2ZJ9A

X-ray crystal structure of ampc beta-lactamase (ampc(d)) from an escherichia coli with a tripeptide deletion (gly286 ser287 asp288) on the h10 helix
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
355
structure length
355
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMKTRVFQPLKLNHTWINVPSAEEKNYAWGYREGKAVHVSPRALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDIIINNKIALAARPVKPITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AmpC
molecule tags Hydrolase
source organism Escherichia coli
publication title Structure of AmpC beta-lactamase (AmpCD) from an Escherichia coli clinical isolate with a tripeptide deletion (Gly286-Ser287-Asp288) in the H10 helix
pubmed doi rcsb
total genus 124
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zj9A00
1PWCA 3Q82A 4JXGA 2XD1A 2Y2OA 4IBXA 4OQGA 1AXBA 4X55A 4X6TA 4YINA 2DNSA 3RXXA 5CHJA 5EE8A 4ZJ1A 1ES2A 1K4EA 2PU2A 4LV2A 2H0TA 3ZVWA 3ZG7B 2WYXA 1IKIA 1HVBA 1YLYA 1RGYA 4KG2A 2HDSA 1S6RA 1MWTA 3UNWA 3G30A 1QMEA 1RP5A 3G4PA 5HFOA 4WEKA 3MZDA 1YLWA 5FQIA 3GSGA 4X53A 2Z2LB 1NZOA 3PBRA 1JVJA 1U60A 5HX9A 4C6YA 3IXGA 3CZDA 4U3TA 2UWXA 2ZJ9A 1MY8A 5CECA 4BL3A 3NC8A 2QPNA 3BEBA 2HP6A 3UO9A 5TR7A 4S2NA 3IF6B 4U0TA 1TVFA 1FQGA 3PBQA 4P6BA 5HL1A 1NYMA 1XXMA 3GR2A 3PBNA 1HD8A 2PBYA 3OZHA 2OV5A 3TG9A 1YMXA 5EVIA 3SOIA 2JCHA 5HW3A 1XP4A 3HLDA 1MWRA 2ZLYA 3LEZA 3QHYA 2WADA 4OQHA 5FQMA 5GLBA 3BFGA 4EBPA 4R1GA 3NCKA 4O7DA 3ZCZA 4E3JA 4PM9A 3UPOA 2ZD8A 4C75A 3N7WA 1N9BA 4E3MA 4KQRA 4ZJ2A 1ONHA 4BJPA 1PWGA 3IF5A 3IH8A 3IWOA 3IHBA 3FWLA 2GDNA 2EX9A 5DF8A 5FI2A 4GKUA 4Y0OA 5FAQA 5HAIA 4D2OA 5GHZA 4JKTA 1KE3A 3NY4A 1CI8A 3UDIA 3HUOA 3O87A 4HESA 1K56A 4Y7PA 3S4XA 5M19A 1J9MA 1LI9A 4P0MA 3V3RA 4OLGA 3MKEA 5E2FA 3ZG8B 1ZG4A 1RGZA 3HVFA 5J8XA 5EVID 1G68A 1C3BA 1YM1A 4KZ6A 1OMEA 4GDNA 3HLBA 2P74A 1FOFA 4E6WA 1NRFA 4JF5A 3W4QA 3Q1FA 3Q7VA 4OOYA 4B4ZA 1BTLA 3BM6A 2RL3A 5FATA 3ZHHA 5A93A 1K57C 4MBHA 3W8KA 1EWZA 4S2OA 4A5RA 1Z6FA 3EQVA 1K4FA 3ZG9B 4BD0A 4KZ3A 3LO7A 3UE1A 4F94A 2OLUA 1MXOA 1XX2A 5M1AA 1BT5A 3NDGA 4ZTKA 3PBTA 4WELA 3ZDJA 4JF6A 5HAPA 5KSCA 3ZNYA 2ZC6B 2IWDA 1E3UA 2HDQA 3PAGA 4R4SA 5L2FA 2EFXA 1NZUA 4IVIA 1S0WA 3HLCA 3PTEA 4KZ9A 1W7FA 1PIOA 4R3JA 4ZAMA 3WS4A 2VGKA 1KGFA 2WKHA 5FQJA 2Y4AA 1KGGA 2ZQCA 4EQIA 4MEZA 4IBRA 4QY5A 4DRTA 3QNCA 3A3FA 4N1HA 3IHAA 1ES3A 4B88A 4N1XA 2B5RA 2JC7A 1FSWA 1W8QA 1KVMA 3BLMA 3E2LA 5F83A 2WGWB 1WE4A 3IWIA 4GN2A 4U0XA 4XUXA 5FDHA 3VOYA 2XGNA 3Q7VB 4RYEA 3O88A 4N92A 2J9OA 1L0GA 1NJ4A 3C5AA 1ONGA 1L2SA 2XFSA 4S2JA 5A91A 3HUMA 1ESUA 1YLJA 4DE2A 2A49A 3UPNA 4JBFA 4PM7A 3D4FA 3OCLA 2C6WB 1CI9A 3C4PA 4OQIA 3OPLA 4GDBA 3HREA 4CPKA 2XQZA 4LCMA 2BLSA 1O07A 2Y2IA 2P9VA 3LCEA 3ZG5A 1FSYA 3WS5A 4DXCA 4ZDXA 2PU4A 3G2ZA 3BLSA 4XXRA 3IT9A 5F82A 2V1ZA 3GMWA 5TFQA 3BECA 3WWXA 1YQSA 3ITAA 5FI7A 1K6RA 5CGXA 5DTSA 1HZOA 4KZAA 1XGJA 2H5SA 5FAOA 2HP5A 4OOLA 1WYCA 3Q7ZA 5KZHA 3WRZA 4KG5A 1GCEA 4GD8A 2Q9NA 3GRJA 4KZ4A 1KDWA 2R9XA 2WGIA 3E2KA 2V2FF 4HBUA 5TGFA 4E3LA 1VQQA 2Y2JA 1BLSA 4DE0A 4QB8A 3N8SA 1JTGA 4X68A 5A92A 2ZC4B 5CTNA 3C4OA 1ES4A 1PW1A 3M6BA 2Y2QA 1IYPA 4R23A 2WAFA 3HLWA 3PAEA 5BOHA 2ZMAA 3OPPA 4K0XA 5AQ7A 1SDNA 5FAPA 3VSLA 3DW0A 1IELA 2ZQ9A 1ZG6A 4Y0TA 3B3XA 2WKIA 3RJUA 1K56D 5CHMA 5GLAA 4B4XA 1PI4A 3A3DA 3HL9A 4JXSA 3VFHA 2DRWA 1KDSA 5IHVA 4JXWA 2EX8A 4FD8A 1YLZA 2WZZA 4OH0A 1PW8A 4WZ5C 1KE4A 4LV3A 4QD4A 4WYYA 4Y0UA 4ID4A 3WS0A 4EV4A 2EXBA 3BFFA 1LHYA 2QMIA 1FR6A 2OSUA 5M18A 1CEGA 3OCNA 1XA1A 5GHYA 3HUNA 3NBLA 4YFMA 1W5DA 3G31A 2XDMA 4OP8A 1BULA 2OLVA 4OP5A 4OONA 2Z2MB 1CEFA 2ZM2A 3C7UA 4NK3A 3FZCA 4OOMA 5EECA 3I7JA 1H8ZA 5F1GA 3UY6A 1ESIA 1QMFA 4E3NA 2ZQAA 4KZ8A 2IWBA 1ES5A 1ERMA 3C7VA 4IVKA 2ZC3B 2Q9MA 5AQAA 3UDXA 2H10A 3FKWA 4Q8IA 1BSGA 1Y54A 2EFUA 5GHXA 3DWZA 5FI6A 4ZJ3A 1PZPA 3IH9A 4P85A 4WMCD 1PWDA 1TDGA 2XLNA 1W79A 4DXBA 5E43A 4CJNA 4S2LA 2I72A 3CJMA 3DTMA 3N4IA 3NIAA 3BRMA 2ZC7A 3HLGA 1JWZA 1GHMA 2JE5A 3IXHA 1K6SA 2EXAA 4GOGA 3WS1A 1BUEA 1KGEA 3ITBA 3OC2A 4E6XA 1K54C 1IYSA 3W4OA 5GLCA 5F1FA 4X56A 4GNUA 4GD6A 3AGDA 1LI0A 4S2IA 5EVIC 3WS2A 2WKEA 2EX6A 4MNRA 2R9WA 2G2WA 3FV7A 3A3IA 4OPRA 4RVAA 1TDLA 3SS3A 3VOZA 3GVBA 3AGEA 1XA7A 5DTKA 1YT4A 3N8LA 3V3SA 4PM6A 1ZC2A 5EPHA 3A3EA 3DWKA 4JPMA 4OPYA 4Z9QA 1MKIA 4DDSA 3ZFZA 3IXBA 4WMCA 5I94A 4KZ5A 2HDUA 4OPQA 2Y2PA 1BZAA 1LL9A 5E2EA 1H8YA 2XF3A 3OPHA 5CGSA 5HAQA 3MFDA 4N9KA 4S2PA 4KG6A 2H0YA 1DY6A 1MWUA 1VM1A 4FH4A 1WYBA 4HEFA 4QHCA 2IWCA 2FFFB 3EQUA 2J8YA 3JYIA 2XK1A 3N6IA 3TSGA 3MXSA 4PMAA 3BYDA 2ZC5B 2XEPA 2Y2NA 1RCJA 4WZ4A 3ZGAB 1NYYA 5G18A 5A90A 2WGWA 2Y2KA 4KZBA 2Y2GA 1ZKJA 1IYQA 1MPLA 1EROA 1K55A 3G32A 4XUZA 3V39A 1FCOA 1GHIA 3ZNTA 3MKFA 1BLCA 1KE0A 1JTDA 2EX2A 3Q81A 3NDEA 1SKFA 4KQQA 5CRFA 1XGIA 2HDRA 3M2KA 4FH2A 1LLBA 3GTCA 5EVLA 4MLLA 4BENA 1SHVA 5DF9A 2WK0A 2Y91A 2Y59A 5FQ9A 5FQQA 1CK3A 4KENB 3HLFA 3MZFA 1IYOA 3ZG0A 3VMAA 2VGJA 4S2KA 5AQ9A 4C3QA 5CEDA 3M2JA 3RXWA 4GB7A 3UE3A 1TEMA 2G2UA 4E3KA 1FCNA 3UDFA 4QJGA 3VP2A 4X69A 2E8IA 1G6AA 2WAEA 2ZM8A 5KSHA 4LV1A 4L0LA 4BQMA 5FQKA 3BFCA 3IXDA 2ZQ8A 3UPPA 3Q07A 1K55C 1LL5A 2A3UA 2V20A 1HTZA 1M40A 3VP3A 3W4PA 4DE1A 1BLHA 3VP0A 4GZBA 4NETA 4QU3A 5GL9A 5CXWA 1IKGA 2C5WB 4UA9A 4OKPA 3M6HA 4RX2A 5E2GA 3IF6A 4R3BA 3WRTA 2WUQA 1DJCA 4WZ5A 3UE0A 3O86A 3MZEA 5CHUA 2XR0A 4IEDA 2QZ6A 3LY4A 1XPBA 4JXVA 2ZM0A 1I2WA 1FCMA 4E3IA 2ZQDA 1IEMA 1KVLA 3N8RA 4HBTA 4K91A 4WBGA 1N4OA 1YLPA 1E25A 1XKZA 4S2NC 2X01A 5FA7A 4EUZA 3G2YA 1SCWA 4PM5A 2DCFA 4PM8A 4QY6A 1GA0A 3HBRA 4OPZA 5EOOA 2CC1A 3IQAA 3SH7A 2WGVA 1W8YA 2Y2MA 3SS5A 4DKIA 3FYZA 1O7EA 3UN7A 5DVAA 4LCLA 1I5QA 2Y2HA 4UAAA 5KMWA 1L0DA 4RA7A 4OVDA 1DJAA 1L0EA 5JYOA 1MWSA 4JLFA 4ZBEA 3GV9A 3SH8A 3ISGA 1MBLA 1YMSA 2XD5A 3HLEA 4K0WA 5CTMA 3GQZA 1K57A 4FSFA 5AQBA 4DE3A 3A3JA 3SS4A 1NY0A 4DF6A 4S2MA 4DDYA 5JYPA 5DTTA 2XFTA 1BLPA 2ZQ7A 3IF6C 3PBOA 1YLTA 5CERA 3VP4A 1PZOA 2X02A 5D3OA 1M6KA 3SH9A 4EBLA 2Y55A 4R4RA 5CGWA 3G34A 4MBKA 3ZVTA 1K38A 3MBZA 3QNBA 1Q2PA 4BD1A 2HP9A 3CG5A 4FCFA 1E3UD 3AGFA 4EWFA 1EI5A 3LY3A 4P87A 2J7VA 4N9LA 4RX3A 1PI5A 4BL2A 3P09A 1H5XA 3O3VA 4R0QA 4UA6A 5FSRA 2Y2LA 3S1YA 3V50A 1DJBA 2X71A 5CEBA 1K54A 1GHPA 5EUAA 1K25A 4E3OA 1JWPA 3IWQA 2RCXA 2J9PA 2JBFA 2P9VB 5EOEA 4EBNA 5FASA 3S22A 3VFFA 3FKVA 5HARA 1L0FA 5U47A 1GA9A 1JWVA 3CMZA 4PPRA 4UA7A 4UHUA 3MXRA 3V5MA 4MBFA 4JF4A 1I2SA 3G35A 4OLDA 5EVIB 5DF7A 1E4DA 4LV0A 3VP1A 4BLMA 1ALQA 1ERQA 4H8RA 3BFEA 4KQOA 4M3KA 1NXYA 4OQ0A 4WEJA 1Q2QA 2XH9A 1SDEA 2FFYA 2BG1A 3P98A 4LENA 5GLDA 1FR1A 3VSKA 1PYYA 3NI9A 3PBSA 4WM9A 3TOIA 2HPBA 5E2HA 4KZ7A 3OPRA 3BFDA 2WZXA
