 1R0ZA 4R81A 4B3GA 5EWMB 2OORA 3OEHD 1IULA 4DNOA 3BYZA 4MICA 3SHWA 5CEEA 3WB2A 4GR4A 4RTMA 1N2CB 2Q07A 4OYYA 3DAGA 5B12A 4HTFB 1JXMA 1NFFA 2FETA 1I3LA 3A1TA 3OU2A 5DCWA 3UOAB 5HNKA 4CLDA 1X77A 2O5EA 1YFZA 3ITKA 2ID7A 5DRTA 3RC2A 4D02A 3K70D 3GBVA 3FD8A 1JKFA 4MARA 4N7RA 2OQ2A 3KJFA 5FEMA 2Z58A 1DC8A 3M6FA 1GRVA 1DPGA 4OI4A 3WLNA 1FRQA 4GNRA 4ATNA 5DB4A 5ALOA 4YAFA 3ROKA 1N9GB 2BFDA 2WV7A 2YWXA 4M0DA 4XUCA 2BUCA 3U7QA 2EP5A 2BGKA 3V34A 1E9AA 3AP1A 2CCGA 2KLBA 2Y68A 1IN7A 4KRFA 4PRLA 1OROA 1AGXA 2CFCA 5SYMA 1T24A 4BVBA 2R9VA 5EWLA 3LRPA 2F3PA 2NV6A 5ETJA 4QUEA 1R8XA 1KVQA 3H2ZA 3L0OA 3IOYA 4IXWA 1A8IA 1ISRA 1G8JA 2ZS8A 3ACCA 3PRKE 2HA3A 2KQUA 4GVXA 1SBTA 5JNWA 3QVMA 4Q03A 4PY2A 3ANXA 3SF0A 3C3MA 3AF5A 1EH5A 2R44A 2HRRA 4HXYA 1P33A 3ZPXA 1FP6A 3PEYA 2XQKA 1QGZA 1JJVA 1KXZA 2IZ7A 1N6OA 3RFCA 1M6VA 1CT9A 1RVV1 4PXSA 2VJDA 1NKVA 5C1IA 2QZSA 3DFFA 3MILA 4PVCA 4WGFA 3IO5A 3L6UA 4IZIA 5LKRA 2DEUA 1E1MA 1OASA 2DBVO 5CVVA 5AJXA 3QJYA 4HEA6 9ATCA 5AHOA 2MJLA 3AM5A 1U3WA 4BB6A 1NE7A 4AT1A 4YCCA 1OBFO 2XIQA 4HLUA 2H06A 1RZ3A 4G25A 4ACAA 3NZEA 4W63A 3SKVA 1U9JA 4AZ3B 3AEUA 3OAAD 3HVUA 4BS9A 3MJTA 2FQYA 4WPGA 3ZLVA 2PUEA 3ZXUB 3GHHA 3PJFA 3V4OA 3WLSA 5J2TB 5JSHA 4BFZA 1DEHA 1TYEB 2IS4A 4BVAA 3I4CA 1BX3A 2WU1A 3FZNA 4GOJA 3WBBA 5BMVA 5TDHA 1M2WA 4E5VA 3B3GA 3RCBA 2WAOA 1UDRA 3PXEA 4KH0A 5DLPA 2WIGA 4W82A 5EQFA 1QKJA 2G76A 3AP3A 4KSCA 4UHJA 2OYRA 2AZDA 5DKFA 2C2KA 5H70A 4MR7A 2I3AA 1SMKA 3F90A 3TTUA 3UBMA 3SM3A 3VU8A 4YAOA 1Z7YA 2OKGA 3FYDA 4OK3A 4U5XA 2D2EA 3BGDA 1U81A 2A9KA 3U3XA 3KB6A 1EWRA 2PNJA 2G28A 4LY9A 5GQSA 5BSUA 1VPLA 2NSDA 3CO0S 2HA5A 4EKDA 3UTCA 1MRNA 1QWSA 3QVKA 5EIXA 1AV7A 3ANYB 1AKVA 4A6XA 1Y0BA 2VH5R 2R11A 2Z56A 2FPKA 3JYOA 1SVLA 1N2GA 2Q46A 1L0BA 1UZNA 4LTMA 2R84A 4IQ0A 3ER9A 1W1WA 3ID6C 4LXYA 3SEQA 3FVQA 1VSUA 3HR7A 5DYWA 3DPSA 4PZLA 1H0HA 1DJNA 1EVQA 2A78A 4NBLA 2RGDA 1HUQA 5EPEA 4DIFA 1DOZA 3IPRA 2J0QA 4MPDA 3KSDO 4ZC8A 3HB7A 1W4BA 5ICCA 2GEJA 3KZXA 3J80A 4MIKA 4LTDA 2J0UA 3K5WA 1Z13A 3LUFA 4NY1A 5IJ0B 1DKNA 5GY7A 4X1OA 3OWHA 1SHJA 1NMYA 2C5BA 3E5HA 3IAXA 1OD6A 5IP5A 1IG0A 3AEQA 1Y8QB 4Z0TA 3ZVMA 4FI3F 3WWDA 3ZGYA 1SIOA 4YPOA 3PC8A 4HNAA 2PYZA 2WG2A 3SQMA 3VZSA 4ZYLA 4PQRA 3HADA 3ZHVA 1H8HA 3ZVNA 2AN4A 1H2WA 3AYXB 3WWEA 1LFDB 4FIDA 1XSEA 2VHTA 2IHKA 5IU6A 2DUWA 2GBLC 3MWYW 1F14A 5BMOA 3GLRA 4XWOA 2RGRA 1DFHA 3KAKA 1D2HA 2A0WA 1CY0A 3KOUA 1PGOA 1U2RA 3Q9SA 1QIHA 3F71A 3GDWA 3QJGA 1MA3A 2SKEA 3N8GA 4REQA 4UDXX 4BNVA 2CJFA 5C9ZA 4WTOA 3AVWA 2BN4A 5C5CA 2GN8A 7YASA 1FYDA 2TMDA 5BOVA 3GUUA 1SQFA 1Z5UA 1AA9A 3ZG6A 3ZNOA 4TLDA 2JIZD 3LY7A 2J33A 3DJFA 2C3YA 3L40A 4TXJA 4C7JA 4OP1A 4Y2UA 1U2TA 2Z1DA 3HKCA 2PJZA 3ZHTA 3LX5A 5LQJA 1HOTA 2DLCX 3ZYZA 1PSZA 1SUSA 4HWRA 3RJ9A 5IKEA 3C5EA 5BV2P 5EEHA 3UCXA 1ZGGA 3FYUB 3K09C 1T0IA 2B36A 3GLIA 2CXSA 3ZWPA 4YO8A 4XH9B 5KZMB 2XKKA 2SCUA 3EXEA 1I51A 2B8JA 2NV0A 2WW8A 3SSMA 3BXOA 4XVCA 4RIIA 4LIPD 1RYBA 2VQSA 4C4AA 1I5EA 2P5SA 3FX2A 3IOCA 3S2FA 5A5GA 1ODFA 1ZJYA 1NUHA 2CXRA 4B6SA 1GXSB 3W79A 4KL8S 3JQFA 3OZIA 5K8IA 5HUQA 4FR0A 3D7SA 5CM9C 1KYYA 2AQ8A 5ECWA 2HRBA 4GPIB 1URPA 3LWBA 5AVJA 2CHQA 2FOLA 2VJNA 4F46A 1W48A 1BMFD 4BO8A 5TMDA 5KEIA 2XZDA 4MGYR 1WV0A 3S8YA 3GFBA 1Z12A 4OAOA 1YZHA 3UMFA 1AXRA 1D0IA 2JFNA 4CQMB 3E9YA 4RJLA 3DTVA 4PAGA 4PLTA 3HKBA 3UJ3X 3S2SA 2AE1A 1P1HA 2KM1A 3HN6A 4JBHA 4UHEA 2MIIA 2YHIA 3G5UA 2W2PA 3HA3A 3AG6A 3U3ZA 2W93A 3RTEA 2CLIB 4Q1BA 3OIWA 3ZWQA 3O8NA 3SJBA 4WA8A 4RTNA 1Y6GA 1ICIA 1F0NA 1UXJA 1BGXT 1T6BY 4R01A 1Y6JA 3A9VA 1U8AA 1AKUA 1RYFA 4ZT6A 