2ZJ9A

X-ray crystal structure of ampc beta-lactamase (ampc(d)) from an escherichia coli with a tripeptide deletion (gly286 ser287 asp288) on the h10 helix
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
355
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMKTRVFQPLKLNHTWINVPSAEEKNYAWGYREGKAVHVSPRALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDIIINNKIALAARPVKPITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of AmpC beta-lactamase (AmpCD) from an Escherichia coli clinical isolate with a tripeptide deletion (Gly286-Ser287-Asp288) in the H10 helix
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AmpC
total genus 124
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zj9A00
1DJBA 2Y2MA 2R9WA 2XR0A 3PTEA 3ZG5A 2Y91A 5DF9A 3GSGA 3NCKA 3FKVA 5EUAA 5EOEA 5GLAA 3LCEA 2HP9A 3LO7A 4HESA 1YLJA 4P85A 4Y0OA 5E2EA 3ZDJA 4E6XA 5KMWA 4WBGA 3IXHA 4MLLA 2HDQA 3LY3A 3JYIA 3SH9A 3UO9A 3BFFA 4OLGA 2HDUA 1NZOA 4WM9A 3MKFA 3W4OA 1W8YA 3OCNA 3IH8A 3HLWA 5EECA 3E2LA 4KZAA 1FOFA 1KE3A 1K4FA 4PM8A 4N1XA 3Q07A 2BG1A 2JE5A 3I7JA 5FAQA 3FV7A 3ITBA 3W8KA 3NC8A 4Y0UA 4OOMA 3VP3A 3IF6A 5HL1A 5AQ7A 3BRMA 2IWCA 4EBLA 4GOGA 1E3UA 1YLPA 2X01A 3UPPA 4K0XA 1QMEA 1GCEA 1IYPA 1DY6A 2ZM2A 2Y2LA 3HUMA 3PBTA 3Q7VB 3MFDA 4KZ9A 3G32A 4WMCA 4OKPA 5FASA 4R4RA 1K56A 1FSYA 4KQOA 4NK3A 2PBYA 3BLMA 1PWDA 4BL3A 5CEDA 2HPBA 5HAPA 4JBFA 1ERMA 4YFMA 4QY5A 3CZDA 3OPRA 4OP5A 5E2HA 2OLUA 2A49A 1CI9A 3CG5A 3O3VA 5EOOA 4X69A 1PIOA 4PM6A 2WGWB 3BECA 4JXVA 1NXYA 1WE4A 3GV9A 5FAOA 3HREA 1FR1A 4OQGA 4LV2A 4JF5A 3Q82A 2V2FF 1KDSA 3BFEA 4ZDXA 2WK0A 1LHYA 3S4XA 3IF6C 1PWCA 2ZC6B 3QNBA 4KG5A 5CGWA 2ZM0A 2XF3A 1EROA 5M18A 1YT4A 1BTLA 5HAQA 4LV3A 1MWUA 3ZNTA 2Y55A 4HBTA 2B5RA 3B3XA 2PU4A 5EVIC 1IYSA 1OMEA 4RA7A 3C5AA 1KE0A 3N8SA 4N1HA 5KZHA 2ZMAA 5TGFA 3C4OA 3A3EA 5DVAA 4MEZA 4U0TA 3FYZA 4A5RA 2JBFA 3CJMA 5A91A 4JXGA 1HZOA 1AXBA 2Y59A 4FH2A 5L2FA 3E2KA 1W8QA 3NY4A 1E25A 3WWXA 5EVIB 1BLPA 4E3NA 1DJAA 1K6RA 1BULA 3G31A 3IWQA 1BSGA 1H8ZA 1JWZA 1K56D 4OQIA 2Y2HA 4E3KA 5CTNA 4C6YA 4JXSA 4GB7A 4LV0A 2J9PA 2E8IA 5TFQA 2HDRA 4GD6A 2C5WB 1K57C 4GDBA 3VSKA 3VOZA 1XA1A 1SKFA 4FH4A 1K57A 3VFFA 4JXWA 3M2JA 4CJNA 3S1YA 3ZVTA 2XEPA 5FAPA 3A3FA 5F82A 3Q1FA 3AGEA 3N7WA 3NDEA 3Q7ZA 5GLDA 4E3JA 2Q9NA 4ZAMA 1CEGA 3OPLA 3PAEA 4UAAA 2ZJ9A 3IQAA 1L0EA 5CTMA 1MXOA 3DW0A 4PPRA 5FI7A 4FSFA 3NI9A 5A93A 3UDXA 3HLBA 1KGGA 4P0MA 3ZHHA 3NIAA 5A92A 2DNSA 3M6HA 3UDIA 3HLFA 1MKIA 1PZPA 5HARA 3WS1A 4BLMA 1YLYA 2WADA 1CEFA 2X71A 3UE3A 1FCOA 3PBOA 1CI8A 2EX9A 1GHIA 2H10A 1KVMA 2J8YA 4S2KA 5EVIA 3ZG8B 1W79A 4R4SA 1YM1A 5CHMA 3UPOA 3IXGA 4E6WA 3A3IA 5CEBA 1L0DA 4GDNA 1IYOA 2WZZA 1DJCA 3C7UA 3G30A 4DDSA 2G2WA 5FQJA 4S2NA 1MY8A 3DWZA 3MZEA 4N9KA 1EWZA 1QMFA 2QPNA 4KQQA 2QMIA 3A3JA 3OZHA 3MBZA 5HAIA 3N8RA 4N92A 3ZFZA 4OPRA 2H0TA 1K55A 1HTZA 2Y2OA 5GHZA 5E43A 1L0FA 3BLSA 5GLCA 1KVLA 3V39A 5DTKA 1WYCA 2RL3A 4BD1A 2XLNA 4BL2A 1LLBA 3AGDA 2H5SA 3IWOA 4ID4A 2WGVA 3O88A 3LY4A 4N9LA 4B4ZA 1TVFA 1K6SA 2IWDA 2ZQ9A 1PZOA 3UE1A 1XXMA 5FQKA 3WS0A 1XGIA 4QD4A 2Z2MB 3ZCZA 1YLWA 3V3RA 5F1GA 3NBLA 4S2IA 2P9VA 3RJUA 3VMAA 4DE1A 1ERQA 3P09A 3VP1A 2G2UA 4B4XA 4OPQA 2Z2LB 1Q2PA 2P9VB 2VGKA 4KG2A 5DTTA 1NY0A 4WMCD 2P74A 2WZXA 1ONGA 3FWLA 3SH7A 2Q9MA 4QY6A 1J9MA 5D3OA 3SOIA 4DKIA 1HD8A 4LENA 4ZBEA 2ZC3B 4HBUA 2Y4AA 1KE4A 4UHUA 1PW8A 1ZC2A 3S22A 4JKTA 4S2OA 4QJGA 1BLHA 3GQZA 2V1ZA 4R3JA 4E3LA 1E3UD 4S2MA 4WEJA 3ZG7B 1K38A 3BFDA 1SDEA 1YLTA 3UDFA 2ZQCA 3IF6B 4O7DA 4PM9A 3FKWA 4WZ5A 3WS5A 4BENA 4Z9QA 2Y2NA 3UY6A 4GZBA 1MWRA 3PBNA 5EVLA 1NYMA 5GL9A 3M6BA 5CGSA 4MNRA 5FSRA 5KSCA 3BFCA 4ZJ2A 3ZG9B 3VSLA 3PBSA 3W4QA 3BM6A 1YMXA 3GMWA 5FI6A 1ES4A 4KZ4A 4OQHA 1G6AA 5FATA 1YMSA 2V20A 4OPYA 4IBRA 2WGWA 3HLCA 1ESUA 1YLZA 1XP4A 3GTCA 2EXBA 1KGFA 1SCWA 4P6BA 4FD8A 4PM7A 1ESIA 5AQ9A 2XFTA 2ZQ7A 4JF4A 3A3DA 1S0WA 3C4PA 4ZTKA 1JWPA 4R23A 4OLDA 4S2LA 4E3IA 4Y0TA 4EQIA 2ZD8A 4IVIA 3PBRA 3UE0A 1BUEA 4X6TA 4XUZA 2XGNA 5M19A 3IF5A 1M40A 3OPPA 4WYYA 4BD0A 4UA6A 3IHBA 2UWXA 3G2ZA 4OPZA 4S2JA 1E4DA 3V3SA 4DXBA 2XDMA 3IH9A 3P98A 1EI5A 1RGZA 1GHMA 2A3UA 4DDYA 3MZFA 3ZGAB 5EE8A 1RGYA 4M3KA 3IT9A 4U0XA 4MBFA 4X56A 4L0LA 2DCFA 3ZNYA 1GHPA 2HP5A 4UA9A 3DWKA 3Q81A 4K91A 2JC7A 2R9XA 2XD5A 2ZLYA 1WYBA 1BT5A 3VP0A 4DF6A 4Q8IA 3OPHA 3SS3A 3N8LA 3MXSA 5CRFA 4KZ8A 3OC2A 1I2WA 5GHYA 3BFGA 2WYXA 1ZKJA 1MWSA 2ZC4B 4KZ3A 5HX9A 3SS4A 4QHCA 1BLCA 4RYEA 2GDNA 5CXWA 3ISGA 1SDNA 1JTDA 1LL5A 4X53A 3M2KA 2ZQDA 5F1FA 3HL9A 1IKIA 4KQRA 4GKUA 4WZ5C 3V5MA 3CMZA 2VGJA 1NZUA 1ES5A 3OCLA 3HUNA 3N6IA 4PM5A 2Y2QA 4WELA 3VP4A 3BEBA 3G35A 3D4FA 3SS5A 2J9OA 1LI9A 5GHXA 4K0WA 3HLDA 3O87A 1KDWA 3MXRA 2BLSA 5U47A 4S2PA 1IKGA 3IXDA 1JVJA 3HUOA 4LCLA 4RVAA 5CECA 1FCNA 1VM1A 4IEDA 1K54A 2CC1A 5AQBA 4R3BA 3EQUA 3MZDA 5EVID 5IHVA 1YQSA 4MBKA 1O07A 3SH8A 4EBPA 1ES2A 2RCXA 4DXCA 2WKEA 1LI0A 5DTSA 2XD1A 2FFFB 2Y2GA 5CHJA 5AQAA 3RXWA 4QB8A 5HW3A 2Y2JA 4DE0A 4OONA 5CGXA 1MPLA 1HVBA 2WAEA 4OOYA 5E2FA 3MKEA 1FSWA 2H0YA 3NDGA 1K54C 1PW1A 4IBXA 4QU3A 2WKIA 1M6KA 1N9BA 2Y2IA 4LCMA 3WRZA 4E3MA 1FCMA 1K4EA 4EUZA 4ZJ3A 1RCJA 1L2SA 4GNUA 1I2SA 1RP5A 4H8RA 1NYYA 4XXRA 3VP2A 3HBRA 1H8YA 4X55A 4F94A 3EQVA 1ES3A 1I5QA 4KZ7A 2ZC5B 2PU2A 4YINA 5FQIA 2DRWA 4B88A 5I94A 1VQQA 4BJPA 1C3BA 1O7EA 2FFYA 4R1GA 3G34A 3ZVWA 1Q2QA 3HLEA 4JPMA 4LV1A 2I72A 4KZ5A 4C3QA 1ALQA 3IXBA 5FDHA 4Y7PA 3TOIA 1XPBA 1FQGA 2OLVA 4OP8A 3GR2A 2JCHA 3WS2A 4KZ6A 5JYPA 5G18A 1GA9A 2ZC7A 4X68A 2EX2A 4BQMA 3O86A 1BZAA 3HVFA 4FCFA 1SHVA 2XQZA 3VOYA 4WEKA 1PYYA 1FR6A 3G2YA 3UPNA 2X02A 4DE3A 4ZJ1A 1MBLA 1K25A 4EWFA 3ITAA 5FA7A 4HEFA 1W7FA 3WRTA 2HP6A 1LL9A 1K55C 2EX8A 2WUQA 1ZG6A 3IHAA 1GA0A 3QHYA 4KZBA 1S6RA 2C6WB 4DE2A 4DRTA 5FQ9A 3ZG0A 2WKHA 5GLBA 5EPHA 2XFSA 1JTGA 1TDLA 4GN2A 3DTMA 4S2NC 2EXAA 4OH0A 4R0QA 5JYOA 5M1AA 3IWIA 4CPKA 3LEZA 5BOHA 3C7VA 4EV4A 5TR7A 5DF8A 1IEMA 1NJ4A 4PMAA 5FI2A 2OSUA 5E2GA 4GD8A 2EFUA 1PI5A 2WAFA 4RX2A 4OVDA 1MWTA 1TDGA 3HLGA 5CERA 3G4PA 3AGFA 3UNWA 1XX2A 3TG9A 1KGEA 1W5DA 2ZQ8A 4MBHA 4UA7A 4P87A 1XA7A 4OQ0A 1PWGA 1U60A 1H5XA 2ZM8A 4C75A 4D2OA 3FZCA 1L0GA 1PI4A 4XUXA 3WS4A 4E3OA 1BLSA 4KG6A 4U3TA 1ZG4A 1CK3A 1XGJA 1TEMA 2Y2PA 3VFHA 1Y54A 2Y2KA 5J8XA 5DF7A 2EX6A 5FQMA 1JWVA 2J7VA 3RXXA 2IWBA 3V50A 3BYDA 4IVKA 1XKZA 1NRFA 3PAGA 3TSGA 3GVBA 3W4PA 5A90A 1N4OA 1G68A 5CHUA 2QZ6A 2WGIA 2HDSA 2XH9A 4RX3A 4WZ4A 5KSHA 4NETA 4EBNA 4KENB 2XK1A 4JLFA 1IELA 4JF6A 3Q7VA 5FQQA 3PBQA 5HFOA 3QNCA 3GRJA 5F83A 4OOLA 3N4IA 2EFXA 1IYQA 1ONHA 2ZQAA 3UN7A 1Z6FA 2OV5A
chains in the Genus database with same CATH superfamily