chains in the Genus database with same CATH superfamily
1P9RA 1PWCA 4OQGA 3EGDC 3RXXA 1NRJA 3BY9A 1IKIA 4IUHA 1T18A 1RGYA 3UNWA 3G30A 3NECA 3ICYA 4WEKA 1YLWA 4FUWA 3GSGA 5EV0A 1NZOA 1VEUA 3PBRA 3IXGA 2HZ5A 2UWXA 4E04A 2QPNA 1S1YA 5HL1A 3PBQA 5IU1A 4GS9A 2OV5A 3TG9A 1YMXA 1XP4A 3HLDA 5FQMA 3BFGA 4ARZB 2A2LA 4E3JA 5AVEA 3T1QB 1ONHA 3D72A 3IF5A 3T4QA 2EX9A 4Y0OA 2V8CA 2MJ6A 4JKTA 1CI8A 3HUOA 4HESA 5M19A 3S4XA 1RGZA 1C3BA 2P74A 3PXPA 4O0PA 2GX5A 3Q1FA 3Q7VA 4OOYA 5A93A 1K57C 4MBHA 1EWZA 4R6LA 4S2OA 3ZG9B 3T1XA 5KSCA 2ZC6B 4R4SA 2QJ7A 4LPZA 4KZ9A 2VJWA 3LR4A 3HCYA 2JHEA 3B47A 2VLGA 3RTYA 4EQIA 4LRXC 4IBRA 3A3FA 4N1HA 3RFBA 5F69A 4N1XA 2HF6A 2JC7A 1FSWA 2V9AA 1KVMA 2J80A 3BLMA 5F83A 2XGNA 2J9OA 1L0GA 1NJ4A 3C5AA 1ONGA 5EM1A 1DP8A 1SZVA 1ESUA 1YLJA 1W63M 2KOIA 3OCLA 2W1TB 4WF0A 2XQZA 4LCMA 1A0KA 4CLCC 3WS5A 1H3QA 2PU4A 3G6OA 1ACFA 5L10A 2V1ZA 3GMWA 5TJJA 1YQSA 1HLUP 5CGXA 5L07A 2EA9A 2M1CA 5HL6A 3TE8A 4KZAA 2KX6A 2H5SA 4I3JA 3D3OA 2W3EA 3GRJA 2R9XA 1TF1A 4HBUA 5TGFA 1IOUA 3EWKA 5A92A 4X68A 4WL9A 1ES4A 5LBRA 3HLWA 5AQ7A 3VSLA 4Y0TA 1IELA 1Y28A 2WKIA 5DKLA 3HL9A 3V67A 4CQHA 5IHVA 1OTDA 4FD8A 2HJ9C 4WZ5C 4QD4A 3WS0A 4EV4A 3K3DA 1FR6A 5K5BA 4Y3IA 3P7NA 1XA1A 3C2WA 3G31A 3NHQA 4OP5A 1SKOA 1OTIA 3U4LP 2GNXA 1J3WA 1MC0A 2ZQAA 4KZ8A 2Q9MA 4HOIA 3DWZA 4ZJ3A 1PZPA 3T4SA 4WMCD 4S2LA 2I72A 3NIAA 3DTMA 2G7UA 3BRMA 2EXAA 1BUEA 3ITBA 3OC2A 5FEFA 3UB5P 2W1RA 4HJ4A 4GCZA 3AGDA 5DJTA 3F1NB 4EESA 5L09A 3SS3A 3VOZA 3BW6A 4PKYG 2VV7A 3IX4A 1Z09A 3EEHA 1MKIA 4DDSA 1IFQA 4WMCA 4DMZA 4H6JA 1LL9A 3MFDA 1MKMA 1DY6A 2J8YA 3JYIA 2XK1A 1LSXA 3MXSA 3BYDA 2Y2NA 4WZ4A 1Y4OA 3ZGAB 3BQ8A 5A90A 2GZAA 2CMNA 2WGWA 4XUZA 1K55A 3KSHA 2JKRM 1GHIA 1KE0A 1SKFA 1YKDA 3BJNA 2ZL1A 3UB7A 2M7UA 4XT2B 1ZHHB 4KENB 3OBFA 4S2KA 1UWNX 5AQ9A 2ZOIA 2G2UA 3UDFA 3LFVA 3EEAA 2WAEA 3KYQA 4L0LA 1T1CA 3BFCA 5HZHA 3UB6A 3UPPA 3Q07A 1K55C 2A3UA 2V20A 1HTZA 1M40A 3W4PA 4DE1A 1BLHA 2R78A 2VK3A 4O8GA 1DRMA 2BASA 3C38A 5E2GA 1OJ5A 4WZ5A 4UQIS 5CHUA 3FC7A 2XR0A 1KVLA 4HBTA 2PYPA 4K91A 3QP5A 1YLPA 2PDRA 4QY6A 3T4OA 4PKYA 5EOOA 2CC1A 3SH7A 4DKIA 4ETZA 3CHWP 3FYZA 3JPUA 5L8MA 1L0EA 5JYOA 3H82B 4NXBA 3GV9A 1TS7A 1MBLA 2XD5A 5CTMA 3GQZA 3A3JA 1PFLA 4S2MA 1CQAA 2XFTA 2ZQ7A 3CPTA 3VP4A 3SH9A 4EBLA 5CGWA 3T4JA 4HIAA 1Q2PA 4FCFA 3AGFA 3E4OA 3LY3A 4RX3A 1PI5A 4DN0A 4BL2A 1CJFA 1VHMA 4UA6A 5FSRA 4G3KA 1GHPA 2RCXA 5EOEA 5HARA 1XFNA 4B93A 4UHUA 3V5MA 1X0OA 1E4DA 3O5YA 3VP1A 1ALQA 4LRYC 1NXYA 5HDCA 1Q2QA 1SDEA 2BG1A 1FR1A 3VSKA 3NI9A 4WM9A 3T1RA 3IBJA 3LGOA 3Q82A 3H7WB 4X55A 4X6TA 4YINA 4ZJ1A 3ZVWA 1VB6A 3ZG7B 4KG2A 2XRNA 1QMEA 3G4PA 5HFOA 5FQIA 3MJQA 3VV4A 2QYBA 1W63Q 5CECA 4BBTA 3NC8A 4Y15A 2VX8A 4S2NA 4Q0JA 2QJ5A 5C5KA 3OZHA 2A24A 5EVIA 2JCHA 2ZLYA 4LLOB 4EBPA 3KSFA 1OTEA 4PM9A 4Y2FA 4E3MA 4KQRA 4BJPA 1PWGA 5HAIA 4D2OA 5GHZA 1J9MA 4P0MA 4OLGA 5E2FA 1ZG4A 3HVFA 5J8XA 5EVID 1G68A 1YM1A 2NUTC 1FOFA 1NRFA 4JF5A 3W4QA 3HJKA 4JGRA 4Z1WA 2EWWA 3ZHHA 3W8KA 4NKPA 3T4LA 2OLUA 2QKPA 1MXOA 4NXEA 3NDGA 5HAPA 3LUQA 5L2FA 1E3UA 3PAGA 3DAVA 1L3LA 4IVIA 3HLCA 3PTEA 3H82A 3LIBA 1W7FA 1PIOA 4R3JA 2VGKA 1KGFA 2WKHA 5FQJA 2ZQCA 4L9GA 1GSXA 3E2LA 1F98A 3MFXA 1P0ZA 3RH8B 3IWIA 5FDHA 3VOYA 3Q7VB 4N92A 2PT7A 1L2SA 2W27A 4HY8A 2A49A 4PM7A 4OQIA 3OPLA 4GDBA 2BLSA 2Y2IA 4HP4A 1FSYA 4DXCA 4ZDXA 2PBDP 5F82A 3BECA 2GJ3A 4I5SA 5DTSA 2INWA 2HP5A 2VGLS 4ETXA 1WYCA 3H7WA 1PNEA 3WRZA 3LYXA 3LEQA 1KDWA 2WGIA 3E2KA 3MQQA 1VQQA 2H28A 2K31A 1BLSA 3N8SA 3FPWA 5DFXA 4Y13A 4R23A 3T4KA 2WAFA 3PAEA 5HPFA 2AVXA 3B42A 2QHKA 3NOPC 3E4PA 3B3XA 1S66L 3RJUA 3IX8A 4GJ4A 4B4XA 3A3DA 4JXSA 3VFHA 1LT0A 5EM0A 3S7NA 4LV3A 4ID4A 4NG2A 2EXBA 4MN6A 2QMIA 2OWHA 3OCNA 5GHYA 3H9WA 3HUNA 2VZWA 1BULA 4OONA 2Z2MB 3C7UA 3GECA 4NK3A 3FZCA 5EECA 1QMFA 1ES5A 4IVKA 5AQAA 2H10A 4JGPA 5FI6A 1PWDA 3CJMA 3N4IA 3IXHA 1JWZA 2J3TC 3MR0A 4NEED 1K54C 1IYSA 5HWWA 3W4OA 5GLCA 1LSVA 3MMHA 3K2NA 1LI0A 4S2IA 3WS2A 2EX6A 4RVAA 2G2WA 3FV7A 1TDLA 3PYPA 4KUOA 2OOLA 3AGEA 5DTKA 1YT4A 2Y79A 1ZC2A 3A3EA 4JPMA 3TJZC 3IXBA 2HDUA 4F3LA 1BZAA 4DJ2A 1H8YA 2XF3A 3OPHA 5HAQA 3P01A 2H0YA 1VM1A 2L0WA 3MS6A 4HEFA 1WYBA 2ZMFA 2FFFB 5FEGA 1TS0A 1UWPX 4I3AA 4PMAA 4WN5A 2ZMVA 4BMWA 4KZBA 3MXQA 1MPLA 1EROA 3G32A 3VE4A 3QP8A 2EX2A 2PD7A 2W3HA 4KQQA 3M2KA 5EVLA 4L9FA 2WK0A 2Y59A 4KUKA 2PAVP 1CK3A 1IYOA 1XFQA 3M2JA 3L9KA 3RXWA 3UMDA 4X69A 2E8IA 5KSHA 2ZM8A 1STZA 4G3VA 4EXOA 4HNBA 1OT6A 4M4XA 2ZQ8A 4EERA 2V0UA 1EW0A 3T1SA 4QU3A 3MQ0A 4UA9A 4OKPA 4RQ9A 4RX2A 1VETA 3ZQ5A 2PYRA 5MC7A 4NXFA 4R3BA 2WUQA 3O86A 5DKKA 3LI9A 4JXVA 2ZM0A 4E3IA 4UEYA 1YAXA 3N8RA 4S2NC 2X01A 3IBRA 1D1JA 1UGUA 2JKRI 3HBRA 2VV6A 1W8YA 2Y2MA 4EW7A 1FIKA 1I5QA 2Y2HA 1L0DA 4RA7A 4OVDA 1MWSA 3NJAA 4JLFA 3FPVA 4X1LA 3HLEA 3F1NA 3SS4A 1NY0A 5JYPA 1T1BA 4DDYA 3CWFA 3IF6C 1PZOA 2X02A 4QPRA 1M6KA 4IUKA 5D3OA 4R4RA 3G34A 2O9BA 3ZVTA 3MBZA 5IS1A 2O99A 1E3UD 1EI5A 2L4RA 2KLIA 3P09A 4GHIB 3O3VA 4MMNA 3S1YA 2X71A 5CEBA 1K54A 2P9VB 4EBNA 1OTBA 3S22A 2FH5A 3FKVA 5U47A 1GA9A 4JF4A 4BLMA 3VOLA 4LV0A 1OJGA 1ERQA 3BFEA 2OAQ1 4KQOA 3F1OB 4WEJA 3P98A 3PBSA 1NWZA 4KZ7A 3BY8A 2XD1A 2Y2OA 1H8MA 4IBXA 1AXBA 5CHJA 5EE8A 1KOUA 1ES2A 4LV2A 2H0TA 3L7HA 2HDSA 1S6RA 2L1MA 1RP5A 4MN5A 4X53A 2XA7M 1JVJA 4C6YA 2ZJ9A 2XROA 4YNRA 4BL3A 5IT5A 5TR7A 4U0TA 3VE3A 1TVFA 2A24B 1FQGA 4P6BA 1NYMA 1XXMA 3PBNA 3CI6A 4I38A 3QHYA 1MWRA 2WADA 2O9AA 4R1GA 4O7DA 2VA0A 1D06A 2ZD8A 3N7WA 1N9BA 4I39A 4H6JB 3IH8A 5FI2A 5A8BA 4GHIA 3NY4A 3LR5A 3O87A 3MKEA 2PD8A 1S4RA 2Z6DA 4LGWA 3KX0X 4B4ZA 3BM6A 4A5RA 3EQVA 1K4FA 3CAXA 4KZ3A 1BT5A 3QP2A 3JVUA 4ZTKA 3ZDJA 4JF6A 3NULA 2IWDA 4G3WA 4L9EA 2VKSA 5HWVA 3WS4A 1JNUA 1T19A 1H0MA 1KGGA 4QY5A 4DRTA 3QNCA 2D02A 3IHAA 1TS8A 4MCWA 2WGWB 1WE4A 4GN2A 4HJ6A 4U0XA 5F6AA 2Q0OA 1ODVA 2LB9A 4RYEA 3O88A 2Y8HA 2XFSA 4S2JA 4DE2A 2V8FA 3UPNA 3D4FA 4LFUA 2C6WB 3QP1A 1CI9A 3C4PA 3HREA 2P9VA 3CUEC 3LCEA 1P9WA 2M7VA 3G2ZA 3BLSA 4XXRA 3IT9A 2NUPC 3UB9A 5TFQA 1K6RA 4I3IA 1G5UA 1HZOA 1LL8A 4OOLA 4MN7A 3Q7ZA 1GCEA 4GD8A 2Q9NA 4KZ4A 4Y5FA 5CX7A 1F2KA 3LIFA 4DE0A 4QB8A 1JTGA 2P04A 3C4OA 2VEAA 4HI4A 2I9VA 2ZMAA 3OPPA 1N9OA 5FAPA 3UE6A 1ZTUA 1K56D 2WKQA 3OOVA 5CHMA 4LRZE 1PI4A 1KDSA 2EX8A 1PW8A 1KE4A 2EWVA 3CUEA 1LHYA 2OSUA 3ZYTA 4ARZA 3FG8A 3MF0A 5M18A 3NBLA 4YFMA 3CPTB 2XDMA 4OP8A 3R4KA 4GW9A 3I7JA 3UY6A 1ESIA 4E3NA 1ERMA 3C7VA 4HP9A 3FKWA 4Q8IA 1BSGA 1Y54A 2EFUA 5GHXA 4II7A 1DP6A 3DBAA 2WKRA 4DXBA 3E0YA 3S7OA 2ZC7A 4GOGA 3EGXC 2PR5A 1KGEA 4P6ZM 3MSHA 4X56A 4GD6A 4EETB 5EVIC 2WKEA 3LIDA 3A3IA 1XJ4A 3GVBA 4BBUA 1XA7A 4PM6A 5I94A 4KZ5A 1OT9A 5CGSA 4S2PA 4N9KA 