1OILA 2ZREA 4U0KA 1SCJA 1G1MA 3T1NA 5I47A 3SD7A 1TO6A 1WY7A 2BKXA 4G8CA 5DIZA 1A9PA 1VRVA 2P2SA 2CNWA 2X4LA 3CN7A 3HBJA 3O74A 4A3SA 4B43A 2X2OA 4QAQA 4ZT3A 1NY6A 2ZG6A 1F4PA 4Z9BA 2JA1A 1JG6A 4L0DA 3H3FA 2IGBA 1EDZA 3R7SA 2L69A 1ZW1A 2GPYA 2WHYA 3EVFA 3ILXA 4FFSA 5T3UA 4ABYA 3OQVA 4HN2A 4I19A 1XAHA 3HGMA 4CMEA 1Z2PX 3V8BA 1ISJA 2BFDB 5D7NA 1CZOA 3E22A 3HDJA 5PGMA 4WUVA 5F7JA 4UM8B 2DFTA 2HQBA 2PSSA 3H2BA 1HRKA 1UAGA 4R69A 1M1ZA 5A7GA 1NLUA 1IK6A 1U3VA 2GCOA 3D6VA 2WWVD 1U80A 2JHFA 4Y2TA 4MVXA 5A4IS 2HA0A 1TW3A 4M7OA 2FFAA 4QQFA 5GTDA 4MKGA 2AMJA 3RC1A 4LWQA 1QH8A 4M0MA 3SKXA 5TGZA 3LUHA 1E1QD 2B82A 5BSGA 4WCDA 2W2NA 2JLWA 4HH0A 2FEKA 4KKXB 5I8WA 3MJVA 1ZOOA 4OOFA 4P6VF 5JCOC 2QIOA 3QU7A 4K05A 2AYZA 2WTNA 4YUYA 5T5QA 4CQLA 2FMHA 1LLDA 5ALLA 1KP9A 5FJJA 2OYSA 5BV8A 3FH0A 3JWIA 3KKNA 4TRJA 3CLKA 3QQ5A 3KRTA 2PO7A 4B33A 1YQUA 1M6VB 3CNEA 1CUDA 1AOXA 1EZ1A 3H5TA 4R6WA 1PGNA 4OFWA 3WNVA 3B9BA 1B0AA 2H5LA 2JBHA 1EK2A 2OAP1 2WWGA 5CURA 1SQ6A 2CE2X 3W3ZB 6ABPA 4FMCF 3EGEA 2EG9A 1ZHFA 2IRWA 4GGPA 4A91A 2JLCA 1AZWA 3E3OA 4I1SA 4B7XA 2ZE7A 1BW9A 1OSNA 1XNJA 4P98A 4PHFA 3GP5A 2GM4A 1Q92A 2I55A 2FMFA 3ORYA 5KI6A 4EI8A 5I9LA 2WBLC 5FAXA 2GI4A 3SG0A 1PR6A 1S3FA 5C80A 1Z26A 1X74A 5CJ2A 5JBIA 2W4MA 1QKIA 3CCBA 5E6UA 3RREA 1TO2E 3TKAA 2LUOA 2Q1WA 4ZU1X 4BVLA 2DHQA 5DXAA 2QI9C 3HSSA 1CFJA 3PUYA 1G3RA 3I1FA 3MBIA 3TI7A 3V8RA 3W8DA 3OUUA 1G2QA 2IDKA 4E94A 3RAEC 1UBGA 3HG7A 3I34X 3KR1A 1IOLA 1L5RA 4TQUS 3EEYA 2W2QA 4G8BA 2BHSA 1XQ1A 3MTEA 1W0JD 3AM3A 5AIAA 1OQAA 4OQNA 5CP8A 4UM5A 1GN8A 4LX0A 3WK7A 3ZLUA 3S55A 1GZUA 5ALWA 4LQ4A 1AE1A 4DDMA 4W9NC 2VK8A 4IDDA 4X3OA 3HU1A 2Y0CA 1Q5PA 1U0TA 1P72A 2WSYB 4INAA 4JVMA 1TF5A 4YAJA 4DA9A 2GKSA 2QROA 2E21A 1WDTA 1PR4A 3HHPA 4LJKA 2YN0A 4MJXA 4DBZA 2J5XA 2OO5A 3S2ZA 1PGJA 3I1IA 1LDBA 2H1WA 4MPTA 4UAUA 1UC8A 3GNSA 3A6ZA 5EP1A 4DAEA 5JWRA 3ADDA 3WGQA 3W6PA 1PEKE 1SHUX 4E88A 2I4MA 2XCLA 4XUDA 4TLEA 1EK0A 2QTLA 1T9DA 3F78A 3W3AA 3WGKA 2J0UB 1EBBA 1EGVB 2JLXA 2AE2A 4KFTA 1CNFA 3GUCA 2FK7A 4HLCA 4M1SA 3E7DA 1DBIA 4X54A 5EAIA 1LNSA 4UUOA 5T6BA 1JAYA 1V8FA 3SHVA 2IUTA 3AEQB 5C8YA 3AIMA 2WM2A 3A4YA 3ZE6A 3I09A 1MVOA 3N07A 5KTNA 4RX1A 3B6EA 4HQOA 3E1KA 5FI3A 1A9XB 2Z57A 4P92A 1KJZA 1RLMA 3W2EA 2VZ8A 1JXQA 3PEEA 4RL6A 2ZUEA 1XHFA 3HEBA 3V7UA 5DW3A 4YMSA 4O4HF 2P0YA 2EIHA 5CK4A 1DIOB 3PD0A 5KNDH 1KP2A 5LMUB 1GNVA 3QV1A 1GYRA 3WYBA 1IPHA 4JYPA 2JZNA 2VHUA 2RMKA 2YXDA 3GWGA 3P52A 4XXHA 3B3FA 3G0DA 2FLKA 1I1QB 3FRJA 5EKUA 4ZDIA 1Y8ZA 3BT7A 4P34A 3C3JA 5ALDA 3TZKA 4C14A 4DCSA 1Q17A 4CG2A 1FX0B 2FW8A 2Q4RA 4N82A 4YA6A 5HZGA 2JHPA 3VR2A 2O1EA 1QUEA 1J0CA 4N49A 5ALHA 2G5GX 4D4HA 2QMQA 1PWYE 1KI2A 1NBAA 3IURA 1SXJA 2ZR9A 3W9BA 3NRBA 3M5CA 4JJ6A 1AK1A 4CNQA 1VL0A 3HKCB 1PJ3A 1PN3A 4FZJA 2OHXA 5G0SA 5IZ4A 4Z1MA 2QUHA 5JCZA 3DHNA 1W52X 3M6LA 4JJFA 4MWDA 4WKBA 2C54A 1HH4A 1SA0A 2AX4A 4WNYA 5E0KB 4MIYA 4PZEA 1PSWA 1JWAB 1NAHA 1L1QA 2ERYA 2YV4A 1GO2A 5K3SA 3RJMA 3GLIB 2VPPA 3FOBA 3HCWA 4DB2A 4R9RA 4D3FA 3IQXA 3LP6A 3SDSA 1DFGA 4OH1A 5JQGA 2SCUB 4AS3A 4MEAA 4W8HA 3E8XA 1QU2A 2E4WA 4KQKA 1E6EA 1OOEA 2IZ6A 4H9GA 4US0R 5B1EA 1KU0A 3HVKA 4WOBA 4CV3A 4F4UA 1KAHA 1UZUA 3U9SA 4NESA 3KZCA 1UDBA 1BXGA 2IZ0A 4A36A 2BF7A 2FPLA 2ZCJA 4FFDA 4KB5A 5LD2B 3DB2A 4DV0B 1G6HA 5GZ1A 5CA0A 1JIXA 4KLCA 2HNAA 2XNCA 3N1UA 2OFOA 2XNHA 5FWXA 1H8ED 3A7EA 2JS7A 1ZS9A 1S8FA 1JH9A 3UBTA 2GEDA 5IKPA 1RPTA 4MGIR 1GSOA 2IJGX 3RRYA 5EMNA 3TNFA 4ICIA 3PTLA 3OCVA 1QORA 3R75A 4DCUA 2NSHA 1Q0LA 1UEJA 1K92A 2OCYC 2CGEA 4HZUA 4R8MA 1GTMA 4BU1A 1FSSA 4CCYA 3C6YA 