4L9GA 1P0ZA 2W3HA 3GSGA 3NCKA 5EUAA 5GLAA 4BBUA 4EEPA 4Y0OA 1Y28A 2O9BA 1TS7A 1VB6A 3UO9A 4HI4A 1NZOA 2KOIA 4WM9A 4FUWA 1W8YA 3IH8A 4CLCC 2J80A 3HLWA 5AVFA 3IS2A 1KE3A 2JE5A 3NC8A 1OTEA 4Y0UA 4OOMA 5HL1A 1VETA 3BRMA 2IWCA 1N9NA 4GOGA 1YLPA 2XA7S 4LRXC 3LIBA 4K0XA 1IYPA 3Q7VB 2ZM2A 2Y2LA 3PBTA 4KZ9A 4WMCA 3G32A 4UQIS 1K56A 4NK3A 4BL3A 4JBFA 4YFMA 5E2HA 2OLUA 3CG5A 5EOOA 4X69A 1T1BA 2WGWB 3BECA 3GV9A 3HREA 2PR6A 4O0PA 4ZDXA 2WK0A 4R3AA 3IF6C 1PWCA 2ZC6B 4KG5A 2ZM0A 1EROA 1BTLA 1MWUA 4HP9A 3ZNTA 3B3XA 2PU4A 5KZHA 1KE0A 3C4OA 3A3EA 4MEZA 3FYZA 2VEAA 1YPRA 3E2KA 1K6RA 1BSGA 2JKRM 5TJJA 1K56D 2Y2HA 3MQ0A 3NJAA 4IJGA 2J9PA 2HDRA 5I5LA 1K57C 3VSKA 1XA1A 3VFFA 4CJNA 2I9VA 2XEPA 3A3FA 1PFLA 3Q7ZA 5GLDA 2Q9NA 1CEGA 4NXEA 3PAEA 4UAAA 1P9RA 3F1OA 1T19A 3DW0A 5FI7A 1TD5A 1S67L 1KGGA 3ZHHA 5MC7A 3NIAA 3M6HA 1MKIA 1LL8A 3WS1A 1YLYA 2DMWA 1GSXA 2EX9A 1GHIA 5EVIA 4HJ6A 4R4SA 4MN6A 3UPOA 3IXGA 5G4YA 4E6WA 3A3IA 1IYOA 3G30A 1V9YA 2G2WA 5FQJA 5HDDA 1EWZA 2QMIA 5C5KA 3T4KA 1LT0A 3ZFZA 4CLCE 1K55A 4P6ZM 3IX4A 5L8MA 2Y2OA 5GHZA 2QHKA 4I3JA 5DTKA 3NHQA 2P08A 2VJWA 2H5SA 3IWOA 3KYZA 1K6SA 5FQKA 3WS0A 5HDSA 2Z2MB 3V3RA 5F1GA 3NBLA 2P9VA 3VMAA 4JGPA 3P09A 3VP1A 2G2UA 4B4XA 4OPQA 1Q2PA 2VGKA 3JVUA 4KG2A 5CX7A 3MR0A 2WZXA 1ONGA 4PKYG 3C2WA 3SOIA 2ZC3B 4HBUA 2Y4AA 2JKRI 3R4KA 4JKTA 4Q0IA 4S2MA 3NULA 2XSSA 2INWA 4CQHA 4I39A 3U4LP 2ZQCA 3IF6B 3FKWA 3PYPA 3T4QA 2KLIA 1J3WA 3GDIA 5GL9A 3PBSA 3W4QA 4WF0A 2VX8A 2PRFA 1G6AA 4IBRA 4P6ZS 1XP4A 3IX3A 4PM7A 3A3DA 1S0WA 4NXBA 4ARZA 3PBRA 4LPZA 4XUZA 2XGNA 2O9CA 3OPPA 4WYYA 4UA6A 4OPZA 4S2JA 4PAUA 3IH9A 2P04A 2A3UA 3ZGAB 3ZNYA 2HP5A 4UA9A 3Q81A 4IUKA 2OAP1 3VP0A 3N8LA 3MXSA 2CMNA 4KZ8A 3B33A 4CLCB 1ZKJA 5EM1A 5CXWA 1SDNA 1JTDA 3M2KA 2ZQDA 3LIFA 4KQRA 3C38A 2VGJA 1P97A 3SZTA 5IS1A 5GHXA 4R38A 1SZVA 3HLDA 3MS6A 3MXRA 1H8MA 4F3LA 1JVJA 4LCLA 2JKFA 4RVAA 1FILA 1K54A 3EQUA 5EVID 1VEUA 4HNBA 4EBPA 1OTDA 5F69A 3UMDA 2FFFB 4QB8A 2QJ7A 3S7PA 4DE0A 1MPLA 1HVBA 4OOYA 5E2FA 3MKEA 1N9BA 3WRZA 4Y17A 1FCMA 4II7A 4H8RA 4XXRA 3HBRA 1ES3A 3D72A 3NOUC 4E04A 4B88A 3DAVA 3LI9A 3G34A 3ZVWA 3HLEA 4JPMA 4KZ5A 3IXBA 5FDHA 3CUEC 3TOIA 2EWWA 2OLVA 1SKOB 2IA2A 1GA9A 2EX2A 3TW8A 4B9OA 2VKSA 3R7WB 4FCFA 1SHVA 2XQZA 1STZA 1PYYA 5HD3A 4ZJ1A 1MBLA 4HEFA 1LL9A 2EX8A 4BLMA 4KZBA 2WKQA 2C6WB 4KQDA 2XFSA 4OH0A 5HL6A 2ZMVA 3C7VA 4HQAA 4PMAA 5FI2A 3MF0A 4Z1WA 3H7WA 1MWTA 1TDGA 3HLGA 4GS9B 2VV8A 3G4PA 2W1TB 4NKPA 4RQ9A 5EVEA 1W63M 3E4OA 4GCZA 1PI4A 4XUXA 3ZQ5A 1XGJA 1JWVA 2J7VA 2IWBA 1D7EA 3TSGA 3GVBA 3W4PA 5A90A 1N4OA 2QZ6A 2XH9A 2O0YA 4RX3A 4EBNA 1IELA 5HPFA 1S66L 3PBQA 2PYRA 5F83A 1ONHA 2ZQAA 3ZDJA 4B93A 1DJBA 4NXFA 3QP1A 3MFXA 3VE4A 4ME4A 1G6OA 3KYQA 4MLLA 3JYIA 3SH9A 2HDUA 3MKFA 3W4OA 5EECA 3E2LA 4KZAA 3T1RA 5EFWA 4JGRA 4PM8A 3Q07A 3I7JA 3W8KA 3IF6A 4R70A 3RH8B 2V9AA 1E3UA 2J3TD 3UPPA 2W3FA 3HUMA 3K3DA 2A24B 1OJGA 4OKPA 3T4LA 4R4RA 4KQOA 4MMNA 4O8GA 1JNUA 3OPRA 4OP5A 1NXYA 4OQGA 4JF5A 3Q82A 2OAQ1 5CGWA 3RTYA 5HAQA 1CQAA 4HBTA 1IOUA 1IYSA 1OMEA 4X1LA 1BYWA 3LI8A 5TGFA 4A5RA 3BQAA 4JXGA 1HZOA 1AXBA 5L2FA 1W8QA 3NY4A 3WWXA 1BLPA 1LSWA 1BULA 3G31A 3IWQA 2ZOHA 3ICYA 5CTNA 4I5SA 2PD8A 1P9WA 3LIDA 1OJ5A 3OOVA 4GD6A 2C5WB 3LFVA 3BWLA 4FH4A 3LGOA 3C8CA 1UGUA 3E0YA 4CLCA 3QP6A 3ZVTA 3A0SA 3Q1FA 4E3JA 4XT2B 3QP5A 4HHDA 4ZAMA 3IBRA 3JVVA 1L0EA 5J4EA 5CTMA 2J3TC 3KO6A 3UDXA 4P0MA 4GHIA 2DNSA 3HLFA 5HARA 2WADA 3EGDC 2H10A 2J8YA 4S2KA 4MN5A 3E98A 5CEBA 3H82A 3C7UA 2WZZA 3P01A 1OTBA 1VEUB 1AWIA 4I3AA 1QMFA 4Y15A 4KQQA 2VZWA 3E4PA 3N8RA 4OPRA 2ZL1B 2H0TA 4PHTA 2PR5A 1KVLA 3V39A 1WYCA 2RL3A 3AGDA 4Y3IA 4ID4A 2WGVA 1S1YA 3LY4A 2QWSA 3T1QB 2IWDA 2ZQ9A 1PZOA 3UE1A 4HIAA 4QD4A 3ZCZA 3KX0X 1ERQA 1W63Q 3NECA 2Z2LB 1NY0A 5DJTA 2P74A 1LSVA 3FWLA 2Q9MA 4QY6A 4DKIA 2YKFA 4ZBEA 3DTIA 3R7WA 1KE4A 1PW8A 3GQZA 4M4XA 4R3JA 4E3LA 2VGLS 3ZG7B 1K38A 1T18A 3UDFA 3WS5A 3TRCA 2Y2NA 3LYXA 4NG2A 5EV0A 3ULFA 5DFXA 5EVLA 1NYMA 3FPVA 1NLYA 4Q0HA 3MMHA 5FSRA 2W0NA 3IBJA 3VSLA 3GMWA 5FI6A 1ES4A 1YMSA 3HLCA 1SCWA 4P6BA 5J7EA 2ZQ7A 1D1JA 2NUPC 4R23A 4YOFA 4S2LA 4Y0TA 3UE0A 3IF5A 1DP9A 3T1XA 3MQOA 2K31A 1F2KA 2W27A 2LB9A 1EI5A 1RGZA 2UV0E 2OWHA 5EE8A 3NOPC 4L0LA 2DCFA 1VETB 4EERA 2OWJA 2VV7A 3E4QA 3CUEA 2KDKA 5GHYA 3BFGA 3OBFA 3ZYTA 4G3VA 4UQIM 3SS4A 3CAXA 2GDNA 3V67A 3ISGA 1IKIA 4GKUA 2W3EA 4HY8A 1NZUA 3OCLA 2FZ0A 3D4FA 3SS5A 2J9OA 4K0WA 3O5YA 2V8CA 1KDWA 1PNEA 2GX5A 1L3LA 2BLSA 3IXDA 3HUOA 5CECA 1FCNA 1PRQA 3LUQA 1YQSA 2RCXA 2FH5A 1LI0A 4O01A 3CLOA 2Y2GA 5CHJA 5TBMA 4R6LA 5HW3A 5CGXA 2WAEA 2B95A 2ZMFA 3NDGA 4IBXA 1PW1A 3T50A 1M6KA 2ZBBA 4E3MA 4QPRA 2V8FA 5HDCA 1L2SA 1RP5A 3F1OB 3VP2A 2PYPA 1H8YA 4HJ3A 4BWIA 4KZ7A 2PU2A 4YINA 2DRWA 4MCWA 5I94A 1K0KA 4BJPA 4LFUA 1C3BA 2FFYA 2D02A 3LEQA 1ALQA 5G4ZA 1XPBA 3GR2A 4KZ6A 3UE6A 5JYPA 5G18A 2ZC7A 4X68A 4BQMA 5HWVA 2Q0OA 2JHEA 1VHMA 3GECA 4WEKA 3G2YA 3UPNA 4DE3A 1K25A 4EWFA 1N9OA 2HP6A 3IHAA 2WUQA 1ZG6A 3ZG0A 2WKHA 1JTGA 4GN2A 3DTMA 3F1NA 3HJIA 5HZHA 2PT7A 5J3WA 3LEZA 5BOHA 4EV4A 5DJUA 1N9LA 1KOUA 1IEMA 2W1TA 5E2GA 4RX2A 4OVDA 4MDZA 1XJ2A 1S4SA 2HZ5A 1W5DA 2XRNA 2ZQ8A 4MBHA 4UA7A 4CLCD 4P87A 3K3CA 4WUJA 2Z6DA 1XJ3A 2ZM8A 3S7NA 3WS4A 1GSVA 1ZG4A 5L07A 3L9KA 2ZL1A 5EM0A 3BYDA 3PAGA 3L7HA 1F9IA 4GW9A 1G68A 3UB8A 2GZAA 2HDSA 3QP4A 4WZ4A 5KSHA 4KENB 4JF6A 3Q7VA 5FQQA 3QNCA 3DTEA 3N4IA 2EFXA 1Z6FA 2OV5A 3QP8A 2R9WA 2XR0A 5IT5A 3ZG5A 2Y91A 5DF9A 3FKVA 3LO7A 4HESA 1YLJA 4P85A 4E6XA 5E2EA 3DBAA 3H9WA 3IXHA 5HPIA 3PR6A 3LY3A 3OLOA 2V1BA 4OLGA 2QYBA 1X0OA 3RFBA 4ARZB 1FOFA 1K4FA 2D01A 3T4JA 5FAQA 3FV7A 3ITBA 2L0WA 1DRMA 2O9AA 3VP3A 4EBLA 4BMWA 2X01A 4KZ3A 1GCEA 1DY6A 3T4OA 1YAXA 3QP2A 5HAPA 5CEDA 3CZDA 2A49A 1CI9A 3O3VA 1PIOA 4PM6A 4JXVA 2HJEA 4LV2A 3CPTB 3QNBA 5M18A 4Y13A 2B5RA 3NOTC 4NXGA 3C5AA 2ZMAA 2JBFA 3CJMA 1ZHHB 1TF1A 5EVIB 3S7OA 1OT6A 1H8ZA 3JPUA 4C6YA 4F3LB 4JXSA 2E8IA 3UB5P 1SKFA 1K57A 4JXWA 2LB5A 3M2JA 3S1YA 3K2NA 4HP4A 5L10A 5F82A 2V0UA 3AGEA 3N7WA 3NDEA 5DKLA 3OPLA 3IQAA 4WN5A 1MXOA 4FSFA 5A92A 1DP8A 3F1PA 4EQ1A 1KVMA 5AVEA 1W79A 3FC7A 5CHMA 1DJCA 4BBVA 1MY8A 3DWZA 3MZEA 2QPNA 1XJ6A 3A3JA 3OZHA 3MBZA 4FOFA 5HAIA 2BTFP 1L0FA 5GLCA 4BD1A 2XLNA 1LLBA 4B4ZA 1TVFA 1NWZA 1YLWA 4S2IA 3RJUA 4DE1A 4KUKA 3G6OA 4NEED 4DJ2A 3SH7A 1J9MA 4LENA 2BASA 2M7UA 4UHUA 1ZC2A 3S22A 4S2OA 1BLHA 2V1ZA 1E3UD 4WEJA 5FEGA 3BFDA 1SDEA 4WZ5A 4PM9A 4O7DA 4Z9QA 3UY6A 2EA9A 1MWRA 3PBNA 3F1NB 1TS0A 4IHQA 5KSCA 4MNRA 3BFCA 4K08A 1YMXA 2B18A 3B42A 4KZ4A 4OQHA 5FATA 1YLZA 4G3WA 2JKGA 2EXBA 4EW7A 2M1CA 5AQ9A 4JF4A 3C4PA 4ZTKA 4OLDA 5F68A 4EQIA 3VOLA 4DJ3A 4X6TA 5M19A 1YSQA 1M40A 3IHBA 2UWXA 4H6JA 1G5UA 4Q0JA 3V3SA 4DXBA 4FTXA 4QWOA 5F5YA 1RGYA 4U0XA 4MBFA 3P7NA 4K91A 4X25A 2R9XA 1CF0A 1WYBA 3UMEA 4YNRA 4DF6A 1IFQA 3OPHA 4Q8IA 3SS3A 5CRFA 3OC2A 2WYXA 5HX9A 4QHCA 1BLCA 3KSIA 4RYEA 4L9FA 4X53A 2W1RA 3HL9A 1ES5A 3HUNA 3N6IA 2Y2QA 2J3WA 3MSHA 3VP4A 1A0KA 3T4TA 3TJZC 3EGXC 5U47A 2K7SA 5AQBA 2CC1A 2OOLA 2HGVA 4LRZE 2NUTC 1O07A 3SH8A 1ODVA 2Y79A 5DTSA 3RXWA 3CPTA 2H0YA 1K54C 4QU3A 2Y2IA 1K4EA 4EUZA 1RCJA 5FDSA 4GNUA 3T4SA 1HLUP 2JKTI 3VV4A 4X55A 4F94A 3A0VA 5FQIA 4PKYA 5L09A 4GHIB 1O7EA 3H7WB 1Q2QA 4HJ4A 4LV1A 2I72A 4C3QA 4Y7PA 2JCHA 3MXQA 2W3GA 