1MWUA 4FH4A 2IWCA 3KYEA 3N6IA 2ZC5B 5FL3A 1RCJA 5G18A 2Y2KA 5HD5A 2Y2GA 1FCOA 3ZNTA 3MKFA 2JN7A 1JTDA 1F5MA 3K3CA 3NOUC 3NDEA 5CRFA 1XGIA 2HDRA 4FH2A 1LLBA 3GTCA 4BENA 1NLYA 1SHVA 4X1MA 4D60A 5DF9A 3C30A 4O01A 2OAP1 3HLFA 3MZFA 3ZG0A 5AVFA 1CF0A 4C3QA 5CEDA 3TW8A 3UE3A 1FCNA 1T1AA 3IS2A 5F5YA 5FQKA 1LL5A 3VP3A 2JKFA 2XSSA 4ZRRA 3JVVA 3VP0A 4GZBA 5GL9A 5CXWA 4FTXA 2C5WB 3M6HA 4DJ3A 2VV8A 5TBMB 1DJCA 3UE0A 3MZEA 3LR3A 1YSQA 2QZ6A 4CLCD 3CLOA 1I2WA 2ZQDA 1IEMA 3KO6A 1N4OA 1PRQA 1E25A 1XKZA 4EUZA 3G2YA 4PM5A 2DCFA 5HDSA 4OPZA 3IQAA 2WGVA 3SS5A 3UN7A 2D01A 3QP4A 1DJAA 1XJ6A 1N9LA 2HGVA 3ISGA 1XJ3A 4CLCA 2J3TD 3PBOA 5TBMA 3S7PA 3QNBA 4BD1A 3CG5A 5DFYA 3T50A 3SZTA 2XA7S 3BWLA 4P87A 2J7VA 5HWTA 4ME4A 5I5LA 4R0QA 2WKPA 3V50A 1S4SA 3R7WA 4IHQA 5EUAA 1JWPA 3IWQA 4Q0HA 3VFFA 2ACGA 3SW1A 3PHYA 1L0FA 4PPRA 4MDZA 3HJIA 1V9ZA 4OLDA 1GSVA 2QWSA 4M3KA 3F1PB 2XH9A 5GLDA 3A0RA 3BFDA 3LIEA 2WZXA 3D9YA 4JXGA 2ZBBA 5J7EA 2DNSA 3DTKA 1K4EA 2PU2A 2WYXA 1HVBA 4R38A 1YLYA 3R7WB 1MWTA 3CITA 3MZDA 4HHDA 1S1ZA 2Z2LB 1D7EA 4HH3A 5HX9A 1U60A 3CZDA 4U3TA 4PHTA 1MY8A 2PHYA 4FOFA 3BEBA 2HP6A 3UO9A 3IF6B 2V1BA 3LIAA 2JKGA 2VGLM 3GR2A 4X25A 1HD8A 2PBYA 3SOIA 5HW3A 3LEZA 2B18A 4OQHA 5GLBA 2JKTM 3NCKA 3ZCZA 3UPOA 5HSQA 4C75A 2PR6A 4ZJ2A 3IWOA 3IHBA 3FWLA 2GDNA 5DF8A 4GKUA 5FAQA 2ZOHA 1KE3A 4AFIA 3UDIA 1K56A 4Y7PA 1LI9A 3V3RA 4IJGA 3ZG8B 2W3GA 5DJUA 4KZ6A 1OMEA 4GDNA 3HLBA 4E6WA 1BTLA 2RL3A 1G6OA 5FATA 4EUVA 4BWIA 1Z6FA 1OTAA 4PAUA 3NOTC 4BD0A 3LO7A 3UE1A 4F94A 5AJGA 5J4EA 2P7JA 1XX2A 5M1AA 3PBTA 4YWZA 4WELA 3ZNYA 2HDQA 2EFXA 1NZUA 3UB8A 2O0YA 1S0WA 3DTIA 3W2ZA 4GLQA 1SKOB 5HD3A 3PR6A 3U2AA 4ZAMA 3LICA 3LR0A 2Y4AA 4MEZA 1ES3A 4B88A 2B5RA 1W8QA 2V0WA 1BYWA 4XUXA 4ESPA 3T4TA 5A91A 2V1AA 3HUMA 2K7SA 1FILA 4JBFA 1NLZA 4CPKA 2W1TA 1O07A 1K0KA 3ZG5A 2UV0E 3WWXA 3B33A 3ITAA 5FI7A 3KSIA 1XGJA 5G4ZA 4HH2A 4HQAA 5FAOA 2HV1A 4QWOA 5KZHA 2B95A 4KG5A 4WLAA 2V2FF 4E3LA 2Y2JA 2JKTI 2ZC4B 5CTNA 3S7QA 5EFWA 4R3AA 1PW1A 3M6BA 4R70A 2Y2QA 1IYPA 4NXGA 3T12B 5BOHA 4K0XA 1SDNA 2PRFA 3DW0A 2ZQ9A 1ZG6A 2O9CA 5GLAA 3F1OA 3IS2B 1TS6A 2DRWA 5J3WA 4CLCE 4JXWA 5G4YA 1YLZA 2WZZA 4OH0A 1GSWA 4WYYA 4Y0UA 3BFFA 2B02A 2W0NA 1CEGA 1W5DA 2OLVA 1CEFA 2ZM2A 4OOMA 1H8ZA 5F1GA 3TRCA 2IWBA 3KYZA 2ZC3B 3UDXA 3ULFA 3IH9A 4P85A 1TDGA 2XLNA 3GDIA 1W79A 5E43A 4CJNA 2FZ0A 3HLGA 2JE5A 1GHMA 3A0SA 4GS9B 1K6SA 3WS1A 4WUJA 4E6XA 3E98A 3UMEA 5F1FA 4GNUA 5KIZA 4MNRA 2R9WA 4EEUA 4OPRA 2IA2A 3C8CA 3V3SA 3N8LA 5EPHA 3DWKA 4OPYA 4Z9QA 3IX3A 4BBVA 3ZFZA 1WA9A 5F68A 4OPQA 2Y2PA 5E2EA 4EU0A 4KG6A 2P08A 4QHCA 3EQUA 3TSGA 2XEPA 1NYYA 1ZKJA 1IYQA 3V39A 1YSPA 1BLCA 3LI8A 3Q81A 1S67L 4YOFA 4K08A 2YKHA 4MLLA 4B9OA 3OLOA 2Y91A 3DTEA 5FQ9A 5FQQA 3VMAA 2VGJA 2YKFA 3QP6A 4GB7A 1TEMA 4E3KA 4QJGA 3VP2A 4JGOA 1G6AA 4LV1A 4BQMA 1LSWA 4EQ1A 3IXDA 3MQOA 2BTFP 1OPXA 1V9YA 2K2NA 4NETA 1IKGA 4UQIM 3IF6A 1F9IA 3WRTA 4Y17A 4JGQA 2OWJA 4IEDA 3LY4A 1XPBA 4KQDA 1FCMA 5HDDA 5HPIA 3EOIA 2W3DA 4WBGA 1XJ2A 2HJEA 5FA7A 1SCWA 4PM8A 1GA0A 4XT2A 5EVEA 1O7EA 4F3LB 5DVAA 4LCLA 4UAAA 4EEPA 5KMWA 3F1PA 4ZBEA 3SH8A 1MZUA 1YMSA 4K0WA 1YPRA 1K57A 4FSFA 5AQBA 4DE3A 3BQAA 4DF6A 2DMWA 5DTTA 4P6ZS 5CERA 1BLPA 2J3WA 1YLTA 1P97A 2Y55A 4MBKA 1K38A 2HP9A 4Q0IA 4EWFA 4HJ3A 4N9LA 1H5XA 2Y2LA 1DJBA 2Z6CA 2W3FA 1K25A 4E3OA 1TD5A 1N9NA 1AWIA 2J9PA 2JBFA 2LB5A 5FASA 1VEUB 3CMZA 1JWVA 4UA7A 3MXRA 3E4QA 4MBFA 5FDSA 1I2SA 3G35A 5EVIB 5DF7A 4H8RA 3KSGA 1G28A 4OQ0A 2FFYA 2ZL1B 4LENA 1PYYA 1DP9A 2KDKA 3TOIA 3A0VA 2HPBA 5E2HA 3OPRA 2E8JA 4CLCB 1VETB
chains in the Genus database with same CATH topology
1PWCA 3Q82A 4JXGA 2XD1A 2Y2OA 4IBXA 4OQGA 1AXBA 4X55A 4X6TA 4YINA 2DNSA 3RXXA 5CHJA 5EE8A 4ZJ1A 1ES2A 1K4EA 2PU2A 4LV2A 2H0TA 3ZVWA 3ZG7B 2WYXA 1IKIA 1HVBA 1YLYA 1RGYA 4KG2A 2HDSA 1S6RA 1MWTA 3UNWA 3G30A 1QMEA 1RP5A 3G4PA 5HFOA 4WEKA 3MZDA 1YLWA 5FQIA 3GSGA 4X53A 2Z2LB 1NZOA 3PBRA 1JVJA 1U60A 5HX9A 4C6YA 3IXGA 3CZDA 4U3TA 2UWXA 2ZJ9A 1MY8A 5CECA 4BL3A 3NC8A 2QPNA 3BEBA 2HP6A 3UO9A 5TR7A 4S2NA 3IF6B 4U0TA 1TVFA 1FQGA 3PBQA 4P6BA 5HL1A 1NYMA 1XXMA 3GR2A 3PBNA 1HD8A 2PBYA 3OZHA 2OV5A 3TG9A 1YMXA 5EVIA 3SOIA 2JCHA 5HW3A 1XP4A 3HLDA 1MWRA 2ZLYA 3LEZA 3QHYA 2WADA 4OQHA 5FQMA 5GLBA 3BFGA 4EBPA 4R1GA 3NCKA 4O7DA 3ZCZA 4E3JA 4PM9A 3UPOA 2ZD8A 4C75A 3N7WA 1N9BA 4E3MA 4KQRA 4ZJ2A 1ONHA 4BJPA 1PWGA 3IF5A 3IH8A 3IWOA 3IHBA 3FWLA 2GDNA 2EX9A 5DF8A 5FI2A 4GKUA 4Y0OA 5FAQA 5HAIA 4D2OA 5GHZA 4JKTA 1KE3A 3NY4A 1CI8A 3UDIA 3HUOA 3O87A 4HESA 1K56A 4Y7PA 3S4XA 5M19A 1J9MA 1LI9A 4P0MA 3V3RA 4OLGA 3MKEA 5E2FA 3ZG8B 1ZG4A 1RGZA 3HVFA 5J8XA 5EVID 1G68A 1C3BA 1YM1A 4KZ6A 1OMEA 4GDNA 3HLBA 2P74A 1FOFA 4E6WA 1NRFA 4JF5A 3W4QA 3Q1FA 3Q7VA 4OOYA 4B4ZA 1BTLA 3BM6A 2RL3A 5FATA 3ZHHA 5A93A 1K57C 4MBHA 3W8KA 1EWZA 4S2OA 4A5RA 1Z6FA 3EQVA 1K4FA 3ZG9B 4BD0A 4KZ3A 3LO7A 3UE1A 4F94A 2OLUA 1MXOA 1XX2A 5M1AA 1BT5A 3NDGA 4ZTKA 3PBTA 4WELA 3ZDJA 4JF6A 5HAPA 5KSCA 3ZNYA 2ZC6B 2IWDA 1E3UA 2HDQA 3PAGA 4R4SA 5L2FA 2EFXA 1NZUA 4IVIA 1S0WA 3HLCA 3PTEA 4KZ9A 1W7FA 1PIOA 4R3JA 4ZAMA 3WS4A 2VGKA 1KGFA 2WKHA 5FQJA 2Y4AA 1KGGA 2ZQCA 4EQIA 4MEZA 4IBRA 4QY5A 4DRTA 3QNCA 3A3FA 4N1HA 3IHAA 1ES3A 4B88A 4N1XA 2B5RA 2JC7A 1FSWA 1W8QA 1KVMA 3BLMA 3E2LA 5F83A 2WGWB 1WE4A 3IWIA 4GN2A 4U0XA 4XUXA 5FDHA 3VOYA 2XGNA 3Q7VB 4RYEA 3O88A 4N92A 2J9OA 1L0GA 1NJ4A 3C5AA 1ONGA 1L2SA 2XFSA 4S2JA 5A91A 3HUMA 1ESUA 1YLJA 4DE2A 2A49A 3UPNA 4JBFA 4PM7A 3D4FA 3OCLA 2C6WB 1CI9A 3C4PA 4OQIA 3OPLA 4GDBA 3HREA 4CPKA 2XQZA 4LCMA 2BLSA 1O07A 2Y2IA 2P9VA 3LCEA 3ZG5A 1FSYA 3WS5A 4DXCA 4ZDXA 2PU4A 3G2ZA 3BLSA 4XXRA 3IT9A 5F82A 2V1ZA 3GMWA 5TFQA 3BECA 3WWXA 1YQSA 3ITAA 5FI7A 1K6RA 5CGXA 5DTSA 1HZOA 4KZAA 1XGJA 2H5SA 5FAOA 2HP5A 4OOLA 1WYCA 3Q7ZA 5KZHA 3WRZA 4KG5A 1GCEA 4GD8A 2Q9NA 3GRJA 4KZ4A 1KDWA 2R9XA 2WGIA 3E2KA 2V2FF 4HBUA 5TGFA 4E3LA 1VQQA 2Y2JA 1BLSA 4DE0A 4QB8A 3N8SA 1JTGA 4X68A 5A92A 2ZC4B 5CTNA 3C4OA 1ES4A 1PW1A 3M6BA 2Y2QA 1IYPA 4R23A 2WAFA 3HLWA 3PAEA 5BOHA 2ZMAA 3OPPA 4K0XA 5AQ7A 1SDNA 5FAPA 3VSLA 3DW0A 1IELA 2ZQ9A 1ZG6A 4Y0TA 3B3XA 2WKIA 3RJUA 1K56D 5CHMA 5GLAA 4B4XA 1PI4A 3A3DA 3HL9A 4JXSA 3VFHA 2DRWA 1KDSA 5IHVA 4JXWA 2EX8A 4FD8A 1YLZA 2WZZA 4OH0A 1PW8A 4WZ5C 1KE4A 4LV3A 4QD4A 4WYYA 4Y0UA 4ID4A 3WS0A 4EV4A 2EXBA 3BFFA 1LHYA 2QMIA 1FR6A 2OSUA 5M18A 1CEGA 3OCNA 1XA1A 5GHYA 3HUNA 3NBLA 4YFMA 1W5DA 3G31A 2XDMA 4OP8A 1BULA 2OLVA 4OP5A 4OONA 2Z2MB 1CEFA 2ZM2A 3C7UA 4NK3A 3FZCA 4OOMA 5EECA 3I7JA 1H8ZA 5F1GA 3UY6A 1ESIA 1QMFA 4E3NA 2ZQAA 4KZ8A 2IWBA 1ES5A 1ERMA 3C7VA 4IVKA 2ZC3B 2Q9MA 5AQAA 3UDXA 2H10A 3FKWA 4Q8IA 1BSGA 1Y54A 2EFUA 5GHXA 3DWZA 