4I4CA 2B0CA 4BVKA 1PEYA 1RM4A 1BWQA 1U8XX 3PJGA 5AUPB 2EZUA 4BV3A 2D2IA 3FYSA 4QX6A 3DF9A 3UT6A 2YIVX 3VPGA 1JKXA 1NPYA 2I22A 1E32A 2QR3A 3A58B 3A6DA 4OG2A 5DN9A 4DRYA 3FTEA 3WLKX 1L7NA 5K0NA 1GP2A 1O96B 2F48A 3TCKA 3VX4A 4U2BA 1NDUA 3VOAA 4MQEB 1O0CA 4ITRC 4ZVQA 3K2EA 3L4EA 2DZDA 3U80A 1XAIA 1J24A 3DE7X 4D44A 1M2VA 3F49S 4NBWA 2A3RA 2BI7A 2VUTA 4TMWA 3EEIA 2Y3IA 3KJXA 1VLMA 3DOJA 1EU1A 2Z3VA 3KBBA 3R7BA 2YN2A 4GWKA 1VLHA 2CVOA 4IO1A 1U2DA 3QHQA 4C78A 4TV9A 4CQMD 4JLNA 4AXBA 1CDZA 1I80A 2TMKA 4TSFD 1US8A 3MYYA 1DIBA 3E22B 4NHEA 4OBXA 4JB8A 4GBED 1N7GA 1PK9A 4NS1A 4RVHA 1G5RA 2GCOB 3OZUA 4ZMSA 1H2ZA 1RRPA 2B3DA 1ML3A 2DHDA 3C5WP 5HTKA 1W94A 1BFUA 1AGNA 3RS3A 1JG4A 3S2IA 2AN3A 3RC9A 3EOBI 2EYQA 4Y0AA 3TDKA 5CPFA 2ZJAA 2O20A 2OZKA 3D8SA 2HMVA 4UEOA 2IU6A 4LNUA 4HWKA 2R87A 1KH3A 4HEA1 3S40A 3AKCA 1RQNA 4JI2B 4ZMRA 2P6UA 5CEJA 2BTQA 2G1PA 4JU8A 2UZ1A 3EHEA 1W5FA 1JSXA 4QDJA 4CETA 5C53B 1LDMA 2G1AA 1QQTA 1W88B 2PKXA 3LGAA 1C41A 3LUGA 3Q4GA 1XLTA 2GM3A 5AK6A 3F46A 3KAJA 5I01A 4WXYB 4MULA 3SYLA 3ZV5A 2PT9A 521PA 1DUIA 3KYDB 3W8EA 4HXGA 2OCIA 1IPFA 2QRNA 4IS3A 2PRKA 4XGQA 2H1RA 1A95A 4HWGA 4BP9A 4HGQA 4RV5A 2OPHA 3K6SB 1JHMA 2V6BA 5EPOA 4KKVA 4FKMA 4PX5A 2EFYA 2ZI4A 5FUXA 2R2GA 6ADHA 2H7YA 4JYBA 4XQGA 4UFNA 1Q44A 2AXNA 5CVUA 2YFKA 3NT4A 1I7LA 1FXWF 3AHCA 4Q37A 2C9BA 1PQWA 2QLTA 4LOIA 2FEXA 4I66A 3H5AA 4GNKA 5E6UB 3R3VA 3LV8A 3EG5A 2VO1A 2Z04A 3AINA 3D5TA 3PWZA 4IIJF 1Q0SA 4EPVA 5A5EA 1QAQA 4H77A 4C0HA 5JTTA 5F1OA 4ZYUA 1YVDA 3D3WA 2UXDB 4RY9A 5FADA 1TM3E 1KARA 5H3CA 4N8EA 1EM8A 1QNLA 3KETA 2W5UA 4PFJA 5IMBA 1QIMA 5KJEA 1K8ZB 1WBBA 4IUDS 5BOSB 5EFZA 3IA7A 4X66B 1ZR2A 4DA7A 1KAQA 1HDXA 4WZBE 2B8NA 1SCAA 1WMDA 1XVVA 2LD4A 2VZLA 3E2PA 2ZAOA 4PW0A 2BH9A 5FV4A 1GN9A 3KQWA 1P2DA 3ZI7A 3JARA 4DV2B 1X7WB 3HS3A 2IYXA 1TADA 1T43A 1CNMA 3K0FA 4Q1CA 1SAYA 4QJIA 3NBQA 3DBIA 1FUIA 2E48A 1LVGA 2JJYA 1GL9B 1RRMA 3T5TA 1CULC 2O48X 2ZJ5A 1D2EA 2X0RA 3LUBA 4HGRA 5DH9A 5AXAA 1KORA 1LJ8A 1U5CA 3SI7A 3BD8A 5B58T 4BECA 2AOXA 3EX7C 4MV6A 3OQIB 1YQ9A 3U9TA 5BSWA 3P7MA 4HSEA 3B13B 4OHOA 1QMGA 3F4KA 4X90A 2AOTB 3NC1C 4ALNA 5BW4A 3U7GA 5BW5A 3LXRA 1N77A 1IHUA 2NTYC 4BQSA 3WICA 1RJ9A 4PC7A 4XSVA 5EPUA 3TAXA 4UOQA 1B6SA 1Y6RA 5IKXA 1IUPA 1JEOA 4XCVA 1IBSA 3MLAA 3PNYA 1R2QA 4M1QA 1O94C 1R5NA 4C2BA 4YMGA 3KOYA 1SVWA 3R5FA 5FPYA 1TUBA 2QD5A 2XA9A 1ULUA 4K81B 4NH0A 4KO1S 4CF6A 1JFSA 3PYLA 1NR5A 3P9XA 3BA1A 1W2WB 5LLTA 4QODA 1ENZA 4MWOA 4RNDB 4JB0A 3BCHA 2IA5A 5TMPA 4W9MC 3GNQA 1KMQA 3SOZA 1ORRA 2JGRA 3L8CA 4A10A 2DWCA 3CY6A 5EP4A 4CLOA 1M1NA 1HLGA 3K3PA 3WO0A 1SN7A 3C8UA 1G8GA 4CIVA 1XDWA 4FYPA 4GKKB 1XRQA 4ZVLA 3KSMA 1KMHB 3IUBA 1J2UA 2WUWE 1DC3A 1SD5A 3LP5A 3PGKA 3IPLA 4N5MA 2VDKB 1LQUA 4B8YA 4YR7A 3WYDA 1FLDA 1TZMA 3PBKA 4LBZA 3QF7A 3GMDA 3SNKA 3WSWA 1DXHA 1IN4A 1FUKA 3CPSA 1A2QA 5AVQA 2VKTA 2WJWA 4MYSA 5AYVA 1XCGB 1MTZA 3M4XA 3S44A 4DTCA 1PFGA 4EMSA 4NULA 5CLJA 3WLOA 1ZJWA 3WGLA 1YS9A 5J2UB 1NATA 1SU6A 4Q1VA 3JWGA 3R41A 4FOPA 5FBWB 2AK3A 4NR0A 3DE5X 3TECE 1EJ6A 3ENKA 2OXEA 1FIUA 4Z4QA 3NBUA 2WAMA 4IF6A 1TEZA 5KQMA 3AKZA 1DKQA 2VPQA 1BYIA 2Z2JA 3SMQA 4MJLA 2J67A 1QLWA 2QYTA 3MJDA 1Q0PA 1XMOB 4K88A 1OXTA 1MT0A 2VYQA 1H6DA 1UJ6A 1J07A 2FAXA 2WKQA 3HN2A 3LY8A 1I24A 3NUZA 5JD4A 4L78A 3BMCA 4CEJB 1HDIA 4JT8A 4PXYA 4U2CA 1N2EA 3S2UA 4OJQA 1OX5A 2YOHA 3OVMA 5DBOA 2IXBA 1BXGB 4Z99A 5HX7A 2L18A 3RSCA 3HJGA 5K0TA 1B8PA 4G41A 4WZBB 3R7AA 1SKMA 3V1NA 1Y7TA 2LKDA 1W30A 1M2NA 1XRJA 2IYOA 3PNKA 4M22A 4MPRA 5IJXA 3UQZA 3ZCVA 5CA0B 4W6ZA 4JCOA 5I45A 1L6RA 5K0FA 