2ZJ9A

X-ray crystal structure of ampc beta-lactamase (ampc(d)) from an escherichia coli with a tripeptide deletion (gly286 ser287 asp288) on the h10 helix
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
355
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMKTRVFQPLKLNHTWINVPSAEEKNYAWGYREGKAVHVSPRALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDIIINNKIALAARPVKPITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AmpC
publication title Structure of AmpC beta-lactamase (AmpCD) from an Escherichia coli clinical isolate with a tripeptide deletion (Gly286-Ser287-Asp288) in the H10 helix
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 124
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zj9A00
4FH4A 3M6HA 1ERQA 5E2HA 1E3UA 1EROA 4JXVA 3OPPA 5DVAA 5TR7A 3HREA 4WYYA 4E3OA 4LCLA 3FZCA 5GLBA 3SS5A 2Z2LB 2IWDA 3O86A 1O7EA 4WEKA 2EFUA 1HZOA 2EX6A 2XH9A 3UDIA 3UN7A 4HBTA 3BFEA 1MPLA 4B4XA 4GD8A 5EVIA 1G6AA 1JVJA 1TDLA 4X69A 5AQ7A 3GVBA 1NY0A 2EX8A 2Q9NA 5JYPA 3RXWA 4PM6A 5FDHA 2WGWB 3IXHA 1BLPA 2P74A 2ZQDA 3E2LA 4O7DA 3V3SA 1ZG4A 4BL2A 3ZNYA 3WRTA 3UPOA 2Y2OA 1KGGA 3OC2A 4E3NA 4K91A 1NYYA 5F1GA 4MNRA 3OPLA 5E43A 4Y0TA 3PBTA 4JPMA 4OVDA 3O88A 2ZC5B 1ESIA 1PW1A 3D4FA 1K4EA 4X53A 5A90A 2X01A 5CRFA 4NK3A 3P98A 3ZG5A 2ZM0A 2ZC4B 2WKHA 1K55C 2XFTA 2Y4AA 4OQHA 4RVAA 1MBLA 2DNSA 3HBRA 4C6YA 1XGJA 3HUOA 1LI0A 1HVBA 2RCXA 1CI8A 4LV3A 3V50A 3ZVTA 1ALQA 2WGWA 1W5DA 3IF6C 3WS4A 4OLGA 3WS1A 1WE4A 4KZ4A 3WRZA 2H0YA 1E4DA 3OCNA 1MWUA 4HESA 2JBFA 1W8QA 2ZLYA 1DY6A 3MBZA 1SDNA 4UHUA 4OQ0A 1S6RA 1LL9A 3PBSA 4S2LA 5HL1A 5HAQA 2DRWA 2H5SA 4Y0UA 4IVIA 3NC8A 4S2JA 1K54A 3VMAA 5FQKA 1CEGA 5CEDA 5KSCA 1ES2A 1CEFA 2ZJ9A 3BFCA 1RP5A 1VQQA 1YMSA 2WK0A 2UWXA 3IT9A 2EXAA 4DE0A 4XUZA 2PU2A 5F83A 1JWPA 2ZQ9A 2B5RA 4F94A 4OQIA 4KZBA 2JC7A 2WZZA 4MBFA 5J8XA 1G68A 4D2OA 2FFYA 4MEZA 1PWCA 3IWIA 4OLDA 4BENA 1MY8A 4GZBA 3SH7A 4Y7PA 3ZG7B 1RGYA 1E25A 4OPQA 1IKIA 4GDBA 4ZTKA 3VSLA 4C3QA 2WUQA 4JLFA 3HLEA 4KZAA 3EQUA 4ID4A 4DDYA 3FKVA 3A3IA 1I2WA 3Q7VB 4U3TA 3DWKA 1O07A 3OCLA 4HBUA 1K25A 5CHMA 3TG9A 3VP1A 4E3LA 4PM9A 1MXOA 4DDSA 1XA7A 4K0XA 5CTNA 5FA7A 3ZG8B 3MXRA 2J8YA 4PMAA 4S2NA 5FQQA 5A93A 4ZAMA 4OOYA 1BULA 1FR6A 2CC1A 1QMFA 4KQRA 2QPNA 5U47A 4LV1A 3TOIA 1Q2QA 5AQBA 2BLSA 5HX9A 2HDSA 1K4FA 3UE1A 4DXCA 3SH9A 3N7WA 4P87A 3IWOA 4E6WA 1KE4A 3FV7A 2R9XA 3Q7VA 4RX3A 3SS3A 5FATA 4DE3A 2V2FF 4NETA 1XPBA 1YMXA 1H8YA 4KZ8A 1FCOA 3C4OA 1Y54A 2Y91A 2BG1A 2Y2QA 1MWTA 3HLFA 4KG6A 1KDSA 1WYCA 3A3DA 1K57C 1K6SA 4OPZA 1GA0A 5G18A 1I2SA 3BM6A 4GN2A 5FQIA 3ZG0A 2C5WB 5FQJA 3IWQA 1PZOA 4BD0A 5FQ9A 3HLGA 2Z2MB 4Y0OA 4R4SA 4LCMA 1L0FA 1L0EA 4KZ5A 2PU4A 1KE3A 2XD1A 1N9BA 2WKEA 2XEPA 3LCEA 2XFSA 3ZG9B 5TFQA 2WAFA 1I5QA 2ZM8A 3GRJA 1SDEA 5GL9A 3UO9A 2P9VB 4LENA 4EUZA 3VFHA 5EOOA 1Z6FA 3HLCA 2HDUA 3DTMA 3HLBA 4BJPA 3OZHA 3ZGAB 3HUMA 2IWCA 3UE3A 1YM1A 5CEBA 4OQGA 4UA7A 2XR0A 1ES5A 1WYBA 2Q9MA 3G35A 3ITAA 1PI4A 3N4IA 3MZEA 3NBLA 1YLWA 2V1ZA 3FYZA 1YLJA 5EPHA 4E3KA 5CGWA 3UE0A 3VP3A 4KZ6A 3IH9A 1NXYA 3G2YA 4QB8A 5EVID 2ZQ7A 4OONA 5HARA 1L0GA 5JYOA 3N8SA 2E8IA 5FAQA 3CG5A 1IYSA 4E3JA 2HP5A 1BZAA 2WGIA 4ZJ1A 5GLCA 1ES3A 2HPBA 3MZDA 4N1HA 5FI2A 2Y2PA 3O3VA 2WKIA 1PZPA 2QZ6A 4X56A 2P9VA 5EVLA 4IVKA 5A92A 1YQSA 2OV5A 4EWFA 3VP0A 1EWZA 3UPNA 2HDRA 2R9WA 1SCWA 4UA9A 1PIOA 5HFOA 2HP6A 1KDWA 2XLNA 4WEJA 1K56D 2ZM2A 4KQQA 5FI6A 2ZC3B 3C5AA 3UY6A 4EQIA 3OPHA 4N9KA 5KMWA 2A3UA 3SOIA 3VP2A 1XGIA 1FSYA 4QY5A 4MLLA 3EQVA 1FSWA 4OKPA 5EVIC 5M1AA 3VOZA 1HTZA 2VGJA 1RGZA 3M6BA 4IEDA 3A3FA 4WZ5A 4U0XA 5GHZA 2OLVA 4L0LA 5CHUA 1GA9A 1ZC2A 3N6IA 2RL3A 5GLDA 2X71A 4Q8IA 1NZOA 2XK1A 4S2OA 4U0TA 5AQAA 2WGVA 3S4XA 5GHXA 5A91A 5AQ9A 1ESUA 1IYPA 2Y59A 4BQMA 1FOFA 1KVMA 4EBPA 3V39A 5M19A 4LV0A 5CGSA 2FFFB 2ZC6B 3LY4A 3I7JA 3O87A 3BECA 1FCMA 5CXWA 1CK3A 3HVFA 4R4RA 4R23A 3M2KA 5CECA 3Q07A 4UAAA 5EE8A 4BLMA 2PBYA 3V5MA 1YLTA 1ERMA 4X6TA 3UDFA 1W8YA 1MWSA 3G31A 1W79A 3BFGA 1M40A 2ZQAA 3BLMA 2Y55A 1YT4A 1K54C 3BLSA 3DWZA 3QHYA 4E6XA 4EBNA 4RA7A 2EXBA 2ZD8A 1PWGA 2VGKA 5F82A 3HLDA 5DTKA 4WM9A 5HAPA 3GMWA 1FCNA 1K38A 4JXWA 4OOLA 5FQMA 4BL3A 3V3RA 3MKFA 4FSFA 4H8RA 4ZBEA 4GB7A 5GHYA 3PAGA 1BT5A 1XXMA 5M18A 4WBGA 1H8ZA 1BLCA 5EUAA 4R3BA 5E2FA 4OP5A 3G32A 4JF6A 3LEZA 1PI5A 4PM7A 3GV9A 3ZVWA 5D3OA 3ZNTA 4JF4A 2GDNA 3G34A 1BSGA 4QJGA 4QY6A 3RXXA 5E2GA 1ONGA 4DF6A 2WADA 1GHIA 3VOYA 3LY3A 3PBNA 2J9OA 3G4PA 3IF6B 4S2NC 2JCHA 3VFFA 1VM1A 1XA1A 2I72A 3A3EA 1TEMA 4FCFA 4GD6A 4WMCD 3M2JA 1XP4A 3P09A 2DCFA 1N4OA 1AXBA 2HP9A 3FKWA 1E3UD 3IQAA 4X68A 5FAPA 3GSGA 3SS4A 5TGFA 4RYEA 5FASA 1S0WA 3B3XA 4OPYA 2XGNA 5CGXA 4YFMA 3GR2A 1BTLA 3BFDA 3IXDA 3S1YA 4WZ4A 1K55A 2XD5A 1M6KA 2J7VA 3OPRA 3IXBA 3HUNA 3VP4A 3ZFZA 5DF8A 3AGDA 4OOMA 5CERA 1DJBA 5DF7A 3IHBA 4HEFA 3NCKA 4QHCA 5CHJA 2WAEA 4XUXA 3IHAA 2EX2A 3BRMA 4R3JA 3CMZA 3IF6A 4E3IA 4GOGA 4XXRA 5KZHA 1DJAA 3WS5A 4CPKA 3WS0A 5DF9A 2ZQ8A 4OPRA 3NDGA 3NI9A 3IF5A 5FI7A 3UDXA 2H10A 1RCJA 3UPPA 4KZ7A 4IBXA 2G2WA 3WWXA 2Y2HA 4QU3A 3C4PA 4JXGA 5FSRA 4GKUA 1XX2A 1IEMA 3BEBA 1IKGA 3NY4A 5EOEA 1IYOA 1NRFA 2Y2GA 4PM5A 4DKIA 1SHVA 3QNBA 4GDNA 2IWBA 3MKEA 3C7UA 3FWLA 1KGEA 4N9LA 2EFXA 2WYXA 2Y2LA 4UA6A 3W4QA 3AGFA 4B4ZA 1FR1A 1ONHA 1KVLA 1K56A 4MBKA 4RX2A 1LI9A 2QMIA 2ZC7A 4DE1A 3G2ZA 4GNUA 4M3KA 5E2EA 2Y2MA 3Q82A 1CI9A 3C7VA 1BLSA 3W8KA 2OLUA 1C3BA 5HAIA 4DRTA 1J9MA 4Z9QA 1BLHA 3ITBA 4DE2A 4OH0A 4ZJ2A 2XDMA 3A3JA 4N1XA 3WS2A 2ZQCA 3IH8A 2Y2NA 3CZDA 3CJMA 4A5RA 5CTMA 2EX9A 3N8LA 2HDQA 3Q1FA 5IHVA 4FD8A 4JF5A 1IELA 2XF3A 1GHPA 5HW3A 1U60A 1Q2PA 3MXSA 3GQZA 1LHYA 3E2KA 3LO7A 1L0DA 3ZDJA 1EI5A 1YLYA 5F1FA 4P85A 1DJCA 1XKZA 1NJ4A 1ZKJA 3PBRA 3MFDA 1TVFA 4JBFA 2C6WB 4IBRA 1YLZA 1IYQA 1NZUA 5DTSA 1PW8A 4S2IA 4JKTA 4CJNA 1PWDA 1LL5A 4ZDXA 2V20A 3PBOA 4R0QA 4WZ5C 3ZCZA 4S2MA 3W4OA 4KENB 1HD8A 1JWZA 3Q7ZA 1GCEA 1TDGA 4ZJ3A 4QD4A 1OMEA 4X55A 4FH2A 3DW0A 1MWRA 3VSKA 1K57A 1JWVA 4P6BA 3ISGA 1YLPA 1NYMA 4KQOA 4DXBA 5I94A 5DTTA 1ES4A 4B88A 3TSGA 4JXSA 4MBHA 5KSHA 1FQGA 3HL9A 5L2FA 4PPRA 1W7FA 3PAEA 1GHMA 3PTEA 4S2KA 3PBQA 1KE0A 2OSUA 2X02A 3BFFA 3BYDA 2WZXA 2A49A 3GTCA 2H0TA 3QNCA 4OP8A 4YINA 1JTGA 1ZG6A 1LLBA 2Y2IA 3NIAA 4WELA 1H5XA 3NDEA 4KG5A 4R1GA 4N92A 1L2SA 1QMEA 4LV2A 3UNWA 1SKFA 3W4PA 1PYYA 1JTDA 3HLWA 5EECA 5FAOA 5BOHA 2ZMAA 4EBLA 2Y2KA 4S2PA 1KGFA 4BD1A 2G2UA 2J9PA 5GLAA 4C75A 4EV4A 2XQZA 3RJUA 3ZHHA 3Q81A 5EVIB 3IXGA 2JE5A 4K0WA 4P0MA 1MKIA 3MZFA 4E3MA 3AGEA 4KZ9A 2Y2JA 4KZ3A 4PM8A 1K6RA 1BUEA 4WMCA 3G30A 3SH8A 4KG2A 3JYIA 3N8RA 3S22A
chains in the Genus database with same CATH superfamily