5FI6A 4ZJ3A 1PZPA 3IH9A 4P85A 4WMCD 1PWDA 1TDGA 2XLNA 1W79A 4DXBA 5E43A 4CJNA 4S2LA 2I72A 3CJMA 3DTMA 3N4IA 3NIAA 3BRMA 2ZC7A 3HLGA 1JWZA 1GHMA 2JE5A 3IXHA 1K6SA 2EXAA 4GOGA 3WS1A 1BUEA 1KGEA 3ITBA 3OC2A 4E6XA 1K54C 1IYSA 3W4OA 5GLCA 5F1FA 4X56A 4GNUA 4GD6A 3AGDA 1LI0A 4S2IA 5EVIC 3WS2A 2WKEA 2EX6A 4MNRA 2R9WA 2G2WA 3FV7A 3A3IA 4OPRA 4RVAA 1TDLA 3SS3A 3VOZA 3GVBA 3AGEA 1XA7A 5DTKA 1YT4A 3N8LA 3V3SA 4PM6A 1ZC2A 5EPHA 3A3EA 3DWKA 4JPMA 4OPYA 4Z9QA 1MKIA 4DDSA 3ZFZA 3IXBA 4WMCA 5I94A 4KZ5A 2HDUA 4OPQA 2Y2PA 1BZAA 1LL9A 5E2EA 1H8YA 2XF3A 3OPHA 5CGSA 5HAQA 3MFDA 4N9KA 4S2PA 4KG6A 2H0YA 1DY6A 1MWUA 1VM1A 4FH4A 1WYBA 4HEFA 4QHCA 2IWCA 2FFFB 3EQUA 2J8YA 3JYIA 2XK1A 3N6IA 3TSGA 3MXSA 4PMAA 3BYDA 2ZC5B 2XEPA 2Y2NA 1RCJA 4WZ4A 3ZGAB 1NYYA 5G18A 5A90A 2WGWA 2Y2KA 4KZBA 2Y2GA 1ZKJA 1IYQA 1MPLA 1EROA 1K55A 3G32A 4XUZA 3V39A 1FCOA 1GHIA 3ZNTA 3MKFA 1BLCA 1KE0A 1JTDA 2EX2A 3Q81A 3NDEA 1SKFA 4KQQA 5CRFA 1XGIA 2HDRA 3M2KA 4FH2A 1LLBA 3GTCA 5EVLA 4MLLA 4BENA 1SHVA 5DF9A 2WK0A 2Y91A 2Y59A 5FQ9A 5FQQA 1CK3A 4KENB 3HLFA 3MZFA 1IYOA 3ZG0A 3VMAA 2VGJA 4S2KA 5AQ9A 4C3QA 5CEDA 3M2JA 3RXWA 4GB7A 3UE3A 1TEMA 2G2UA 4E3KA 1FCNA 3UDFA 4QJGA 3VP2A 4X69A 2E8IA 1G6AA 2WAEA 2ZM8A 5KSHA 4LV1A 4L0LA 4BQMA 5FQKA 3BFCA 3IXDA 2ZQ8A 3UPPA 3Q07A 1K55C 1LL5A 2A3UA 2V20A 1HTZA 1M40A 3VP3A 3W4PA 4DE1A 1BLHA 3VP0A 4GZBA 4NETA 4QU3A 5GL9A 5CXWA 1IKGA 2C5WB 4UA9A 4OKPA 3M6HA 4RX2A 5E2GA 3IF6A 4R3BA 3WRTA 2WUQA 1DJCA 4WZ5A 3UE0A 3O86A 3MZEA 5CHUA 2XR0A 4IEDA 2QZ6A 3LY4A 1XPBA 4JXVA 2ZM0A 1I2WA 1FCMA 4E3IA 2ZQDA 1IEMA 1KVLA 3N8RA 4HBTA 4K91A 4WBGA 1N4OA 1YLPA 1E25A 1XKZA 4S2NC 2X01A 5FA7A 4EUZA 3G2YA 1SCWA 4PM5A 2DCFA 4PM8A 4QY6A 1GA0A 3HBRA 4OPZA 5EOOA 2CC1A 3IQAA 3SH7A 2WGVA 1W8YA 2Y2MA 3SS5A 4DKIA 3FYZA 1O7EA 3UN7A 5DVAA 4LCLA 1I5QA 2Y2HA 4UAAA 5KMWA 1L0DA 4RA7A 4OVDA 1DJAA 1L0EA 5JYOA 1MWSA 4JLFA 4ZBEA 3GV9A 3SH8A 3ISGA 1MBLA 1YMSA 2XD5A 3HLEA 4K0WA 5CTMA 3GQZA 1K57A 4FSFA 5AQBA 4DE3A 3A3JA 3SS4A 1NY0A 4DF6A 4S2MA 4DDYA 5JYPA 5DTTA 2XFTA 1BLPA 2ZQ7A 3IF6C 3PBOA 1YLTA 5CERA 3VP4A 1PZOA 2X02A 5D3OA 1M6KA 3SH9A 4EBLA 2Y55A 4R4RA 5CGWA 3G34A 4MBKA 3ZVTA 1K38A 3MBZA 3QNBA 1Q2PA 4BD1A 2HP9A 3CG5A 4FCFA 1E3UD 3AGFA 4EWFA 1EI5A 3LY3A 4P87A 2J7VA 4N9LA 4RX3A 1PI5A 4BL2A 3P09A 1H5XA 3O3VA 4R0QA 4UA6A 5FSRA 2Y2LA 3S1YA 3V50A 1DJBA 2X71A 5CEBA 1K54A 1GHPA 5EUAA 1K25A 4E3OA 1JWPA 3IWQA 2RCXA 2J9PA 2JBFA 2P9VB 5EOEA 4EBNA 5FASA 3S22A 3VFFA 3FKVA 5HARA 1L0FA 5U47A 1GA9A 1JWVA 3CMZA 4PPRA 4UA7A 4UHUA 3MXRA 3V5MA 4MBFA 4JF4A 1I2SA 3G35A 4OLDA 5EVIB 5DF7A 1E4DA 4LV0A 3VP1A 4BLMA 1ALQA 1ERQA 4H8RA 3BFEA 4KQOA 4M3KA 1NXYA 4OQ0A 4WEJA 1Q2QA 2XH9A 1SDEA 2FFYA 2BG1A 3P98A 4LENA 5GLDA 1FR1A 3VSKA 1PYYA 3NI9A 3PBSA 4WM9A 3TOIA 2HPBA 5E2HA 4KZ7A 3OPRA 3BFDA 2WZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWC A;  3Q82 A;  4JXG A;  2XD1 A;  2Y2O A;  4IBX A;  4OQG A;  1AXB A;  4X55 A;  4X6T A;  4YIN A;  2DNS A;  3RXX A;  5CHJ A;  5EE8 A;  4ZJ1 A;  1ES2 A;  1K4E A;  2PU2 A;  4LV2 A;  2H0T A;  3ZVW A;  3ZG7 B;  2WYX A;  1IKI A;  1HVB A;  1YLY A;  1RGY A;  4KG2 A;  2HDS A;  1S6R A;  1MWT A;  3UNW A;  3G30 A;  1QME A;  1RP5 A;  3G4P A;  5HFO A;  4WEK A;  3MZD A;  1YLW A;  5FQI A;  3GSG A;  4X53 A;  2Z2L B;  1NZO A;  3PBR A;  1JVJ A;  1U60 A;  5HX9 A;  4C6Y A;  3IXG A;  3CZD A;  4U3T A;  2UWX A;  2ZJ9 A;  1MY8 A;  5CEC A;  4BL3 A;  3NC8 A;  2QPN A;  3BEB A;  2HP6 A;  3UO9 A;  5TR7 A;  4S2N A;  3IF6 B;  4U0T A;  1TVF A;  1FQG A;  3PBQ A;  4P6B A;  5HL1 A;  1NYM A;  1XXM A;  3GR2 A;  3PBN A;  1HD8 A;  2PBY A;  3OZH A;  2OV5 A;  3TG9 A;  1YMX A;  5EVI A;  3SOI A;  2JCH A;  5HW3 A;  1XP4 A;  3HLD A;  1MWR A;  2ZLY A;  3LEZ A;  3QHY A;  2WAD A;  4OQH A;  5FQM A;  5GLB A;  3BFG A;  4EBP A;  4R1G A;  3NCK A;  4O7D A;  3ZCZ A;  4E3J A;  4PM9 A;  3UPO A;  2ZD8 A;  4C75 A;  3N7W A;  1N9B A;  4E3M A;  4KQR A;  4ZJ2 A;  1ONH A;  4BJP A;  1PWG A;  3IF5 A;  3IH8 A;  3IWO A;  3IHB A;  3FWL A;  2GDN A;  2EX9 A;  5DF8 A;  5FI2 A;  4GKU A;  4Y0O A;  5FAQ A;  5HAI A;  4D2O A;  5GHZ A;  4JKT A;  1KE3 A;  3NY4 A;  1CI8 A;  3UDI A;  3HUO A;  3O87 A;  4HES A;  1K56 A;  4Y7P A;  3S4X A;  5M19 A;  1J9M A;  1LI9 A;  4P0M A;  3V3R A;  4OLG A;  3MKE A;  5E2F A;  3ZG8 B;  1ZG4 A;  1RGZ A;  3HVF A;  5J8X A;  5EVI D;  1G68 A;  1C3B A;  1YM1 A;  4KZ6 A;  1OME A;  4GDN A;  3HLB A;  2P74 A;  1FOF A;  4E6W A;  1NRF A;  4JF5 A;  3W4Q A;  3Q1F A;  3Q7V A;  4OOY A;  4B4Z A;  1BTL A;  3BM6 A;  2RL3 A;  5FAT A;  3ZHH A;  5A93 A;  1K57 C;  4MBH A;  3W8K A;  1EWZ A;  4S2O A;  4A5R A;  1Z6F A;  3EQV A;  1K4F A;  3ZG9 B;  4BD0 A;  4KZ3 A;  3LO7 A;  3UE1 A;  4F94 A;  2OLU A;  1MXO A;  1XX2 A;  5M1A A;  1BT5 A;  3NDG A;  4ZTK A;  3PBT A;  4WEL A;  3ZDJ A;  4JF6 A;  5HAP A;  5KSC A;  3ZNY A;  2ZC6 B;  2IWD A;  1E3U A;  2HDQ A;  3PAG A;  4R4S A;  5L2F A;  2EFX A;  1NZU A;  4IVI A;  1S0W A;  3HLC A;  3PTE A;  4KZ9 A;  1W7F A;  1PIO A;  4R3J A;  4ZAM A;  3WS4 A;  2VGK A;  1KGF A;  2WKH A;  5FQJ A;  2Y4A A;  1KGG A;  2ZQC A;  4EQI A;  4MEZ A;  4IBR A;  4QY5 A;  4DRT A;  3QNC A;  3A3F A;  4N1H A;  3IHA A;  1ES3 A;  4B88 A;  4N1X A;  2B5R A;  2JC7 A;  1FSW A;  1W8Q A;  1KVM A;  3BLM A;  3E2L A;  5F83 A;  2WGW B;  1WE4 A;  3IWI A;  4GN2 A;  4U0X A;  4XUX A;  5FDH A;  3VOY A;  2XGN A;  3Q7V B;  4RYE A;  3O88 A;  4N92 A;  2J9O A;  1L0G A;  1NJ4 A;  3C5A A;  1ONG A;  1L2S A;  2XFS A;  4S2J A;  5A91 A;  3HUM A;  1ESU A;  1YLJ A;  4DE2 A;  2A49 A;  3UPN A;  4JBF A;  4PM7 A;  3D4F A;  3OCL A;  2C6W B;  1CI9 A;  3C4P A;  4OQI A;  3OPL A;  4GDB A;  3HRE A;  4CPK A;  2XQZ A;  4LCM A;  2BLS A;  1O07 A;  2Y2I A;  2P9V A;  3LCE A;  3ZG5 A;  1FSY A;  3WS5 A;  4DXC A;  4ZDX A;  2PU4 A;  3G2Z A;  3BLS A;  4XXR A;  3IT9 A;  5F82 A;  2V1Z A;  3GMW A;  5TFQ A;  3BEC A;  3WWX A;  1YQS A;  3ITA A;  5FI7 A;  1K6R A;  5CGX A;  5DTS A;  1HZO A;  4KZA A;  1XGJ A;  2H5S A;  5FAO A;  2HP5 A;  4OOL A;  1WYC A;  3Q7Z A;  5KZH A;  3WRZ A;  4KG5 A;  1GCE A;  4GD8 A;  2Q9N A;  3GRJ A;  4KZ4 A;  1KDW A;  2R9X A;  2WGI A;  3E2K A;  2V2F F;  4HBU A;  5TGF A;  4E3L A;  1VQQ A;  2Y2J A;  1BLS A;  4DE0 A;  4QB8 A;  3N8S A;  1JTG A;  4X68 A;  5A92 A;  2ZC4 B;  5CTN A;  3C4O A;  1ES4 A;  1PW1 A;  3M6B A;  2Y2Q A;  1IYP A;  4R23 A;  2WAF A;  3HLW A;  3PAE A;  5BOH A;  2ZMA A;  3OPP A;  4K0X A;  5AQ7 A;  1SDN A;  5FAP A;  3VSL A;  3DW0 A;  1IEL A;  2ZQ9 A;  1ZG6 A;  4Y0T A;  3B3X A;  2WKI A;  3RJU A;  1K56 D;  5CHM A;  5GLA A;  4B4X A;  1PI4 A;  3A3D A;  3HL9 A;  4JXS A;  