3NATA 2D0IA 5FPPA 4UULA 4W1QA 1WABA 3EIOA 5LQCA 2D0OB 2YZKA 2ZTUA 1G0NA 1RBMA 3DF7A 2BW0A 4KIGA 4LJ8A 3TX6A 2Q99A 1DC5A 4D0LB 4D3YA 3GRYA 3JVEA 4DQ0A 1XTRA 3MT8A 3R3HA 5K0ZA 3SQNA 2AFIA 1YHNA 5E9JA 3TH5A 4DR3B 4AFNA 1X86B 1R27A 2G0AA 3H13A 4HZUB 5CLIA 3A1WA 3PR1A 3DOEA 2LPMA 4OKNA 5KBYA 1FJXA 1KNXA 4B44A 4BLVA 5J5CA 5C1OA 1X13A 1NXQA 1OC4A 3K7EA 3FFAA 4MV7A 3UXMA 2XQVA 2DWOA 1O5IA 1EFVB 1UMCB 4EPTA 1QB8A 1FMLA 4ZANA 1BHJA 1GNSA 2BBTA 1JECA 4K9SA 1HOXA 5AK5A 3C7CB 3TIXB 2D1TA 1JLLB 1MAAA 2OO7A 1KKUA 2PGLA 3I04M 5ENDA 3ZBQA 1P60A 5HKLA 3AHEA 4BFUA 5AVXA 2V1UA 4A5OA 2FFHA 3ONVA 4BEBA 3GPIA 2NPFA 1XXLA 2JCSA 9LDBA 4IX9A 1W4RA 2RE8A 1UJCA 4WV3A 2EF0A 1JQ3A 5AKIA 2BEJA 5DFAA 1CRZA 2GFQA 4FHZA 2W6NA 3IP9A 4IKEA 2Q2QA 5EKTA 3ZX4A 2XUJA 3CH6A 1US8B 3DTVD 5EMKA 3ZXIA 2FPPB 4MVWA 1EIZA 1F06A 1OKKA 1V45E 2BY4A 2OHOA 2PZFA 3O8DA 1WTAA 3OU7A 4BQOA 3MGAA 4RLFA 5F2NA 3HNRA 3KUKA 1CU1A 2CD7A 2EWWA 3ZJVA 4NI5A 3A37A 4O5OA 4MKRA 2VBCA 2C29D 4RV9A 5TQ2A 4AL4A 4M86A 4KQJA 4QU0A 4G8JA 3GXBA 1S1MA 5HS6A 2FZLA 1R7RA 4MA5A 4U7JA 1J70A 1ZL0A 3IT2A 3MWFA 2FXVA 3LHDA 1T8PA 1R0RE 1RLIA 4RVUA 3UAOA 3A10A 4QYWA 5F3RA 1R3UA 3ENWA 1G21A 3I6YA 3NTLA 3GEMA 3OTQA 5ICSA 1K86A 2CNWD 4EOGA 2F67A 2H7XA 1EGHA 3DWFA 3U6BA 2H1OA 3MVEA 2C4VA 4UNNA 2VT6A 2W2TA 5D86A 4DR1B 4KR7A 1T1SA 3LVFO 3N2IA 2GXAA 1G20E 5IANA 4IKPA 3V2UA 4RPIA 4DR4B 3WNQA 4NICA 1NRIA 1NL3A 1NRJB 5HJ5A 3BEOA 1KKLA 2N0SA 2O0JA 2KI5A 2OAGA 3CZ4A 3JAKB 3KD2A 1IEWA 3P32A 4JDPA 4EIWA 4JI5B 2D1YA 3N6VA 3AKDA 3U1TA 5D51S 4OFZA 3NP9A 2GVDC 1B0UA 1B14A 3R3UA 3LFUA 4JENA 4WL0A 2W7TA 4GPEA 2W0MA 4HO1X 4LN1A 2QU7A 3I2KA 3PKIA 2FX5A 3AUAA 4GD3Q 1TD9A 4H4EA 1GAEO 4KR6A 3OI7A 3VQTA 1NXVA 1U3TA 2O8CA 5E4YA 1E20A 1QX3A 2FPOA 3GX1A 5A4AA 5F3WB 2QN1A 2WLSA 4RETA 1ULTA 3EPJA 2JCXA 5DM2A 3VSDA 1RXIA 1XYGA 1F0YA 4U6SA 3D3WB 3HCEA 5LOVA 4BRUA 4GDMA 1EM8B 2R4UA 5JPIA 2ZJ8A 4N0DA 5LMNB 2Q3JA 3GH1A 1AGYA 2MR5A 2YH2A 1D8AA 2ZUDA 4JBYA 1QE3A 2GHRA 1MQ9A 4CYMA 1TU3A 3QX9A 1WXFA 3HACA 3UF0A 3AHFA 4B76A 1RWNA 1GZHB 4BBJA 2JAHA 1UK6A 4FOSA 4BMPB 5ED4A 1PT7A 5FUBA 2CLSA 4AJ1A 1IZZA 3JRXA 2VHVA 3CCCA 3GD7A 4HH1A 3CG0A 3D0RA 4HYYA 3NDIA 4URZR 4GP9A 2QSZA 5BO5A 3LQ2A 1GCGA 1XKXA 3UCFA 3DBHB 3TMAA 5F23A 3LC7O 2AFIE 4FONA 1HF3A 5FP0A 5LL6P 2CCJA 4RACA 4JJGA 4WKPA 3ZUGA 3F9IA 5CDTA 1Q84A 5FBQB 3GPCA 1XFDA 1V11A 3KKMA 3VBCA 4WBXC 3CW8X 1E7WA 1FTYA 2PUTA 4I6EA 3H5LA 4B7AA 2D74A 3TQHA 1RJ9B 1TZJA 1KIFA 1MO3A 2WJPA 2JW5A 3CA8A 4L50A 4BX0A 3L5KA 1PT5A 1LSJA 1ACLA 1QSGA 3PZBA 4UNQA 3AZQA 3MMZA 1XYYA 2DM6A 4NL4H 4IDCA 3TZBA 3C4QA 4DDVA 1TUBB 3OQBA 1EUCA 3TINA 3UJDA 1UQUA 2IUUA 4QFMA 4RWEA 4OKIA 1R0YA 3HL0A 3IBSA 3RV4A 5F9FA 4TL7A 2H11A 2XJ9A 4HQ0A 3C7KA 4L5JA 1DAMA 2ZWMA 4OL0A 3ANMA 3KZVA 2NZWA 4YP9A 5HMLA 1KVRA 2OSVA 1DRUA 3AESB 2C2HA 4IL5A 2EKPA 2D7DA 1RRFA 4K87A 1U02A 1G20B 2JI9A 1FFBA 4UUAA 3VNUA 2ZYTX 2H5JA 2F59A 2J3DA 2A1TS 3WFZA 4BBAA 4RHEA 4Z1OA 4C6HA 1FDIA 2GGSA 3O75A 3W3AD 1AKNA 1DV1A 2JLYA 4EGCB 3R8XA 1V4VA 4IMJB 1Y6FA 2Q4DA 3QVGA 1XCPA 1LX7A 1OE0A 3H1TA 5AKEA 5I7WA 3T5DA 1OX4A 3QBVA 4K0KB 2ZEJA 3QK7A 5HWSA 2XF8A 4FW9A 3PL5A 3BXZA 5JALA 1AF7A 1XALA 2WVGA 1U90A 1ZD4A 1NXOA 1VQ1A 5FO1A 3M5PA 2HLPA 4NV1A 4WLVA 4JJIA 2GARA 3QVWA 4UU8A 4KFSA 3VU0A 5JYDA 3QUAA 3VVBA 1DVRA 1PRYA 2ROQA 4MUXA 3RVMA 4IZOA 1G9SA 4KVFA 4FEEA 3HYLA 1Y81A 3HBMA 3Q8MA 1XL0A 1U7TA 2Q29A 1ZH6A 1XTVA 1GCAA 1ISHA 1O54A 2BRUC 4HYQA 1S7GA 1QDEA 3BMCB 3KPWA 4XWWA 3UHJA 2DOKA 4TWBA 2OA0A 4DRXA 4L72A 2FF7A 4JXJA 4IFIA 1TAGA 1G3UA 4M9UA 3AY0A 4ZAZA 1C3OA 2RH5A 