5IU1A 1E3UA 4E3OA 2P04A 4H6JA 4LCLA 3FZCA 3L9KA 3SS5A 3H9WA 1O7EA 3QP5A 3UN7A 2EX6A 4L9FA 4P6ZM 4HBTA 5AQ7A 3IXHA 2P74A 3E2LA 3V3SA 4BL2A 4Z1WA 4NXGA 3WRTA 5FDSA 1DP8A 5E43A 3O88A 2UV0E 1PW1A 3D4FA 1F9IA 4NK3A 3P98A 1TS6A 1UWPX 2Y4AA 4OQHA 4RVAA 3HUOA 1LI0A 3EGDC 4CLCA 1DY6A 3MBZA 1LL9A 2H5SA 2FZ0A 3VMAA 5FQKA 2P08A 3T1SA 3BFCA 3T4TA 1W63M 4I3JA 5F83A 3ZYTA 3OLOA 3PYPA 4GS9A 2JC7A 2WZZA 2VKSA 4ETZA 4GDBA 1OTEA 4C3QA 3BY9A 1I2WA 3DWKA 3EEHA 4DDSA 5CTNA 5FA7A 3MXRA 1BULA 2CC1A 5HD3A 4JGRA 3TOIA 5AQBA 5HX9A 3SH9A 3N7WA 5F68A 3Q7VA 4BBUA 4MMNA 3LIFA 1YMXA 4R3AA 1FCOA 2Y91A 3HJKA 2B18A 1MWTA 3HLFA 4KG6A 3S7NA 1GA0A 5G18A 2PBDP 1IOUA 3ZG0A 3E98A 4PAUA 4LCMA 1OTDA 1N9BA 3P01A 2XFSA 5TFQA 4EERA 5GL9A 1SDEA 4LENA 3VFHA 5EOOA 3DTMA 4BJPA 3UMEA 3UE3A 2JKGA 2GJ3A 3ITAA 2A24A 3FYZA 1YKDA 1VB6A 3E4PA 3IH9A 2W3EA 1LSXA 4KZ6A 4QB8A 4CJNA 5GLCA 5FI2A 5FEFA 2EWWA 2P9VA 4IVKA 2OV5A 1EWZA 4BMWA 2J3TC 2R9WA 2HP6A 1KDWA 3OOVA 4KQQA 2ZC3B 4DMZA 1XGIA 4OKPA 5EVIC 3VOZA 3TJZC 2VGJA 3A3FA 4WZ5A 4U0XA 5GHZA 2OLVA 2FH5A 3N6IA 2RL3A 2X71A 5HDSA 2L1MA 1NZOA 5HWTA 1ZHHB 3S4XA 3MQ0A 4LRXC 4R23A 1YAXA 5CECA 2PT7A 5EE8A 4HNBA 3T1RA 1YLTA 3BQAA 3MJQA 2QJ5A 4B93A 2KOIA 1W79A 3LI9A 2OWHA 2Z6DA 3BLMA 3DWZA 4E6XA 2EXBA 1PWGA 1TS0A 5F82A 3GMWA 1K38A 4OOLA 3MSHA 5FQMA 3KYQA 4HY8A 2OWJA 3KSHA 2QHKA 4H8RA 3VOLA 4GB7A 1BT5A 3IS2A 3UE6A 4WBGA 1XJ3A 1BLCA 4R3BA 4EXOA 4LLOB 3LEZA 4PM7A 3U4LP 3ZVWA 3ZNTA 4QY6A 2Q0OA 4DF6A 1GHIA 3LY3A 3PBNA 1TS7A 1XJ6A 3VFFA 3A3EA 1TEMA 3QP2A 3P09A 1N4OA 1E3UD 2BASA 4RYEA 1S0WA 3GR2A 3IXDA 1UWNX 1P0ZA 4ARZA 3VP4A 3HUNA 2HF6A 2QKPA 3F1NA 2LB5A 3BRMA 4R38A 4UQIS 4XXRA 3CITA 4HIAA 4GHIB 5FI7A 2VV7A 3NOPC 4QU3A 3C4PA 4O01A 3KO6A 3T50A 3NY4A 2O99A 1NRFA 1SHVA 4GDNA 3MKEA 5FL3A 3FWLA 2CMNA 1ZTUA 3W4QA 1NLZA 3AGFA 1KVLA 1K56A 4MBKA 4RX2A 2YKFA 4CLCD 2PR5A 1LI9A 4GNUA 4HOIA 2Y2MA 1C3BA 5HAIA 4R6LA 1BLHA 4DE2A 3UB6A 3A3JA 1OPXA 3CZDA 2G7UA 3N8LA 2HDQA 3MR0A 5HW3A 3E2KA 4X1LA 5F1FA 1OJGA 3R7WA 1NZUA 5DTSA 5TBMB 4S2IA 4JKTA 2K7SA 3CUEC 3A0SA 3E4QA 4FOFA 5DFYA 5A8BA 3A0RA 4QD4A 1OMEA 3RFBA 1MWRA 1K57A 3ISGA 4B9OA 1FQGA 5L2FA 2V0UA 4NXFA 4PPRA 1W7FA 4F3LB 3ICYA 5C5KA 2DMWA 3D3OA 2WZXA 3GTCA 2H0TA 4OP8A 2WKRA 1QMEA 4L9GA 5DJTA 1JTDA 5EECA 5BOHA 5L8MA 1KGFA 4BD1A 2G2UA 2KDKA 3T4OA 2XQZA 1PRQA 3HCYA 3IXGA 2JE5A 2OAP1 1MKIA 4E3MA 4KZ9A 1N9OA 1K6RA 4WMCA 3N8RA 3BWLA 2V0WA 3M6HA 4PKYG 1EROA 4JXVA 5TR7A 3HREA 3PR6A 5GLBA 4NG2A 2IWDA 5J7EA 1XFQA 1HZOA 2HV1A 1MPLA 1JVJA 4BBVA 3GVBA 1NY0A 2EX8A 2GNXA 4CLCB 4YNRA 4EQ1A 1KGGA 3QP6A 3OC2A 5AVFA 4E3NA 4K91A 1NYYA 5F1GA 3OPLA 3DTEA 1F98A 5TJJA 3LIAA 1T1CA 1T19A 3B33A 3UB7A 4GS9B 4Y5FA 2ZMFA 3HBRA 4HQAA 1XGJA 3FPVA 3ZVTA 4HH2A 5HWVA 3DTKA 2JBFA 1W8QA 3KSGA 4OQ0A 4S2LA 1K54A 2OAQ1 3LR0A 1CEGA 2ZJ9A 4YWZA 1OTIA 1RP5A 1VQQA 2I9VA 3IT9A 1JWPA 2ZQ9A 3NOUC 1MC0A 4F94A 2PYRA 4GCZA 5J8XA 3BQ8A 1PWCA 3UB8A 4BENA 1DRMA 5HSQA 4GZBA 1E25A 1IKIA 4ZTKA 1GSWA 4HHDA 1G28A 3QP1A 4ETXA 3Q7VB 1D06A 3C38A 1O07A 3TG9A 4HBUA 1K25A 1LT0A 3CWFA 1X0OA 1MXOA 1XA7A 3ZG8B 4PMAA 3CAXA 5L07A 2P7JA 4LV1A 2O0YA 2BLSA 2R78A 2HDSA 3IWOA 4E6WA 4RX3A 3MXQA 3SS3A 1XPBA 2VV6A 5HZHA 1Y54A 2Y2QA 4WF0A 1KDSA 1WYCA 2A24B 3A3DA 1K6SA 5FQIA 5FQJA 3SZTA 4MN5A 1D1JA 3IWQA 5FQ9A 2OOLA 1L0EA 4KZ5A 2XD1A 2WKEA 1I5QA 2ZM8A 3GRJA 2P9VB 4EUZA 1WA9A 3HLCA 3VE4A 3OZHA 3HUMA 2IWCA 4X25A 4OQGA 2XR0A 2Q9MA 2W3FA 3G35A 4JGQA 1PI4A 3N4IA 3MZEA 1YLWA 1NXYA 4OONA 1S66L 3LICA 2E8IA 2HP5A 1BZAA 1ES3A 2HPBA 3MZDA 2Y2PA 1PZPA 2QZ6A 4X56A 3F1PA 5EVLA 5A92A 3IBJA 3CI6A 1YQSA 3NULA 2HDRA 3W2ZA 1K56D 5FI6A 1H8MA 4EQIA 3VP2A 2NUTC 2Z6CA 1FSWA 4I3IA 1HTZA 3M6BA 4IEDA 3DBAA 4L0LA 5AJGA 1GA9A 1ZC2A 3GDIA 2VGLM 5A91A 1ESUA 1FOFA 3V39A 5M19A 3GECA 5CGSA 5CXWA 3O87A 1FCMA 4R4RA 3Q07A 4UAAA 2V9AA 3V5MA 1ERMA 2IA2A 4LPZA 3IS2B 3KSFA 1MWSA 3G31A 4CLCC 3BFGA 4EU0A 1YT4A 4EBNA 2ZD8A 3TE8A 2QYBA 5DTKA 3NECA 4HJ3A 4ZBEA 1XXMA 4ESPA 5M18A 4XT2A 5E2FA 3GV9A 4ARZB 5D3OA 3F1NB 3VOYA 4I5SA 3MMHA 1VM1A 1XA1A 4GD6A 4WMCD 1AXBA 1T18A 2HP9A 4X68A 3SS4A 5TGFA 2VJWA 5CGXA 1BTLA 2PR6A 1K55A 3OPRA 3IXBA 4K08A 3IX4A 5CERA 1DJBA 5DF7A 3K2NA 3NCKA 4QHCA 1F5MA 5CHJA 2WAEA 2K31A 2EX2A 3IF6A 5KZHA 1DJAA 4G3VA 3WS5A 4CPKA 1MKMA 4OPRA 5G4ZA 2H10A 1RCJA 4IBXA 2G2WA 4UEYA 3WWXA 4O0PA 5FSRA 3LIEA 1VEUB 4PM5A 4DKIA 2PAVP 4UA6A 1OTAA 1ONHA 2ZC7A 1OTBA 3D9YA 3Q82A 3C7VA 3R7WB 2W3GA 3OBFA 4N1XA 3WS2A 3CJMA 2O9CA 2EX9A 3SW1A 1A0KA 2ACGA 4JF5A 2JKTM 2XF3A 1GHPA 1U60A 3GQZA 4Q0IA 1LHYA 1YLYA 4KUKA 4P85A 1VETA 1DJCA 1TVFA 4NEED 2C6WB 1YLZA 1IYQA 1PWDA 1LL5A 2V20A 4R0QA 4WZ5C 3ZCZA 1P9WA 1HD8A 4ZJ3A 4FH2A 1YLPA 1ES4A 2B95A 4Y15A 5CX7A 3PAEA 1GHMA 1KE0A 3BFFA 5HDCA 2Y2IA 2JKTI 5G4YA 4KG5A 4R1GA 4LV2A 2KLIA 3W4PA 4BBTA 5FAOA 4EBLA 1Y28A 3R4KA 5GLAA 4EV4A 4LRZE 3RJUA 3JPUA 4K0WA 3CPTA 3MZFA 3AGEA 5HPIA 3SH8A 4LGWA 4KG2A 2Y8HA 1ERQA 5E2HA 3OPPA 4WYYA 5F6AA 1OJ5A 1LL8A 1TS8A 1V9ZA 4IUKA 1H0MA 5AVEA 2L0WA 4WEKA 3UDIA 3BFEA 4GD8A 4X69A 5JYPA 3RXWA 4PM6A 2ZQDA 2YKHA 3UPOA 2Y2OA 4PKYA 4Y0TA 3PBTA 4JPMA 4OVDA 5A90A 1K4EA 2X01A 5CRFA 2ZC4B 2HJEA 4YOFA 2W3HA 5EM0A 2LB9A 5L09A 5FEGA 1HVBA 2VA0A 1S67L 4LV3A 4IJGA 1ALQA 2WGWA 4OLGA 1WE4A 1E4DA 3U2AA 1J3WA 5IT5A 2ZLYA 1SDNA 4UHUA 1VEUA 3PBSA 2W1RA 2DRWA 3NOTC 4Y0UA 4S2JA 5KSCA 3ULFA 4L9EA 1CEFA 3T12B 2UWXA 4DE0A 2PU2A 2B5RA 4OQIA 2KX6A 3K3CA 4KZBA 4NXEA 2GZAA 4MBFA 1L3LA 4MEZA 5IS1A 4OLDA 4Y17A 3JVVA 3LGOA 4Y7PA 1RGYA 3LIBA 3VSLA 3KX0X 2WUQA 4JLFA 3HLEA 4KZAA 3EQUA 4DDYA 4EETB 3OCLA 1Z09A 4PM9A 3A0VA 3MFXA 1EW0A 3H82B 3T4KA 4S2NA 5FQQA 3BJNA 2O9AA 5A93A 4ZAMA 4OOYA 1FR6A 1QMFA 4NXBA 4KQRA 2QPNA 5U47A 2W0NA 1Q2QA 4UQIM 2M7VA 3FG8A 2HJ9C 2WKQA 3UE1A 4P87A 2PHYA 3FV7A 4G3WA 5FATA 4NETA 4KZ8A 3C4OA 1K57C 4OPZA 1XJ2A 1I2SA 3BM6A 2O9BA 1PZOA 4BD0A 4II7A 3MQQA 3HLGA 4Y0OA 1L0FA 2PU4A 2XEPA 3LCEA 3ZG9B 3EGXC 5EVEA 3UO9A 4HI4A 3F1PB 1Z6FA 2INWA 2AVXA 3HLBA 3ZGAB 1YM1A 4UA7A 1ES5A 4DN0A 4E3KA 3NBLA 5EPHA 3LYXA 5CGWA 5EVID 2ZQ7A 5HARA 5JYOA 4CLCE 3N8SA 3DAVA 5FAQA 2PRFA 2BTFP 4D60A 4MCWA 3VP0A 2V8FA 3UPNA 1SCWA 4HP4A 5HFOA 3F1OA 2NUPC 2JKRM 3UY6A 3OPHA 5KMWA 2A3UA 1P9RA 1FSYA 4MLLA 4WUJA 3CLOA 4EEPA 1RGZA 5CHUA 4Q8IA 4S2OA 2WGVA 5GHXA 5AQ9A 4P6ZS 2Y59A 1KVMA 1NLYA 4EBPA 1OT9A 2ZC6B 2QWSA 3I7JA 1CK3A 3HVFA 2D01A 2PBYA 4HJ4A 4X6TA 4KQDA 3UMDA 1TF1A 2JKRI 3EEAA 2WKPA 3T1XA 4XT2B 1M40A 3JVUA 2Y55A 1K54C 3QHYA 4RA7A 2VGKA 3K3DA 4WM9A 3IX3A 1FCNA 4JXWA 3V3RA 4QPRA 4WL9A 2W3DA 3MKFA 4FSFA 1SKOA 5GHYA 3PAGA 3S7PA 4DJ2A 5EUAA 3H82A 2ZMVA 2J3WA 2GDNA 3RXXA 5E2GA 4GJ4A 2PD8A 3G4PA 3IF6B 2JCHA 1CJFA 2XA7M 4FCFA 5EV0A 4EUVA 2M7UA 3M2JA 1XP4A 3IQAA 1STZA 5FAPA 3GSGA 1H3QA 3BFDA 3S1YA 4WZ4A 1NWZA 2XD5A 1DP9A 1GSVA 1F2KA 5DF8A 4OOMA 2V1AA 2VZWA 4Q0JA 4XUXA 1SZVA 4MN7A 3CMZA 3E4OA 5DKLA 2W27A 3WS0A 3UDXA 4CQHA 2Y2HA 2ZOIA 4JXGA 3HJIA 3BEBA 4GKUA 5EOEA 1IYOA 3TW8A 2Y2GA 4E04A 3QNBA 3UB9A 4N9LA 1LSVA 4B4ZA 1FR1A 1TD5A 5DKKA 2QMIA 1VETB 4DE1A 3G2ZA 4Q0HA 4M3KA 3T1QB 5J3WA 2OLUA 4WN5A 2L4RA 4Z9QA 3ITBA 4PHTA 4OH0A 4ZJ2A 4A5RA 5CTMA 3B42A 3C30A 1UGUA 3CHWP 4FD8A 3S7OA 4DJ3A 1Q2PA 3MXSA 5DJUA 1L0DA 1S4RA 2J80A 4HP9A 1XKZA 1ZKJA 3PBRA 4JBFA 4IBRA 3D72A 1PW8A 3PBOA 