3VFH A;  2DRW A;  1KDS A;  5IHV A;  4JXW A;  2EX8 A;  4FD8 A;  1YLZ A;  2WZZ A;  4OH0 A;  1PW8 A;  4WZ5 C;  1KE4 A;  4LV3 A;  4QD4 A;  4WYY A;  4Y0U A;  4ID4 A;  3WS0 A;  4EV4 A;  2EXB A;  3BFF A;  1LHY A;  2QMI A;  1FR6 A;  2OSU A;  5M18 A;  1CEG A;  3OCN A;  1XA1 A;  5GHY A;  3HUN A;  3NBL A;  4YFM A;  1W5D A;  3G31 A;  2XDM A;  4OP8 A;  1BUL A;  2OLV A;  4OP5 A;  4OON A;  2Z2M B;  1CEF A;  2ZM2 A;  3C7U A;  4NK3 A;  3FZC A;  4OOM A;  5EEC A;  3I7J A;  1H8Z A;  5F1G A;  3UY6 A;  1ESI A;  1QMF A;  4E3N A;  2ZQA A;  4KZ8 A;  2IWB A;  1ES5 A;  1ERM A;  3C7V A;  4IVK A;  2ZC3 B;  2Q9M A;  5AQA A;  3UDX A;  2H10 A;  3FKW A;  4Q8I A;  1BSG A;  1Y54 A;  2EFU A;  5GHX A;  3DWZ A;  5FI6 A;  4ZJ3 A;  1PZP A;  3IH9 A;  4P85 A;  4WMC D;  1PWD A;  1TDG A;  2XLN A;  1W79 A;  4DXB A;  5E43 A;  4CJN A;  4S2L A;  2I72 A;  3CJM A;  3DTM A;  3N4I A;  3NIA A;  3BRM A;  2ZC7 A;  3HLG A;  1JWZ A;  1GHM A;  2JE5 A;  3IXH A;  1K6S A;  2EXA A;  4GOG A;  3WS1 A;  1BUE A;  1KGE A;  3ITB A;  3OC2 A;  4E6X A;  1K54 C;  1IYS A;  3W4O A;  5GLC A;  5F1F A;  4X56 A;  4GNU A;  4GD6 A;  3AGD A;  1LI0 A;  4S2I A;  5EVI C;  3WS2 A;  2WKE A;  2EX6 A;  4MNR A;  2R9W A;  2G2W A;  3FV7 A;  3A3I A;  4OPR A;  4RVA A;  1TDL A;  3SS3 A;  3VOZ A;  3GVB A;  3AGE A;  1XA7 A;  5DTK A;  1YT4 A;  3N8L A;  3V3S A;  4PM6 A;  1ZC2 A;  5EPH A;  3A3E A;  3DWK A;  4JPM A;  4OPY A;  4Z9Q A;  1MKI A;  4DDS A;  3ZFZ A;  3IXB A;  4WMC A;  5I94 A;  4KZ5 A;  2HDU A;  4OPQ A;  2Y2P A;  1BZA A;  1LL9 A;  5E2E A;  1H8Y A;  2XF3 A;  3OPH A;  5CGS A;  5HAQ A;  3MFD A;  4N9K A;  4S2P A;  4KG6 A;  2H0Y A;  1DY6 A;  1MWU A;  1VM1 A;  4FH4 A;  1WYB A;  4HEF A;  4QHC A;  2IWC A;  2FFF B;  3EQU A;  2J8Y A;  3JYI A;  2XK1 A;  3N6I A;  3TSG A;  3MXS A;  4PMA A;  3BYD A;  2ZC5 B;  2XEP A;  2Y2N A;  1RCJ A;  4WZ4 A;  3ZGA B;  1NYY A;  5G18 A;  5A90 A;  2WGW A;  2Y2K A;  4KZB A;  2Y2G A;  1ZKJ A;  1IYQ A;  1MPL A;  1ERO A;  1K55 A;  3G32 A;  4XUZ A;  3V39 A;  1FCO A;  1GHI A;  3ZNT A;  3MKF A;  1BLC A;  1KE0 A;  1JTD A;  2EX2 A;  3Q81 A;  3NDE A;  1SKF A;  4KQQ A;  5CRF A;  1XGI A;  2HDR A;  3M2K A;  4FH2 A;  1LLB A;  3GTC A;  5EVL A;  4MLL A;  4BEN A;  1SHV A;  5DF9 A;  2WK0 A;  2Y91 A;  2Y59 A;  5FQ9 A;  5FQQ A;  1CK3 A;  4KEN B;  3HLF A;  3MZF A;  1IYO A;  3ZG0 A;  3VMA A;  2VGJ A;  4S2K A;  5AQ9 A;  4C3Q A;  5CED A;  3M2J A;  3RXW A;  4GB7 A;  3UE3 A;  1TEM A;  2G2U A;  4E3K A;  1FCN A;  3UDF A;  4QJG A;  3VP2 A;  4X69 A;  2E8I A;  1G6A A;  2WAE A;  2ZM8 A;  5KSH A;  4LV1 A;  4L0L A;  4BQM A;  5FQK A;  3BFC A;  3IXD A;  2ZQ8 A;  3UPP A;  3Q07 A;  1K55 C;  1LL5 A;  2A3U A;  2V20 A;  1HTZ A;  1M40 A;  3VP3 A;  3W4P A;  4DE1 A;  1BLH A;  3VP0 A;  4GZB A;  4NET A;  4QU3 A;  5GL9 A;  5CXW A;  1IKG A;  2C5W B;  4UA9 A;  4OKP A;  3M6H A;  4RX2 A;  5E2G A;  3IF6 A;  4R3B A;  3WRT A;  2WUQ A;  1DJC A;  4WZ5 A;  3UE0 A;  3O86 A;  3MZE A;  5CHU A;  2XR0 A;  4IED A;  2QZ6 A;  3LY4 A;  1XPB A;  4JXV A;  2ZM0 A;  1I2W A;  1FCM A;  4E3I A;  2ZQD A;  1IEM A;  1KVL A;  3N8R A;  4HBT A;  4K91 A;  4WBG A;  1N4O A;  1YLP A;  1E25 A;  1XKZ A;  4S2N C;  2X01 A;  5FA7 A;  4EUZ A;  3G2Y A;  1SCW A;  4PM5 A;  2DCF A;  4PM8 A;  4QY6 A;  1GA0 A;  3HBR A;  4OPZ A;  5EOO A;  2CC1 A;  3IQA A;  3SH7 A;  2WGV A;  1W8Y A;  2Y2M A;  3SS5 A;  4DKI A;  3FYZ A;  1O7E A;  3UN7 A;  5DVA A;  4LCL A;  1I5Q A;  2Y2H A;  4UAA A;  5KMW A;  1L0D A;  4RA7 A;  4OVD A;  1DJA A;  1L0E A;  5JYO A;  1MWS A;  4JLF A;  4ZBE A;  3GV9 A;  3SH8 A;  3ISG A;  1MBL A;  1YMS A;  2XD5 A;  3HLE A;  4K0W A;  5CTM A;  3GQZ A;  1K57 A;  4FSF A;  5AQB A;  4DE3 A;  3A3J A;  3SS4 A;  1NY0 A;  4DF6 A;  4S2M A;  4DDY A;  5JYP A;  5DTT A;  2XFT A;  1BLP A;  2ZQ7 A;  3IF6 C;  3PBO A;  1YLT A;  5CER A;  3VP4 A;  1PZO A;  2X02 A;  5D3O A;  1M6K A;  3SH9 A;  4EBL A;  2Y55 A;  4R4R A;  5CGW A;  3G34 A;  4MBK A;  3ZVT A;  1K38 A;  3MBZ A;  3QNB A;  1Q2P A;  4BD1 A;  2HP9 A;  3CG5 A;  4FCF A;  1E3U D;  3AGF A;  4EWF A;  1EI5 A;  3LY3 A;  4P87 A;  2J7V A;  4N9L A;  4RX3 A;  1PI5 A;  4BL2 A;  3P09 A;  1H5X A;  3O3V A;  4R0Q A;  4UA6 A;  5FSR A;  2Y2L A;  3S1Y A;  3V50 A;  1DJB A;  2X71 A;  5CEB A;  1K54 A;  1GHP A;  5EUA A;  1K25 A;  4E3O A;  1JWP A;  3IWQ A;  2RCX A;  2J9P A;  2JBF A;  2P9V B;  5EOE A;  4EBN A;  5FAS A;  3S22 A;  3VFF A;  3FKV A;  5HAR A;  1L0F A;  5U47 A;  1GA9 A;  1JWV A;  3CMZ A;  4PPR A;  4UA7 A;  4UHU A;  3MXR A;  3V5M A;  4MBF A;  4JF4 A;  1I2S A;  3G35 A;  4OLD A;  5EVI B;  5DF7 A;  1E4D A;  4LV0 A;  3VP1 A;  4BLM A;  1ALQ A;  1ERQ A;  4H8R A;  3BFE A;  4KQO A;  4M3K A;  1NXY A;  4OQ0 A;  4WEJ A;  1Q2Q A;  2XH9 A;  1SDE A;  2FFY A;  2BG1 A;  3P98 A;  4LEN A;  5GLD A;  1FR1 A;  3VSK A;  1PYY A;  3NI9 A;  3PBS A;  4WM9 A;  3TOI A;  2HPB A;  5E2H A;  4KZ7 A;  3OPR A;  3BFD A;  2WZX A; 
#chains in the Genus database with same CATH topology
 1P9R A;  1PWC A;  4OQG A;  3EGD C;  3RXX A;  1NRJ A;  3BY9 A;  1IKI A;  4IUH A;  1T18 A;  1RGY A;  3UNW A;  3G30 A;  3NEC A;  3ICY A;  4WEK A;  1YLW A;  4FUW A;  3GSG A;  5EV0 A;  1NZO A;  1VEU A;  3PBR A;  3IXG A;  2HZ5 A;  2UWX A;  4E04 A;  2QPN A;  1S1Y A;  5HL1 A;  3PBQ A;  5IU1 A;  4GS9 A;  2OV5 A;  3TG9 A;  1YMX A;  1XP4 A;  3HLD A;  5FQM A;  3BFG A;  4ARZ B;  2A2L A;  4E3J A;  5AVE A;  3T1Q B;  1ONH A;  3D72 A;  3IF5 A;  3T4Q A;  2EX9 A;  4Y0O A;  2V8C A;  2MJ6 A;  4JKT A;  1CI8 A;  3HUO A;  4HES A;  5M19 A;  3S4X A;  1RGZ A;  1C3B A;  2P74 A;  3PXP A;  4O0P A;  2GX5 A;  3Q1F A;  3Q7V A;  4OOY A;  5A93 A;  1K57 C;  4MBH A;  1EWZ A;  4R6L A;  4S2O A;  3ZG9 B;  3T1X A;  5KSC A;  2ZC6 B;  4R4S A;  2QJ7 A;  4LPZ A;  4KZ9 A;  2VJW A;  3LR4 A;  3HCY A;  2JHE A;  3B47 A;  2VLG A;  3RTY A;  4EQI A;  4LRX C;  4IBR A;  3A3F A;  4N1H A;  3RFB A;  5F69 A;  4N1X A;  2HF6 A;  2JC7 A;  1FSW A;  2V9A A;  1KVM A;  2J80 A;  3BLM A;  5F83 A;  2XGN A;  2J9O A;  1L0G A;  1NJ4 A;  3C5A A;  1ONG A;  5EM1 A;  1DP8 A;  1SZV A;  1ESU A;  1YLJ A;  1W63 M;  2KOI A;  3OCL A;  2W1T B;  4WF0 A;  2XQZ A;  4LCM A;  1A0K A;  4CLC C;  3WS5 A;  1H3Q A;  2PU4 A;  3G6O A;  1ACF A;  5L10 A;  2V1Z A;  3GMW A;  5TJJ A;  1YQS A;  1HLU P;  5CGX A;  5L07 A;  2EA9 A;  2M1C A;  5HL6 A;  3TE8 A;  4KZA A;  2KX6 A;  2H5S A;  4I3J A;  3D3O A;  2W3E A;  3GRJ A;  2R9X A;  1TF1 A;  4HBU A;  5TGF A;  1IOU A;  3EWK A;  5A92 A;  4X68 A;  4WL9 A;  1ES4 A;  5LBR A;  3HLW A;  5AQ7 A;  3VSL A;  4Y0T A;  1IEL A;  1Y28 A;  2WKI A;  5DKL A;  3HL9 A;  3V67 