4MDYA 2P6PA 3KX2A 4FUTA 5G41A 3TD2A 4G0WA 1DBPA 1FQKA 4ZTUB 2Q2NA 1HLPA 2W22A 3LQYA 2H0RA 2KB0A 3VR2D 4IMRA 1J8MF 2XB6A 3K0CA 1RFGE 2JKVA 1AKMA 2QI9F 2VPXA 3LK6A 2Z2KA 4N7MA 1UXHA 1SXJD 4DDWA 5CX1B 1A5ZA 1RP7A 2C5FA 3M7IA 5DBHX 1PNOA 3W8NA 1BO6A 2IPXA 3CZPA 3K92A 3WLFA 4EUNA 5T8KC 3ZVRA 4Z1MD 3NV9A 3TAHA 4ASUA 4QUJA 2AFIB 5ER9A 2FWRA 4YFVA 2BEWB 2HA6A 3OO0A 1Z0ZA 4RXMA 2PEZA 5CT4A 3H1AA 4Q1FA 3FPLA 4RHCA 4DV1B 1Z73A 3DXFA 3M89A 3KU1A 1U28C 4RKWA 2RC6A 1V5WA 1WKVA 3AW9A 5ALQA 3R24A 1GA1A 4Q3DA 4P4NA 1SIUA 3L02A 4QFCA 1ITZA 3KVOA 2JFBA 5FOUA 1NVKA 2Y1EA 4D9IA 3PQ8A 4EVRA 1JEQB 4TOIA 2C0CA 3RS0A 3DW1X 1SURA 4GI3A 1M74A 3HABA 1YQEA 2BELA 1ODLA 4BLSA 1GKKA 2BD0A 1D2NA 1V8PA 1F5SA 2PL1A 3EXAA 4NP6A 3ECSA 3S1LA 4A6DA 2FSIA 1O97D 4LOAA 3ACBA 2NU8A 4L0MA 5AW2A 2X4DA 2G5TA 2SKDA 4CKYA 1B74A 3HU3A 4B3BA 2VRWA 1KTVA 2O7NA 2V58A 1S8AA 3EDMA 1DWOA 1QE0A 3NNNA 1CXZA 2XWBF 4C20A 2QRQA 4BNDA 2I71A 3OT4A 2WR8A 2FSUA 2ORVA 1X7YA 1SOAA 2I0FA 4UASA 1HC7A 1OXBB 3BTOA 4XYEA 1DEOA 1GPAA 1SIWA 4N5NA 3VYUB 4CIYA 1C0EA 4I08A 3TLCA 4WLUA 2EKZA 2M2IA 3TXYA 3FAZA 1QC5B 1LH0A 2QM0A 3I04A 4Z9YA 2CL7X 3FPHA 4U39A 4ZJUA 2PD4A 3RS7A 5KKCA 2H5EA 2JEYA 1L5HA 2REBA 3M8KA 3FOEC 3K8QA 4GF5A 1X1TA 4WIAA 4LG1A 3SXUA 3NANA 2GUGA 3NTOA 3QE0A 1G21B 4XJSA 1U7UA 4FNAA 4Q12A 5J5AA 1D1PA 3I62A 3QELB 1ORHA 1CVLA 2DKFA 1R9GA 3N76A 4JVNA 3GEPA 5ALXA 1X3LA 3TLJA 3HPRA 3HP4A 1UDXA 1MN6A 2XTMA 5EE5B 1FL9A 1VA4A 2OMKA 4D9HA 3EC2A 1K98A 3CKMA 5EMMA 2JATA 4B4WA 4HNTA 1JDPA 2X0EA 2HK9A 2GEKA 1JYFA 1VBNA 2HPVA 2XNDA 3GFPA 1JRLA 1W35A 2Q6TA 2W43A 5DGXA 1JKIA 2HL6A 4TWZA 2YYZA 1C3EA 4DXAA 5TF4A 3C6XA 4LX8A 2R8RA 1YK1A 2Q2OA 2IW1A 1S3GA 2RI0A 4KR0A 4KHPB 2XMZA 4N41A 4MV8A 1QUFA 4PC2A 3D4BA 1Z2OX 1E9DA 3RRZA 2B1IA 1T9BA 3H97A 4CZ2A 1RCFA 3AR9A 3EY9A 3SC2B 3HWWA 1Z16A 1FP2A 2EEZA 3DZBA 3WGOA 3EDCA 3QXSA 2CJXA 1D0VA 4DPKA 1T9CA 5CDUA 1ZITA 4CI0B 4EECA 3CVVA 4WJZA 3AUKA 2ZJOA 3P27A 4K3UA 2TECE 4D2IA 1EZ4A 3E53A 4CMGA 3C15C 2OV8A 3LCCA 5HF5A 4OQEA 3MINA 2O05A 3OQ1A 4HDQB 5SZKB 1YKGA 2UAGA 2AN5A 2WSMA 4MYRA 1W2HA 2RHOA 1OAKA 3ILVA 1OIWA 2G71A 4KNYA 1P2SA 3DGFC 5F7ZA 3B6ZA 5JV5A 3QIVA 3PQEA 3PQ7A 5E9QA 1HQKA 3EQ7A 1K3FA 3C7DB 3EF3A 2ZQ5A 1XDGA 4LZNA 3O8CA 5AVZA 4B6GA 2BBWA 4LZWA 1XRRA 2EXXA 4CV1A 3LT4A 3LIPA 3ISJA 3F73A 1M2KA 2H31A 3SZRA 5CU7A 1B93A 4U63A 1V11B 2QS9A 1TDJA 1U7XA 2ZBEA 3PTZA 5AQEA 3WYGA 2G6BA 2R00C 3D9QX 4IM7A 1EGAA 1UOPA 1O9HA 1H2AS 1C9EA 2JFXA 4NDNE 4D1YA 7GPBA 4TV8B 3KQSA 3MPOA 5A6VA 2QBYA 2R7AA 3PENA 8ABPA 3KD3A 3MJHA 4XKJA 4NE9A 2J59A 1ZY2A 3X1WA 5EIBD 3UUEA 1BFKA 4LZAA 2VBGA 1C9MA 4KODA 2ZAYA 3TRIA 2O8VA 4I4TB 4YDQA 3WTBA 1SK8A 4J91A 3V4RA 3T0FA 4V0ME 1R4NB 2FMUA 3AFGA 1Z0FA 4TLMB 1ZWLA 3T3EA 4DYVA 4WFKA 3EGWA 2RHBA 3KLOA 3LRXA 5LP1A 3UJ9A 1HO3A 1YIAA 4D99A 3K1AB 2P68A 2BCGY 1U2GA 2D1SA 1A5BB 3O3OB 3UMRA 1GZ6A 1OREA 1BCRA 4BVJA 3DO8A 3M4ZA 1C7RA 1JHVA 1L4KA 2I3ZA 2Q2VA 1EDDA 2WG0A 2OCXA 3O83A 3KB8A 1UKYA 2Q1YA 2V7QA 2FR8C 3UQYS 4A0GA 1YU9A 5KC9A 3VZDA 1Q0QA 3M1YA 5HJEA 4IPTA 2MYUA 4OGLA 2B2CA 2EHDA 2FZGA 4PGHA 3UV7A 5BVGB 2DQYA 1CHDA 4BMYA 2EX0A 5A9TA 1AUOA 4NONA 1NJFA 2DCMA 3Q7IA 1I3KA 1M1UA 4FGUA 3DBVO 4UATA 2QMHA 3ZNNA 1S3SA 2ZXEA 3QLVA 3C70A 4D80A 3EF0A 1KQOA 2CLLB 1A2KC 3FROA 5LR6A 4FYYA 4EZIA 4H6VA 2V7XA 1UZMA 4H4DA 5K0CA 5K8LA 2GN4A 3AT1A 5I4KA 3EQZA 2AA3A 2X22A 1R0CA 5EZQA 2NO7A 4HAXA 5IDXA 4A2WA 4D43A 4TLBA 3NO4A 1GU1A 3D54D 3IS3A 3QIAA 4QDXA 1G64A 1QX4A 2V7EA 3AF2A 3JVUA 1E2EA 4IKOA 2CXPA 4P82A 3HUFA 3G6KA 3KPVA 2ZCVA 2HCBA 1K2WA 1QZXA 1T9AA 