3LR3A 4S2MA 3W4OA 3QP8A 4KENB 4BWIA 3Q7ZA 1TDGA 3UB5P 4HJ6A 1BYWA 3RH8B 4P6BA 4KQOA 1NYMA 5I94A 3H7WA 5DTTA 5J4EA 4MBHA 2ZL1B 1S1ZA 4S2KA 2XRNA 3BYDA 3QNCA 3CPTB 4HH3A 4YINA 2E8JA 3NIAA 3NDEA 3T4SA 1CQAA 3BY8A 1SKFA 3HLWA 2ZMAA 2Y2KA 4S2PA 1S4SA 2J9PA 1PFLA 4I3AA 1OT6A 3Q81A 2EWVA 4Y2FA 4EESA 2PDRA 4FH4A 2W1TA 5KIZA 5DVAA 1T1AA 1N9NA 1S1YA 4KUOA 3RTYA 2VEAA 2VLGA 2Z2LB 3FC7A 3O86A 3NJAA 2EFUA 2XH9A 1ODVA 3FPWA 4B4XA 5EVIA 1G6AA 3MF0A 1TDLA 2Q9NA 5FDHA 2WGWB 4O7DA 1BLPA 3KYEA 2GX5A 5EM1A 1ZG4A 1Y4OA 2H28A 3ZNYA 4MDZA 1D7EA 4MNRA 3BW6A 3MQOA 2ZC5B 1ESIA 4X53A 1DP6A 3ZG5A 2ZM0A 2WKHA 1K55C 3LEQA 2XFTA 1MBLA 2DNSA 4C6YA 2RCXA 1CI8A 1ACFA 3V50A 3IF6C 1W5DA 3VV4A 3WS4A 3WS1A 4KZ4A 3WRZA 2H0YA 3OCNA 1MWUA 4HESA 3PHYA 4RQ9A 1S6RA 5HL1A 5HAQA 4IVIA 3NC8A 5CEDA 3C2WA 4G3KA 1ES2A 2WK0A 1KOUA 1YMSA 2EXAA 4XUZA 1VHMA 3P7NA 1G68A 3L7HA 4D2OA 2FFYA 2Y79A 3IWIA 3C8CA 1MY8A 3SH7A 3ZG7B 3T4LA 4OPQA 3EOIA 4ID4A 3FKVA 3A3IA 4U3TA 4E3LA 5CHMA 3VP1A 3S7QA 2EA9A 3TRCA 4QWOA 4K0XA 2J8YA 5DFXA 2VX8A 4Y13A 1K4FA 4DXCA 5L10A 1W63Q 1KE4A 5I5LA 2R9XA 3LR4A 4DE3A 2V2FF 1H8YA 2ZL1A 2BG1A 4EEUA 1V9YA 1YSPA 1HLUP 4JGPA 4GN2A 2C5WB 2JKFA 3ZQ5A 4AFIA 2Z2MB 4R4SA 2K2NA 4MN6A 1KE3A 2WAFA 2HDUA 3NHQA 3F1OB 5CEBA 1CF0A 1WYBA 1XJ4A 2XROA 2V1ZA 1YLJA 2MJ6A 3UE0A 3VP3A 1L0GA 3G2YA 3LR5A 4GW9A 3CG5A 1IYSA 4E3JA 4X1MA 2WGIA 4ZJ1A 4N1HA 3O3VA 2WKIA 5HD5A 5K5BA 3V67A 4EWFA 3DTIA 4UA9A 1PIOA 5LBRA 2XLNA 3LFVA 4WEJA 2ZM2A 3C5AA 3VE3A 4FUWA 4N9KA 4I39A 3SOIA 4QY5A 3EQVA 5M1AA 5HPFA 3CUEA 4Y3IA 2PD7A 3IBRA 4NKPA 4LFUA 4O8GA 5GLDA 2XK1A 5AQAA 4U0TA 3LUQA 4IHQA 1IYPA 4BQMA 4LV0A 2FFFB 3LY4A 3BECA 3M2KA 1SKOB 4BLMA 3UDFA 2ZBBA 1W8YA 1YSQA 2ZQAA 3T4QA 1GSXA 3B47A 3BLSA 3HLDA 5HAPA 1AWIA 1FIKA 4FTXA 1FILA 4BL3A 1NRJA 3T4JA 2D02A 3LI8A 1T1BA 2VV8A 3O5YA 1H8ZA 2M1CA 3EWKA 2V1BA 2PYPA 4OP5A 3G32A 4JF6A 1PI5A 4ZRRA 4JF4A 3G34A 1BSGA 4QJGA 1G5UA 1ONGA 2WADA 5HWWA 2J9OA 4EW7A 4H6JB 1K0KA 4S2NC 3E0YA 2I72A 3MS6A 2J3TD 2DCFA 3FKWA 1IFQA 5FASA 4OPYA 3B3XA 2XGNA 4YFMA 1MZUA 1M6KA 2J7VA 3ZFZA 3AGDA 3IHBA 4HEFA 4ME4A 3IHAA 4R3JA 4E3IA 2A2LA 4GOGA 4IUHA 1G6OA 5DF9A 2ZQ8A 3NDGA 3LIDA 1XFNA 3NI9A 3IF5A 1YPRA 3UPPA 4KZ7A 5HL6A 3KYZA 1XX2A 1IEMA 1IKGA 5EFWA 5MC7A 2IWBA 2QJ7A 3C7UA 1KGEA 2EFXA 4WLAA 2WYXA 2Y2LA 5F5YA 4JGOA 5E2EA 4GHIA 1CI9A 2XA7S 1BLSA 3KSIA 3W8KA 4LRYC 4DRTA 1J9MA 2XDMA 2ZQCA 3IH8A 2Y2NA 1N9LA 1PNEA 3PXPA 2XSSA 1P97A 3Q1FA 5IHVA 3H7WB 1IELA 3IX8A 1LSWA 3LO7A 3ZDJA 1EI5A 3QP4A 4GLQA 4R70A 2HZ5A 1NJ4A 3MFDA 2B02A 2JHEA 2HGVA 4ZDXA 1JWZA 1JNUA 1GCEA 4X55A 3DW0A 3G6OA 3VSKA 1JWVA 4DXBA 2VK3A 4B88A 3TSGA 4JXSA 5KSHA 3HL9A 5F69A 3PTEA 3PBQA 2OSUA 2X02A 4M4XA 2A49A 1JTGA 1ZG6A 1LLBA 4WELA 5TBMA 1H5XA 2VGLS 4N92A 1L2SA 2W1TB 3UNWA 1PYYA 2ZOHA 2JN7A 4C75A 2V8CA 3ZHHA 5EVIB 4F3LA 4P0MA 4KZ3A 4PM8A 2Y2JA 4I38A 5HDDA 1BUEA 3G30A 3JYIA 3S22A
chains in the Genus database with same CATH topology
4FH4A 3M6HA 1ERQA 5E2HA 1E3UA 1EROA 4JXVA 3OPPA 5DVAA 5TR7A 3HREA 4WYYA 4E3OA 4LCLA 3FZCA 5GLBA 3SS5A 2Z2LB 2IWDA 3O86A 1O7EA 4WEKA 2EFUA 1HZOA 2EX6A 2XH9A 3UDIA 3UN7A 4HBTA 3BFEA 1MPLA 4B4XA 4GD8A 5EVIA 1G6AA 1JVJA 1TDLA 4X69A 5AQ7A 3GVBA 1NY0A 2EX8A 2Q9NA 5JYPA 3RXWA 4PM6A 5FDHA 2WGWB 3IXHA 1BLPA 2P74A 2ZQDA 3E2LA 4O7DA 3V3SA 1ZG4A 4BL2A 3ZNYA 3WRTA 3UPOA 2Y2OA 1KGGA 3OC2A 4E3NA 4K91A 1NYYA 5F1GA 4MNRA 3OPLA 5E43A 4Y0TA 3PBTA 4JPMA 4OVDA 3O88A 2ZC5B 1ESIA 1PW1A 3D4FA 1K4EA 4X53A 5A90A 2X01A 5CRFA 4NK3A 3P98A 3ZG5A 2ZM0A 2ZC4B 2WKHA 1K55C 2XFTA 2Y4AA 4OQHA 4RVAA 1MBLA 2DNSA 3HBRA 4C6YA 1XGJA 3HUOA 1LI0A 1HVBA 2RCXA 1CI8A 4LV3A 3V50A 3ZVTA 1ALQA 2WGWA 1W5DA 3IF6C 3WS4A 4OLGA 3WS1A 1WE4A 4KZ4A 3WRZA 2H0YA 1E4DA 3OCNA 1MWUA 4HESA 2JBFA 1W8QA 2ZLYA 1DY6A 3MBZA 1SDNA 4UHUA 4OQ0A 1S6RA 1LL9A 3PBSA 4S2LA 5HL1A 5HAQA 2DRWA 2H5SA 4Y0UA 4IVIA 3NC8A 4S2JA 1K54A 3VMAA 5FQKA 1CEGA 5CEDA 5KSCA 1ES2A 1CEFA 2ZJ9A 3BFCA 1RP5A 1VQQA 1YMSA 2WK0A 2UWXA 3IT9A 2EXAA 4DE0A 4XUZA 2PU2A 5F83A 1JWPA 2ZQ9A 2B5RA 4F94A 4OQIA 4KZBA 2JC7A 2WZZA 4MBFA 5J8XA 1G68A 4D2OA 2FFYA 4MEZA 1PWCA 3IWIA 4OLDA 4BENA 1MY8A 4GZBA 3SH7A 4Y7PA 3ZG7B 1RGYA 1E25A 4OPQA 1IKIA 4GDBA 4ZTKA 3VSLA 4C3QA 2WUQA 4JLFA 3HLEA 4KZAA 3EQUA 4ID4A 4DDYA 3FKVA 3A3IA 1I2WA 3Q7VB 4U3TA 3DWKA 1O07A 3OCLA 4HBUA 1K25A 5CHMA 3TG9A 3VP1A 4E3LA 4PM9A 1MXOA 4DDSA 1XA7A 4K0XA 5CTNA 5FA7A 3ZG8B 3MXRA 2J8YA 4PMAA 4S2NA 5FQQA 5A93A 4ZAMA 4OOYA 1BULA 1FR6A 2CC1A 1QMFA 4KQRA 2QPNA 5U47A 4LV1A 3TOIA 1Q2QA 5AQBA 2BLSA 5HX9A 2HDSA 1K4FA 3UE1A 4DXCA 3SH9A 3N7WA 4P87A 3IWOA 4E6WA 1KE4A 3FV7A 2R9XA 3Q7VA 4RX3A 3SS3A 5FATA 4DE3A 2V2FF 4NETA 1XPBA 1YMXA 1H8YA 4KZ8A 1FCOA 3C4OA 1Y54A 2Y91A 2BG1A 2Y2QA 1MWTA 3HLFA 4KG6A 1KDSA 1WYCA 3A3DA 1K57C 1K6SA 4OPZA 1GA0A 5G18A 1I2SA 3BM6A 4GN2A 5FQIA 3ZG0A 2C5WB 5FQJA 3IWQA 1PZOA 4BD0A 5FQ9A 3HLGA 2Z2MB 4Y0OA 4R4SA 4LCMA 1L0FA 1L0EA 4KZ5A 2PU4A 1KE3A 2XD1A 1N9BA 2WKEA 2XEPA 3LCEA 2XFSA 3ZG9B 5TFQA 2WAFA 1I5QA 2ZM8A 3GRJA 1SDEA 5GL9A 3UO9A 2P9VB 4LENA 4EUZA 3VFHA 5EOOA 1Z6FA 3HLCA 2HDUA 3DTMA 3HLBA 4BJPA 3OZHA 3ZGAB 3HUMA 2IWCA 3UE3A 1YM1A 5CEBA 4OQGA 4UA7A 2XR0A 1ES5A 1WYBA 2Q9MA 3G35A 3ITAA 1PI4A 3N4IA 3MZEA 3NBLA 1YLWA 2V1ZA 3FYZA 1YLJA 5EPHA 4E3KA 5CGWA 3UE0A 3VP3A 4KZ6A 3IH9A 1NXYA 3G2YA 4QB8A 5EVID 2ZQ7A 4OONA 5HARA 1L0GA 5JYOA 3N8SA 2E8IA 5FAQA 3CG5A 1IYSA 4E3JA 2HP5A 1BZAA 2WGIA 4ZJ1A 5GLCA 1ES3A 2HPBA 3MZDA 4N1HA 5FI2A 2Y2PA 3O3VA 2WKIA 1PZPA 2QZ6A 4X56A 2P9VA 5EVLA 4IVKA 5A92A 1YQSA 2OV5A 4EWFA 3VP0A 1EWZA 3UPNA 2HDRA 2R9WA 1SCWA 4UA9A 1PIOA 5HFOA 2HP6A 1KDWA 2XLNA 4WEJA 1K56D 2ZM2A 4KQQA 5FI6A 2ZC3B 3C5AA 3UY6A 4EQIA 3OPHA 4N9KA 5KMWA 2A3UA 3SOIA 3VP2A 1XGIA 1FSYA 4QY5A 4MLLA 3EQVA 1FSWA 4OKPA 5EVIC 5M1AA 3VOZA 1HTZA 2VGJA 1RGZA 3M6BA 4IEDA 3A3FA 4WZ5A 4U0XA 5GHZA 2OLVA 4L0LA 5CHUA 1GA9A 1ZC2A 3N6IA 2RL3A 5GLDA 2X71A 4Q8IA 1NZOA 2XK1A 4S2OA 4U0TA 5AQAA 2WGVA 3S4XA 5GHXA 5A91A 5AQ9A 1ESUA 1IYPA 2Y59A 4BQMA 1FOFA 1KVMA 4EBPA 3V39A 5M19A 4LV0A 5CGSA 2FFFB 2ZC6B 3LY4A 3I7JA 3O87A 3BECA 1FCMA 5CXWA 1CK3A 3HVFA 4R4RA 4R23A 3M2KA 5CECA 3Q07A 4UAAA 5EE8A 4BLMA 2PBYA 3V5MA 1YLTA 1ERMA 4X6TA 3UDFA 1W8YA 1MWSA 3G31A 1W79A 3BFGA 1M40A 2ZQAA 3BLMA 2Y55A 1YT4A 1K54C 3BLSA 3DWZA 3QHYA 4E6XA 4EBNA 4RA7A 2EXBA 2ZD8A 1PWGA 2VGKA 5F82A 3HLDA 5DTKA 4WM9A 5HAPA 3GMWA 1FCNA 1K38A 4JXWA 4OOLA 5FQMA 4BL3A 3V3RA 3MKFA 4FSFA 4H8RA 4ZBEA 4GB7A 5GHYA 3PAGA 1BT5A 1XXMA 5M18A 4WBGA 1H8ZA 1BLCA 5EUAA 4R3BA 5E2FA 4OP5A 3G32A 4JF6A 3LEZA 1PI5A 4PM7A 3GV9A 3ZVWA 5D3OA 3ZNTA 4JF4A 2GDNA 3G34A 1BSGA 4QJGA 4QY6A 3RXXA 5E2GA 1ONGA 4DF6A 2WADA 1GHIA 3VOYA 3LY3A 3PBNA 2J9OA 3G4PA 3IF6B 4S2NC 2JCHA 3VFFA 1VM1A 1XA1A 2I72A 3A3EA 1TEMA 4FCFA 4GD6A 4WMCD 3M2JA 1XP4A 3P09A 2DCFA 1N4OA 1AXBA 2HP9A 3FKWA 1E3UD 3IQAA 4X68A 5FAPA 3GSGA 3SS4A 5TGFA 4RYEA 5FASA 1S0WA 3B3XA 4OPYA 2XGNA 5CGXA 4YFMA 3GR2A 1BTLA 3BFDA 3IXDA 3S1YA 4WZ4A 1K55A 2XD5A 1M6KA 