A;  4CQH A;  5IHV A;  1OTD A;  4FD8 A;  2HJ9 C;  4WZ5 C;  4QD4 A;  3WS0 A;  4EV4 A;  3K3D A;  1FR6 A;  5K5B A;  4Y3I A;  3P7N A;  1XA1 A;  3C2W A;  3G31 A;  3NHQ A;  4OP5 A;  1SKO A;  1OTI A;  3U4L P;  2GNX A;  1J3W A;  1MC0 A;  2ZQA A;  4KZ8 A;  2Q9M A;  4HOI A;  3DWZ A;  4ZJ3 A;  1PZP A;  3T4S A;  4WMC D;  4S2L A;  2I72 A;  3NIA A;  3DTM A;  2G7U A;  3BRM A;  2EXA A;  1BUE A;  3ITB A;  3OC2 A;  5FEF A;  3UB5 P;  2W1R A;  4HJ4 A;  4GCZ A;  3AGD A;  5DJT A;  3F1N B;  4EES A;  5L09 A;  3SS3 A;  3VOZ A;  3BW6 A;  4PKY G;  2VV7 A;  3IX4 A;  1Z09 A;  3EEH A;  1MKI A;  4DDS A;  1IFQ A;  4WMC A;  4DMZ A;  4H6J A;  1LL9 A;  3MFD A;  1MKM A;  1DY6 A;  2J8Y A;  3JYI A;  2XK1 A;  1LSX A;  3MXS A;  3BYD A;  2Y2N A;  4WZ4 A;  1Y4O A;  3ZGA B;  3BQ8 A;  5A90 A;  2GZA A;  2CMN A;  2WGW A;  4XUZ A;  1K55 A;  3KSH A;  2JKR M;  1GHI A;  1KE0 A;  1SKF A;  1YKD A;  3BJN A;  2ZL1 A;  3UB7 A;  2M7U A;  4XT2 B;  1ZHH B;  4KEN B;  3OBF A;  4S2K A;  1UWN X;  5AQ9 A;  2ZOI A;  2G2U A;  3UDF A;  3LFV A;  3EEA A;  2WAE A;  3KYQ A;  4L0L A;  1T1C A;  3BFC A;  5HZH A;  3UB6 A;  3UPP A;  3Q07 A;  1K55 C;  2A3U A;  2V20 A;  1HTZ A;  1M40 A;  3W4P A;  4DE1 A;  1BLH A;  2R78 A;  2VK3 A;  4O8G A;  1DRM A;  2BAS A;  3C38 A;  5E2G A;  1OJ5 A;  4WZ5 A;  4UQI S;  5CHU A;  3FC7 A;  2XR0 A;  1KVL A;  4HBT A;  2PYP A;  4K91 A;  3QP5 A;  1YLP A;  2PDR A;  4QY6 A;  3T4O A;  4PKY A;  5EOO A;  2CC1 A;  3SH7 A;  4DKI A;  4ETZ A;  3CHW P;  3FYZ A;  3JPU A;  5L8M A;  1L0E A;  5JYO A;  3H82 B;  4NXB A;  3GV9 A;  1TS7 A;  1MBL A;  2XD5 A;  5CTM A;  3GQZ A;  3A3J A;  1PFL A;  4S2M A;  1CQA A;  2XFT A;  2ZQ7 A;  3CPT A;  3VP4 A;  3SH9 A;  4EBL A;  5CGW A;  3T4J A;  4HIA A;  1Q2P A;  4FCF A;  3AGF A;  3E4O A;  3LY3 A;  4RX3 A;  1PI5 A;  4DN0 A;  4BL2 A;  1CJF A;  1VHM A;  4UA6 A;  5FSR A;  4G3K A;  1GHP A;  2RCX A;  5EOE A;  5HAR A;  1XFN A;  4B93 A;  4UHU A;  3V5M A;  1X0O A;  1E4D A;  3O5Y A;  3VP1 A;  1ALQ A;  4LRY C;  1NXY A;  5HDC A;  1Q2Q A;  1SDE A;  2BG1 A;  1FR1 A;  3VSK A;  3NI9 A;  4WM9 A;  3T1R A;  3IBJ A;  3LGO A;  3Q82 A;  3H7W B;  4X55 A;  4X6T A;  4YIN A;  4ZJ1 A;  3ZVW A;  1VB6 A;  3ZG7 B;  4KG2 A;  2XRN A;  1QME A;  3G4P A;  5HFO A;  5FQI A;  3MJQ A;  3VV4 A;  2QYB A;  1W63 Q;  5CEC A;  4BBT A;  3NC8 A;  4Y15 A;  2VX8 A;  4S2N A;  4Q0J A;  2QJ5 A;  5C5K A;  3OZH A;  2A24 A;  5EVI A;  2JCH A;  2ZLY A;  4LLO B;  4EBP A;  3KSF A;  1OTE A;  4PM9 A;  4Y2F A;  4E3M A;  4KQR A;  4BJP A;  1PWG A;  5HAI A;  4D2O A;  5GHZ A;  1J9M A;  4P0M A;  4OLG A;  5E2F A;  1ZG4 A;  3HVF A;  5J8X A;  5EVI D;  1G68 A;  1YM1 A;  2NUT C;  1FOF A;  1NRF A;  4JF5 A;  3W4Q A;  3HJK A;  4JGR A;  4Z1W A;  2EWW A;  3ZHH A;  3W8K A;  4NKP A;  3T4L A;  2OLU A;  2QKP A;  1MXO A;  4NXE A;  3NDG A;  5HAP A;  3LUQ A;  5L2F A;  1E3U A;  3PAG A;  3DAV A;  1L3L A;  4IVI A;  3HLC A;  3PTE A;  3H82 A;  3LIB A;  1W7F A;  1PIO A;  4R3J A;  2VGK A;  1KGF A;  2WKH A;  5FQJ A;  2ZQC A;  4L9G A;  1GSX A;  3E2L A;  1F98 A;  3MFX A;  1P0Z A;  3RH8 B;  3IWI A;  5FDH A;  3VOY A;  3Q7V B;  4N92 A;  2PT7 A;  1L2S A;  2W27 A;  4HY8 A;  2A49 A;  4PM7 A;  4OQI A;  3OPL A;  4GDB A;  2BLS A;  2Y2I A;  4HP4 A;  1FSY A;  4DXC A;  4ZDX A;  2PBD P;  5F82 A;  3BEC A;  2GJ3 A;  4I5S A;  5DTS A;  2INW A;  2HP5 A;  2VGL S;  4ETX A;  1WYC A;  3H7W A;  1PNE A;  3WRZ A;  3LYX A;  3LEQ A;  1KDW A;  2WGI A;  3E2K A;  3MQQ A;  1VQQ A;  2H28 A;  2K31 A;  1BLS A;  3N8S A;  3FPW A;  5DFX A;  4Y13 A;  4R23 A;  3T4K A;  2WAF A;  3PAE A;  5HPF A;  2AVX A;  3B42 A;  2QHK A;  3NOP C;  3E4P A;  3B3X A;  1S66 L;  3RJU A;  3IX8 A;  4GJ4 A;  4B4X A;  3A3D A;  4JXS A;  3VFH A;  1LT0 A;  5EM0 A;  3S7N A;  4LV3 A;  4ID4 A;  4NG2 A;  2EXB A;  4MN6 A;  2QMI A;  2OWH A;  3OCN A;  5GHY A;  3H9W A;  3HUN A;  2VZW A;  1BUL A;  4OON A;  2Z2M B;  3C7U A;  3GEC A;  4NK3 A;  3FZC A;  5EEC A;  1QMF A;  1ES5 A;  4IVK A;  5AQA A;  2H10 A;  4JGP A;  5FI6 A;  1PWD A;  3CJM A;  3N4I A;  3IXH A;  1JWZ A;  2J3T C;  3MR0 A;  4NEE D;  1K54 C;  1IYS A;  5HWW A;  3W4O A;  5GLC A;  1LSV A;  3MMH A;  3K2N A;  1LI0 A;  4S2I A;  3WS2 A;  2EX6 A;  4RVA A;  2G2W A;  3FV7 A;  1TDL A;  3PYP A;  4KUO A;  2OOL A;  3AGE A;  5DTK A;  1YT4 A;  2Y79 A;  1ZC2 A;  3A3E A;  4JPM A;  3TJZ C;  3IXB A;  2HDU A;  4F3L A;  1BZA A;  4DJ2 A;  1H8Y A;  2XF3 A;  3OPH A;  5HAQ A;  3P01 A;  2H0Y A;  1VM1 A;  2L0W A;  3MS6 A;  4HEF A;  1WYB A;  2ZMF A;  2FFF B;  5FEG A;  1TS0 A;  1UWP X;  4I3A A;  4PMA A;  4WN5 A;  2ZMV A;  4BMW A;  4KZB A;  3MXQ A;  1MPL A;  1ERO A;  3G32 A;  3VE4 A;  3QP8 A;  2EX2 A;  2PD7 A;  2W3H A;  4KQQ A;  3M2K A;  5EVL A;  4L9F A;  2WK0 A;  2Y59 A;  4KUK A;  2PAV P;  1CK3 A;  1IYO A;  1XFQ A;  3M2J A;  3L9K A;  3RXW A;  3UMD A;  4X69 A;  2E8I A;  5KSH A;  2ZM8 A;  1STZ A;  4G3V A;  4EXO A;  4HNB A;  1OT6 A;  4M4X A;  2ZQ8 A;  4EER A;  2V0U A;  1EW0 A;  3T1S A;  4QU3 A;  3MQ0 A;  4UA9 A;  4OKP A;  4RQ9 A;  4RX2 A;  1VET A;  3ZQ5 A;  2PYR A;  5MC7 A;  4NXF A;  4R3B A;  2WUQ A;  3O86 A;  5DKK A;  3LI9 A;  4JXV A;  2ZM0 A;  4E3I A;  4UEY A;  1YAX A;  3N8R A;  4S2N C;  2X01 A;  3IBR A;  1D1J A;  1UGU A;  2JKR I;  3HBR A;  2VV6 A;  1W8Y A;  2Y2M A;  4EW7 A;  1FIK A;  1I5Q A;  2Y2H A;  1L0D A;  4RA7 A;  4OVD A;  1MWS A;  3NJA A;  4JLF A;  3FPV A;  4X1L A;  3HLE A;  3F1N A;  3SS4 A;  1NY0 A;  5JYP A;  1T1B A;  4DDY A;  3CWF A;  3IF6 C;  1PZO A;  2X02 A;  4QPR A;  1M6K A;  4IUK A;  5D3O A;  4R4R A;  3G34 A;  2O9B A;  3ZVT A;  3MBZ A;  5IS1 A;  2O99 A;  1E3U D;  1EI5 A;  2L4R A;  2KLI A;  3P09 A;  4GHI B;  3O3V A;  4MMN A;  3S1Y A;  2X71 A;  5CEB A;  1K54 A;  2P9V B;  4EBN A;  1OTB A;  3S22 A;  2FH5 A;  3FKV A;  5U47 A;  1GA9 A;  4JF4 A;  4BLM A;  3VOL A;  4LV0 A;  1OJG A;  1ERQ A;  3BFE A;  2OAQ 1;  4KQO A;  3F1O B;  4WEJ A;  3P98 A;  3PBS A;  1NWZ A;  4KZ7 A;  3BY8 A;  2XD1 A;  2Y2O A;  1H8M A;  4IBX A;  1AXB A;  5CHJ A;  5EE8 A;  1KOU A;  1ES2 A;  4LV2 A;  2H0T A;  3L7H A;  2HDS A;  1S6R A;  2L1M A;  1RP5 A;  4MN5 A;  4X53 A;  2XA7 M;  1JVJ A;  4C6Y A;  2ZJ9 A;  2XRO A;  4YNR A;  4BL3 A;  5IT5 A;  5TR7 A;  4U0T A;  3VE3 A;  1TVF A;  2A24 B;  1FQG A;  4P6B A;  1NYM A;  1XXM A;  3PBN A;  3CI6 A;  4I38 A;  3QHY A;  1MWR A;  2WAD A;  2O9A A;  4R1G A;  4O7D A;  2VA0 A;  1D06 A;  2ZD8 A;  3N7W A;  1N9B A;  4I39 A;  4H6J B;  3IH8 A;  5FI2 A;  5A8B A;  4GHI A;  3NY4 A;  3LR5 A;  3O87 A;  3MKE A;  2PD8 A;  1S4R A;  2Z6D A;  4LGW A;  3KX0 X;  4B4Z A;  3BM6 A;  4A5R