4ESPA 3O86A 3HVFA 1G28A 5DKKA 5K5BA 2G7UA 1FR6A 4LRYC 3ITAA 1W7FA 3EWKA 4I38A 4DRTA 1GA0A 1S6RA 5FQ9A 1GSWA 4GJ4A 5EPHA 2M7VA 1MZUA 4EESA 1TDLA 1TS8A 4X1MA 5JYOA 5M1AA 4CPKA 3FG8A 2PD7A 3UB7A 5DF8A 2OSUA 2EFUA 1PI5A 2WAFA 3AGFA 3C30A 3UNWA 2A2LA 3TG9A 1XFQA 1SKOA 1U60A 4C75A 4WLAA 3EEHA 4E3OA 4KG6A 4U3TA 2R78A 1CK3A 3BQ8A 4KUOA 3VFHA 5J8XA 3D3OA 5DF7A 3V50A 5FQMA 3RXXA 1XKZA 1V9ZA 5FL3A 4NETA 1ZTUA 2YKHA 5HFOA 3GRJA 2Y2MA 3PTEA 1F98A 2HJ9C 5EOEA 3LCEA 2HP9A 4JGOA 5KMWA 2GNXA 3MJQA 4UEYA 4WBGA 3KSGA 2HDQA 3LR3A 3BFFA 3OCNA 4Y5FA 1OT9A 4EUVA 4N1XA 2BG1A 2QJ5A 2B02A 3IS2B 4Y2FA 2E8JA 5AQ7A 1QMEA 1UWPX 3MFDA 5HWTA 5FASA 1FSYA 2PBYA 3BLMA 1PWDA 2HPBA 5KIZA 1ERMA 4QY5A 1WE4A 5FAOA 1FR1A 3UB9A 2V2FF 1KDSA 3BFEA 3HCYA 2Y8HA 1LHYA 3S4XA 1CJFA 2XF3A 1YT4A 3LR5A 4LV3A 1F5MA 2Y55A 3S7QA 5EVIC 2WKPA 4RA7A 3N8SA 4N1HA 2ZOIA 5HSQA 5DVAA 4U0TA 2MJ6A 4H6JB 5A91A 4FH2A 2Y59A 4HH2A 1E25A 4E3NA 1DJAA 3PHYA 4OQIA 1JWZA 4E3KA 4GB7A 1EW0A 4LV0A 5TFQA 1S4RA 2PAVP 4GDBA 3VOZA 1LSXA 2EWVA 4JGQA 1MKMA 5FAPA 5AJGA 1OTAA 3U2AA 3LR0A 2ZJ9A 4HOIA 4PPRA 3NI9A 5A93A 2VA0A 1OTIA 3HLBA 5IU1A 4BBTA 1YKDA 2WKRA 3UDIA 1PZPA 1CEFA 2X71A 3UE3A 1FCOA 3PBOA 2HV1A 1CI8A 2O99A 3ZG8B 1YM1A 1L0DA 4GDNA 4G3KA 4DDSA 2VLGA 4S2NA 3LIEA 4N9KA 1YSPA 2QKPA 4N92A 2PDRA 2HF6A 1HTZA 4XT2A 1S1ZA 5E43A 2VK3A 3BLSA 1FIKA 4BL2A 3O88A 4N9LA 4L9EA 1XXMA 4WL9A 1XGIA 1D06A 2H28A 4HH3A 4LGWA 3BY9A 2P9VB 5DTTA 4WMCD 3KYEA 4IUHA 1OPXA 5D3OA 3IX8A 1HD8A 3EEAA 1DP6A 3T12B 2VV6A 4QJGA 1Z09A 1YLTA 4BENA 3UB6A 1NRJA 4GZBA 2AVXA 3M6BA 5CGSA 4ZJ2A 3ZG9B 3BM6A 2V20A 4OPYA 5F6AA 2WGWA 1ESUA 3GTCA 1KGFA 4ETXA 4FD8A 2L4RA 1ESIA 2XFTA 2K2NA 3VE3A 1JWPA 4E3IA 2ZD8A 4IVIA 1BUEA 4BD0A 3G2ZA 1E4DA 2XDMA 2L1MA 3P98A 1GHMA 4DDYA 4EEUA 2A24A 3MZFA 1T1CA 3LICA 4M3KA 3IT9A 4X56A 1GHPA 3DWKA 1UWNX 2JC7A 2KX6A 2XD5A 1WA9A 2ZLYA 3LIAA 1BT5A 3EOIA 4EU0A 4MN7A 1I2WA 1ACFA 1MWSA 2ZC4B 1NLZA 1LL5A 5F1FA 3A0RA 3KSFA 4WZ5C 3V5MA 3CMZA 5DFYA 4PM5A 4WELA 3BEBA 5FEFA 2W3DA 3G35A 1LI9A 4DN0A 1XFNA 3O87A 2PHYA 5LBRA 4EXOA 4S2PA 1IKGA 3BJNA 1TS6A 1VM1A 4IEDA 4R3BA 3MZDA 3B47A 3CITA 5IHVA 4LLOB 4MBKA 1ES2A 3SW1A 4DXCA 2WKEA 2XD1A 5AQAA 2Z6CA 1MC0A 2Y2JA 4OONA 1FSWA 2WKIA 4LCMA 2XROA 3T1SA 4ZJ3A 2V0WA 1I2SA 1NYYA 3PXPA 2PBDP 3EQVA 1I5QA 2ZC5B 1XJ4A 1VQQA 4R1GA 3H82B 3W2ZA 1T1AA 1FQGA 4OP8A 3F1PB 3WS2A 4DMZA 3HJKA 2ACGA 1BZAA 1H3QA 3VOYA 4D60A 4EETB 5TBMB 4AFIA 2X02A 5FA7A 3WRTA 1K55C 3QHYA 3TE8A 2JN7A 4DE2A 1Y4OA 5GLBA 2P7JA 4S2NC 2EXAA 4R0QA 3CWFA 3IWIA 4ETZA 5TR7A 1NJ4A 3CI6A 4I3IA 3KSHA 4GD8A 3CHWP 2VGLM 5HD5A 5CERA 1XX2A 1KGEA 3DTKA 4GS9A 1XA7A 3FPWA 4OQ0A 1PWGA 2XA7M 1H5XA 4ZRRA 4D2OA 3FZCA 1L0GA 1BLSA 2GJ3A 4YWZA 1TEMA 2Y2PA 1Y54A 2Y2KA 2EX6A 3BW6A 3MQQA 4IVKA 2JKTM 1NRFA 4GLQA 3BY8A 5CHUA 2WGIA 5HWWA 2V1AA 2XK1A 4JLFA 1H0MA 4OOLA 1IYQA 3UN7A 3LR4A 3D9YA 5A8BA
chains in the Genus database with same CATH topology
1DJBA 2Y2MA 2R9WA 2XR0A 3PTEA 3ZG5A 2Y91A 5DF9A 3GSGA 3NCKA 3FKVA 5EUAA 5EOEA 5GLAA 3LCEA 2HP9A 3LO7A 4HESA 1YLJA 4P85A 4Y0OA 5E2EA 3ZDJA 4E6XA 5KMWA 4WBGA 3IXHA 4MLLA 2HDQA 3LY3A 3JYIA 3SH9A 3UO9A 3BFFA 4OLGA 2HDUA 1NZOA 4WM9A 3MKFA 3W4OA 1W8YA 3OCNA 3IH8A 3HLWA 5EECA 3E2LA 4KZAA 1FOFA 1KE3A 1K4FA 4PM8A 4N1XA 3Q07A 2BG1A 2JE5A 3I7JA 5FAQA 3FV7A 3ITBA 3W8KA 3NC8A 4Y0UA 4OOMA 3VP3A 3IF6A 5HL1A 5AQ7A 3BRMA 2IWCA 4EBLA 4GOGA 1E3UA 1YLPA 2X01A 3UPPA 4K0XA 1QMEA 1GCEA 1IYPA 1DY6A 2ZM2A 2Y2LA 3HUMA 3PBTA 3Q7VB 3MFDA 4KZ9A 3G32A 4WMCA 4OKPA 5FASA 4R4RA 1K56A 1FSYA 4KQOA 4NK3A 2PBYA 3BLMA 1PWDA 4BL3A 5CEDA 2HPBA 5HAPA 4JBFA 1ERMA 4YFMA 4QY5A 3CZDA 3OPRA 4OP5A 5E2HA 2OLUA 2A49A 1CI9A 3CG5A 3O3VA 5EOOA 4X69A 1PIOA 4PM6A 2WGWB 3BECA 4JXVA 1NXYA 1WE4A 3GV9A 5FAOA 3HREA 1FR1A 4OQGA 4LV2A 4JF5A 3Q82A 2V2FF 1KDSA 3BFEA 4ZDXA 2WK0A 1LHYA 3S4XA 3IF6C 1PWCA 2ZC6B 3QNBA 4KG5A 5CGWA 2ZM0A 2XF3A 1EROA 5M18A 1YT4A 1BTLA 5HAQA 4LV3A 1MWUA 3ZNTA 2Y55A 4HBTA 2B5RA 3B3XA 2PU4A 5EVIC 1IYSA 1OMEA 4RA7A 3C5AA 1KE0A 3N8SA 4N1HA 5KZHA 2ZMAA 5TGFA 3C4OA 3A3EA 5DVAA 4MEZA 4U0TA 3FYZA 4A5RA 2JBFA 3CJMA 5A91A 4JXGA 1HZOA 1AXBA 2Y59A 4FH2A 5L2FA 3E2KA 1W8QA 3NY4A 1E25A 3WWXA 5EVIB 1BLPA 4E3NA 1DJAA 1K6RA 1BULA 3G31A 3IWQA 1BSGA 1H8ZA 1JWZA 1K56D 4OQIA 2Y2HA 4E3KA 5CTNA 4C6YA 4JXSA 4GB7A 4LV0A 2J9PA 2E8IA 5TFQA 2HDRA 4GD6A 2C5WB 1K57C 4GDBA 3VSKA 3VOZA 1XA1A 1SKFA 4FH4A 1K57A 3VFFA 4JXWA 3M2JA 4CJNA 3S1YA 3ZVTA 2XEPA 5FAPA 3A3FA 5F82A 3Q1FA 3AGEA 3N7WA 3NDEA 3Q7ZA 5GLDA 4E3JA 2Q9NA 4ZAMA 1CEGA 3OPLA 3PAEA 4UAAA 2ZJ9A 3IQAA 1L0EA 5CTMA 1MXOA 3DW0A 4PPRA 5FI7A 4FSFA 3NI9A 5A93A 3UDXA 3HLBA 1KGGA 4P0MA 3ZHHA 3NIAA 5A92A 2DNSA 3M6HA 3UDIA 3HLFA 1MKIA 1PZPA 5HARA 3WS1A 4BLMA 1YLYA 2WADA 1CEFA 2X71A 3UE3A 1FCOA 3PBOA 1CI8A 2EX9A 1GHIA 2H10A 1KVMA 2J8YA 4S2KA 5EVIA 3ZG8B 1W79A 4R4SA 1YM1A 5CHMA 3UPOA 3IXGA 4E6WA 3A3IA 5CEBA 1L0DA 4GDNA 1IYOA 2WZZA 1DJCA 3C7UA 3G30A 4DDSA 2G2WA 5FQJA 4S2NA 1MY8A 3DWZA 3MZEA 4N9KA 1EWZA 1QMFA 2QPNA 4KQQA 2QMIA 3A3JA 3OZHA 3MBZA 5HAIA 3N8RA 4N92A 3ZFZA 4OPRA 2H0TA 1K55A 1HTZA 2Y2OA 5GHZA 5E43A 1L0FA 3BLSA 5GLCA 1KVLA 3V39A 5DTKA 1WYCA 2RL3A 4BD1A 2XLNA 4BL2A 1LLBA 3AGDA 2H5SA 3IWOA 4ID4A 2WGVA 3O88A 3LY4A 4N9LA 4B4ZA 1TVFA 1K6SA 2IWDA 2ZQ9A 1PZOA 3UE1A 1XXMA 5FQKA 3WS0A 1XGIA 4QD4A 2Z2MB 3ZCZA 1YLWA 3V3RA 5F1GA 3NBLA 4S2IA 2P9VA 3RJUA 3VMAA 4DE1A 1ERQA 3P09A 3VP1A 2G2UA 4B4XA 4OPQA 2Z2LB 1Q2PA 2P9VB 2VGKA 4KG2A 5DTTA 1NY0A 4WMCD 2P74A 2WZXA 1ONGA 3FWLA 3SH7A 2Q9MA 4QY6A 1J9MA 5D3OA 3SOIA 4DKIA 1HD8A 4LENA 4ZBEA 2ZC3B 4HBUA 2Y4AA 1KE4A 4UHUA 1PW8A 1ZC2A 3S22A 4JKTA 4S2OA 4QJGA 1BLHA 3GQZA 2V1ZA 4R3JA 4E3LA 1E3UD 4S2MA 4WEJA 3ZG7B 1K38A 3BFDA 1SDEA 1YLTA 3UDFA 2ZQCA 3IF6B 4O7DA 4PM9A 3FKWA 4WZ5A 3WS5A 4BENA 4Z9QA 2Y2NA 3UY6A 4GZBA 1MWRA 3PBNA 5EVLA 1NYMA 5GL9A 3M6BA 5CGSA 4MNRA 5FSRA 5KSCA 3BFCA 4ZJ2A 3ZG9B 3VSLA 3PBSA 3W4QA 3BM6A 1YMXA 3GMWA 5FI6A 1ES4A 4KZ4A 4OQHA 1G6AA 5FATA 1YMSA 2V20A 4OPYA 4IBRA 2WGWA 3HLCA 1ESUA 1YLZA 1XP4A 3GTCA 2EXBA 1KGFA 1SCWA 4P6BA 4FD8A 4PM7A 1ESIA 5AQ9A 2XFTA 2ZQ7A 4JF4A 3A3DA 1S0WA 3C4PA 4ZTKA 1JWPA 4R23A 4OLDA 4S2LA 4E3IA 4Y0TA 4EQIA 2ZD8A 4IVIA 3PBRA 3UE0A 1BUEA 4X6TA 4XUZA 2XGNA 5M19A 3IF5A 1M40A 3OPPA 4WYYA 4BD0A 4UA6A 3IHBA 2UWXA 3G2ZA 4OPZA 4S2JA 1E4DA 3V3SA 4DXBA 2XDMA 3IH9A 3P98A 1EI5A 1RGZA 1GHMA 2A3UA 4DDYA 3MZFA 3ZGAB 5EE8A 1RGYA 4M3KA 3IT9A 4U0XA 4MBFA 4X56A 4L0LA 2DCFA 3ZNYA 1GHPA 2HP5A 4UA9A 3DWKA 3Q81A 4K91A 2JC7A 2R9XA 2XD5A 2ZLYA 1WYBA 1BT5A 3VP0A 4DF6A 4Q8IA 3OPHA 3SS3A 3N8LA 3MXSA 5CRFA 4KZ8A 3OC2A 1I2WA 5GHYA 3BFGA 2WYXA 1ZKJA 1MWSA 2ZC4B 4KZ3A 5HX9A 3SS4A 4QHCA 1BLCA 4RYEA 2GDNA 5CXWA 3ISGA 1SDNA 1JTDA 1LL5A 4X53A 3M2KA 2ZQDA 5F1FA 3HL9A 1IKIA 4KQRA 4GKUA 4WZ5C 3V5MA 3CMZA 2VGJA 1NZUA 1ES5A 3OCLA 3HUNA 3N6IA 4PM5A 2Y2QA 4WELA 3VP4A 3BEBA 3G35A 3D4FA 3SS5A 2J9OA 1LI9A 5GHXA 4K0WA 3HLDA 3O87A 1KDWA 3MXRA 2BLSA 5U47A 4S2PA 1IKGA 3IXDA 1JVJA 