2J7VA 3OPRA 3IXBA 3HUNA 3VP4A 3ZFZA 5DF8A 3AGDA 4OOMA 5CERA 1DJBA 5DF7A 3IHBA 4HEFA 3NCKA 4QHCA 5CHJA 2WAEA 4XUXA 3IHAA 2EX2A 3BRMA 4R3JA 3CMZA 3IF6A 4E3IA 4GOGA 4XXRA 5KZHA 1DJAA 3WS5A 4CPKA 3WS0A 5DF9A 2ZQ8A 4OPRA 3NDGA 3NI9A 3IF5A 5FI7A 3UDXA 2H10A 1RCJA 3UPPA 4KZ7A 4IBXA 2G2WA 3WWXA 2Y2HA 4QU3A 3C4PA 4JXGA 5FSRA 4GKUA 1XX2A 1IEMA 3BEBA 1IKGA 3NY4A 5EOEA 1IYOA 1NRFA 2Y2GA 4PM5A 4DKIA 1SHVA 3QNBA 4GDNA 2IWBA 3MKEA 3C7UA 3FWLA 1KGEA 4N9LA 2EFXA 2WYXA 2Y2LA 4UA6A 3W4QA 3AGFA 4B4ZA 1FR1A 1ONHA 1KVLA 1K56A 4MBKA 4RX2A 1LI9A 2QMIA 2ZC7A 4DE1A 3G2ZA 4GNUA 4M3KA 5E2EA 2Y2MA 3Q82A 1CI9A 3C7VA 1BLSA 3W8KA 2OLUA 1C3BA 5HAIA 4DRTA 1J9MA 4Z9QA 1BLHA 3ITBA 4DE2A 4OH0A 4ZJ2A 2XDMA 3A3JA 4N1XA 3WS2A 2ZQCA 3IH8A 2Y2NA 3CZDA 3CJMA 4A5RA 5CTMA 2EX9A 3N8LA 2HDQA 3Q1FA 5IHVA 4FD8A 4JF5A 1IELA 2XF3A 1GHPA 5HW3A 1U60A 1Q2PA 3MXSA 3GQZA 1LHYA 3E2KA 3LO7A 1L0DA 3ZDJA 1EI5A 1YLYA 5F1FA 4P85A 1DJCA 1XKZA 1NJ4A 1ZKJA 3PBRA 3MFDA 1TVFA 4JBFA 2C6WB 4IBRA 1YLZA 1IYQA 1NZUA 5DTSA 1PW8A 4S2IA 4JKTA 4CJNA 1PWDA 1LL5A 4ZDXA 2V20A 3PBOA 4R0QA 4WZ5C 3ZCZA 4S2MA 3W4OA 4KENB 1HD8A 1JWZA 3Q7ZA 1GCEA 1TDGA 4ZJ3A 4QD4A 1OMEA 4X55A 4FH2A 3DW0A 1MWRA 3VSKA 1K57A 1JWVA 4P6BA 3ISGA 1YLPA 1NYMA 4KQOA 4DXBA 5I94A 5DTTA 1ES4A 4B88A 3TSGA 4JXSA 4MBHA 5KSHA 1FQGA 3HL9A 5L2FA 4PPRA 1W7FA 3PAEA 1GHMA 3PTEA 4S2KA 3PBQA 1KE0A 2OSUA 2X02A 3BFFA 3BYDA 2WZXA 2A49A 3GTCA 2H0TA 3QNCA 4OP8A 4YINA 1JTGA 1ZG6A 1LLBA 2Y2IA 3NIAA 4WELA 1H5XA 3NDEA 4KG5A 4R1GA 4N92A 1L2SA 1QMEA 4LV2A 3UNWA 1SKFA 3W4PA 1PYYA 1JTDA 3HLWA 5EECA 5FAOA 5BOHA 2ZMAA 4EBLA 2Y2KA 4S2PA 1KGFA 4BD1A 2G2UA 2J9PA 5GLAA 4C75A 4EV4A 2XQZA 3RJUA 3ZHHA 3Q81A 5EVIB 3IXGA 2JE5A 4K0WA 4P0MA 1MKIA 3MZFA 4E3MA 3AGEA 4KZ9A 2Y2JA 4KZ3A 4PM8A 1K6RA 1BUEA 4WMCA 3G30A 3SH8A 4KG2A 3JYIA 3N8RA 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FH4 A;  3M6H A;  1ERQ A;  5E2H A;  1E3U A;  1ERO A;  4JXV A;  3OPP A;  5DVA A;  5TR7 A;  3HRE A;  4WYY A;  4E3O A;  4LCL A;  3FZC A;  5GLB A;  3SS5 A;  2Z2L B;  2IWD A;  3O86 A;  1O7E A;  4WEK A;  2EFU A;  1HZO A;  2EX6 A;  2XH9 A;  3UDI A;  3UN7 A;  4HBT A;  3BFE A;  1MPL A;  4B4X A;  4GD8 A;  5EVI A;  1G6A A;  1JVJ A;  1TDL A;  4X69 A;  5AQ7 A;  3GVB A;  1NY0 A;  2EX8 A;  2Q9N A;  5JYP A;  3RXW A;  4PM6 A;  5FDH A;  2WGW B;  3IXH A;  1BLP A;  2P74 A;  2ZQD A;  3E2L A;  4O7D A;  3V3S A;  1ZG4 A;  4BL2 A;  3ZNY A;  3WRT A;  3UPO A;  2Y2O A;  1KGG A;  3OC2 A;  4E3N A;  4K91 A;  1NYY A;  5F1G A;  4MNR A;  3OPL A;  5E43 A;  4Y0T A;  3PBT A;  4JPM A;  4OVD A;  3O88 A;  2ZC5 B;  1ESI A;  1PW1 A;  3D4F A;  1K4E A;  4X53 A;  5A90 A;  2X01 A;  5CRF A;  4NK3 A;  3P98 A;  3ZG5 A;  2ZM0 A;  2ZC4 B;  2WKH A;  1K55 C;  2XFT A;  2Y4A A;  4OQH A;  4RVA A;  1MBL A;  2DNS A;  3HBR A;  4C6Y A;  1XGJ A;  3HUO A;  1LI0 A;  1HVB A;  2RCX A;  1CI8 A;  4LV3 A;  3V50 A;  3ZVT A;  1ALQ A;  2WGW A;  1W5D A;  3IF6 C;  3WS4 A;  4OLG A;  3WS1 A;  1WE4 A;  4KZ4 A;  3WRZ A;  2H0Y A;  1E4D A;  3OCN A;  1MWU A;  4HES A;  2JBF A;  1W8Q A;  2ZLY A;  1DY6 A;  3MBZ A;  1SDN A;  4UHU A;  4OQ0 A;  1S6R A;  1LL9 A;  3PBS A;  4S2L A;  5HL1 A;  5HAQ A;  2DRW A;  2H5S A;  4Y0U A;  4IVI A;  3NC8 A;  4S2J A;  1K54 A;  3VMA A;  5FQK A;  1CEG A;  5CED A;  5KSC A;  1ES2 A;  1CEF A;  2ZJ9 A;  3BFC A;  1RP5 A;  1VQQ A;  1YMS A;  2WK0 A;  2UWX A;  3IT9 A;  2EXA A;  4DE0 A;  4XUZ A;  2PU2 A;  5F83 A;  1JWP A;  2ZQ9 A;  2B5R A;  4F94 A;  4OQI A;  4KZB A;  2JC7 A;  2WZZ A;  4MBF A;  5J8X A;  1G68 A;  4D2O A;  2FFY A;  4MEZ A;  1PWC A;  3IWI A;  4OLD A;  4BEN A;  1MY8 A;  4GZB A;  3SH7 A;  4Y7P A;  3ZG7 B;  1RGY A;  1E25 A;  4OPQ A;  1IKI A;  4GDB A;  4ZTK A;  3VSL A;  4C3Q A;  2WUQ A;  4JLF A;  3HLE A;  4KZA A;  3EQU A;  4ID4 A;  4DDY A;  3FKV A;  3A3I A;  1I2W A;  3Q7V B;  4U3T A;  3DWK A;  1O07 A;  3OCL A;  4HBU A;  1K25 A;  5CHM A;  3TG9 A;  3VP1 A;  4E3L A;  4PM9 A;  1MXO A;  4DDS A;  1XA7 A;  4K0X A;  5CTN A;  5FA7 A;  3ZG8 B;  3MXR A;  2J8Y A;  4PMA A;  4S2N A;  5FQQ A;  5A93 A;  4ZAM A;  4OOY A;  1BUL A;  1FR6 A;  2CC1 A;  1QMF A;  4KQR A;  2QPN A;  5U47 A;  4LV1 A;  3TOI A;  1Q2Q A;  5AQB A;  2BLS A;  5HX9 A;  2HDS A;  1K4F A;  3UE1 A;  4DXC A;  3SH9 A;  3N7W A;  4P87 A;  3IWO A;  4E6W A;  1KE4 A;  3FV7 A;  2R9X A;  3Q7V A;  4RX3 A;  3SS3 A;  5FAT A;  4DE3 A;  2V2F F;  4NET A;  1XPB A;  1YMX A;  1H8Y A;  4KZ8 A;  1FCO A;  3C4O A;  1Y54 A;  2Y91 A;  2BG1 A;  2Y2Q A;  1MWT A;  3HLF A;  4KG6 A;  1KDS A;  1WYC A;  3A3D A;  1K57 C;  1K6S A;  4OPZ A;  1GA0 A;  5G18 A;  1I2S A;  3BM6 A;  4GN2 A;  5FQI A;  3ZG0 A;  2C5W B;  5FQJ A;  3IWQ A;  1PZO A;  4BD0 A;  5FQ9 A;  3HLG A;  2Z2M B;  4Y0O A;  4R4S A;  4LCM A;  1L0F A;  1L0E A;  4KZ5 A;  2PU4 A;  1KE3 A;  2XD1 A;  1N9B A;  2WKE A;  2XEP A;  3LCE A;  2XFS A;  3ZG9 B;  5TFQ A;  2WAF A;  1I5Q A;  2ZM8 A;  3GRJ A;  1SDE A;  5GL9 A;  3UO9 A;  2P9V B;  4LEN A;  4EUZ A;  3VFH A;  5EOO A;  1Z6F A;  3HLC A;  2HDU A;  3DTM A;  3HLB A;  4BJP A;  3OZH A;  3ZGA B;  3HUM A;  2IWC A;  3UE3 A;  1YM1 A;  5CEB A;  4OQG A;  4UA7 A;  2XR0 A;  1ES5 A;  1WYB A;  2Q9M A;  3G35 A;  3ITA A;  1PI4 A;  3N4I A;  3MZE A;  3NBL A;  1YLW A;  2V1Z A;  3FYZ A;  1YLJ A;  5EPH A;  4E3K A;  5CGW A;  3UE0 A;  3VP3 A;  4KZ6 A;  3IH9 A;  1NXY A;  3G2Y A;  4QB8 A;  5EVI D;  2ZQ7 A;  4OON A;  5HAR A;  1L0G A;  5JYO A;  3N8S A;  2E8I A;  5FAQ A;  3CG5 A;  1IYS A;  4E3J A;  2HP5 A;  1BZA A;  2WGI A;  4ZJ1 A;  5GLC A;  1ES3 A;  2HPB A;  3MZD A;  4N1H A;  5FI2 A;  2Y2P A;  3O3V A;  2WKI A;  1PZP A;  2QZ6 A;  4X56 A;  2P9V A;  5EVL A;  4IVK A;  5A92 A;  1YQS A;  2OV5 A;  4EWF A;  3VP0 A;  1EWZ A;  3UPN A;  2HDR A;  2R9W A;  1SCW A;  4UA9 A;  1PIO A;  5HFO A;  2HP6 A;  1KDW A;  2XLN A;  4WEJ A;  1K56 D;  2ZM2 A;  4KQQ A;  5FI6 A;  2ZC3 B;  3C5A A;  3UY6 A;  4EQI A;  3OPH A;  4N9K A;  5KMW A;  2A3U A;  3SOI A;  3VP2 A;  1XGI A;  1FSY A;  4QY5 A;  4MLL A;  3EQV A;  1FSW A;  4OKP A;  5EVI C;  5M1A A;  3VOZ A;  1HTZ A;  2VGJ A;  1RGZ A;  3M6B A;  4IED A;  3A3F A;  4WZ5 A;  4U0X A;  5GHZ A;  2OLV A;  4L0L A;  5CHU A;  1GA9 A;  1ZC2 A;  3N6I A;  2RL3 A;  5GLD A;  2X71 A;  4Q8I A;  1NZO A;  2XK1 A;  4S2O A;  4U0T A;  5AQA A;  2WGV A;  3S4X A;  5GHX A;  5A91 A;  5AQ9 A;  1ESU A;  1IYP A;  2Y59 A;  4BQM A;  1FOF A;  1KVM A;  4EBP A;  3V39 A;  5M19 A;  4LV0 A;  5CGS A;  2FFF B;  2ZC6 B;  3LY4 A;  3I7J A;  3O87 A;  3BEC A;  1FCM A;  5CXW A;  1CK3 A;  3HVF A;  4R4R A;  4R23 A;  3M2K A;  5CEC A;  3Q07 A;  4UAA A;  5EE8 A;  4BLM A;  2PBY A;  3V5M A;  1YLT A;  1ERM A;  4X6T A;  3UDF A;  1W8Y A;  1MWS A;  3G31 A;  1W79 A;  3BFG A;  1M40 A;  2ZQA A;  3BLM A;  2Y55 A;  1YT4 A;  1K54 C;  3BLS A;  3DWZ A;  3QHY A;  4E6X A;  4EBN A;  4RA7 A;  2EXB A;  2ZD8 A;  1PWG A;  2VGK A;  5F82 A;  3HLD A;  5DTK A;  4WM9 A;  5HAP