A;  3EQV A;  1K4F A;  3CAX A;  4KZ3 A;  1BT5 A;  3QP2 A;  3JVU A;  4ZTK A;  3ZDJ A;  4JF6 A;  3NUL A;  2IWD A;  4G3W A;  4L9E A;  2VKS A;  5HWV A;  3WS4 A;  1JNU A;  1T19 A;  1H0M A;  1KGG A;  4QY5 A;  4DRT A;  3QNC A;  2D02 A;  3IHA A;  1TS8 A;  4MCW A;  2WGW B;  1WE4 A;  4GN2 A;  4HJ6 A;  4U0X A;  5F6A A;  2Q0O A;  1ODV A;  2LB9 A;  4RYE A;  3O88 A;  2Y8H A;  2XFS A;  4S2J A;  4DE2 A;  2V8F A;  3UPN A;  3D4F A;  4LFU A;  2C6W B;  3QP1 A;  1CI9 A;  3C4P A;  3HRE A;  2P9V A;  3CUE C;  3LCE A;  1P9W A;  2M7V A;  3G2Z A;  3BLS A;  4XXR A;  3IT9 A;  2NUP C;  3UB9 A;  5TFQ A;  1K6R A;  4I3I A;  1G5U A;  1HZO A;  1LL8 A;  4OOL A;  4MN7 A;  3Q7Z A;  1GCE A;  4GD8 A;  2Q9N A;  4KZ4 A;  4Y5F A;  5CX7 A;  1F2K A;  3LIF A;  4DE0 A;  4QB8 A;  1JTG A;  2P04 A;  3C4O A;  2VEA A;  4HI4 A;  2I9V A;  2ZMA A;  3OPP A;  1N9O A;  5FAP A;  3UE6 A;  1ZTU A;  1K56 D;  2WKQ A;  3OOV A;  5CHM A;  4LRZ E;  1PI4 A;  1KDS A;  2EX8 A;  1PW8 A;  1KE4 A;  2EWV A;  3CUE A;  1LHY A;  2OSU A;  3ZYT A;  4ARZ A;  3FG8 A;  3MF0 A;  5M18 A;  3NBL A;  4YFM A;  3CPT B;  2XDM A;  4OP8 A;  3R4K A;  4GW9 A;  3I7J A;  3UY6 A;  1ESI A;  4E3N A;  1ERM A;  3C7V A;  4HP9 A;  3FKW A;  4Q8I A;  1BSG A;  1Y54 A;  2EFU A;  5GHX A;  4II7 A;  1DP6 A;  3DBA A;  2WKR A;  4DXB A;  3E0Y A;  3S7O A;  2ZC7 A;  4GOG A;  3EGX C;  2PR5 A;  1KGE A;  4P6Z M;  3MSH A;  4X56 A;  4GD6 A;  4EET B;  5EVI C;  2WKE A;  3LID A;  3A3I A;  1XJ4 A;  3GVB A;  4BBU A;  1XA7 A;  4PM6 A;  5I94 A;  4KZ5 A;  1OT9 A;  5CGS A;  4S2P A;  4N9K A;  1MWU A;  4FH4 A;  2IWC A;  3KYE A;  3N6I A;  2ZC5 B;  5FL3 A;  1RCJ A;  5G18 A;  2Y2K A;  5HD5 A;  2Y2G A;  1FCO A;  3ZNT A;  3MKF A;  2JN7 A;  1JTD A;  1F5M A;  3K3C A;  3NOU C;  3NDE A;  5CRF A;  1XGI A;  2HDR A;  4FH2 A;  1LLB A;  3GTC A;  4BEN A;  1NLY A;  1SHV A;  4X1M A;  4D60 A;  5DF9 A;  3C30 A;  4O01 A;  2OAP 1;  3HLF A;  3MZF A;  3ZG0 A;  5AVF A;  1CF0 A;  4C3Q A;  5CED A;  3TW8 A;  3UE3 A;  1FCN A;  1T1A A;  3IS2 A;  5F5Y A;  5FQK A;  1LL5 A;  3VP3 A;  2JKF A;  2XSS A;  4ZRR A;  3JVV A;  3VP0 A;  4GZB A;  5GL9 A;  5CXW A;  4FTX A;  2C5W B;  3M6H A;  4DJ3 A;  2VV8 A;  5TBM B;  1DJC A;  3UE0 A;  3MZE A;  3LR3 A;  1YSQ A;  2QZ6 A;  4CLC D;  3CLO A;  1I2W A;  2ZQD A;  1IEM A;  3KO6 A;  1N4O A;  1PRQ A;  1E25 A;  1XKZ A;  4EUZ A;  3G2Y A;  4PM5 A;  2DCF A;  5HDS A;  4OPZ A;  3IQA A;  2WGV A;  3SS5 A;  3UN7 A;  2D01 A;  3QP4 A;  1DJA A;  1XJ6 A;  1N9L A;  2HGV A;  3ISG A;  1XJ3 A;  4CLC A;  2J3T D;  3PBO A;  5TBM A;  3S7P A;  3QNB A;  4BD1 A;  3CG5 A;  5DFY A;  3T50 A;  3SZT A;  2XA7 S;  3BWL A;  4P87 A;  2J7V A;  5HWT A;  4ME4 A;  5I5L A;  4R0Q A;  2WKP A;  3V50 A;  1S4S A;  3R7W A;  4IHQ A;  5EUA A;  1JWP A;  3IWQ A;  4Q0H A;  3VFF A;  2ACG A;  3SW1 A;  3PHY A;  1L0F A;  4PPR A;  4MDZ A;  3HJI A;  1V9Z A;  4OLD A;  1GSV A;  2QWS A;  4M3K A;  3F1P B;  2XH9 A;  5GLD A;  3A0R A;  3BFD A;  3LIE A;  2WZX A;  3D9Y A;  4JXG A;  2ZBB A;  5J7E A;  2DNS A;  3DTK A;  1K4E A;  2PU2 A;  2WYX A;  1HVB A;  4R38 A;  1YLY A;  3R7W B;  1MWT A;  3CIT A;  3MZD A;  4HHD A;  1S1Z A;  2Z2L B;  1D7E A;  4HH3 A;  5HX9 A;  1U60 A;  3CZD A;  4U3T A;  4PHT A;  1MY8 A;  2PHY A;  4FOF A;  3BEB A;  2HP6 A;  3UO9 A;  3IF6 B;  2V1B A;  3LIA A;  2JKG A;  2VGL M;  3GR2 A;  4X25 A;  1HD8 A;  2PBY A;  3SOI A;  5HW3 A;  3LEZ A;  2B18 A;  4OQH A;  5GLB A;  2JKT M;  3NCK A;  3ZCZ A;  3UPO A;  5HSQ A;  4C75 A;  2PR6 A;  4ZJ2 A;  3IWO A;  3IHB A;  3FWL A;  2GDN A;  5DF8 A;  4GKU A;  5FAQ A;  2ZOH A;  1KE3 A;  4AFI A;  3UDI A;  1K56 A;  4Y7P A;  1LI9 A;  3V3R A;  4IJG A;  3ZG8 B;  2W3G A;  5DJU A;  4KZ6 A;  1OME A;  4GDN A;  3HLB A;  4E6W A;  1BTL A;  2RL3 A;  1G6O A;  5FAT A;  4EUV A;  4BWI A;  1Z6F A;  1OTA A;  4PAU A;  3NOT C;  4BD0 A;  3LO7 A;  3UE1 A;  4F94 A;  5AJG A;  5J4E A;  2P7J A;  1XX2 A;  5M1A A;  3PBT A;  4YWZ A;  4WEL A;  3ZNY A;  2HDQ A;  2EFX A;  1NZU A;  3UB8 A;  2O0Y A;  1S0W A;  3DTI A;  3W2Z A;  4GLQ A;  1SKO B;  5HD3 A;  3PR6 A;  3U2A A;  4ZAM A;  3LIC A;  3LR0 A;  2Y4A A;  4MEZ A;  1ES3 A;  4B88 A;  2B5R A;  1W8Q A;  2V0W A;  1BYW A;  4XUX A;  4ESP A;  3T4T A;  5A91 A;  2V1A A;  3HUM A;  2K7S A;  1FIL A;  4JBF A;  1NLZ A;  4CPK A;  2W1T A;  1O07 A;  1K0K A;  3ZG5 A;  2UV0 E;  3WWX A;  3B33 A;  3ITA A;  5FI7 A;  3KSI A;  1XGJ A;  5G4Z A;  4HH2 A;  4HQA A;  5FAO A;  2HV1 A;  4QWO A;  5KZH A;  2B95 A;  4KG5 A;  4WLA A;  2V2F F;  4E3L A;  2Y2J A;  2JKT I;  2ZC4 B;  5CTN A;  3S7Q A;  5EFW A;  4R3A A;  1PW1 A;  3M6B A;  4R70 A;  2Y2Q A;  1IYP A;  4NXG A;  3T12 B;  5BOH A;  4K0X A;  1SDN A;  2PRF A;  3DW0 A;  2ZQ9 A;  1ZG6 A;  2O9C A;  5GLA A;  3F1O A;  3IS2 B;  1TS6 A;  2DRW A;  5J3W A;  4CLC E;  4JXW A;  5G4Y A;  1YLZ A;  2WZZ A;  4OH0 A;  1GSW A;  4WYY A;  4Y0U A;  3BFF A;  2B02 A;  2W0N A;  1CEG A;  1W5D A;  2OLV A;  1CEF A;  2ZM2 A;  4OOM A;  1H8Z A;  5F1G A;  3TRC A;  2IWB A;  3KYZ A;  2ZC3 B;  3UDX A;  3ULF A;  3IH9 A;  4P85 A;  1TDG A;  2XLN A;  3GDI A;  1W79 A;  5E43 A;  4CJN A;  2FZ0 A;  3HLG A;  2JE5 A;  1GHM A;  3A0S A;  4GS9 B;  1K6S A;  3WS1 A;  4WUJ A;  4E6X A;  3E98 A;  3UME A;  5F1F A;  4GNU A;  5KIZ A;  4MNR A;  2R9W A;  4EEU A;  4OPR A;  2IA2 A;  3C8C A;  3V3S A;  3N8L A;  5EPH A;  3DWK A;  4OPY A;  4Z9Q A;  3IX3 A;  4BBV A;  3ZFZ A;  1WA9 A;  5F68 A;  4OPQ A;  2Y2P A;  5E2E A;  4EU0 A;  4KG6 A;  2P08 A;  4QHC A;  3EQU A;  3TSG A;  2XEP A;  1NYY A;  1ZKJ A;  1IYQ A;  3V39 A;  1YSP A;  1BLC A;  3LI8 A;  3Q81 A;  1S67 L;  4YOF A;  4K08 A;  2YKH A;  4MLL A;  4B9O A;  3OLO A;  2Y91 A;  3DTE A;  5FQ9 A;  5FQQ A;  3VMA A;  2VGJ A;  2YKF A;  3QP6 A;  4GB7 A;  1TEM A;  4E3K A;  4QJG A;  3VP2 A;  4JGO A;  1G6A A;  4LV1 A;  4BQM A;  1LSW A;  4EQ1 A;  3IXD A;  3MQO A;  2BTF P;  1OPX A;  1V9Y A;  2K2N A;  4NET A;  1IKG A;  4UQI M;  3IF6 A;  1F9I A;  3WRT A;  4Y17 A;  4JGQ A;  2OWJ A;  4IED A;  3LY4 A;  1XPB A;  4KQD A;  1FCM A;  5HDD A;  5HPI A;  3EOI A;  2W3D A;  4WBG A;  1XJ2 A;  2HJE A;  5FA7 A;  1SCW A;  4PM8 A;  1GA0 A;  4XT2 A;  5EVE A;  1O7E A;  4F3L B;  5DVA A;  4LCL A;  4UAA A;  4EEP A;  5KMW A;  3F1P A;  4ZBE A;  3SH8 A;  1MZU A;  1YMS A;  4K0W A;  1YPR A;  1K57 A;  4FSF A;  5AQB A;  4DE3 A;  3BQA A;  4DF6 A;  2DMW A;  5DTT A;  4P6Z S;  5CER A;  1BLP A;  2J3W A;  1YLT A;  1P97 A;  2Y55 A;  4MBK A;  1K38 A;  2HP9 A;  4Q0I A;  4EWF A;  4HJ3 A;  4N9L A;  1H5X A;  2Y2L A;  1DJB A;  2Z6C A;  2W3F A;  1K25 A;  4E3O A;  1TD5 A;  1N9N A;  1AWI A;  2J9P A;  2JBF A;  2LB5 A;  5FAS A;  1VEU B;  3CMZ A;  1JWV A;  4UA7 A;  3MXR A;  3E4Q A;  4MBF A;  5FDS A;  1I2S A;  3G35 A;  5EVI B;  5DF7 A;  4H8R A;  3KSG A;  1G28 A;  4OQ0 A;  2FFY A;  2ZL1 B;  4LEN A;  1PYY A;  1DP9 A;  2KDK A;  3TOI A;  3A0V A;  2HPB A;  5E2H A;  3OPR A;  2E8J A;  4CLC B;  1VET B; 