3HUOA 4LCLA 4RVAA 5CECA 1FCNA 1VM1A 4IEDA 1K54A 2CC1A 5AQBA 4R3BA 3EQUA 3MZDA 5EVID 5IHVA 1YQSA 4MBKA 1O07A 3SH8A 4EBPA 1ES2A 2RCXA 4DXCA 2WKEA 1LI0A 5DTSA 2XD1A 2FFFB 2Y2GA 5CHJA 5AQAA 3RXWA 4QB8A 5HW3A 2Y2JA 4DE0A 4OONA 5CGXA 1MPLA 1HVBA 2WAEA 4OOYA 5E2FA 3MKEA 1FSWA 2H0YA 3NDGA 1K54C 1PW1A 4IBXA 4QU3A 2WKIA 1M6KA 1N9BA 2Y2IA 4LCMA 3WRZA 4E3MA 1FCMA 1K4EA 4EUZA 4ZJ3A 1RCJA 1L2SA 4GNUA 1I2SA 1RP5A 4H8RA 1NYYA 4XXRA 3VP2A 3HBRA 1H8YA 4X55A 4F94A 3EQVA 1ES3A 1I5QA 4KZ7A 2ZC5B 2PU2A 4YINA 5FQIA 2DRWA 4B88A 5I94A 1VQQA 4BJPA 1C3BA 1O7EA 2FFYA 4R1GA 3G34A 3ZVWA 1Q2QA 3HLEA 4JPMA 4LV1A 2I72A 4KZ5A 4C3QA 1ALQA 3IXBA 5FDHA 4Y7PA 3TOIA 1XPBA 1FQGA 2OLVA 4OP8A 3GR2A 2JCHA 3WS2A 4KZ6A 5JYPA 5G18A 1GA9A 2ZC7A 4X68A 2EX2A 4BQMA 3O86A 1BZAA 3HVFA 4FCFA 1SHVA 2XQZA 3VOYA 4WEKA 1PYYA 1FR6A 3G2YA 3UPNA 2X02A 4DE3A 4ZJ1A 1MBLA 1K25A 4EWFA 3ITAA 5FA7A 4HEFA 1W7FA 3WRTA 2HP6A 1LL9A 1K55C 2EX8A 2WUQA 1ZG6A 3IHAA 1GA0A 3QHYA 4KZBA 1S6RA 2C6WB 4DE2A 4DRTA 5FQ9A 3ZG0A 2WKHA 5GLBA 5EPHA 2XFSA 1JTGA 1TDLA 4GN2A 3DTMA 4S2NC 2EXAA 4OH0A 4R0QA 5JYOA 5M1AA 3IWIA 4CPKA 3LEZA 5BOHA 3C7VA 4EV4A 5TR7A 5DF8A 1IEMA 1NJ4A 4PMAA 5FI2A 2OSUA 5E2GA 4GD8A 2EFUA 1PI5A 2WAFA 4RX2A 4OVDA 1MWTA 1TDGA 3HLGA 5CERA 3G4PA 3AGFA 3UNWA 1XX2A 3TG9A 1KGEA 1W5DA 2ZQ8A 4MBHA 4UA7A 4P87A 1XA7A 4OQ0A 1PWGA 1U60A 1H5XA 2ZM8A 4C75A 4D2OA 3FZCA 1L0GA 1PI4A 4XUXA 3WS4A 4E3OA 1BLSA 4KG6A 4U3TA 1ZG4A 1CK3A 1XGJA 1TEMA 2Y2PA 3VFHA 1Y54A 2Y2KA 5J8XA 5DF7A 2EX6A 5FQMA 1JWVA 2J7VA 3RXXA 2IWBA 3V50A 3BYDA 4IVKA 1XKZA 1NRFA 3PAGA 3TSGA 3GVBA 3W4PA 5A90A 1N4OA 1G68A 5CHUA 2QZ6A 2WGIA 2HDSA 2XH9A 4RX3A 4WZ4A 5KSHA 4NETA 4EBNA 4KENB 2XK1A 4JLFA 1IELA 4JF6A 3Q7VA 5FQQA 3PBQA 5HFOA 3QNCA 3GRJA 5F83A 4OOLA 3N4IA 2EFXA 1IYQA 1ONHA 2ZQAA 3UN7A 1Z6FA 2OV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJB A;  2Y2M A;  2R9W A;  2XR0 A;  3PTE A;  3ZG5 A;  2Y91 A;  5DF9 A;  3GSG A;  3NCK A;  3FKV A;  5EUA A;  5EOE A;  5GLA A;  3LCE A;  2HP9 A;  3LO7 A;  4HES A;  1YLJ A;  4P85 A;  4Y0O A;  5E2E A;  3ZDJ A;  4E6X A;  5KMW A;  4WBG A;  3IXH A;  4MLL A;  2HDQ A;  3LY3 A;  3JYI A;  3SH9 A;  3UO9 A;  3BFF A;  4OLG A;  2HDU A;  1NZO A;  4WM9 A;  3MKF A;  3W4O A;  1W8Y A;  3OCN A;  3IH8 A;  3HLW A;  5EEC A;  3E2L A;  4KZA A;  1FOF A;  1KE3 A;  1K4F A;  4PM8 A;  4N1X A;  3Q07 A;  2BG1 A;  2JE5 A;  3I7J A;  5FAQ A;  3FV7 A;  3ITB A;  3W8K A;  3NC8 A;  4Y0U A;  4OOM A;  3VP3 A;  3IF6 A;  5HL1 A;  5AQ7 A;  3BRM A;  2IWC A;  4EBL A;  4GOG A;  1E3U A;  1YLP A;  2X01 A;  3UPP A;  4K0X A;  1QME A;  1GCE A;  1IYP A;  1DY6 A;  2ZM2 A;  2Y2L A;  3HUM A;  3PBT A;  3Q7V B;  3MFD A;  4KZ9 A;  3G32 A;  4WMC A;  4OKP A;  5FAS A;  4R4R A;  1K56 A;  1FSY A;  4KQO A;  4NK3 A;  2PBY A;  3BLM A;  1PWD A;  4BL3 A;  5CED A;  2HPB A;  5HAP A;  4JBF A;  1ERM A;  4YFM A;  4QY5 A;  3CZD A;  3OPR A;  4OP5 A;  5E2H A;  2OLU A;  2A49 A;  1CI9 A;  3CG5 A;  3O3V A;  5EOO A;  4X69 A;  1PIO A;  4PM6 A;  2WGW B;  3BEC A;  4JXV A;  1NXY A;  1WE4 A;  3GV9 A;  5FAO A;  3HRE A;  1FR1 A;  4OQG A;  4LV2 A;  4JF5 A;  3Q82 A;  2V2F F;  1KDS A;  3BFE A;  4ZDX A;  2WK0 A;  1LHY A;  3S4X A;  3IF6 C;  1PWC A;  2ZC6 B;  3QNB A;  4KG5 A;  5CGW A;  2ZM0 A;  2XF3 A;  1ERO A;  5M18 A;  1YT4 A;  1BTL A;  5HAQ A;  4LV3 A;  1MWU A;  3ZNT A;  2Y55 A;  4HBT A;  2B5R A;  3B3X A;  2PU4 A;  5EVI C;  1IYS A;  1OME A;  4RA7 A;  3C5A A;  1KE0 A;  3N8S A;  4N1H A;  5KZH A;  2ZMA A;  5TGF A;  3C4O A;  3A3E A;  5DVA A;  4MEZ A;  4U0T A;  3FYZ A;  4A5R A;  2JBF A;  3CJM A;  5A91 A;  4JXG A;  1HZO A;  1AXB A;  2Y59 A;  4FH2 A;  5L2F A;  3E2K A;  1W8Q A;  3NY4 A;  1E25 A;  3WWX A;  5EVI B;  1BLP A;  4E3N A;  1DJA A;  1K6R A;  1BUL A;  3G31 A;  3IWQ A;  1BSG A;  1H8Z A;  1JWZ A;  1K56 D;  4OQI A;  2Y2H A;  4E3K A;  5CTN A;  4C6Y A;  4JXS A;  4GB7 A;  4LV0 A;  2J9P A;  2E8I A;  5TFQ A;  2HDR A;  4GD6 A;  2C5W B;  1K57 C;  4GDB A;  3VSK A;  3VOZ A;  1XA1 A;  1SKF A;  4FH4 A;  1K57 A;  3VFF A;  4JXW A;  3M2J A;  4CJN A;  3S1Y A;  3ZVT A;  2XEP A;  5FAP A;  3A3F A;  5F82 A;  3Q1F A;  3AGE A;  3N7W A;  3NDE A;  3Q7Z A;  5GLD A;  4E3J A;  2Q9N A;  4ZAM A;  1CEG A;  3OPL A;  3PAE A;  4UAA A;  2ZJ9 A;  3IQA A;  1L0E A;  5CTM A;  1MXO A;  3DW0 A;  4PPR A;  5FI7 A;  4FSF A;  3NI9 A;  5A93 A;  3UDX A;  3HLB A;  1KGG A;  4P0M A;  3ZHH A;  3NIA A;  5A92 A;  2DNS A;  3M6H A;  3UDI A;  3HLF A;  1MKI A;  1PZP A;  5HAR A;  3WS1 A;  4BLM A;  1YLY A;  2WAD A;  1CEF A;  2X71 A;  3UE3 A;  1FCO A;  3PBO A;  1CI8 A;  2EX9 A;  1GHI A;  2H10 A;  1KVM A;  2J8Y A;  4S2K A;  5EVI A;  3ZG8 B;  1W79 A;  4R4S A;  1YM1 A;  5CHM A;  3UPO A;  3IXG A;  4E6W A;  3A3I A;  5CEB A;  1L0D A;  4GDN A;  1IYO A;  2WZZ A;  1DJC A;  3C7U A;  3G30 A;  4DDS A;  2G2W A;  5FQJ A;  4S2N A;  1MY8 A;  3DWZ A;  3MZE A;  4N9K A;  1EWZ A;  1QMF A;  2QPN A;  4KQQ A;  2QMI A;  3A3J A;  3OZH A;  3MBZ A;  5HAI A;  3N8R A;  4N92 A;  3ZFZ A;  4OPR A;  2H0T A;  1K55 A;  1HTZ A;  2Y2O A;  5GHZ A;  5E43 A;  1L0F A;  3BLS A;  5GLC A;  1KVL A;  3V39 A;  5DTK A;  1WYC A;  2RL3 A;  4BD1 A;  2XLN A;  4BL2 A;  1LLB A;  3AGD A;  2H5S A;  3IWO A;  4ID4 A;  2WGV A;  3O88 A;  3LY4 A;  4N9L A;  4B4Z A;  1TVF A;  1K6S A;  2IWD A;  2ZQ9 A;  1PZO A;  3UE1 A;  1XXM A;  5FQK A;  3WS0 A;  1XGI A;  4QD4 A;  2Z2M B;  3ZCZ A;  1YLW A;  3V3R A;  5F1G A;  3NBL A;  4S2I A;  2P9V A;  3RJU A;  3VMA A;  4DE1 A;  1ERQ A;  3P09 A;  3VP1 A;  2G2U A;  4B4X A;  4OPQ A;  2Z2L B;  1Q2P A;  2P9V B;  2VGK A;  4KG2 A;  5DTT A;  1NY0 A;  4WMC D;  2P74 A;  2WZX A;  1ONG A;  3FWL A;  3SH7 A;  2Q9M A;  4QY6 A;  1J9M A;  5D3O A;  3SOI A;  4DKI A;  1HD8 A;  4LEN A;  4ZBE A;  2ZC3 B;  4HBU A;  2Y4A A;  1KE4 A;  4UHU A;  1PW8 A;  1ZC2 A;  3S22 A;  4JKT A;  4S2O A;  4QJG A;  1BLH A;  3GQZ A;  2V1Z A;  4R3J A;  4E3L A;  1E3U D;  4S2M A;  4WEJ A;  3ZG7 B;  1K38 A;  3BFD A;  1SDE A;  1YLT A;  3UDF A;  2ZQC A;  3IF6 B;  4O7D A;  4PM9 A;  3FKW A;  4WZ5 A;  3WS5 A;  4BEN A;  4Z9Q A;  2Y2N A;  3UY6 A;  4GZB A;  1MWR A;  3PBN A;  5EVL A;  1NYM A;  5GL9 A;  3M6B A;  5CGS A;  4MNR A;  5FSR A;  5KSC A;  3BFC A;  4ZJ2 A;  3ZG9 B;  3VSL A;  3PBS A;  3W4Q A;  3BM6 A;  1YMX A;  3GMW A;  5FI6 A;  1ES4 A;  4KZ4 A;  4OQH A;  1G6A A;  5FAT A;  1YMS A;  2V20 A;  4OPY A;  4IBR A;  2WGW A;  3HLC A;  1ESU A;  1YLZ A;  1XP4 A;  3GTC A;  2EXB A;  1KGF A;  1SCW A;  4P6B A;  4FD8 A;  4PM7 A;  1ESI A;  5AQ9 A;  2XFT A;  2ZQ7 A;  4JF4 A;  3A3D A;  1S0W A;  3C4P A;  4ZTK A;  1JWP A;  4R23 A;  4OLD A;  4S2L A;  4E3I A;  4Y0T A;  4EQI A;  2ZD8 A;  4IVI A;  3PBR A;  3UE0 A;  1BUE A;  4X6T A;  4XUZ A;  2XGN A;  5M19 A;  3IF5 A;  1M40 A;  3OPP A;  4WYY A;  4BD0 A;  4UA6 A;  3IHB A;  2UWX A;  3G2Z A;  4OPZ A;  4S2J A;  1E4D A;  3V3S A;  4DXB A;  2XDM A;  3IH9 A;  3P98 A;  1EI5 A;  