2GX6A 2B0JA 3O1HB 4AICA 4CM7A 5H83A 4GI5A 3EEFA 2QAGB 3WC4A 4F04A 2WNSA 2I4TA 3Q5DA 3MNFA 5DYTA 1YJCA 1F0PA 1SK9A 2QM7A 1XBTA 4MGEA 4ZODA 4D26A 4WZZA 4A5SA 3LI2A 4ZOLF 3AMVA 2WU4A 1W36D 2HMTA 3BK7A 2C3OA 2PBRA 4MDEA 1ZC4A 1TMYA 1P2FA 3AFOA 4ZI5A 4P4LA 5BQXA 1JHXA 1ZXLA 3CJRA 3FOWA 4YAUA 3EYWA 2PLNA 1XI2A 1YDWA 1NBME 4DDUA 3BJRA 5HCIA 1EHIA 3Q8XB 4BUCA 4EYEA 2NTJA 3I5YA 3P5SA 2PMEA 4MAMA 1I01A 4G0MA 4HXEB 1OAOC 1J9EA 3MWDA 3L07A 4QBGB 1XRNA 2X3FA 4LEIA 1RHKA 2PU5A 5L40A 4C88A 1QANA 3QITA 1XDBA 2I8AA 1U1EA 2R6AA 2VJLA 3GOHA 3KYCA 4C2TA 3G1UA 1JIKA 1NYRA 4RPJA 4K9PA 4INPA 2NU8B 3SYKA 1KMMA 4DYDA 1AS0A 4Q3KA 5ERYA 1RE0A 4PYMA 4CM1A 1T5TA 1XU4A 4Z4EA 2NO0A 2PX8A 1K5PA 3F1KA 4GOXA 1RI5A 4JSTA 1IY2A 4B34A 1KEUA 2AJBA 1X7YB 3A3YA 3SWWA 4EJ2A 2Q1XA 2RBGA 1RP1A 1FS5A 1EESA 3Q0EA 5CFLA 3GHYA 1M1YE 3GDOA 4JJ7A 4HX9A 1TLTA 3M1IA 3C3EA 3H4TA 3TM4A 3VYVA 2P2LA 4QDKA 4P93A 1XZMA 2JHGA 1FMTA 4N1AA 2OZEA 1V1RA 4DMRA 3N2KA 5H1YA 5KSZA 3KQUA 3LCUA 2BFFA 2YWJA 1S7CA 4MQBA 1UUFA 3I64A 3OPVA 1XZNA 4S1PA 4EENA 4US2R 4LF7B 4ZK6A 1V1JA 1SY7A 5B57C 4R7ZA 3OZCA 1IAVA 3VHQA 3ICEA 1XR3A 3B1VA 3B85A 4KCGA 4RHUA 5F1PA 3QG5A 2QXUA 5FA6A 5L7TA 1OH8A 2JD2A 2E4YA 4V2IA 4YJ3F 2QA5A 2QE6A 1ISIA 4NFLA 1C1HA 3WNBA 5B7NA 3RVBA 2DECA 1KDZA 3W5DA 4C3VA 2NSYA 3K31A 2GN1A 2OZLA 3LQ1A 4K6FA 2H8KA 2F3TA 2X2EA 4M0LA 4BWGA 2X1LA 1FTWA 5G02A 2ADFA 4X6YA 1QDLB 2H57A 3V1UA 2IE0A 3WL7A 4B3JA 4ISCA 3RNOA 4KQFA 1NVVQ 2JIPA 3OHSX 5HZKA 1BD4A 3FR7A 2G8LA 1FRZA 2MOKA 4DLAA 3RTAA 4EY7A 5IAOA 2FTKE 1YRLA 3SXPA 3WG9A 1IJFA 2QLLA 1EINA 2ZI6A 3H5OA 4GM0A 3OH8A 2J6BA 2VF2A 4RZ2A 1A88A 1DQRA 2C42A 1ZD9A 3FFBA 3R6WA 2OLKA 5HG0A 4NBVA 1JQDA 4AJLA 5KHLB 3UN1A 3EBPA 5JAHA 2PRIA 4EABA 1NN5A 2Q3LA 1L5NA 1A9YA 3NHKA 2IXGA 2GXQA 4RV4A 4TMYA 1TKCA 1PT9A 1SKYE 2XYPA 3KDPA 2EU8A 4P3PA 1Q0ZA 5DO9A 4A92A 5LLDA 2GN2A 4ZICA 1HXHA 4C9BA 3DV0A 4XQEA 4LSWA 1W34A 5DNCA 1J56A 3OP4A 5C31A 4XGNA 3WV4A 2KYRA 1JFRA 3NORA 1KY5A 4PZUA 5KSPA 2HLHA 5KWVA 2QORA 2FE1A 3ETDA 3KDAA 1V6CA 1V5GA 3UOWA 4JJZA 4GX1A 4YT5A 1XMVA 1T2EA 3H5NA 3NWBA 3OZVA 4B2PA 1XMXA 3VHLB 5IJ9B 5KREA 4MV0A 1Y4UA 2ISQA 2XUDA 5G1NA 1VCIA 2FRDC 2RGBA 2Q5IA 5DGCA 3YASA 4BC0A 1C5KA 4YGYA 2O59A 3PRHA 1D2RA 2X8LA 2XA1A 1QHIA 2YXPX 5FFFA 4FFOA 2VHXA 4G5HA 5BQOA 5CB8A 2Y67A 3ZY2A 3TZLA 5CT6A 3ROMA 2X0FA 3DDZX 5B55A 1B2LA 2J3IA 4IIUA 5AUQA 1M1YB 3L8HA 1P5HA 4QO8A 2XQJA 3BWCA 4Y0NA 3R9KA 4O8ZA 2Y6VA 4MHOA 5J4VA 1FVXA 1R6TA 2C5SA 4RKEA 1H5UA 1V8BA 1YS6A 4PPNA 3O95A 1TMOA 1U7OA 1V2HE 1KYWA 3JS5A 4ZRDA 2AB0A 4UBJA 2GDJA 2PGIA 4OQZA 1O95C 2NVUB 2FI1A 2QSJA 3VTFA 1YNOA 2CE7A 5D84A 1V6AA 2X8WA 5SZIA 3RC7A 1NURA 4P5PA 3LPMA 1SKAA 1LDNA 1M2GA 1M72A 5LYYA 4YRSA 4NV3A 1IQUA 4E5DA 2PMCA 4YT8A 1IM5A 4QQKA 5IDWA 2IUSA 3V4ZA 5KSOA 1L7RA 2XMRA 3QXXA 1ORIA 3F2VA 3ITEA 3K4HA 4DE5A 3SQLA 1B6GA 2H9YA 2ZRIA 1FJGB 4CEIA 1BCRB 2QW8A 1QHHA 1K6JA 1RSZA 2VPYA 2A84A 1G55A 4JBWA 2J6HA 1AQIA 1DV2A 3D64A 5K45A 4OSOA 3ZW9A 1VKJA 4L74A 3WNZA 3V4LA 4L76A 2I3DA 2PT6A 1ZA2A 5KNCA 1OTHA 1TX4B 1V8OA 1WSDA 3KALA 4FP9A 5TARA 3T4EA 4D9EA 5BYJA 1BOOA 1ZWKA 2JAPA 3DYIA 3MA0A 3CE9A 1ZONA 3SM9A 5C34B 1PFQA 3FNQA 1AKRA 3G0IA 2WHEA 1R18A 4X3PA 1GA6A 2J08A 2D4HA 3JCZA 3ZH9B 1OJLA 3RVKA 4E7PA 4M9RA 4N0EA 5A3RA 2ZTHA 3IKVA 4BGVA 1RACA 4JIMA 1XEWY 5A3SA 4Y6GB 5L3VA 5E38A 2YNMA 4CKZA 2ZJ2A 1FBNA 1H1TA 1QAMA 1UDCA 1VBMA 1VIYA 2ZDHA 3NYRA 6LDHA 1UIRA 4YN3A 1YXMA 4KIWA 1FXWA 2O2XA 4LDJA 1SKYB 3LH5A 3KYBA 1SR8A 2IEAA 4OTZA 4E6PA 1R4MA 2NTEA 4C6TB 3W5HA 2WHPA 4GG1A 5JRJA 2E0IA 2XVYA 3BB3A 4OU4A 