A;  3GMW A;  1FCN A;  1K38 A;  4JXW A;  4OOL A;  5FQM A;  4BL3 A;  3V3R A;  3MKF A;  4FSF A;  4H8R A;  4ZBE A;  4GB7 A;  5GHY A;  3PAG A;  1BT5 A;  1XXM A;  5M18 A;  4WBG A;  1H8Z A;  1BLC A;  5EUA A;  4R3B A;  5E2F A;  4OP5 A;  3G32 A;  4JF6 A;  3LEZ A;  1PI5 A;  4PM7 A;  3GV9 A;  3ZVW A;  5D3O A;  3ZNT A;  4JF4 A;  2GDN A;  3G34 A;  1BSG A;  4QJG A;  4QY6 A;  3RXX A;  5E2G A;  1ONG A;  4DF6 A;  2WAD A;  1GHI A;  3VOY A;  3LY3 A;  3PBN A;  2J9O A;  3G4P A;  3IF6 B;  4S2N C;  2JCH A;  3VFF A;  1VM1 A;  1XA1 A;  2I72 A;  3A3E A;  1TEM A;  4FCF A;  4GD6 A;  4WMC D;  3M2J A;  1XP4 A;  3P09 A;  2DCF A;  1N4O A;  1AXB A;  2HP9 A;  3FKW A;  1E3U D;  3IQA A;  4X68 A;  5FAP A;  3GSG A;  3SS4 A;  5TGF A;  4RYE A;  5FAS A;  1S0W A;  3B3X A;  4OPY A;  2XGN A;  5CGX A;  4YFM A;  3GR2 A;  1BTL A;  3BFD A;  3IXD A;  3S1Y A;  4WZ4 A;  1K55 A;  2XD5 A;  1M6K A;  2J7V A;  3OPR A;  3IXB A;  3HUN A;  3VP4 A;  3ZFZ A;  5DF8 A;  3AGD A;  4OOM A;  5CER A;  1DJB A;  5DF7 A;  3IHB A;  4HEF A;  3NCK A;  4QHC A;  5CHJ A;  2WAE A;  4XUX A;  3IHA A;  2EX2 A;  3BRM A;  4R3J A;  3CMZ A;  3IF6 A;  4E3I A;  4GOG A;  4XXR A;  5KZH A;  1DJA A;  3WS5 A;  4CPK A;  3WS0 A;  5DF9 A;  2ZQ8 A;  4OPR A;  3NDG A;  3NI9 A;  3IF5 A;  5FI7 A;  3UDX A;  2H10 A;  1RCJ A;  3UPP A;  4KZ7 A;  4IBX A;  2G2W A;  3WWX A;  2Y2H A;  4QU3 A;  3C4P A;  4JXG A;  5FSR A;  4GKU A;  1XX2 A;  1IEM A;  3BEB A;  1IKG A;  3NY4 A;  5EOE A;  1IYO A;  1NRF A;  2Y2G A;  4PM5 A;  4DKI A;  1SHV A;  3QNB A;  4GDN A;  2IWB A;  3MKE A;  3C7U A;  3FWL A;  1KGE A;  4N9L A;  2EFX A;  2WYX A;  2Y2L A;  4UA6 A;  3W4Q A;  3AGF A;  4B4Z A;  1FR1 A;  1ONH A;  1KVL A;  1K56 A;  4MBK A;  4RX2 A;  1LI9 A;  2QMI A;  2ZC7 A;  4DE1 A;  3G2Z A;  4GNU A;  4M3K A;  5E2E A;  2Y2M A;  3Q82 A;  1CI9 A;  3C7V A;  1BLS A;  3W8K A;  2OLU A;  1C3B A;  5HAI A;  4DRT A;  1J9M A;  4Z9Q A;  1BLH A;  3ITB A;  4DE2 A;  4OH0 A;  4ZJ2 A;  2XDM A;  3A3J A;  4N1X A;  3WS2 A;  2ZQC A;  3IH8 A;  2Y2N A;  3CZD A;  3CJM A;  4A5R A;  5CTM A;  2EX9 A;  3N8L A;  2HDQ A;  3Q1F A;  5IHV A;  4FD8 A;  4JF5 A;  1IEL A;  2XF3 A;  1GHP A;  5HW3 A;  1U60 A;  1Q2P A;  3MXS A;  3GQZ A;  1LHY A;  3E2K A;  3LO7 A;  1L0D A;  3ZDJ A;  1EI5 A;  1YLY A;  5F1F A;  4P85 A;  1DJC A;  1XKZ A;  1NJ4 A;  1ZKJ A;  3PBR A;  3MFD A;  1TVF A;  4JBF A;  2C6W B;  4IBR A;  1YLZ A;  1IYQ A;  1NZU A;  5DTS A;  1PW8 A;  4S2I A;  4JKT A;  4CJN A;  1PWD A;  1LL5 A;  4ZDX A;  2V20 A;  3PBO A;  4R0Q A;  4WZ5 C;  3ZCZ A;  4S2M A;  3W4O A;  4KEN B;  1HD8 A;  1JWZ A;  3Q7Z A;  1GCE A;  1TDG A;  4ZJ3 A;  4QD4 A;  1OME A;  4X55 A;  4FH2 A;  3DW0 A;  1MWR A;  3VSK A;  1K57 A;  1JWV A;  4P6B A;  3ISG A;  1YLP A;  1NYM A;  4KQO A;  4DXB A;  5I94 A;  5DTT A;  1ES4 A;  4B88 A;  3TSG A;  4JXS A;  4MBH A;  5KSH A;  1FQG A;  3HL9 A;  5L2F A;  4PPR A;  1W7F A;  3PAE A;  1GHM A;  3PTE A;  4S2K A;  3PBQ A;  1KE0 A;  2OSU A;  2X02 A;  3BFF A;  3BYD A;  2WZX A;  2A49 A;  3GTC A;  2H0T A;  3QNC A;  4OP8 A;  4YIN A;  1JTG A;  1ZG6 A;  1LLB A;  2Y2I A;  3NIA A;  4WEL A;  1H5X A;  3NDE A;  4KG5 A;  4R1G A;  4N92 A;  1L2S A;  1QME A;  4LV2 A;  3UNW A;  1SKF A;  3W4P A;  1PYY A;  1JTD A;  3HLW A;  5EEC A;  5FAO A;  5BOH A;  2ZMA A;  4EBL A;  2Y2K A;  4S2P A;  1KGF A;  4BD1 A;  2G2U A;  2J9P A;  5GLA A;  4C75 A;  4EV4 A;  2XQZ A;  3RJU A;  3ZHH A;  3Q81 A;  5EVI B;  3IXG A;  2JE5 A;  4K0W A;  4P0M A;  1MKI A;  3MZF A;  4E3M A;  3AGE A;  4KZ9 A;  2Y2J A;  4KZ3 A;  4PM8 A;  1K6R A;  1BUE A;  4WMC A;  3G30 A;  3SH8 A;  4KG2 A;  3JYI A;  3N8R A;  3S22 A; 
#chains in the Genus database with same CATH topology
 5IU1 A;  1E3U A;  4E3O A;  2P04 A;  4H6J A;  4LCL A;  3FZC A;  3L9K A;  3SS5 A;  3H9W A;  1O7E A;  3QP5 A;  3UN7 A;  2EX6 A;  4L9F A;  4P6Z M;  4HBT A;  5AQ7 A;  3IXH A;  2P74 A;  3E2L A;  3V3S A;  4BL2 A;  4Z1W A;  4NXG A;  3WRT A;  5FDS A;  1DP8 A;  5E43 A;  3O88 A;  2UV0 E;  1PW1 A;  3D4F A;  1F9I A;  4NK3 A;  3P98 A;  1TS6 A;  1UWP X;  2Y4A A;  4OQH A;  4RVA A;  3HUO A;  1LI0 A;  3EGD C;  4CLC A;  1DY6 A;  3MBZ A;  1LL9 A;  2H5S A;  2FZ0 A;  3VMA A;  5FQK A;  2P08 A;  3T1S A;  3BFC A;  3T4T A;  1W63 M;  4I3J A;  5F83 A;  3ZYT A;  3OLO A;  3PYP A;  4GS9 A;  2JC7 A;  2WZZ A;  2VKS A;  4ETZ A;  4GDB A;  1OTE A;  4C3Q A;  3BY9 A;  1I2W A;  3DWK A;  3EEH A;  4DDS A;  5CTN A;  5FA7 A;  3MXR A;  1BUL A;  2CC1 A;  5HD3 A;  4JGR A;  3TOI A;  5AQB A;  5HX9 A;  3SH9 A;  3N7W A;  5F68 A;  3Q7V A;  4BBU A;  4MMN A;  3LIF A;  1YMX A;  4R3A A;  1FCO A;  2Y91 A;  3HJK A;  2B18 A;  1MWT A;  3HLF A;  4KG6 A;  3S7N A;  1GA0 A;  5G18 A;  2PBD P;  1IOU A;  3ZG0 A;  3E98 A;  4PAU A;  4LCM A;  1OTD A;  1N9B A;  3P01 A;  2XFS A;  5TFQ A;  4EER A;  5GL9 A;  1SDE A;  4LEN A;  3VFH A;  5EOO A;  3DTM A;  4BJP A;  3UME A;  3UE3 A;  2JKG A;  2GJ3 A;  3ITA A;  2A24 A;  3FYZ A;  1YKD A;  1VB6 A;  3E4P A;  3IH9 A;  2W3E A;  1LSX A;  4KZ6 A;  4QB8 A;  4CJN A;  5GLC A;  5FI2 A;  5FEF A;  2EWW A;  2P9V A;  4IVK A;  2OV5 A;  1EWZ A;  4BMW A;  2J3T C;  2R9W A;  2HP6 A;  1KDW A;  3OOV A;  4KQQ A;  2ZC3 B;  4DMZ A;  1XGI A;  4OKP A;  5EVI C;  3VOZ A;  3TJZ C;  2VGJ A;  3A3F A;  4WZ5 A;  4U0X A;  5GHZ A;  2OLV A;  2FH5 A;  3N6I A;  2RL3 A;  2X71 A;  5HDS A;  2L1M A;  1NZO A;  5HWT A;  1ZHH B;  3S4X A;  3MQ0 A;  4LRX C;  4R23 A;  1YAX A;  5CEC A;  2PT7 A;  5EE8 A;  4HNB A;  3T1R A;  1YLT A;  3BQA A;  3MJQ A;  2QJ5 A;  4B93 A;  2KOI A;  1W79 A;  3LI9 A;  2OWH A;  2Z6D A;  3BLM A;  3DWZ A;  4E6X A;  2EXB A;  1PWG A;  1TS0 A;  5F82 A;  3GMW A;  1K38 A;  4OOL A;  3MSH A;  5FQM A;  3KYQ A;  4HY8 A;  2OWJ A;  3KSH A;  2QHK A;  4H8R A;  3VOL A;  4GB7 A;  1BT5 A;  3IS2 A;  3UE6 A;  4WBG A;  1XJ3 A;  1BLC A;  4R3B A;  4EXO A;  4LLO B;  3LEZ A;  4PM7 A;  3U4L P;  3ZVW A;  3ZNT A;  4QY6 A;  2Q0O A;  4DF6 A;  1GHI A;  3LY3 A;  3PBN A;  1TS7 A;  1XJ6 A;  3VFF A;  3A3E A;  1TEM A;  3QP2 A;  3P09 A;  1N4O A;  1E3U D;  2BAS A;  4RYE A;  1S0W A;  3GR2 A;  3IXD A;  1UWN X;  1P0Z A;  4ARZ A;  3VP4 A;  3HUN A;  2HF6 A;  2QKP A;  3F1N A;  2LB5 A;  3BRM A;  4R38 A;  4UQI S;  4XXR A;  3CIT A;  4HIA A;  4GHI B;  5FI7 A;  2VV7 A;  3NOP C;  4QU3 A;  3C4P A;  4O01 A;  3KO6 A;  3T50 A;  3NY4 A;  2O99 A;  1NRF A;  1SHV A;  4GDN A;  3MKE A;  5FL3 A;  3FWL A;  2CMN A;  1ZTU A;  3W4Q A;  1NLZ A;  3AGF A;  1KVL A;  1K56 A;  4MBK A;  4RX2 A;  2YKF A;  4CLC D;  2PR5 A;  1LI9 A;  4GNU A;  4HOI A;  2Y2M A;  1C3B A;  5HAI A;  4R6L A;  1BLH A;  4DE2 A;  3UB6 A;  3A3J A;  1OPX A;  3CZD A;  2G7U A;  3N8L A;  2HDQ A;  3MR0 A;  5HW3 A;  3E2K A;  4X1L A;  5F1F A;  1OJG A;  3R7W A;  1NZU A;  5DTS A;  5TBM B;  4S2I A;  4JKT A;  2K7S A;  3CUE C;  3A0S A;  3E4Q A;  4FOF A;  5DFY A;  5A8B A;  3A0R A;  4QD4 A;  1OME A;  3RFB A;  1MWR A;  1K57 A;  