1RGZ A;  1GHM A;  2A3U A;  4DDY A;  3MZF A;  3ZGA B;  5EE8 A;  1RGY A;  4M3K A;  3IT9 A;  4U0X A;  4MBF A;  4X56 A;  4L0L A;  2DCF A;  3ZNY A;  1GHP A;  2HP5 A;  4UA9 A;  3DWK A;  3Q81 A;  4K91 A;  2JC7 A;  2R9X A;  2XD5 A;  2ZLY A;  1WYB A;  1BT5 A;  3VP0 A;  4DF6 A;  4Q8I A;  3OPH A;  3SS3 A;  3N8L A;  3MXS A;  5CRF A;  4KZ8 A;  3OC2 A;  1I2W A;  5GHY A;  3BFG A;  2WYX A;  1ZKJ A;  1MWS A;  2ZC4 B;  4KZ3 A;  5HX9 A;  3SS4 A;  4QHC A;  1BLC A;  4RYE A;  2GDN A;  5CXW A;  3ISG A;  1SDN A;  1JTD A;  1LL5 A;  4X53 A;  3M2K A;  2ZQD A;  5F1F A;  3HL9 A;  1IKI A;  4KQR A;  4GKU A;  4WZ5 C;  3V5M A;  3CMZ A;  2VGJ A;  1NZU A;  1ES5 A;  3OCL A;  3HUN A;  3N6I A;  4PM5 A;  2Y2Q A;  4WEL A;  3VP4 A;  3BEB A;  3G35 A;  3D4F A;  3SS5 A;  2J9O A;  1LI9 A;  5GHX A;  4K0W A;  3HLD A;  3O87 A;  1KDW A;  3MXR A;  2BLS A;  5U47 A;  4S2P A;  1IKG A;  3IXD A;  1JVJ A;  3HUO A;  4LCL A;  4RVA A;  5CEC A;  1FCN A;  1VM1 A;  4IED A;  1K54 A;  2CC1 A;  5AQB A;  4R3B A;  3EQU A;  3MZD A;  5EVI D;  5IHV A;  1YQS A;  4MBK A;  1O07 A;  3SH8 A;  4EBP A;  1ES2 A;  2RCX A;  4DXC A;  2WKE A;  1LI0 A;  5DTS A;  2XD1 A;  2FFF B;  2Y2G A;  5CHJ A;  5AQA A;  3RXW A;  4QB8 A;  5HW3 A;  2Y2J A;  4DE0 A;  4OON A;  5CGX A;  1MPL A;  1HVB A;  2WAE A;  4OOY A;  5E2F A;  3MKE A;  1FSW A;  2H0Y A;  3NDG A;  1K54 C;  1PW1 A;  4IBX A;  4QU3 A;  2WKI A;  1M6K A;  1N9B A;  2Y2I A;  4LCM A;  3WRZ A;  4E3M A;  1FCM A;  1K4E A;  4EUZ A;  4ZJ3 A;  1RCJ A;  1L2S A;  4GNU A;  1I2S A;  1RP5 A;  4H8R A;  1NYY A;  4XXR A;  3VP2 A;  3HBR A;  1H8Y A;  4X55 A;  4F94 A;  3EQV A;  1ES3 A;  1I5Q A;  4KZ7 A;  2ZC5 B;  2PU2 A;  4YIN A;  5FQI A;  2DRW A;  4B88 A;  5I94 A;  1VQQ A;  4BJP A;  1C3B A;  1O7E A;  2FFY A;  4R1G A;  3G34 A;  3ZVW A;  1Q2Q A;  3HLE A;  4JPM A;  4LV1 A;  2I72 A;  4KZ5 A;  4C3Q A;  1ALQ A;  3IXB A;  5FDH A;  4Y7P A;  3TOI A;  1XPB A;  1FQG A;  2OLV A;  4OP8 A;  3GR2 A;  2JCH A;  3WS2 A;  4KZ6 A;  5JYP A;  5G18 A;  1GA9 A;  2ZC7 A;  4X68 A;  2EX2 A;  4BQM A;  3O86 A;  1BZA A;  3HVF A;  4FCF A;  1SHV A;  2XQZ A;  3VOY A;  4WEK A;  1PYY A;  1FR6 A;  3G2Y A;  3UPN A;  2X02 A;  4DE3 A;  4ZJ1 A;  1MBL A;  1K25 A;  4EWF A;  3ITA A;  5FA7 A;  4HEF A;  1W7F A;  3WRT A;  2HP6 A;  1LL9 A;  1K55 C;  2EX8 A;  2WUQ A;  1ZG6 A;  3IHA A;  1GA0 A;  3QHY A;  4KZB A;  1S6R A;  2C6W B;  4DE2 A;  4DRT A;  5FQ9 A;  3ZG0 A;  2WKH A;  5GLB A;  5EPH A;  2XFS A;  1JTG A;  1TDL A;  4GN2 A;  3DTM A;  4S2N C;  2EXA A;  4OH0 A;  4R0Q A;  5JYO A;  5M1A A;  3IWI A;  4CPK A;  3LEZ A;  5BOH A;  3C7V A;  4EV4 A;  5TR7 A;  5DF8 A;  1IEM A;  1NJ4 A;  4PMA A;  5FI2 A;  2OSU A;  5E2G A;  4GD8 A;  2EFU A;  1PI5 A;  2WAF A;  4RX2 A;  4OVD A;  1MWT A;  1TDG A;  3HLG A;  5CER A;  3G4P A;  3AGF A;  3UNW A;  1XX2 A;  3TG9 A;  1KGE A;  1W5D A;  2ZQ8 A;  4MBH A;  4UA7 A;  4P87 A;  1XA7 A;  4OQ0 A;  1PWG A;  1U60 A;  1H5X A;  2ZM8 A;  4C75 A;  4D2O A;  3FZC A;  1L0G A;  1PI4 A;  4XUX A;  3WS4 A;  4E3O A;  1BLS A;  4KG6 A;  4U3T A;  1ZG4 A;  1CK3 A;  1XGJ A;  1TEM A;  2Y2P A;  3VFH A;  1Y54 A;  2Y2K A;  5J8X A;  5DF7 A;  2EX6 A;  5FQM A;  1JWV A;  2J7V A;  3RXX A;  2IWB A;  3V50 A;  3BYD A;  4IVK A;  1XKZ A;  1NRF A;  3PAG A;  3TSG A;  3GVB A;  3W4P A;  5A90 A;  1N4O A;  1G68 A;  5CHU A;  2QZ6 A;  2WGI A;  2HDS A;  2XH9 A;  4RX3 A;  4WZ4 A;  5KSH A;  4NET A;  4EBN A;  4KEN B;  2XK1 A;  4JLF A;  1IEL A;  4JF6 A;  3Q7V A;  5FQQ A;  3PBQ A;  5HFO A;  3QNC A;  3GRJ A;  5F83 A;  4OOL A;  3N4I A;  2EFX A;  1IYQ A;  1ONH A;  2ZQA A;  3UN7 A;  1Z6F A;  2OV5 A; 
#chains in the Genus database with same CATH topology
 4L9G A;  1P0Z A;  2W3H A;  3GSG A;  3NCK A;  5EUA A;  5GLA A;  4BBU A;  4EEP A;  4Y0O A;  1Y28 A;  2O9B A;  1TS7 A;  1VB6 A;  3UO9 A;  4HI4 A;  1NZO A;  2KOI A;  4WM9 A;  4FUW A;  1W8Y A;  3IH8 A;  4CLC C;  2J80 A;  3HLW A;  5AVF A;  3IS2 A;  1KE3 A;  2JE5 A;  3NC8 A;  1OTE A;  4Y0U A;  4OOM A;  5HL1 A;  1VET A;  3BRM A;  2IWC A;  1N9N A;  4GOG A;  1YLP A;  2XA7 S;  4LRX C;  3LIB A;  4K0X A;  1IYP A;  3Q7V B;  2ZM2 A;  2Y2L A;  3PBT A;  4KZ9 A;  4WMC A;  3G32 A;  4UQI S;  1K56 A;  4NK3 A;  4BL3 A;  4JBF A;  4YFM A;  5E2H A;  2OLU A;  3CG5 A;  5EOO A;  4X69 A;  1T1B A;  2WGW B;  3BEC A;  3GV9 A;  3HRE A;  2PR6 A;  4O0P A;  4ZDX A;  2WK0 A;  4R3A A;  3IF6 C;  1PWC A;  2ZC6 B;  4KG5 A;  2ZM0 A;  1ERO A;  1BTL A;  1MWU A;  4HP9 A;  3ZNT A;  3B3X A;  2PU4 A;  5KZH A;  1KE0 A;  3C4O A;  3A3E A;  4MEZ A;  3FYZ A;  2VEA A;  1YPR A;  3E2K A;  1K6R A;  1BSG A;  2JKR M;  5TJJ A;  1K56 D;  2Y2H A;  3MQ0 A;  3NJA A;  4IJG A;  2J9P A;  2HDR A;  5I5L A;  1K57 C;  3VSK A;  1XA1 A;  3VFF A;  4CJN A;  2I9V A;  2XEP A;  3A3F A;  1PFL A;  3Q7Z A;  5GLD A;  2Q9N A;  1CEG A;  4NXE A;  3PAE A;  4UAA A;  1P9R A;  3F1O A;  1T19 A;  3DW0 A;  5FI7 A;  1TD5 A;  1S67 L;  1KGG A;  3ZHH A;  5MC7 A;  3NIA A;  3M6H A;  1MKI A;  1LL8 A;  3WS1 A;  1YLY A;  2DMW A;  1GSX A;  2EX9 A;  1GHI A;  5EVI A;  4HJ6 A;  4R4S A;  4MN6 A;  3UPO A;  3IXG A;  5G4Y A;  4E6W A;  3A3I A;  1IYO A;  3G30 A;  1V9Y A;  2G2W A;  5FQJ A;  5HDD A;  1EWZ A;  2QMI A;  5C5K A;  3T4K A;  1LT0 A;  3ZFZ A;  4CLC E;  1K55 A;  4P6Z M;  3IX4 A;  5L8M A;  2Y2O A;  5GHZ A;  2QHK A;  4I3J A;  5DTK A;  3NHQ A;  2P08 A;  2VJW A;  2H5S A;  3IWO A;  3KYZ A;  1K6S A;  5FQK A;  3WS0 A;  5HDS A;  2Z2M B;  3V3R A;  5F1G A;  3NBL A;  2P9V A;  3VMA A;  4JGP A;  3P09 A;  3VP1 A;  2G2U A;  4B4X A;  4OPQ A;  1Q2P A;  2VGK A;  3JVU A;  4KG2 A;  5CX7 A;  3MR0 A;  2WZX A;  1ONG A;  4PKY G;  3C2W A;  3SOI A;  2ZC3 B;  4HBU A;  2Y4A A;  2JKR I;  3R4K A;  4JKT A;  4Q0I A;  4S2M A;  3NUL A;  2XSS A;  2INW A;  4CQH A;  4I39 A;  3U4L P;  2ZQC A;  3IF6 B;  3FKW A;  3PYP A;  3T4Q A;  2KLI A;  1J3W A;  3GDI A;  5GL9 A;  3PBS A;  3W4Q A;  4WF0 A;  2VX8 A;  2PRF A;  1G6A A;  4IBR A;  4P6Z S;  1XP4 A;  3IX3 A;  4PM7 A;  3A3D A;  1S0W A;  4NXB A;  4ARZ A;  3PBR A;  4LPZ A;  4XUZ A;  2XGN A;  2O9C A;  3OPP A;  4WYY A;  4UA6 A;  4OPZ A;  4S2J A;  4PAU A;  3IH9 A;  2P04 A;  2A3U A;  3ZGA B;  3ZNY A;  2HP5 A;  4UA9 A;  3Q81 A;  4IUK A;  2OAP 1;  3VP0 A;  3N8L A;  3MXS A;  2CMN A;  4KZ8 A;  3B33 A;  4CLC B;  1ZKJ A;  5EM1 A;  5CXW A;  1SDN A;  1JTD A;  3M2K A;  2ZQD A;  3LIF A;  4KQR A;  3C38 A;  2VGJ A;  1P97 A;  3SZT A;  5IS1 A;  5GHX A;  4R38 A;  1SZV A;  3HLD A;  3MS6 A;  3MXR A;  1H8M A;  4F3L A;  1JVJ A;  4LCL A;  2JKF A;  4RVA A;  1FIL A;  1K54 A;  3EQU A;  5EVI D;  1VEU A;  4HNB A;  4EBP A;  1OTD A;  5F69 A;  3UMD A;  2FFF B;  4QB8 A;  2QJ7 A;  3S7P A;  4DE0 A;  1MPL A;  1HVB A;  4OOY A;  5E2F A;  3MKE A;  1N9B A;  3WRZ A;  4Y17 A;  1FCM A;  4II7 A;  4H8R A;  4XXR A;  3HBR A;  1ES3 A;  3D72 A;  3NOU C;  4E04 A;  4B88 A;  3DAV A;  3LI9 A;  3G34 A;  3ZVW A;  3HLE A;  