2JAQA 2P3SA 2XMQA 5EJ2A 3HVHA 2ZT7A 1TM4E 2FEWB 1G6KA 2HA4A 3K1JA 4IIJA 3GPLA 1YGPA 2BONA 2VHWA 4I36A 5AQ1A 3THWB 5B3JA 4BX9A 5L3RA 1U9CA 4XYLA 1KDVA 1ICEA 4UUNA 1C1XB 1F48A 3IYLW 4M1TA 2XYQA 1MX5A 3HFJA 2UYOA 3KOOA 5AVOA 1NHGA 4Q9KA 3RM3A 4BRZA 4OXIA 1G8KA 4NNJA 2PUBA 5K6AC 2GKGA 3DMNA 1A7AA 4H1HA 1RQ2A 2XUIA 4ZD6A 2FQXA 2HF2A 1LLQA 2CUNA 2QYHA 4M38A 3FVWA 4GE0A 1X9HA 1OR8A 2DBYA 2IVZA 2NVBA 2ZRKA 3FCSB 4TUYB 1KYVA 1A97A 1TW2A 2HJHA 3GA0A 4L27A 3VTKA 5BV0A 3C3CA 3U7EB 1EDOA 4KFUA 3SBXA 5CR9A 3FXAA 4X64B 1RQGA 4B8WA 3GFTA 3M81A 1OX6A 1G0OA 2J9GA 2DFKB 4MVJI 3ET5A 3ZQKA 1SEVA 1T34A 3R44A 2HJWA 1LB1B 4G97A 5DHAA 4EARA 5IUKC 3WR5A 1D4OA 1Z88A 1P7PA 1VYVA 4TZKA 3UHFA 4GBJA 1G5PA 1ZMRA 1LPOA 2R25B 2OHGA 4P8RA 2PPLA 4PG5A 5AUOB 2JIOA 2Z3ZA 1G8AA 3PLNA 3HRKA 3NIGB 3GARA 1JSCA 2G36A 3OD5A 4M36A 3WLPA 2W2KA 3G9XA 4DOMA 4YONB 2BZGA 3FDZA 4U6NA 2X23A 3OLWA 5M5BA 3CZ5A 1WRBA 5I7HA 2R66A 2ZW9A 3DH0A 5HUHA 3HEMA 1HSZA 4Y6QA 3HYNA 4DMFA 5REQB 3PUXA 4QOJA 4EHNA 1XZHA 1EBUA 3WMFA 4ASUD 2ZB4A 2GNOA 3MOIA 4QLBA 2P65A 2HDHA 3DLIA 4MVJG 4XCQA 1CYDA 1JU3A 2OMEA 3EQ8A 4RSGA 5DBEX 4PZYA 4ZCTA 3A1FA 4RVNA 2W2OA 2P91A 3M1AA 2JHCA 1QHFA 2JGDA 4I5EA 5MGNA 3RDPA 4RQBA 2JG3A 3WZ2A 4E2YA 4OLBA 3VO9A 4UC0A 4O4HB 2YR0A 1V1RB 1SEPA 4JJEA 2ACVA 1Z07A 2IBMA 3N8NA 1T0JB 2CVPA 3FLEA 4NZMA 4L3WA 4LVNA 2ZBFA 4ZQGA 2A58A 5K3FB 4K86A 2DT8A 2BHTA 1Z28A 2ZBUA 3AJAA 2XZTA 2WZDA 3HZOA 1QM5A 3IELA 5JJKA 1JEJA 4QJ3A 5BSKA 3D8TA 3QFSA 2BGWA 1F0KA 3U48A 4YT2A 5LQSA 1QG4A 1K5HA 3DA8A 4YIKA 2OZLB 2YJ3A 2YW9A 1JQEA 4V0SA 1DG3A 4FOOA 4GICA 1E6UA 2XD4A 4AIRA 1N2SA 1HA3A 1TIKA 4D74A 3PFGA 4F85A 5KTKA 1HFEL 1OPRA 3BCUA 2P35A 2R6HA 1NZDA 2JF0A 3KJQA 2PKYX 1ECPA 1OW3B 2WF9A 2BLLA 3FUUA 1FDRA 3S2EA 3FSGA 4MYTA 1AS2A 2F43A 4V3BA 4YP7A 3WZMA 2BKVA 3G0OA 3MRSA 5JD6A 2CL6X 3Q2IA 3G7UA 1O03A 3I8XA 3PX3A 4MCAA 2H1IA 1JA1A 2WG1A 2YINC 1SNYA 3EE6A 1ZA1A 4HRXA 1OXXK 3U2QA 2Q41A 1U0EA 1RWVA 2I2DA 2IHYA 5D7BA 2CXNA 5LQAA 1CUGA 3DSRA 3HJTA 3F2IA 3UAXA 3ZD8A 4G5OA 1LW7A 4G5XA 3CEMA 4B85A 5C81A 1ESNA 3IUNA 3JALA 1HL7A 4QKQA 3L7YA 2LKCA 5D3QA 1AMNA 2FN8A 1JVSA 2OD2A 1R10A 1JWLA 3JXEA 1TYCA 2EG5A 5TR9A 4BL5A 3OPMA 2DR0A 1QH9A 1Q95A 1DTEA 2NYUA 4QOGA 2UYHA 1H22A 1KFEB 4OB8A 4I50A 4B4UA 3IMFA 2XNDD 1V9CA 1HG1A 4HMQA 4J7XA 1ATIA 1RPZA 1L5OA 1U11A 4BPRA 2B34A 1V3TA 3PXXA 3I9V6 4H1TA 2X3UA 5IVIA 1VP9A 1DUVG 3B9RA 1Z5NA 1A5AB 1JIUA 2CXUA 2ISSD 2Q3MA 4M98A 1XZCA 3TSZA 3ZW8A 4B17A 1J2RA 2OBYA 4BMNA 2A59A 2RD2A 1XV5A 3EXIB 3EWAA 4KQ9A 4EJSC 2VYVD 4PBSA 2M6LA 4AKSA 1ZK1A 3WRXC 1OPXA 5AJWA 4DIKA 2PKWA 3NIDB 5ALPA 1VGVA 4MOWA 2XMCA 5TPWA 5KS2A 1NNUA 1I6MA 1Y8AA 2Q0HA 2X0KA 3FLMA 3RSHA 4OY3A 4QXAA 4FLFA 3UC9A 1F3LA 1OT3A 2PANA 2HB6A 1MGPA 5IAAA 2VQ3A 3SHOA 4TMKA 3OZ7A 3TSWA 3FG9A 3V8QA 8LDHA 3K0SA 3D3KA 3IOMA 3ZUPA 1J2TA 1HEIA 1QFXA 5K3BA 3H4MA 1T9GS 2AEEA 2WOOA 1TKBA 4E6EA 5ABPA 3P2YA 2RAVA 1PNRA 2Z6QA 1N1DA 4X6UA 3AJ9A 1IEXA 2CL0X 3RIEA 3WDSA 8MHTA 3BZUA 4F38A 4Z51A 1H3EA 1BDMA 1RYEA 1LX6A 2VNKA 3C3AA 1FU4A 4C0QC 1ODJA 2MSLA 2Q5OA 3G9UA 1TM7E 4LXXA 4HDOB 4JL5A 4YRCA 1CRWG 3N2NA 1QFYA 4IBOA 3KXDA 1IY1A 3MTIA 3KSAC 4PPGA 3KQLA 5AVRA 3LCRA 1MTOA 2GBLA 5EE1A 1GUAA 3AKYA 3CVJA 1TPYA 2Q2WA 4CEIB 1DJOA 4CMBA 3N2LA 3CE6A 4XWYA 2Y1GA 2IP2A 4O2BF 1A9SA 1MABA 1G7CA 3JQRA 2QHXA 2REQB 4KFRA 4WD3A 1TUGA 4MB2A 4RFSA 4E2FA 2RH4A 1MDBA 1LBIA 3X1KA 4AY6A 3AVQA 1J49A 3QPAA 4CF4A 3I01A 4CLRA 4FFVA 1WXWA 3UAWA 2H59A 4MX8A 1YQWA 2HXGA 1JG7A 2QUAA 4F2HA 1VKOA 2HF7A 2Q5EA 4A16A 2EBHX 1FPMA 4O59O 2PGOA 3Q0IA 2AJCA 