3ISG A;  4B9O A;  1FQG A;  5L2F A;  2V0U A;  4NXF A;  4PPR A;  1W7F A;  4F3L B;  3ICY A;  5C5K A;  2DMW A;  3D3O A;  2WZX A;  3GTC A;  2H0T A;  4OP8 A;  2WKR A;  1QME A;  4L9G A;  5DJT A;  1JTD A;  5EEC A;  5BOH A;  5L8M A;  1KGF A;  4BD1 A;  2G2U A;  2KDK A;  3T4O A;  2XQZ A;  1PRQ A;  3HCY A;  3IXG A;  2JE5 A;  2OAP 1;  1MKI A;  4E3M A;  4KZ9 A;  1N9O A;  1K6R A;  4WMC A;  3N8R A;  3BWL A;  2V0W A;  3M6H A;  4PKY G;  1ERO A;  4JXV A;  5TR7 A;  3HRE A;  3PR6 A;  5GLB A;  4NG2 A;  2IWD A;  5J7E A;  1XFQ A;  1HZO A;  2HV1 A;  1MPL A;  1JVJ A;  4BBV A;  3GVB A;  1NY0 A;  2EX8 A;  2GNX A;  4CLC B;  4YNR A;  4EQ1 A;  1KGG A;  3QP6 A;  3OC2 A;  5AVF A;  4E3N A;  4K91 A;  1NYY A;  5F1G A;  3OPL A;  3DTE A;  1F98 A;  5TJJ A;  3LIA A;  1T1C A;  1T19 A;  3B33 A;  3UB7 A;  4GS9 B;  4Y5F A;  2ZMF A;  3HBR A;  4HQA A;  1XGJ A;  3FPV A;  3ZVT A;  4HH2 A;  5HWV A;  3DTK A;  2JBF A;  1W8Q A;  3KSG A;  4OQ0 A;  4S2L A;  1K54 A;  2OAQ 1;  3LR0 A;  1CEG A;  2ZJ9 A;  4YWZ A;  1OTI A;  1RP5 A;  1VQQ A;  2I9V A;  3IT9 A;  1JWP A;  2ZQ9 A;  3NOU C;  1MC0 A;  4F94 A;  2PYR A;  4GCZ A;  5J8X A;  3BQ8 A;  1PWC A;  3UB8 A;  4BEN A;  1DRM A;  5HSQ A;  4GZB A;  1E25 A;  1IKI A;  4ZTK A;  1GSW A;  4HHD A;  1G28 A;  3QP1 A;  4ETX A;  3Q7V B;  1D06 A;  3C38 A;  1O07 A;  3TG9 A;  4HBU A;  1K25 A;  1LT0 A;  3CWF A;  1X0O A;  1MXO A;  1XA7 A;  3ZG8 B;  4PMA A;  3CAX A;  5L07 A;  2P7J A;  4LV1 A;  2O0Y A;  2BLS A;  2R78 A;  2HDS A;  3IWO A;  4E6W A;  4RX3 A;  3MXQ A;  3SS3 A;  1XPB A;  2VV6 A;  5HZH A;  1Y54 A;  2Y2Q A;  4WF0 A;  1KDS A;  1WYC A;  2A24 B;  3A3D A;  1K6S A;  5FQI A;  5FQJ A;  3SZT A;  4MN5 A;  1D1J A;  3IWQ A;  5FQ9 A;  2OOL A;  1L0E A;  4KZ5 A;  2XD1 A;  2WKE A;  1I5Q A;  2ZM8 A;  3GRJ A;  2P9V B;  4EUZ A;  1WA9 A;  3HLC A;  3VE4 A;  3OZH A;  3HUM A;  2IWC A;  4X25 A;  4OQG A;  2XR0 A;  2Q9M A;  2W3F A;  3G35 A;  4JGQ A;  1PI4 A;  3N4I A;  3MZE A;  1YLW A;  1NXY A;  4OON A;  1S66 L;  3LIC A;  2E8I A;  2HP5 A;  1BZA A;  1ES3 A;  2HPB A;  3MZD A;  2Y2P A;  1PZP A;  2QZ6 A;  4X56 A;  3F1P A;  5EVL A;  5A92 A;  3IBJ A;  3CI6 A;  1YQS A;  3NUL A;  2HDR A;  3W2Z A;  1K56 D;  5FI6 A;  1H8M A;  4EQI A;  3VP2 A;  2NUT C;  2Z6C A;  1FSW A;  4I3I A;  1HTZ A;  3M6B A;  4IED A;  3DBA A;  4L0L A;  5AJG A;  1GA9 A;  1ZC2 A;  3GDI A;  2VGL M;  5A91 A;  1ESU A;  1FOF A;  3V39 A;  5M19 A;  3GEC A;  5CGS A;  5CXW A;  3O87 A;  1FCM A;  4R4R A;  3Q07 A;  4UAA A;  2V9A A;  3V5M A;  1ERM A;  2IA2 A;  4LPZ A;  3IS2 B;  3KSF A;  1MWS A;  3G31 A;  4CLC C;  3BFG A;  4EU0 A;  1YT4 A;  4EBN A;  2ZD8 A;  3TE8 A;  2QYB A;  5DTK A;  3NEC A;  4HJ3 A;  4ZBE A;  1XXM A;  4ESP A;  5M18 A;  4XT2 A;  5E2F A;  3GV9 A;  4ARZ B;  5D3O A;  3F1N B;  3VOY A;  4I5S A;  3MMH A;  1VM1 A;  1XA1 A;  4GD6 A;  4WMC D;  1AXB A;  1T18 A;  2HP9 A;  4X68 A;  3SS4 A;  5TGF A;  2VJW A;  5CGX A;  1BTL A;  2PR6 A;  1K55 A;  3OPR A;  3IXB A;  4K08 A;  3IX4 A;  5CER A;  1DJB A;  5DF7 A;  3K2N A;  3NCK A;  4QHC A;  1F5M A;  5CHJ A;  2WAE A;  2K31 A;  2EX2 A;  3IF6 A;  5KZH A;  1DJA A;  4G3V A;  3WS5 A;  4CPK A;  1MKM A;  4OPR A;  5G4Z A;  2H10 A;  1RCJ A;  4IBX A;  2G2W A;  4UEY A;  3WWX A;  4O0P A;  5FSR A;  3LIE A;  1VEU B;  4PM5 A;  4DKI A;  2PAV P;  4UA6 A;  1OTA A;  1ONH A;  2ZC7 A;  1OTB A;  3D9Y A;  3Q82 A;  3C7V A;  3R7W B;  2W3G A;  3OBF A;  4N1X A;  3WS2 A;  3CJM A;  2O9C A;  2EX9 A;  3SW1 A;  1A0K A;  2ACG A;  4JF5 A;  2JKT M;  2XF3 A;  1GHP A;  1U60 A;  3GQZ A;  4Q0I A;  1LHY A;  1YLY A;  4KUK A;  4P85 A;  1VET A;  1DJC A;  1TVF A;  4NEE D;  2C6W B;  1YLZ A;  1IYQ A;  1PWD A;  1LL5 A;  2V20 A;  4R0Q A;  4WZ5 C;  3ZCZ A;  1P9W A;  1HD8 A;  4ZJ3 A;  4FH2 A;  1YLP A;  1ES4 A;  2B95 A;  4Y15 A;  5CX7 A;  3PAE A;  1GHM A;  1KE0 A;  3BFF A;  5HDC A;  2Y2I A;  2JKT I;  5G4Y A;  4KG5 A;  4R1G A;  4LV2 A;  2KLI A;  3W4P A;  4BBT A;  5FAO A;  4EBL A;  1Y28 A;  3R4K A;  5GLA A;  4EV4 A;  4LRZ E;  3RJU A;  3JPU A;  4K0W A;  3CPT A;  3MZF A;  3AGE A;  5HPI A;  3SH8 A;  4LGW A;  4KG2 A;  2Y8H A;  1ERQ A;  5E2H A;  3OPP A;  4WYY A;  5F6A A;  1OJ5 A;  1LL8 A;  1TS8 A;  1V9Z A;  4IUK A;  1H0M A;  5AVE A;  2L0W A;  4WEK A;  3UDI A;  3BFE A;  4GD8 A;  4X69 A;  5JYP A;  3RXW A;  4PM6 A;  2ZQD A;  2YKH A;  3UPO A;  2Y2O A;  4PKY A;  4Y0T A;  3PBT A;  4JPM A;  4OVD A;  5A90 A;  1K4E A;  2X01 A;  5CRF A;  2ZC4 B;  2HJE A;  4YOF A;  2W3H A;  5EM0 A;  2LB9 A;  5L09 A;  5FEG A;  1HVB A;  2VA0 A;  1S67 L;  4LV3 A;  4IJG A;  1ALQ A;  2WGW A;  4OLG A;  1WE4 A;  1E4D A;  3U2A A;  1J3W A;  5IT5 A;  2ZLY A;  1SDN A;  4UHU A;  1VEU A;  3PBS A;  2W1R A;  2DRW A;  3NOT C;  4Y0U A;  4S2J A;  5KSC A;  3ULF A;  4L9E A;  1CEF A;  3T12 B;  2UWX A;  4DE0 A;  2PU2 A;  2B5R A;  4OQI A;  2KX6 A;  3K3C A;  4KZB A;  4NXE A;  2GZA A;  4MBF A;  1L3L A;  4MEZ A;  5IS1 A;  4OLD A;  4Y17 A;  3JVV A;  3LGO A;  4Y7P A;  1RGY A;  3LIB A;  3VSL A;  3KX0 X;  2WUQ A;  4JLF A;  3HLE A;  4KZA A;  3EQU A;  4DDY A;  4EET B;  3OCL A;  1Z09 A;  4PM9 A;  3A0V A;  3MFX A;  1EW0 A;  3H82 B;  3T4K A;  4S2N A;  5FQQ A;  3BJN A;  2O9A A;  5A93 A;  4ZAM A;  4OOY A;  1FR6 A;  1QMF A;  4NXB A;  4KQR A;  2QPN A;  5U47 A;  2W0N A;  1Q2Q A;  4UQI M;  2M7V A;  3FG8 A;  2HJ9 C;  2WKQ A;  3UE1 A;  4P87 A;  2PHY A;  3FV7 A;  4G3W A;  5FAT A;  4NET A;  4KZ8 A;  3C4O A;  1K57 C;  4OPZ A;  1XJ2 A;  1I2S A;  3BM6 A;  2O9B A;  1PZO A;  4BD0 A;  4II7 A;  3MQQ A;  3HLG A;  4Y0O A;  1L0F A;  2PU4 A;  2XEP A;  3LCE A;  3ZG9 B;  3EGX C;  5EVE A;  3UO9 A;  4HI4 A;  3F1P B;  1Z6F A;  2INW A;  2AVX A;  3HLB A;  3ZGA B;  1YM1 A;  4UA7 A;  1ES5 A;  4DN0 A;  4E3K A;  3NBL A;  5EPH A;  3LYX A;  5CGW A;  5EVI D;  2ZQ7 A;  5HAR A;  5JYO A;  4CLC E;  3N8S A;  3DAV A;  5FAQ A;  2PRF A;  2BTF P;  4D60 A;  4MCW A;  3VP0 A;  2V8F A;  3UPN A;  1SCW A;  4HP4 A;  5HFO A;  3F1O A;  2NUP C;  2JKR M;  3UY6 A;  3OPH A;  5KMW A;  2A3U A;  1P9R A;  1FSY A;  4MLL A;  4WUJ A;  3CLO A;  4EEP A;  1RGZ A;  5CHU A;  4Q8I A;  4S2O A;  2WGV A;  5GHX A;  5AQ9 A;  4P6Z S;  2Y59 A;  1KVM A;  1NLY A;  4EBP A;  1OT9 A;  2ZC6 B;  2QWS A;  3I7J A;  1CK3 A;  3HVF A;  2D01 A;  2PBY A;  4HJ4 A;  4X6T A;  4KQD A;  3UMD A;  1TF1 A;  2JKR I;  3EEA A;  2WKP A;  3T1X A;  4XT2 B;  1M40 A;  3JVU A;  2Y55 A;  1K54 C;  3QHY A;  4RA7 A;  2VGK A;  3K3D A;  4WM9 A;  3IX3 A;  1FCN A;  4JXW A;  3V3R A;  4QPR A;  4WL9 A;  2W3D A;  3MKF A;  4FSF A;  1SKO A;  5GHY A;  3PAG A;  3S7P A;  4DJ2 A;  5EUA A;  3H82 A;  2ZMV A;  2J3W A;  2GDN A;  3RXX A;  5E2G A;  4GJ4 A;  2PD8 A;  3G4P A;  3IF6 B;  2JCH A;  1CJF A;  2XA7 M;  4FCF A;  5EV0 A;  4EUV A;  2M7U A;  3M2J A;  1XP4 A;  3IQA A;  1STZ A;  5FAP A;  3GSG A;  1H3Q A;  3BFD A;  3S1Y A;  4WZ4 A;  1NWZ A;  2XD5 A;  1DP9 A;  1GSV A;  1F2K A;  5DF8 A;  4OOM