4JPM A;  4KZ5 A;  3IXB A;  5FDH A;  3CUE C;  3TOI A;  2EWW A;  2OLV A;  1SKO B;  2IA2 A;  1GA9 A;  2EX2 A;  3TW8 A;  4B9O A;  2VKS A;  3R7W B;  4FCF A;  1SHV A;  2XQZ A;  1STZ A;  1PYY A;  5HD3 A;  4ZJ1 A;  1MBL A;  4HEF A;  1LL9 A;  2EX8 A;  4BLM A;  4KZB A;  2WKQ A;  2C6W B;  4KQD A;  2XFS A;  4OH0 A;  5HL6 A;  2ZMV A;  3C7V A;  4HQA A;  4PMA A;  5FI2 A;  3MF0 A;  4Z1W A;  3H7W A;  1MWT A;  1TDG A;  3HLG A;  4GS9 B;  2VV8 A;  3G4P A;  2W1T B;  4NKP A;  4RQ9 A;  5EVE A;  1W63 M;  3E4O A;  4GCZ A;  1PI4 A;  4XUX A;  3ZQ5 A;  1XGJ A;  1JWV A;  2J7V A;  2IWB A;  1D7E A;  3TSG A;  3GVB A;  3W4P A;  5A90 A;  1N4O A;  2QZ6 A;  2XH9 A;  2O0Y A;  4RX3 A;  4EBN A;  1IEL A;  5HPF A;  1S66 L;  3PBQ A;  2PYR A;  5F83 A;  1ONH A;  2ZQA A;  3ZDJ A;  4B93 A;  1DJB A;  4NXF A;  3QP1 A;  3MFX A;  3VE4 A;  4ME4 A;  1G6O A;  3KYQ A;  4MLL A;  3JYI A;  3SH9 A;  2HDU A;  3MKF A;  3W4O A;  5EEC A;  3E2L A;  4KZA A;  3T1R A;  5EFW A;  4JGR A;  4PM8 A;  3Q07 A;  3I7J A;  3W8K A;  3IF6 A;  4R70 A;  3RH8 B;  2V9A A;  1E3U A;  2J3T D;  3UPP A;  2W3F A;  3HUM A;  3K3D A;  2A24 B;  1OJG A;  4OKP A;  3T4L A;  4R4R A;  4KQO A;  4MMN A;  4O8G A;  1JNU A;  3OPR A;  4OP5 A;  1NXY A;  4OQG A;  4JF5 A;  3Q82 A;  2OAQ 1;  5CGW A;  3RTY A;  5HAQ A;  1CQA A;  4HBT A;  1IOU A;  1IYS A;  1OME A;  4X1L A;  1BYW A;  3LI8 A;  5TGF A;  4A5R A;  3BQA A;  4JXG A;  1HZO A;  1AXB A;  5L2F A;  1W8Q A;  3NY4 A;  3WWX A;  1BLP A;  1LSW A;  1BUL A;  3G31 A;  3IWQ A;  2ZOH A;  3ICY A;  5CTN A;  4I5S A;  2PD8 A;  1P9W A;  3LID A;  1OJ5 A;  3OOV A;  4GD6 A;  2C5W B;  3LFV A;  3BWL A;  4FH4 A;  3LGO A;  3C8C A;  1UGU A;  3E0Y A;  4CLC A;  3QP6 A;  3ZVT A;  3A0S A;  3Q1F A;  4E3J A;  4XT2 B;  3QP5 A;  4HHD A;  4ZAM A;  3IBR A;  3JVV A;  1L0E A;  5J4E A;  5CTM A;  2J3T C;  3KO6 A;  3UDX A;  4P0M A;  4GHI A;  2DNS A;  3HLF A;  5HAR A;  2WAD A;  3EGD C;  2H10 A;  2J8Y A;  4S2K A;  4MN5 A;  3E98 A;  5CEB A;  3H82 A;  3C7U A;  2WZZ A;  3P01 A;  1OTB A;  1VEU B;  1AWI A;  4I3A A;  1QMF A;  4Y15 A;  4KQQ A;  2VZW A;  3E4P A;  3N8R A;  4OPR A;  2ZL1 B;  2H0T A;  4PHT A;  2PR5 A;  1KVL A;  3V39 A;  1WYC A;  2RL3 A;  3AGD A;  4Y3I A;  4ID4 A;  2WGV A;  1S1Y A;  3LY4 A;  2QWS A;  3T1Q B;  2IWD A;  2ZQ9 A;  1PZO A;  3UE1 A;  4HIA A;  4QD4 A;  3ZCZ A;  3KX0 X;  1ERQ A;  1W63 Q;  3NEC A;  2Z2L B;  1NY0 A;  5DJT A;  2P74 A;  1LSV A;  3FWL A;  2Q9M A;  4QY6 A;  4DKI A;  2YKF A;  4ZBE A;  3DTI A;  3R7W A;  1KE4 A;  1PW8 A;  3GQZ A;  4M4X A;  4R3J A;  4E3L A;  2VGL S;  3ZG7 B;  1K38 A;  1T18 A;  3UDF A;  3WS5 A;  3TRC A;  2Y2N A;  3LYX A;  4NG2 A;  5EV0 A;  3ULF A;  5DFX A;  5EVL A;  1NYM A;  3FPV A;  1NLY A;  4Q0H A;  3MMH A;  5FSR A;  2W0N A;  3IBJ A;  3VSL A;  3GMW A;  5FI6 A;  1ES4 A;  1YMS A;  3HLC A;  1SCW A;  4P6B A;  5J7E A;  2ZQ7 A;  1D1J A;  2NUP C;  4R23 A;  4YOF A;  4S2L A;  4Y0T A;  3UE0 A;  3IF5 A;  1DP9 A;  3T1X A;  3MQO A;  2K31 A;  1F2K A;  2W27 A;  2LB9 A;  1EI5 A;  1RGZ A;  2UV0 E;  2OWH A;  5EE8 A;  3NOP C;  4L0L A;  2DCF A;  1VET B;  4EER A;  2OWJ A;  2VV7 A;  3E4Q A;  3CUE A;  2KDK A;  5GHY A;  3BFG A;  3OBF A;  3ZYT A;  4G3V A;  4UQI M;  3SS4 A;  3CAX A;  2GDN A;  3V67 A;  3ISG A;  1IKI A;  4GKU A;  2W3E A;  4HY8 A;  1NZU A;  3OCL A;  2FZ0 A;  3D4F A;  3SS5 A;  2J9O A;  4K0W A;  3O5Y A;  2V8C A;  1KDW A;  1PNE A;  2GX5 A;  1L3L A;  2BLS A;  3IXD A;  3HUO A;  5CEC A;  1FCN A;  1PRQ A;  3LUQ A;  1YQS A;  2RCX A;  2FH5 A;  1LI0 A;  4O01 A;  3CLO A;  2Y2G A;  5CHJ A;  5TBM A;  4R6L A;  5HW3 A;  5CGX A;  2WAE A;  2B95 A;  2ZMF A;  3NDG A;  4IBX A;  1PW1 A;  3T50 A;  1M6K A;  2ZBB A;  4E3M A;  4QPR A;  2V8F A;  5HDC A;  1L2S A;  1RP5 A;  3F1O B;  3VP2 A;  2PYP A;  1H8Y A;  4HJ3 A;  4BWI A;  4KZ7 A;  2PU2 A;  4YIN A;  2DRW A;  4MCW A;  5I94 A;  1K0K A;  4BJP A;  4LFU A;  1C3B A;  2FFY A;  2D02 A;  3LEQ A;  1ALQ A;  5G4Z A;  1XPB A;  3GR2 A;  4KZ6 A;  3UE6 A;  5JYP A;  5G18 A;  2ZC7 A;  4X68 A;  4BQM A;  5HWV A;  2Q0O A;  2JHE A;  1VHM A;  3GEC A;  4WEK A;  3G2Y A;  3UPN A;  4DE3 A;  1K25 A;  4EWF A;  1N9O A;  2HP6 A;  3IHA A;  2WUQ A;  1ZG6 A;  3ZG0 A;  2WKH A;  1JTG A;  4GN2 A;  3DTM A;  3F1N A;  3HJI A;  5HZH A;  2PT7 A;  5J3W A;  3LEZ A;  5BOH A;  4EV4 A;  5DJU A;  1N9L A;  1KOU A;  1IEM A;  2W1T A;  5E2G A;  4RX2 A;  4OVD A;  4MDZ A;  1XJ2 A;  1S4S A;  2HZ5 A;  1W5D A;  2XRN A;  2ZQ8 A;  4MBH A;  4UA7 A;  4CLC D;  4P87 A;  3K3C A;  4WUJ A;  2Z6D A;  1XJ3 A;  2ZM8 A;  3S7N A;  3WS4 A;  1GSV A;  1ZG4 A;  5L07 A;  3L9K A;  2ZL1 A;  5EM0 A;  3BYD A;  3PAG A;  3L7H A;  1F9I A;  4GW9 A;  1G68 A;  3UB8 A;  2GZA A;  2HDS A;  3QP4 A;  4WZ4 A;  5KSH A;  4KEN B;  4JF6 A;  3Q7V A;  5FQQ A;  3QNC A;  3DTE A;  3N4I A;  2EFX A;  1Z6F A;  2OV5 A;  3QP8 A;  2R9W A;  2XR0 A;  5IT5 A;  3ZG5 A;  2Y91 A;  5DF9 A;  3FKV A;  3LO7 A;  4HES A;  1YLJ A;  4P85 A;  4E6X A;  5E2E A;  3DBA A;  3H9W A;  3IXH A;  5HPI A;  3PR6 A;  3LY3 A;  3OLO A;  2V1B A;  4OLG A;  2QYB A;  1X0O A;  3RFB A;  4ARZ B;  1FOF A;  1K4F A;  2D01 A;  3T4J A;  5FAQ A;  3FV7 A;  3ITB A;  2L0W A;  1DRM A;  2O9A A;  3VP3 A;  4EBL A;  4BMW A;  2X01 A;  4KZ3 A;  1GCE A;  1DY6 A;  3T4O A;  1YAX A;  3QP2 A;  5HAP A;  5CED A;  3CZD A;  2A49 A;  1CI9 A;  3O3V A;  1PIO A;  4PM6 A;  4JXV A;  2HJE A;  4LV2 A;  3CPT B;  3QNB A;  5M18 A;  4Y13 A;  2B5R A;  3NOT C;  4NXG A;  3C5A A;  2ZMA A;  2JBF A;  3CJM A;  1ZHH B;  1TF1 A;  5EVI B;  3S7O A;  1OT6 A;  1H8Z A;  3JPU A;  4C6Y A;  4F3L B;  4JXS A;  2E8I A;  3UB5 P;  1SKF A;  1K57 A;  4JXW A;  2LB5 A;  3M2J A;  3S1Y A;  3K2N A;  4HP4 A;  5L10 A;  5F82 A;  2V0U A;  3AGE A;  3N7W A;  3NDE A;  5DKL A;  3OPL A;  3IQA A;  4WN5 A;  1MXO A;  4FSF A;  5A92 A;  1DP8 A;  3F1P A;  4EQ1 A;  1KVM A;  5AVE A;  1W79 A;  3FC7 A;  5CHM A;  1DJC A;  4BBV A;  1MY8 A;  3DWZ A;  3MZE A;  2QPN A;  1XJ6 A;  3A3J A;  3OZH A;  3MBZ A;  4FOF A;  5HAI A;  2BTF P;  1L0F A;  5GLC A;  4BD1 A;  2XLN A;  1LLB A;  4B4Z A;  1TVF A;  1NWZ A;  1YLW A;  4S2I A;  3RJU A;  4DE1 A;  4KUK A;  3G6O A;  4NEE D;  4DJ2 A;  3SH7 A;  1J9M A;  4LEN A;  2BAS A;  2M7U A;  4UHU A;  1ZC2 A;  3S22 A;  4S2O A;  1BLH A;  2V1Z A;  1E3U D;  4WEJ A;  5FEG A;  3BFD A;  1SDE A;  4WZ5 A;  4PM9 A;  4O7D A;  4Z9Q A;  3UY6 A;  2EA9 A;  1MWR A;  3PBN A;  3F1N B;  1TS0 A;  4IHQ A;  5KSC A;  4MNR A;  3BFC A;  4K08 A;  1YMX A;  2B18 A;  3B42 A;  4KZ4 A;  4OQH A;  5FAT A;  1YLZ A;  4G3W A;  2JKG A;  2EXB A;  4EW7 A;  2M1C A;  5AQ9 A;  4JF4 A;  3C4P A;  4ZTK A;  4OLD A;  5F68 A;  4EQI A;  3VOL A;  4DJ3 A;  4X6T A;  5M19 A;  1YSQ A;  1M40 A;  3IHB A;  2UWX A;  4H6J A;  1G5U A;  4Q0J A;  3V3S A;  4DXB A;  4FTX A;  4QWO A;  5F5Y A;  1RGY A;  4U0X A;  4MBF A;  3P7N A;  4K91 A;  4X25 A;  2R9X A;  1CF0 A;  1WYB A;  3UME A;  4YNR A;  