1IOVA 4QO7A 1VG8A 3BWEA 1E7MA 1AKQA 1J0EA 2PIDA 3K4PA 3NASA 2GEVA 3S7TA 3SU8A 4JUAA 1ULBA 2XT9A 4BO5A 1PJQA 3K09A 1VKNA 4E3WA 3DQPA 5CIYA 4XDZA 5FXMA 1Y3IA 2R6R1 4HNUA 1NI5A 7MDHA 4QC2A 1JA0A 1PDWA 3SJ7A 3X1MA 4C76A 5KWEA 3Q8KA 2GEUA 3QBTA 4NOMA 4PPFA 2HREA 2ZI5A 3OEEA 1OV4A 1U0FA 2C07A 1YOVB 2WHPB 4PFKA 1EFUA 3LMKA 5KTSA 2WD8A 2VSFA 3KCNA 3SBDA 4GZLA 4U6QA 1SQ5A 4IIJB 3KJHA 2C9MA 3IXLA 5LQNA 1S2NA 3INNA 2V7QD 1V1MB 3K2BA 2EBUA 3PSAA 4KO8A 3B3QA 3QUQA 2CNLA 1P17A 5GINE 1U8TA 4MUIA 2BF4A 4BB9A 3A6LA 1LRKA 3FI0A 4DJFC 1F3OA 3HJNA 4ZVTA 2DWUA 1LRLA 2ZRCA 1SBYA 2WQ6A 4BIMA 3ZCXA 4E4RA 4GDFA 3DAYA 1G3MA 3D4LA 2NT3A 1UMDB 2IEIA 3L7OA 2IKSA 2EFEB 1NDQA 4Y6SA 4ABTA 1GTZA 1D1SA 4EZBA 4BV2A 3LO8A 2PQ2A 1ECGA 1XCJA 4CM6A 3K05A 4KO3S 2CK3A 2R60A 3I8SA 1BE0A 5BQ3A 5ALGA 1GVNB 2NO9A 4QJBA 2UYYA 2GYUA 2JLAA 4A03A 5A62A 3RUFA 1R64A 2UUPA 1J7KA 2FN9A 1V5EA 2CBXA 2Z09A 4ZO4A 4BCBA 1T35A 2RGNC 2IV3A 3AQIA 4NJEB 3WKDA 3AF3A 4HADA 1F2VA 4B4KA 2ST1A 5JAPA 4BGDA 4PU0A 3WFIA 1OLSA 2RJ3A 1SM4A 1NKSA 5D01A 1SCUB 2Y0EA 4RAQA 3E5MA 3ZHRA 2C7GA 4IFEA 3B51X 4MO9A 1NG9A 4IXNA 1GTL1 4P3YA 4R8VA 2MWMA 3AJ8A 1BQ3A 1YD7A 3CRRA 2J5QA 2J8ZA 2I99A 4DS3A 2HIMA 3O90A 4H3HB 4W5QA 3CZAA 3ZD7A 1H2YA 2GZ3A 2LIVA 1TUEA 1SVMA 1DUSA 5AOVA 1MU0A 3G5LA 4ZTZB 2CJPA 5DWVA 5EHIA 2JGDB 3PDHA 5FYQA 3AIKA 4BGUA 3GDGA 4MUGA 4C21A 3P4UA 4F3CA 1EFLA 3QFFA 5H16A 2FJUA 4M87A 4IIDA 1SVIA 1S2DA 3KJZA 4KO4S 2O1SA 4WMLA 4X7RA 4NYIQ 1K4YA 1XU7A 2E82A 4Q66C 4QDOA 3EVGA 5F1KA 5CVTA 2YC4C 3OE4A 3ANLA 3BD7A 4UBMA 5DHQA 5K4HA 1QE5A 1KSGA 3FGOA 2DCUA 3KQVA 5BQFA 2W0SA 3T5AA 1O4VA 3BQNB 4OEHA 4OK5A 4L95C 4ZXFA 2NQ8A 4YP1A 3PTAA 2K4MA 1P0PA 2EW1A 4MR8B 1NLFA 1ZGHA 1K88A 3KSZO 4R84A 4ZVRA 5JCOA 2XT6A 2GUWA 4JBGA 2C31A 1H69A 1MP0A 2CXHA 3AC0A 1PWZA 1OFTA 3NWJA 1R66A 3ESXA 5DX1A 1ADYA 2ADOA 2QGNA 3K32A 4RIFA 1M2OA 4MI1A 5IMSA 2Q7DA 5LXTB 1K6EA 3MTQA 3Q7SA 5AKZA 3VZPA 4RTJA 2ONJA 1G5TA 1AX9A 2F43B 4U0JA 1FRNA 4XB2A 1ECLA 1XU9A 3ESDA 2XY4A 2OPBA 3IVGA 3MMNA 4YCJA 1KPHA 3ORSA 2ZTVA 2QT0A 1E2QA 2YWBA 5AHXA 2FOIA 4EB6A 3ZU2A 3H3XA 4IHJA 2C92A 2YCLA 1UPXA 3QKUA 4QBHA 3QTLA 1KI3A 4GZ3A 2HGSA 1HORA 2P67A 3JVIA 4R68A 4MA4A 3BXGA 2WWWA 5FRDA 5GJCA 1XD2A 3F96A 4ZJPA 5ALNA 3U19A 4FZ3A 4KI0A 3JALB 3DMGA 3BMOA 3HXOA 3VPHA 4XLZA 3M3HA 1Q21A 3CR3C 1FEZA 3KE9A 4WNAB 2B78A 4IH4A 4R1NA 1OLXB 4PYLA 4Q82A 4RPGA 3FCUB 3PICA 2J41A 2OC4A 4GPAA 1L5MA 1RXSA 2C99A 3MC1A 3QI2A 4RTKA 2AGVA 3L0CA 3L1JA 2KWIA 2ODBA 2C7BA 3E35A 2CFRA 2JBWA 2NUAA 3R4VA 4MH0R 3RAGA 3ZCPA 5FOQA 3T3NA 3HA2A 5IVDA 1R15A 3GAZA 4W9NA 3ZK7A 5DK4A 1I9CA 1Z7GA 1X1AA 3PXAA 2HV9A 1VHWA 4EVIA 3CRW1 1IXRC 4LTNA 4NOKA 1DGQA 3WRWA 3EDQA 1DCMA 1WF3A 4BMZA 1O0BA 2O8DA 3GJ0A 3VC2A 4E30A 4Z4FA 4EUEA 1QONA 1ZCJA 3BF8A 3H65A 2H2IA 1JDJA 4MW4A 4NSNA 3TBHA 3ZR4B 4E51A 3JQ6A 5IYZA 2ZRMA 5JO0A 1ZN2A 2C3MA 1OH6A 4L2IB 1CR4A 3RVSA 4RM3A 1V4NA 1UOQA 2OESA 3BRQA 2J7PA 3QJ5A 5C7IO 2G9NA 1M0SA 3KUDA 1A9OA 3C1TA 3FUVA 3LQQA 2PTGA 2E4VA 4KEAA 4EG7A 3OBIA 3OFND 1KS9A 3P26A 4PLZA 1KE2A 1O5OA 1P18A 1R6VA 4UHHA 5KYUA 1F7UA 3UK0A 3X2FA 4BB5A 1ADFA 1R6DA 1B7GO 4HWTA 4K8RB 4WHMA 2GRAA 1FSGA 1I3MA 3W2TA 2XV1A 3A1EA 1NJ1A 1YOBA 4KOAA 1J06A 4UW9A 4AVYA 3C1UA 4CMIB 2C8KA 3FVVA 4BQEA 1UFQA 2P4QA 3BFPA 2F90A 3H84A 5TB5A 5M7EA 1I94B 1MJ5A 2GXUA 4KWEA 5A9SA 1GZ5A 1FTSA 4KE6A 1ABEA 4YQFA 1Z4PX 1YQXA 2RGAA 3FMGA 5C35A 2NZ2A 3EIHA 3OTHA 3Q8WA 3ABRB 3CW9A 4UVHA 3FTCA 1JXOA 1J97A 1ZQ9A 3CUUA 1MABB 3AR6A 3F6SA 3FMPB 3FYCA 4PAQA 4RVGA 3SE7A 4ILKA 1PL8A 2VDQB 4HLNA 4WOKA 1MO2A 1LZLA 3BWDD