A;  2V1A A;  2VZW A;  4Q0J A;  4XUX A;  1SZV A;  4MN7 A;  3CMZ A;  3E4O A;  5DKL A;  2W27 A;  3WS0 A;  3UDX A;  4CQH A;  2Y2H A;  2ZOI A;  4JXG A;  3HJI A;  3BEB A;  4GKU A;  5EOE A;  1IYO A;  3TW8 A;  2Y2G A;  4E04 A;  3QNB A;  3UB9 A;  4N9L A;  1LSV A;  4B4Z A;  1FR1 A;  1TD5 A;  5DKK A;  2QMI A;  1VET B;  4DE1 A;  3G2Z A;  4Q0H A;  4M3K A;  3T1Q B;  5J3W A;  2OLU A;  4WN5 A;  2L4R A;  4Z9Q A;  3ITB A;  4PHT A;  4OH0 A;  4ZJ2 A;  4A5R A;  5CTM A;  3B42 A;  3C30 A;  1UGU A;  3CHW P;  4FD8 A;  3S7O A;  4DJ3 A;  1Q2P A;  3MXS A;  5DJU A;  1L0D A;  1S4R A;  2J80 A;  4HP9 A;  1XKZ A;  1ZKJ A;  3PBR A;  4JBF A;  4IBR A;  3D72 A;  1PW8 A;  3PBO A;  3LR3 A;  4S2M A;  3W4O A;  3QP8 A;  4KEN B;  4BWI A;  3Q7Z A;  1TDG A;  3UB5 P;  4HJ6 A;  1BYW A;  3RH8 B;  4P6B A;  4KQO A;  1NYM A;  5I94 A;  3H7W A;  5DTT A;  5J4E A;  4MBH A;  2ZL1 B;  1S1Z A;  4S2K A;  2XRN A;  3BYD A;  3QNC A;  3CPT B;  4HH3 A;  4YIN A;  2E8J A;  3NIA A;  3NDE A;  3T4S A;  1CQA A;  3BY8 A;  1SKF A;  3HLW A;  2ZMA A;  2Y2K A;  4S2P A;  1S4S A;  2J9P A;  1PFL A;  4I3A A;  1OT6 A;  3Q81 A;  2EWV A;  4Y2F A;  4EES A;  2PDR A;  4FH4 A;  2W1T A;  5KIZ A;  5DVA A;  1T1A A;  1N9N A;  1S1Y A;  4KUO A;  3RTY A;  2VEA A;  2VLG A;  2Z2L B;  3FC7 A;  3O86 A;  3NJA A;  2EFU A;  2XH9 A;  1ODV A;  3FPW A;  4B4X A;  5EVI A;  1G6A A;  3MF0 A;  1TDL A;  2Q9N A;  5FDH A;  2WGW B;  4O7D A;  1BLP A;  3KYE A;  2GX5 A;  5EM1 A;  1ZG4 A;  1Y4O A;  2H28 A;  3ZNY A;  4MDZ A;  1D7E A;  4MNR A;  3BW6 A;  3MQO A;  2ZC5 B;  1ESI A;  4X53 A;  1DP6 A;  3ZG5 A;  2ZM0 A;  2WKH A;  1K55 C;  3LEQ A;  2XFT A;  1MBL A;  2DNS A;  4C6Y A;  2RCX A;  1CI8 A;  1ACF A;  3V50 A;  3IF6 C;  1W5D A;  3VV4 A;  3WS4 A;  3WS1 A;  4KZ4 A;  3WRZ A;  2H0Y A;  3OCN A;  1MWU A;  4HES A;  3PHY A;  4RQ9 A;  1S6R A;  5HL1 A;  5HAQ A;  4IVI A;  3NC8 A;  5CED A;  3C2W A;  4G3K A;  1ES2 A;  2WK0 A;  1KOU A;  1YMS A;  2EXA A;  4XUZ A;  1VHM A;  3P7N A;  1G68 A;  3L7H A;  4D2O A;  2FFY A;  2Y79 A;  3IWI A;  3C8C A;  1MY8 A;  3SH7 A;  3ZG7 B;  3T4L A;  4OPQ A;  3EOI A;  4ID4 A;  3FKV A;  3A3I A;  4U3T A;  4E3L A;  5CHM A;  3VP1 A;  3S7Q A;  2EA9 A;  3TRC A;  4QWO A;  4K0X A;  2J8Y A;  5DFX A;  2VX8 A;  4Y13 A;  1K4F A;  4DXC A;  5L10 A;  1W63 Q;  1KE4 A;  5I5L A;  2R9X A;  3LR4 A;  4DE3 A;  2V2F F;  1H8Y A;  2ZL1 A;  2BG1 A;  4EEU A;  1V9Y A;  1YSP A;  1HLU P;  4JGP A;  4GN2 A;  2C5W B;  2JKF A;  3ZQ5 A;  4AFI A;  2Z2M B;  4R4S A;  2K2N A;  4MN6 A;  1KE3 A;  2WAF A;  2HDU A;  3NHQ A;  3F1O B;  5CEB A;  1CF0 A;  1WYB A;  1XJ4 A;  2XRO A;  2V1Z A;  1YLJ A;  2MJ6 A;  3UE0 A;  3VP3 A;  1L0G A;  3G2Y A;  3LR5 A;  4GW9 A;  3CG5 A;  1IYS A;  4E3J A;  4X1M A;  2WGI A;  4ZJ1 A;  4N1H A;  3O3V A;  2WKI A;  5HD5 A;  5K5B A;  3V67 A;  4EWF A;  3DTI A;  4UA9 A;  1PIO A;  5LBR A;  2XLN A;  3LFV A;  4WEJ A;  2ZM2 A;  3C5A A;  3VE3 A;  4FUW A;  4N9K A;  4I39 A;  3SOI A;  4QY5 A;  3EQV A;  5M1A A;  5HPF A;  3CUE A;  4Y3I A;  2PD7 A;  3IBR A;  4NKP A;  4LFU A;  4O8G A;  5GLD A;  2XK1 A;  5AQA A;  4U0T A;  3LUQ A;  4IHQ A;  1IYP A;  4BQM A;  4LV0 A;  2FFF B;  3LY4 A;  3BEC A;  3M2K A;  1SKO B;  4BLM A;  3UDF A;  2ZBB A;  1W8Y A;  1YSQ A;  2ZQA A;  3T4Q A;  1GSX A;  3B47 A;  3BLS A;  3HLD A;  5HAP A;  1AWI A;  1FIK A;  4FTX A;  1FIL A;  4BL3 A;  1NRJ A;  3T4J A;  2D02 A;  3LI8 A;  1T1B A;  2VV8 A;  3O5Y A;  1H8Z A;  2M1C A;  3EWK A;  2V1B A;  2PYP A;  4OP5 A;  3G32 A;  4JF6 A;  1PI5 A;  4ZRR A;  4JF4 A;  3G34 A;  1BSG A;  4QJG A;  1G5U A;  1ONG A;  2WAD A;  5HWW A;  2J9O A;  4EW7 A;  4H6J B;  1K0K A;  4S2N C;  3E0Y A;  2I72 A;  3MS6 A;  2J3T D;  2DCF A;  3FKW A;  1IFQ A;  5FAS A;  4OPY A;  3B3X A;  2XGN A;  4YFM A;  1MZU A;  1M6K A;  2J7V A;  3ZFZ A;  3AGD A;  3IHB A;  4HEF A;  4ME4 A;  3IHA A;  4R3J A;  4E3I A;  2A2L A;  4GOG A;  4IUH A;  1G6O A;  5DF9 A;  2ZQ8 A;  3NDG A;  3LID A;  1XFN A;  3NI9 A;  3IF5 A;  1YPR A;  3UPP A;  4KZ7 A;  5HL6 A;  3KYZ A;  1XX2 A;  1IEM A;  1IKG A;  5EFW A;  5MC7 A;  2IWB A;  2QJ7 A;  3C7U A;  1KGE A;  2EFX A;  4WLA A;  2WYX A;  2Y2L A;  5F5Y A;  4JGO A;  5E2E A;  4GHI A;  1CI9 A;  2XA7 S;  1BLS A;  3KSI A;  3W8K A;  4LRY C;  4DRT A;  1J9M A;  2XDM A;  2ZQC A;  3IH8 A;  2Y2N A;  1N9L A;  1PNE A;  3PXP A;  2XSS A;  1P97 A;  3Q1F A;  5IHV A;  3H7W B;  1IEL A;  3IX8 A;  1LSW A;  3LO7 A;  3ZDJ A;  1EI5 A;  3QP4 A;  4GLQ A;  4R70 A;  2HZ5 A;  1NJ4 A;  3MFD A;  2B02 A;  2JHE A;  2HGV A;  4ZDX A;  1JWZ A;  1JNU A;  1GCE A;  4X55 A;  3DW0 A;  3G6O A;  3VSK A;  1JWV A;  4DXB A;  2VK3 A;  4B88 A;  3TSG A;  4JXS A;  5KSH A;  3HL9 A;  5F69 A;  3PTE A;  3PBQ A;  2OSU A;  2X02 A;  4M4X A;  2A49 A;  1JTG A;  1ZG6 A;  1LLB A;  4WEL A;  5TBM A;  1H5X A;  2VGL S;  4N92 A;  1L2S A;  2W1T B;  3UNW A;  1PYY A;  2ZOH A;  2JN7 A;  4C75 A;  2V8C A;  3ZHH A;  5EVI B;  4F3L A;  4P0M A;  4KZ3 A;  4PM8 A;  2Y2J A;  4I38 A;  5HDD A;  1BUE A;  3G30 A;  3JYI A;  3S22 A; 
#chains in the Genus database with same CATH homology
 4FH4 A;  3M6H A;  1ERQ A;  5E2H A;  1E3U A;  1ERO A;  4JXV A;  3OPP A;  5DVA A;  5TR7 A;  3HRE A;  4WYY A;  4E3O A;  4LCL A;  3FZC A;  5GLB A;  3SS5 A;  2Z2L B;  2IWD A;  3O86 A;  1O7E A;  4WEK A;  2EFU A;  1HZO A;  2EX6 A;  2XH9 A;  3UDI A;  3UN7 A;  4HBT A;  3BFE A;  1MPL A;  4B4X A;  4GD8 A;  5EVI A;  1G6A A;  1JVJ A;  1TDL A;  4X69 A;  5AQ7 A;  3GVB A;  1NY0 A;  2EX8 A;  2Q9N A;  5JYP A;  3RXW A;  4PM6 A;  5FDH A;  2WGW B;  3IXH A;  1BLP A;  2P74 A;  2ZQD A;  3E2L A;  4O7D A;  3V3S A;  1ZG4 A;  4BL2 A;  3ZNY A;  3WRT A;  3UPO A;  2Y2O A;  1KGG A;  3OC2 A;  4E3N A;  4K91 A;  1NYY A;  5F1G A;  4MNR A;  3OPL A;  5E43 A;  4Y0T A;  3PBT A;  4JPM A;  4OVD A;  3O88 A;  2ZC5 B;  1ESI A;  1PW1 A;  3D4F A;  1K4E A;  4X53 A;  5A90 A;  2X01 A;  5CRF A;  4NK3 A;  3P98 A;  3ZG5 A;  2ZM0 A;  2ZC4 B;  2WKH A;  1K55 C;  2XFT A;  2Y4A A;  4OQH A;  4RVA A;  1MBL A;  2DNS A;  3HBR A;  4C6Y A;  1XGJ A;  3HUO A;  1LI0 A;  1HVB A;  2RCX A;  1CI8 A;  4LV3 A;  3V50 A;  3ZVT A;  1ALQ A;  2WGW A;  1W5D A;  3IF6 C;  3WS4 A;  4OLG A;  3WS1 A;  1WE4 A;  4KZ4 A;  3WRZ A;  2H0Y A;  1E4D A;  3OCN A;  1MWU A;  4HES A;  2JBF A;  1W8Q A;  2ZLY A;  1DY6 A;  3MBZ A;  1SDN A;  4UHU A;  4OQ0 A;  1S6R A;  1LL9 A;  3PBS A;  4S2L A;  5HL1 A;  5HAQ A;  2DRW A;  2H5S A;  4Y0U A;  4IVI A;  3NC8 A;  4S2J A;  1K54 A;  3VMA A;  5FQK A;  1CEG A;  5CED A;  5KSC A;  1ES2 A;  1CEF A;  2ZJ9 A;  3BFC A;  1RP5 A;  1VQQ A;  1YMS A;  2WK0 A;  2UWX A;  3IT9 A;  2EXA A;  4DE0 A;  4XUZ A;  2PU2 A;  5F83 A;  1JWP A;  2ZQ9 A;  2B5R A;  4F94 A;  4OQI A;  4KZB A;  2JC7 A;  2WZZ A;  4MBF A;  5J8X A;  1G68 A;  4D2O A;  2FFY A;  4MEZ A;  1PWC A;  3IWI A;  4OLD A;  4BEN A;  1MY8 A;  4GZB A;  3SH7 A;  4Y7P A;  3ZG7 B;  1RGY A;  1E25 A;  4OPQ A;  1IKI