4DF6 A;  1IFQ A;  3OPH A;  4Q8I A;  3SS3 A;  5CRF A;  3OC2 A;  2WYX A;  5HX9 A;  4QHC A;  1BLC A;  3KSI A;  4RYE A;  4L9F A;  4X53 A;  2W1R A;  3HL9 A;  1ES5 A;  3HUN A;  3N6I A;  2Y2Q A;  2J3W A;  3MSH A;  3VP4 A;  1A0K A;  3T4T A;  3TJZ C;  3EGX C;  5U47 A;  2K7S A;  5AQB A;  2CC1 A;  2OOL A;  2HGV A;  4LRZ E;  2NUT C;  1O07 A;  3SH8 A;  1ODV A;  2Y79 A;  5DTS A;  3RXW A;  3CPT A;  2H0Y A;  1K54 C;  4QU3 A;  2Y2I A;  1K4E A;  4EUZ A;  1RCJ A;  5FDS A;  4GNU A;  3T4S A;  1HLU P;  2JKT I;  3VV4 A;  4X55 A;  4F94 A;  3A0V A;  5FQI A;  4PKY A;  5L09 A;  4GHI B;  1O7E A;  3H7W B;  1Q2Q A;  4HJ4 A;  4LV1 A;  2I72 A;  4C3Q A;  4Y7P A;  2JCH A;  3MXQ A;  2W3G A;  4ESP A;  3O86 A;  3HVF A;  1G28 A;  5DKK A;  5K5B A;  2G7U A;  1FR6 A;  4LRY C;  3ITA A;  1W7F A;  3EWK A;  4I38 A;  4DRT A;  1GA0 A;  1S6R A;  5FQ9 A;  1GSW A;  4GJ4 A;  5EPH A;  2M7V A;  1MZU A;  4EES A;  1TDL A;  1TS8 A;  4X1M A;  5JYO A;  5M1A A;  4CPK A;  3FG8 A;  2PD7 A;  3UB7 A;  5DF8 A;  2OSU A;  2EFU A;  1PI5 A;  2WAF A;  3AGF A;  3C30 A;  3UNW A;  2A2L A;  3TG9 A;  1XFQ A;  1SKO A;  1U60 A;  4C75 A;  4WLA A;  3EEH A;  4E3O A;  4KG6 A;  4U3T A;  2R78 A;  1CK3 A;  3BQ8 A;  4KUO A;  3VFH A;  5J8X A;  3D3O A;  5DF7 A;  3V50 A;  5FQM A;  3RXX A;  1XKZ A;  1V9Z A;  5FL3 A;  4NET A;  1ZTU A;  2YKH A;  5HFO A;  3GRJ A;  2Y2M A;  3PTE A;  1F98 A;  2HJ9 C;  5EOE A;  3LCE A;  2HP9 A;  4JGO A;  5KMW A;  2GNX A;  3MJQ A;  4UEY A;  4WBG A;  3KSG A;  2HDQ A;  3LR3 A;  3BFF A;  3OCN A;  4Y5F A;  1OT9 A;  4EUV A;  4N1X A;  2BG1 A;  2QJ5 A;  2B02 A;  3IS2 B;  4Y2F A;  2E8J A;  5AQ7 A;  1QME A;  1UWP X;  3MFD A;  5HWT A;  5FAS A;  1FSY A;  2PBY A;  3BLM A;  1PWD A;  2HPB A;  5KIZ A;  1ERM A;  4QY5 A;  1WE4 A;  5FAO A;  1FR1 A;  3UB9 A;  2V2F F;  1KDS A;  3BFE A;  3HCY A;  2Y8H A;  1LHY A;  3S4X A;  1CJF A;  2XF3 A;  1YT4 A;  3LR5 A;  4LV3 A;  1F5M A;  2Y55 A;  3S7Q A;  5EVI C;  2WKP A;  4RA7 A;  3N8S A;  4N1H A;  2ZOI A;  5HSQ A;  5DVA A;  4U0T A;  2MJ6 A;  4H6J B;  5A91 A;  4FH2 A;  2Y59 A;  4HH2 A;  1E25 A;  4E3N A;  1DJA A;  3PHY A;  4OQI A;  1JWZ A;  4E3K A;  4GB7 A;  1EW0 A;  4LV0 A;  5TFQ A;  1S4R A;  2PAV P;  4GDB A;  3VOZ A;  1LSX A;  2EWV A;  4JGQ A;  1MKM A;  5FAP A;  5AJG A;  1OTA A;  3U2A A;  3LR0 A;  2ZJ9 A;  4HOI A;  4PPR A;  3NI9 A;  5A93 A;  2VA0 A;  1OTI A;  3HLB A;  5IU1 A;  4BBT A;  1YKD A;  2WKR A;  3UDI A;  1PZP A;  1CEF A;  2X71 A;  3UE3 A;  1FCO A;  3PBO A;  2HV1 A;  1CI8 A;  2O99 A;  3ZG8 B;  1YM1 A;  1L0D A;  4GDN A;  4G3K A;  4DDS A;  2VLG A;  4S2N A;  3LIE A;  4N9K A;  1YSP A;  2QKP A;  4N92 A;  2PDR A;  2HF6 A;  1HTZ A;  4XT2 A;  1S1Z A;  5E43 A;  2VK3 A;  3BLS A;  1FIK A;  4BL2 A;  3O88 A;  4N9L A;  4L9E A;  1XXM A;  4WL9 A;  1XGI A;  1D06 A;  2H28 A;  4HH3 A;  4LGW A;  3BY9 A;  2P9V B;  5DTT A;  4WMC D;  3KYE A;  4IUH A;  1OPX A;  5D3O A;  3IX8 A;  1HD8 A;  3EEA A;  1DP6 A;  3T12 B;  2VV6 A;  4QJG A;  1Z09 A;  1YLT A;  4BEN A;  3UB6 A;  1NRJ A;  4GZB A;  2AVX A;  3M6B A;  5CGS A;  4ZJ2 A;  3ZG9 B;  3BM6 A;  2V20 A;  4OPY A;  5F6A A;  2WGW A;  1ESU A;  3GTC A;  1KGF A;  4ETX A;  4FD8 A;  2L4R A;  1ESI A;  2XFT A;  2K2N A;  3VE3 A;  1JWP A;  4E3I A;  2ZD8 A;  4IVI A;  1BUE A;  4BD0 A;  3G2Z A;  1E4D A;  2XDM A;  2L1M A;  3P98 A;  1GHM A;  4DDY A;  4EEU A;  2A24 A;  3MZF A;  1T1C A;  3LIC A;  4M3K A;  3IT9 A;  4X56 A;  1GHP A;  3DWK A;  1UWN X;  2JC7 A;  2KX6 A;  2XD5 A;  1WA9 A;  2ZLY A;  3LIA A;  1BT5 A;  3EOI A;  4EU0 A;  4MN7 A;  1I2W A;  1ACF A;  1MWS A;  2ZC4 B;  1NLZ A;  1LL5 A;  5F1F A;  3A0R A;  3KSF A;  4WZ5 C;  3V5M A;  3CMZ A;  5DFY A;  4PM5 A;  4WEL A;  3BEB A;  5FEF A;  2W3D A;  3G35 A;  1LI9 A;  4DN0 A;  1XFN A;  3O87 A;  2PHY A;  5LBR A;  4EXO A;  4S2P A;  1IKG A;  3BJN A;  1TS6 A;  1VM1 A;  4IED A;  4R3B A;  3MZD A;  3B47 A;  3CIT A;  5IHV A;  4LLO B;  4MBK A;  1ES2 A;  3SW1 A;  4DXC A;  2WKE A;  2XD1 A;  5AQA A;  2Z6C A;  1MC0 A;  2Y2J A;  4OON A;  1FSW A;  2WKI A;  4LCM A;  2XRO A;  3T1S A;  4ZJ3 A;  2V0W A;  1I2S A;  1NYY A;  3PXP A;  2PBD P;  3EQV A;  1I5Q A;  2ZC5 B;  1XJ4 A;  1VQQ A;  4R1G A;  3H82 B;  3W2Z A;  1T1A A;  1FQG A;  4OP8 A;  3F1P B;  3WS2 A;  4DMZ A;  3HJK A;  2ACG A;  1BZA A;  1H3Q A;  3VOY A;  4D60 A;  4EET B;  5TBM B;  4AFI A;  2X02 A;  5FA7 A;  3WRT A;  1K55 C;  3QHY A;  3TE8 A;  2JN7 A;  4DE2 A;  1Y4O A;  5GLB A;  2P7J A;  4S2N C;  2EXA A;  4R0Q A;  3CWF A;  3IWI A;  4ETZ A;  5TR7 A;  1NJ4 A;  3CI6 A;  4I3I A;  3KSH A;  4GD8 A;  3CHW P;  2VGL M;  5HD5 A;  5CER A;  1XX2 A;  1KGE A;  3DTK A;  4GS9 A;  1XA7 A;  3FPW A;  4OQ0 A;  1PWG A;  2XA7 M;  1H5X A;  4ZRR A;  4D2O A;  3FZC A;  1L0G A;  1BLS A;  2GJ3 A;  4YWZ A;  1TEM A;  2Y2P A;  1Y54 A;  2Y2K A;  2EX6 A;  3BW6 A;  3MQQ A;  4IVK A;  2JKT M;  1NRF A;  4GLQ A;  3BY8 A;  5CHU A;  2WGI A;  5HWW A;  2V1A A;  2XK1 A;  4JLF A;  1H0M A;  4OOL A;  1IYQ A;  3UN7 A;  3LR4 A;  3D9Y A;  5A8B A; 
#chains in the Genus database with same CATH homology
 1DJB A;  2Y2M A;  2R9W A;  2XR0 A;  3PTE A;  3ZG5 A;  2Y91 A;  5DF9 A;  3GSG A;  3NCK A;  3FKV A;  5EUA A;  5EOE A;  5GLA A;  3LCE A;  2HP9 A;  3LO7 A;  4HES A;  1YLJ A;  4P85 A;  4Y0O A;  5E2E A;  3ZDJ A;  4E6X A;  5KMW A;  4WBG A;  3IXH A;  4MLL A;  2HDQ A;  3LY3 A;  3JYI A;  3SH9 A;  3UO9 A;  3BFF A;  4OLG A;  2HDU A;  1NZO A;  4WM9 A;  3MKF A;  3W4O A;  1W8Y A;  3OCN A;  3IH8 A;  3HLW A;  5EEC A;  3E2L A;  4KZA A;  1FOF A;  1KE3 A;  1K4F A;  4PM8 A;  4N1X A;  3Q07 A;  2BG1 A;  2JE5 A;  3I7J A;  5FAQ A;  3FV7 A;  3ITB A;  3W8K A;  3NC8 A;  4Y0U A;  4OOM A;  3VP3 A;  3IF6 A;  5HL1 A;  5AQ7 A;  3BRM A;  2IWC A;  4EBL A;  4GOG A;  1E3U A;  1YLP A;  2X01 A;  3UPP A;  4K0X A;  1QME A;  1GCE A;  1IYP A;  1DY6 A;  2ZM2 A;  2Y2L A;  3HUM A;  3PBT A;  3Q7V B;  3MFD A;  4KZ9 A;  3G32 A;  4WMC A;  4OKP A;  5FAS A;  4R4R A;  1K56 A;  1FSY A;  4KQO A;  4NK3 A;  2PBY A;  3BLM A;  1PWD A;  4BL3 A;  5CED A;  2HPB A;  5HAP A;  4JBF A;  1ERM A;  4YFM A;  4QY5 A;  3CZD A;  3OPR A;  4OP5 A;  5E2H A;  2OLU A;  2A49 A;  1CI9 A;  3CG5 A;  3O3V A;  5EOO A;  4X69 A;  1PIO A;  4PM6 A;  2WGW B;  3BEC A;  4JXV A;  1NXY A;  1WE4 A;  3GV9 A;  5FAO A;  3HRE A;  1FR1 A;  4OQG A;  4LV2 A;  4JF5 A;  3Q82 A;  2V2F F;  1KDS A;  3BFE A;  4ZDX A;  2WK0 A;  1LHY A;  3S4X A;  3IF6 C;  1PWC A;  2ZC6 B;  3QNB A;  4KG5 A;  5CGW A;  2ZM0 A;  2XF3 A;  1ERO A;  5M18 A;  1YT4 A;  1BTL A;  5HAQ A;  4LV3 A;  1MWU A;  3ZNT A;  2Y55 A;  4HBT A;  2B5R A;  3B3X A;  2PU4 A;  5EVI C;  1IYS A;  1OME A;  4RA7 A;  3C5A A;  1KE0 A;  3N8S A;  4N1H A;  5KZH A;  2ZMA A;  5TGF A;  3C4O A;  3A3E A;  5DVA A;  4MEZ A;  4U0T A;  3FYZ A;  4A5R A;  2JBF A;  3CJM A;  5A91 A;  4JXG A;  1HZO A;  1AXB A;  2Y59 A;  4FH2 A;  5L2F A;  3E2K A;  1W8Q A;  3NY4 A;  1E25 