A;  4GDB A;  4ZTK A;  3VSL A;  4C3Q A;  2WUQ A;  4JLF A;  3HLE A;  4KZA A;  3EQU A;  4ID4 A;  4DDY A;  3FKV A;  3A3I A;  1I2W A;  3Q7V B;  4U3T A;  3DWK A;  1O07 A;  3OCL A;  4HBU A;  1K25 A;  5CHM A;  3TG9 A;  3VP1 A;  4E3L A;  4PM9 A;  1MXO A;  4DDS A;  1XA7 A;  4K0X A;  5CTN A;  5FA7 A;  3ZG8 B;  3MXR A;  2J8Y A;  4PMA A;  4S2N A;  5FQQ A;  5A93 A;  4ZAM A;  4OOY A;  1BUL A;  1FR6 A;  2CC1 A;  1QMF A;  4KQR A;  2QPN A;  5U47 A;  4LV1 A;  3TOI A;  1Q2Q A;  5AQB A;  2BLS A;  5HX9 A;  2HDS A;  1K4F A;  3UE1 A;  4DXC A;  3SH9 A;  3N7W A;  4P87 A;  3IWO A;  4E6W A;  1KE4 A;  3FV7 A;  2R9X A;  3Q7V A;  4RX3 A;  3SS3 A;  5FAT A;  4DE3 A;  2V2F F;  4NET A;  1XPB A;  1YMX A;  1H8Y A;  4KZ8 A;  1FCO A;  3C4O A;  1Y54 A;  2Y91 A;  2BG1 A;  2Y2Q A;  1MWT A;  3HLF A;  4KG6 A;  1KDS A;  1WYC A;  3A3D A;  1K57 C;  1K6S A;  4OPZ A;  1GA0 A;  5G18 A;  1I2S A;  3BM6 A;  4GN2 A;  5FQI A;  3ZG0 A;  2C5W B;  5FQJ A;  3IWQ A;  1PZO A;  4BD0 A;  5FQ9 A;  3HLG A;  2Z2M B;  4Y0O A;  4R4S A;  4LCM A;  1L0F A;  1L0E A;  4KZ5 A;  2PU4 A;  1KE3 A;  2XD1 A;  1N9B A;  2WKE A;  2XEP A;  3LCE A;  2XFS A;  3ZG9 B;  5TFQ A;  2WAF A;  1I5Q A;  2ZM8 A;  3GRJ A;  1SDE A;  5GL9 A;  3UO9 A;  2P9V B;  4LEN A;  4EUZ A;  3VFH A;  5EOO A;  1Z6F A;  3HLC A;  2HDU A;  3DTM A;  3HLB A;  4BJP A;  3OZH A;  3ZGA B;  3HUM A;  2IWC A;  3UE3 A;  1YM1 A;  5CEB A;  4OQG A;  4UA7 A;  2XR0 A;  1ES5 A;  1WYB A;  2Q9M A;  3G35 A;  3ITA A;  1PI4 A;  3N4I A;  3MZE A;  3NBL A;  1YLW A;  2V1Z A;  3FYZ A;  1YLJ A;  5EPH A;  4E3K A;  5CGW A;  3UE0 A;  3VP3 A;  4KZ6 A;  3IH9 A;  1NXY A;  3G2Y A;  4QB8 A;  5EVI D;  2ZQ7 A;  4OON A;  5HAR A;  1L0G A;  5JYO A;  3N8S A;  2E8I A;  5FAQ A;  3CG5 A;  1IYS A;  4E3J A;  2HP5 A;  1BZA A;  2WGI A;  4ZJ1 A;  5GLC A;  1ES3 A;  2HPB A;  3MZD A;  4N1H A;  5FI2 A;  2Y2P A;  3O3V A;  2WKI A;  1PZP A;  2QZ6 A;  4X56 A;  2P9V A;  5EVL A;  4IVK A;  5A92 A;  1YQS A;  2OV5 A;  4EWF A;  3VP0 A;  1EWZ A;  3UPN A;  2HDR A;  2R9W A;  1SCW A;  4UA9 A;  1PIO A;  5HFO A;  2HP6 A;  1KDW A;  2XLN A;  4WEJ A;  1K56 D;  2ZM2 A;  4KQQ A;  5FI6 A;  2ZC3 B;  3C5A A;  3UY6 A;  4EQI A;  3OPH A;  4N9K A;  5KMW A;  2A3U A;  3SOI A;  3VP2 A;  1XGI A;  1FSY A;  4QY5 A;  4MLL A;  3EQV A;  1FSW A;  4OKP A;  5EVI C;  5M1A A;  3VOZ A;  1HTZ A;  2VGJ A;  1RGZ A;  3M6B A;  4IED A;  3A3F A;  4WZ5 A;  4U0X A;  5GHZ A;  2OLV A;  4L0L A;  5CHU A;  1GA9 A;  1ZC2 A;  3N6I A;  2RL3 A;  5GLD A;  2X71 A;  4Q8I A;  1NZO A;  2XK1 A;  4S2O A;  4U0T A;  5AQA A;  2WGV A;  3S4X A;  5GHX A;  5A91 A;  5AQ9 A;  1ESU A;  1IYP A;  2Y59 A;  4BQM A;  1FOF A;  1KVM A;  4EBP A;  3V39 A;  5M19 A;  4LV0 A;  5CGS A;  2FFF B;  2ZC6 B;  3LY4 A;  3I7J A;  3O87 A;  3BEC A;  1FCM A;  5CXW A;  1CK3 A;  3HVF A;  4R4R A;  4R23 A;  3M2K A;  5CEC A;  3Q07 A;  4UAA A;  5EE8 A;  4BLM A;  2PBY A;  3V5M A;  1YLT A;  1ERM A;  4X6T A;  3UDF A;  1W8Y A;  1MWS A;  3G31 A;  1W79 A;  3BFG A;  1M40 A;  2ZQA A;  3BLM A;  2Y55 A;  1YT4 A;  1K54 C;  3BLS A;  3DWZ A;  3QHY A;  4E6X A;  4EBN A;  4RA7 A;  2EXB A;  2ZD8 A;  1PWG A;  2VGK A;  5F82 A;  3HLD A;  5DTK A;  4WM9 A;  5HAP A;  3GMW A;  1FCN A;  1K38 A;  4JXW A;  4OOL A;  5FQM A;  4BL3 A;  3V3R A;  3MKF A;  4FSF A;  4H8R A;  4ZBE A;  4GB7 A;  5GHY A;  3PAG A;  1BT5 A;  1XXM A;  5M18 A;  4WBG A;  1H8Z A;  1BLC A;  5EUA A;  4R3B A;  5E2F A;  4OP5 A;  3G32 A;  4JF6 A;  3LEZ A;  1PI5 A;  4PM7 A;  3GV9 A;  3ZVW A;  5D3O A;  3ZNT A;  4JF4 A;  2GDN A;  3G34 A;  1BSG A;  4QJG A;  4QY6 A;  3RXX A;  5E2G A;  1ONG A;  4DF6 A;  2WAD A;  1GHI A;  3VOY A;  3LY3 A;  3PBN A;  2J9O A;  3G4P A;  3IF6 B;  4S2N C;  2JCH A;  3VFF A;  1VM1 A;  1XA1 A;  2I72 A;  3A3E A;  1TEM A;  4FCF A;  4GD6 A;  4WMC D;  3M2J A;  1XP4 A;  3P09 A;  2DCF A;  1N4O A;  1AXB A;  2HP9 A;  3FKW A;  1E3U D;  3IQA A;  4X68 A;  5FAP A;  3GSG A;  3SS4 A;  5TGF A;  4RYE A;  5FAS A;  1S0W A;  3B3X A;  4OPY A;  2XGN A;  5CGX A;  4YFM A;  3GR2 A;  1BTL A;  3BFD A;  3IXD A;  3S1Y A;  4WZ4 A;  1K55 A;  2XD5 A;  1M6K A;  2J7V A;  3OPR A;  3IXB A;  3HUN A;  3VP4 A;  3ZFZ A;  5DF8 A;  3AGD A;  4OOM A;  5CER A;  1DJB A;  5DF7 A;  3IHB A;  4HEF A;  3NCK A;  4QHC A;  5CHJ A;  2WAE A;  4XUX A;  3IHA A;  2EX2 A;  3BRM A;  4R3J A;  3CMZ A;  3IF6 A;  4E3I A;  4GOG A;  4XXR A;  5KZH A;  1DJA A;  3WS5 A;  4CPK A;  3WS0 A;  5DF9 A;  2ZQ8 A;  4OPR A;  3NDG A;  3NI9 A;  3IF5 A;  5FI7 A;  3UDX A;  2H10 A;  1RCJ A;  3UPP A;  4KZ7 A;  4IBX A;  2G2W A;  3WWX A;  2Y2H A;  4QU3 A;  3C4P A;  4JXG A;  5FSR A;  4GKU A;  1XX2 A;  1IEM A;  3BEB A;  1IKG A;  3NY4 A;  5EOE A;  1IYO A;  1NRF A;  2Y2G A;  4PM5 A;  4DKI A;  1SHV A;  3QNB A;  4GDN A;  2IWB A;  3MKE A;  3C7U A;  3FWL A;  1KGE A;  4N9L A;  2EFX A;  2WYX A;  2Y2L A;  4UA6 A;  3W4Q A;  3AGF A;  4B4Z A;  1FR1 A;  1ONH A;  1KVL A;  1K56 A;  4MBK A;  4RX2 A;  1LI9 A;  2QMI A;  2ZC7 A;  4DE1 A;  3G2Z A;  4GNU A;  4M3K A;  5E2E A;  2Y2M A;  3Q82 A;  1CI9 A;  3C7V A;  1BLS A;  3W8K A;  2OLU A;  1C3B A;  5HAI A;  4DRT A;  1J9M A;  4Z9Q A;  1BLH A;  3ITB A;  4DE2 A;  4OH0 A;  4ZJ2 A;  2XDM A;  3A3J A;  4N1X A;  3WS2 A;  2ZQC A;  3IH8 A;  2Y2N A;  3CZD A;  3CJM A;  4A5R A;  5CTM A;  2EX9 A;  3N8L A;  2HDQ A;  3Q1F A;  5IHV A;  4FD8 A;  4JF5 A;  1IEL A;  2XF3 A;  1GHP A;  5HW3 A;  1U60 A;  1Q2P A;  3MXS A;  3GQZ A;  1LHY A;  3E2K A;  3LO7 A;  1L0D A;  3ZDJ A;  1EI5 A;  1YLY A;  5F1F A;  4P85 A;  1DJC A;  1XKZ A;  1NJ4 A;  1ZKJ A;  3PBR A;  3MFD A;  1TVF A;  4JBF A;  2C6W B;  4IBR A;  1YLZ A;  1IYQ A;  1NZU A;  5DTS A;  1PW8 A;  4S2I A;  4JKT A;  4CJN A;  1PWD A;  1LL5 A;  4ZDX A;  2V20 A;  3PBO A;  4R0Q A;  4WZ5 C;  3ZCZ A;  4S2M A;  3W4O A;  4KEN B;  1HD8 A;  1JWZ A;  3Q7Z A;  1GCE A;  1TDG A;  4ZJ3 A;  4QD4 A;  1OME A;  4X55 A;  4FH2 A;  3DW0 A;  1MWR A;  3VSK A;  1K57 A;  1JWV A;  4P6B A;  3ISG A;  1YLP A;  1NYM A;  4KQO A;  4DXB A;  5I94 A;  5DTT A;  1ES4 A;  4B88 A;  3TSG A;  4JXS A;  4MBH A;  5KSH A;  1FQG A;  3HL9 A;  5L2F A;  4PPR A;  1W7F A;  3PAE A;  1GHM A;  3PTE A;  4S2K A;  3PBQ A;  1KE0 A;  2OSU A;  2X02 A;  3BFF A;  3BYD A;  2WZX A;  2A49 A;  3GTC A;  2H0T A;  3QNC A;  4OP8 A;  4YIN A;  1JTG A;  1ZG6 A;  1LLB A;  2Y2I A;  3NIA A;  4WEL A;  1H5X A;  3NDE A;  4KG5 A;  4R1G A;  4N92 A;  1L2S A;  1QME A;  4LV2 A;  3UNW A;  1SKF A;  3W4P A;  1PYY A;  1JTD A;  3HLW A;  5EEC A;  5FAO A;  5BOH A;  2ZMA A;  4EBL A;  2Y2K A;  4S2P A;  1KGF A;  4BD1 A;  2G2U A;  2J9P A;  5GLA A;  4C75 A;  4EV4 A;  2XQZ A;  3RJU A;  3ZHH A;  3Q81 A;  5EVI B;  3IXG A;  2JE5 A;  4K0W A;  4P0M A;  1MKI A;  3MZF A;  4E3M A;  3AGE A;  4KZ9 A;  2Y2J A;  4KZ3 A;  4PM8 A;  1K6R A;  1BUE A;  4WMC A;  3G30 A;  3SH8 A;  4KG2 A;  3JYI A;  3N8R A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...