A;  3WWX A;  5EVI B;  1BLP A;  4E3N A;  1DJA A;  1K6R A;  1BUL A;  3G31 A;  3IWQ A;  1BSG A;  1H8Z A;  1JWZ A;  1K56 D;  4OQI A;  2Y2H A;  4E3K A;  5CTN A;  4C6Y A;  4JXS A;  4GB7 A;  4LV0 A;  2J9P A;  2E8I A;  5TFQ A;  2HDR A;  4GD6 A;  2C5W B;  1K57 C;  4GDB A;  3VSK A;  3VOZ A;  1XA1 A;  1SKF A;  4FH4 A;  1K57 A;  3VFF A;  4JXW A;  3M2J A;  4CJN A;  3S1Y A;  3ZVT A;  2XEP A;  5FAP A;  3A3F A;  5F82 A;  3Q1F A;  3AGE A;  3N7W A;  3NDE A;  3Q7Z A;  5GLD A;  4E3J A;  2Q9N A;  4ZAM A;  1CEG A;  3OPL A;  3PAE A;  4UAA A;  2ZJ9 A;  3IQA A;  1L0E A;  5CTM A;  1MXO A;  3DW0 A;  4PPR A;  5FI7 A;  4FSF A;  3NI9 A;  5A93 A;  3UDX A;  3HLB A;  1KGG A;  4P0M A;  3ZHH A;  3NIA A;  5A92 A;  2DNS A;  3M6H A;  3UDI A;  3HLF A;  1MKI A;  1PZP A;  5HAR A;  3WS1 A;  4BLM A;  1YLY A;  2WAD A;  1CEF A;  2X71 A;  3UE3 A;  1FCO A;  3PBO A;  1CI8 A;  2EX9 A;  1GHI A;  2H10 A;  1KVM A;  2J8Y A;  4S2K A;  5EVI A;  3ZG8 B;  1W79 A;  4R4S A;  1YM1 A;  5CHM A;  3UPO A;  3IXG A;  4E6W A;  3A3I A;  5CEB A;  1L0D A;  4GDN A;  1IYO A;  2WZZ A;  1DJC A;  3C7U A;  3G30 A;  4DDS A;  2G2W A;  5FQJ A;  4S2N A;  1MY8 A;  3DWZ A;  3MZE A;  4N9K A;  1EWZ A;  1QMF A;  2QPN A;  4KQQ A;  2QMI A;  3A3J A;  3OZH A;  3MBZ A;  5HAI A;  3N8R A;  4N92 A;  3ZFZ A;  4OPR A;  2H0T A;  1K55 A;  1HTZ A;  2Y2O A;  5GHZ A;  5E43 A;  1L0F A;  3BLS A;  5GLC A;  1KVL A;  3V39 A;  5DTK A;  1WYC A;  2RL3 A;  4BD1 A;  2XLN A;  4BL2 A;  1LLB A;  3AGD A;  2H5S A;  3IWO A;  4ID4 A;  2WGV A;  3O88 A;  3LY4 A;  4N9L A;  4B4Z A;  1TVF A;  1K6S A;  2IWD A;  2ZQ9 A;  1PZO A;  3UE1 A;  1XXM A;  5FQK A;  3WS0 A;  1XGI A;  4QD4 A;  2Z2M B;  3ZCZ A;  1YLW A;  3V3R A;  5F1G A;  3NBL A;  4S2I A;  2P9V A;  3RJU A;  3VMA A;  4DE1 A;  1ERQ A;  3P09 A;  3VP1 A;  2G2U A;  4B4X A;  4OPQ A;  2Z2L B;  1Q2P A;  2P9V B;  2VGK A;  4KG2 A;  5DTT A;  1NY0 A;  4WMC D;  2P74 A;  2WZX A;  1ONG A;  3FWL A;  3SH7 A;  2Q9M A;  4QY6 A;  1J9M A;  5D3O A;  3SOI A;  4DKI A;  1HD8 A;  4LEN A;  4ZBE A;  2ZC3 B;  4HBU A;  2Y4A A;  1KE4 A;  4UHU A;  1PW8 A;  1ZC2 A;  3S22 A;  4JKT A;  4S2O A;  4QJG A;  1BLH A;  3GQZ A;  2V1Z A;  4R3J A;  4E3L A;  1E3U D;  4S2M A;  4WEJ A;  3ZG7 B;  1K38 A;  3BFD A;  1SDE A;  1YLT A;  3UDF A;  2ZQC A;  3IF6 B;  4O7D A;  4PM9 A;  3FKW A;  4WZ5 A;  3WS5 A;  4BEN A;  4Z9Q A;  2Y2N A;  3UY6 A;  4GZB A;  1MWR A;  3PBN A;  5EVL A;  1NYM A;  5GL9 A;  3M6B A;  5CGS A;  4MNR A;  5FSR A;  5KSC A;  3BFC A;  4ZJ2 A;  3ZG9 B;  3VSL A;  3PBS A;  3W4Q A;  3BM6 A;  1YMX A;  3GMW A;  5FI6 A;  1ES4 A;  4KZ4 A;  4OQH A;  1G6A A;  5FAT A;  1YMS A;  2V20 A;  4OPY A;  4IBR A;  2WGW A;  3HLC A;  1ESU A;  1YLZ A;  1XP4 A;  3GTC A;  2EXB A;  1KGF A;  1SCW A;  4P6B A;  4FD8 A;  4PM7 A;  1ESI A;  5AQ9 A;  2XFT A;  2ZQ7 A;  4JF4 A;  3A3D A;  1S0W A;  3C4P A;  4ZTK A;  1JWP A;  4R23 A;  4OLD A;  4S2L A;  4E3I A;  4Y0T A;  4EQI A;  2ZD8 A;  4IVI A;  3PBR A;  3UE0 A;  1BUE A;  4X6T A;  4XUZ A;  2XGN A;  5M19 A;  3IF5 A;  1M40 A;  3OPP A;  4WYY A;  4BD0 A;  4UA6 A;  3IHB A;  2UWX A;  3G2Z A;  4OPZ A;  4S2J A;  1E4D A;  3V3S A;  4DXB A;  2XDM A;  3IH9 A;  3P98 A;  1EI5 A;  1RGZ A;  1GHM A;  2A3U A;  4DDY A;  3MZF A;  3ZGA B;  5EE8 A;  1RGY A;  4M3K A;  3IT9 A;  4U0X A;  4MBF A;  4X56 A;  4L0L A;  2DCF A;  3ZNY A;  1GHP A;  2HP5 A;  4UA9 A;  3DWK A;  3Q81 A;  4K91 A;  2JC7 A;  2R9X A;  2XD5 A;  2ZLY A;  1WYB A;  1BT5 A;  3VP0 A;  4DF6 A;  4Q8I A;  3OPH A;  3SS3 A;  3N8L A;  3MXS A;  5CRF A;  4KZ8 A;  3OC2 A;  1I2W A;  5GHY A;  3BFG A;  2WYX A;  1ZKJ A;  1MWS A;  2ZC4 B;  4KZ3 A;  5HX9 A;  3SS4 A;  4QHC A;  1BLC A;  4RYE A;  2GDN A;  5CXW A;  3ISG A;  1SDN A;  1JTD A;  1LL5 A;  4X53 A;  3M2K A;  2ZQD A;  5F1F A;  3HL9 A;  1IKI A;  4KQR A;  4GKU A;  4WZ5 C;  3V5M A;  3CMZ A;  2VGJ A;  1NZU A;  1ES5 A;  3OCL A;  3HUN A;  3N6I A;  4PM5 A;  2Y2Q A;  4WEL A;  3VP4 A;  3BEB A;  3G35 A;  3D4F A;  3SS5 A;  2J9O A;  1LI9 A;  5GHX A;  4K0W A;  3HLD A;  3O87 A;  1KDW A;  3MXR A;  2BLS A;  5U47 A;  4S2P A;  1IKG A;  3IXD A;  1JVJ A;  3HUO A;  4LCL A;  4RVA A;  5CEC A;  1FCN A;  1VM1 A;  4IED A;  1K54 A;  2CC1 A;  5AQB A;  4R3B A;  3EQU A;  3MZD A;  5EVI D;  5IHV A;  1YQS A;  4MBK A;  1O07 A;  3SH8 A;  4EBP A;  1ES2 A;  2RCX A;  4DXC A;  2WKE A;  1LI0 A;  5DTS A;  2XD1 A;  2FFF B;  2Y2G A;  5CHJ A;  5AQA A;  3RXW A;  4QB8 A;  5HW3 A;  2Y2J A;  4DE0 A;  4OON A;  5CGX A;  1MPL A;  1HVB A;  2WAE A;  4OOY A;  5E2F A;  3MKE A;  1FSW A;  2H0Y A;  3NDG A;  1K54 C;  1PW1 A;  4IBX A;  4QU3 A;  2WKI A;  1M6K A;  1N9B A;  2Y2I A;  4LCM A;  3WRZ A;  4E3M A;  1FCM A;  1K4E A;  4EUZ A;  4ZJ3 A;  1RCJ A;  1L2S A;  4GNU A;  1I2S A;  1RP5 A;  4H8R A;  1NYY A;  4XXR A;  3VP2 A;  3HBR A;  1H8Y A;  4X55 A;  4F94 A;  3EQV A;  1ES3 A;  1I5Q A;  4KZ7 A;  2ZC5 B;  2PU2 A;  4YIN A;  5FQI A;  2DRW A;  4B88 A;  5I94 A;  1VQQ A;  4BJP A;  1C3B A;  1O7E A;  2FFY A;  4R1G A;  3G34 A;  3ZVW A;  1Q2Q A;  3HLE A;  4JPM A;  4LV1 A;  2I72 A;  4KZ5 A;  4C3Q A;  1ALQ A;  3IXB A;  5FDH A;  4Y7P A;  3TOI A;  1XPB A;  1FQG A;  2OLV A;  4OP8 A;  3GR2 A;  2JCH A;  3WS2 A;  4KZ6 A;  5JYP A;  5G18 A;  1GA9 A;  2ZC7 A;  4X68 A;  2EX2 A;  4BQM A;  3O86 A;  1BZA A;  3HVF A;  4FCF A;  1SHV A;  2XQZ A;  3VOY A;  4WEK A;  1PYY A;  1FR6 A;  3G2Y A;  3UPN A;  2X02 A;  4DE3 A;  4ZJ1 A;  1MBL A;  1K25 A;  4EWF A;  3ITA A;  5FA7 A;  4HEF A;  1W7F A;  3WRT A;  2HP6 A;  1LL9 A;  1K55 C;  2EX8 A;  2WUQ A;  1ZG6 A;  3IHA A;  1GA0 A;  3QHY A;  4KZB A;  1S6R A;  2C6W B;  4DE2 A;  4DRT A;  5FQ9 A;  3ZG0 A;  2WKH A;  5GLB A;  5EPH A;  2XFS A;  1JTG A;  1TDL A;  4GN2 A;  3DTM A;  4S2N C;  2EXA A;  4OH0 A;  4R0Q A;  5JYO A;  5M1A A;  3IWI A;  4CPK A;  3LEZ A;  5BOH A;  3C7V A;  4EV4 A;  5TR7 A;  5DF8 A;  1IEM A;  1NJ4 A;  4PMA A;  5FI2 A;  2OSU A;  5E2G A;  4GD8 A;  2EFU A;  1PI5 A;  2WAF A;  4RX2 A;  4OVD A;  1MWT A;  1TDG A;  3HLG A;  5CER A;  3G4P A;  3AGF A;  3UNW A;  1XX2 A;  3TG9 A;  1KGE A;  1W5D A;  2ZQ8 A;  4MBH A;  4UA7 A;  4P87 A;  1XA7 A;  4OQ0 A;  1PWG A;  1U60 A;  1H5X A;  2ZM8 A;  4C75 A;  4D2O A;  3FZC A;  1L0G A;  1PI4 A;  4XUX A;  3WS4 A;  4E3O A;  1BLS A;  4KG6 A;  4U3T A;  1ZG4 A;  1CK3 A;  1XGJ A;  1TEM A;  2Y2P A;  3VFH A;  1Y54 A;  2Y2K A;  5J8X A;  5DF7 A;  2EX6 A;  5FQM A;  1JWV A;  2J7V A;  3RXX A;  2IWB A;  3V50 A;  3BYD A;  4IVK A;  1XKZ A;  1NRF A;  3PAG A;  3TSG A;  3GVB A;  3W4P A;  5A90 A;  1N4O A;  1G68 A;  5CHU A;  2QZ6 A;  2WGI A;  2HDS A;  2XH9 A;  4RX3 A;  4WZ4 A;  5KSH A;  4NET A;  4EBN A;  4KEN B;  2XK1 A;  4JLF A;  1IEL A;  4JF6 A;  3Q7V A;  5FQQ A;  3PBQ A;  5HFO A;  3QNC A;  3GRJ A;  5F83 A;  4OOL A;  3N4I A;  2EFX A;  1IYQ A;  1ONH A;  2ZQA A;  3UN7 A;  1Z6F A;  2OV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...