#chains in the Genus database with same CATH homology
 1PWC A;  3Q82 A;  4JXG A;  2XD1 A;  2Y2O A;  4IBX A;  4OQG A;  1AXB A;  4X55 A;  4X6T A;  4YIN A;  2DNS A;  3RXX A;  5CHJ A;  5EE8 A;  4ZJ1 A;  1ES2 A;  1K4E A;  2PU2 A;  4LV2 A;  2H0T A;  3ZVW A;  3ZG7 B;  2WYX A;  1IKI A;  1HVB A;  1YLY A;  1RGY A;  4KG2 A;  2HDS A;  1S6R A;  1MWT A;  3UNW A;  3G30 A;  1QME A;  1RP5 A;  3G4P A;  5HFO A;  4WEK A;  3MZD A;  1YLW A;  5FQI A;  3GSG A;  4X53 A;  2Z2L B;  1NZO A;  3PBR A;  1JVJ A;  1U60 A;  5HX9 A;  4C6Y A;  3IXG A;  3CZD A;  4U3T A;  2UWX A;  2ZJ9 A;  1MY8 A;  5CEC A;  4BL3 A;  3NC8 A;  2QPN A;  3BEB A;  2HP6 A;  3UO9 A;  5TR7 A;  4S2N A;  3IF6 B;  4U0T A;  1TVF A;  1FQG A;  3PBQ A;  4P6B A;  5HL1 A;  1NYM A;  1XXM A;  3GR2 A;  3PBN A;  1HD8 A;  2PBY A;  3OZH A;  2OV5 A;  3TG9 A;  1YMX A;  5EVI A;  3SOI A;  2JCH A;  5HW3 A;  1XP4 A;  3HLD A;  1MWR A;  2ZLY A;  3LEZ A;  3QHY A;  2WAD A;  4OQH A;  5FQM A;  5GLB A;  3BFG A;  4EBP A;  4R1G A;  3NCK A;  4O7D A;  3ZCZ A;  4E3J A;  4PM9 A;  3UPO A;  2ZD8 A;  4C75 A;  3N7W A;  1N9B A;  4E3M A;  4KQR A;  4ZJ2 A;  1ONH A;  4BJP A;  1PWG A;  3IF5 A;  3IH8 A;  3IWO A;  3IHB A;  3FWL A;  2GDN A;  2EX9 A;  5DF8 A;  5FI2 A;  4GKU A;  4Y0O A;  5FAQ A;  5HAI A;  4D2O A;  5GHZ A;  4JKT A;  1KE3 A;  3NY4 A;  1CI8 A;  3UDI A;  3HUO A;  3O87 A;  4HES A;  1K56 A;  4Y7P A;  3S4X A;  5M19 A;  1J9M A;  1LI9 A;  4P0M A;  3V3R A;  4OLG A;  3MKE A;  5E2F A;  3ZG8 B;  1ZG4 A;  1RGZ A;  3HVF A;  5J8X A;  5EVI D;  1G68 A;  1C3B A;  1YM1 A;  4KZ6 A;  1OME A;  4GDN A;  3HLB A;  2P74 A;  1FOF A;  4E6W A;  1NRF A;  4JF5 A;  3W4Q A;  3Q1F A;  3Q7V A;  4OOY A;  4B4Z A;  1BTL A;  3BM6 A;  2RL3 A;  5FAT A;  3ZHH A;  5A93 A;  1K57 C;  4MBH A;  3W8K A;  1EWZ A;  4S2O A;  4A5R A;  1Z6F A;  3EQV A;  1K4F A;  3ZG9 B;  4BD0 A;  4KZ3 A;  3LO7 A;  3UE1 A;  4F94 A;  2OLU A;  1MXO A;  1XX2 A;  5M1A A;  1BT5 A;  3NDG A;  4ZTK A;  3PBT A;  4WEL A;  3ZDJ A;  4JF6 A;  5HAP A;  5KSC A;  3ZNY A;  2ZC6 B;  2IWD A;  1E3U A;  2HDQ A;  3PAG A;  4R4S A;  5L2F A;  2EFX A;  1NZU A;  4IVI A;  1S0W A;  3HLC A;  3PTE A;  4KZ9 A;  1W7F A;  1PIO A;  4R3J A;  4ZAM A;  3WS4 A;  2VGK A;  1KGF A;  2WKH A;  5FQJ A;  2Y4A A;  1KGG A;  2ZQC A;  4EQI A;  4MEZ A;  4IBR A;  4QY5 A;  4DRT A;  3QNC A;  3A3F A;  4N1H A;  3IHA A;  1ES3 A;  4B88 A;  4N1X A;  2B5R A;  2JC7 A;  1FSW A;  1W8Q A;  1KVM A;  3BLM A;  3E2L A;  5F83 A;  2WGW B;  1WE4 A;  3IWI A;  4GN2 A;  4U0X A;  4XUX A;  5FDH A;  3VOY A;  2XGN A;  3Q7V B;  4RYE A;  3O88 A;  4N92 A;  2J9O A;  1L0G A;  1NJ4 A;  3C5A A;  1ONG A;  1L2S A;  2XFS A;  4S2J A;  5A91 A;  3HUM A;  1ESU A;  1YLJ A;  4DE2 A;  2A49 A;  3UPN A;  4JBF A;  4PM7 A;  3D4F A;  3OCL A;  2C6W B;  1CI9 A;  3C4P A;  4OQI A;  3OPL A;  4GDB A;  3HRE A;  4CPK A;  2XQZ A;  4LCM A;  2BLS A;  1O07 A;  2Y2I A;  2P9V A;  3LCE A;  3ZG5 A;  1FSY A;  3WS5 A;  4DXC A;  4ZDX A;  2PU4 A;  3G2Z A;  3BLS A;  4XXR A;  3IT9 A;  5F82 A;  2V1Z A;  3GMW A;  5TFQ A;  3BEC A;  3WWX A;  1YQS A;  3ITA A;  5FI7 A;  1K6R A;  5CGX A;  5DTS A;  1HZO A;  4KZA A;  1XGJ A;  2H5S A;  5FAO A;  2HP5 A;  4OOL A;  1WYC A;  3Q7Z A;  5KZH A;  3WRZ A;  4KG5 A;  1GCE A;  4GD8 A;  2Q9N A;  3GRJ A;  4KZ4 A;  1KDW A;  2R9X A;  2WGI A;  3E2K A;  2V2F F;  4HBU A;  5TGF A;  4E3L A;  1VQQ A;  2Y2J A;  1BLS A;  4DE0 A;  4QB8 A;  3N8S A;  1JTG A;  4X68 A;  5A92 A;  2ZC4 B;  5CTN A;  3C4O A;  1ES4 A;  1PW1 A;  3M6B A;  2Y2Q A;  1IYP A;  4R23 A;  2WAF A;  3HLW A;  3PAE A;  5BOH A;  2ZMA A;  3OPP A;  4K0X A;  5AQ7 A;  1SDN A;  5FAP A;  3VSL A;  3DW0 A;  1IEL A;  2ZQ9 A;  1ZG6 A;  4Y0T A;  3B3X A;  2WKI A;  3RJU A;  1K56 D;  5CHM A;  5GLA A;  4B4X A;  1PI4 A;  3A3D A;  3HL9 A;  4JXS A;  3VFH A;  2DRW A;  1KDS A;  5IHV A;  4JXW A;  2EX8 A;  4FD8 A;  1YLZ A;  2WZZ A;  4OH0 A;  1PW8 A;  4WZ5 C;  1KE4 A;  4LV3 A;  4QD4 A;  4WYY A;  4Y0U A;  4ID4 A;  3WS0 A;  4EV4 A;  2EXB A;  3BFF A;  1LHY A;  2QMI A;  1FR6 A;  2OSU A;  5M18 A;  1CEG A;  3OCN A;  1XA1 A;  5GHY A;  3HUN A;  3NBL A;  4YFM A;  1W5D A;  3G31 A;  2XDM A;  4OP8 A;  1BUL A;  2OLV A;  4OP5 A;  4OON A;  2Z2M B;  1CEF A;  2ZM2 A;  3C7U A;  4NK3 A;  3FZC A;  4OOM A;  5EEC A;  3I7J A;  1H8Z A;  5F1G A;  3UY6 A;  1ESI A;  1QMF A;  4E3N A;  2ZQA A;  4KZ8 A;  2IWB A;  1ES5 A;  1ERM A;  3C7V A;  4IVK A;  2ZC3 B;  2Q9M A;  5AQA A;  3UDX A;  2H10 A;  3FKW A;  4Q8I A;  1BSG A;  1Y54 A;  2EFU A;  5GHX A;  3DWZ A;  5FI6 A;  4ZJ3 A;  1PZP A;  3IH9 A;  4P85 A;  4WMC D;  1PWD A;  1TDG A;  2XLN A;  1W79 A;  4DXB A;  5E43 A;  4CJN A;  4S2L A;  2I72 A;  3CJM A;  3DTM A;  3N4I A;  3NIA A;  3BRM A;  2ZC7 A;  3HLG A;  1JWZ A;  1GHM A;  2JE5 A;  3IXH A;  1K6S A;  2EXA A;  4GOG A;  3WS1 A;  1BUE A;  1KGE A;  3ITB A;  3OC2 A;  4E6X A;  1K54 C;  1IYS A;  3W4O A;  5GLC A;  5F1F A;  4X56 A;  4GNU A;  4GD6 A;  3AGD A;  1LI0 A;  4S2I A;  5EVI C;  3WS2 A;  2WKE A;  2EX6 A;  4MNR A;  2R9W A;  2G2W A;  3FV7 A;  3A3I A;  4OPR A;  4RVA A;  1TDL A;  3SS3 A;  3VOZ A;  3GVB A;  3AGE A;  1XA7 A;  5DTK A;  1YT4 A;  3N8L A;  3V3S A;  4PM6 A;  1ZC2 A;  5EPH A;  3A3E A;  3DWK A;  4JPM A;  4OPY A;  4Z9Q A;  1MKI A;  4DDS A;  3ZFZ A;  3IXB A;  4WMC A;  5I94 A;  4KZ5 A;  2HDU A;  4OPQ A;  2Y2P A;  1BZA A;  1LL9 A;  5E2E A;  1H8Y A;  2XF3 A;  3OPH A;  5CGS A;  5HAQ A;  3MFD A;  4N9K A;  4S2P A;  4KG6 A;  2H0Y A;  1DY6 A;  1MWU A;  1VM1 A;  4FH4 A;  1WYB A;  4HEF A;  4QHC A;  2IWC A;  2FFF B;  3EQU A;  2J8Y A;  3JYI A;  2XK1 A;  3N6I A;  3TSG A;  3MXS A;  4PMA A;  3BYD A;  2ZC5 B;  2XEP A;  2Y2N A;  1RCJ A;  4WZ4 A;  3ZGA B;  1NYY A;  5G18 A;  5A90 A;  2WGW A;  2Y2K A;  4KZB A;  2Y2G A;  1ZKJ A;  1IYQ A;  1MPL A;  1ERO A;  1K55 A;  3G32 A;  4XUZ A;  3V39 A;  1FCO A;  1GHI A;  3ZNT A;  3MKF A;  1BLC A;  1KE0 A;  1JTD A;  2EX2 A;  3Q81 A;  3NDE A;  1SKF A;  4KQQ A;  5CRF A;  1XGI A;  2HDR A;  3M2K A;  4FH2 A;  1LLB A;  3GTC A;  5EVL A;  4MLL A;  4BEN A;  1SHV A;  5DF9 A;  2WK0 A;  2Y91 A;  2Y59 A;  5FQ9 A;  5FQQ A;  1CK3 A;  4KEN B;  3HLF A;  3MZF A;  1IYO A;  3ZG0 A;  3VMA A;  2VGJ A;  4S2K A;  5AQ9 A;  4C3Q A;  5CED A;  3M2J A;  3RXW A;  4GB7 A;  3UE3 A;  1TEM A;  2G2U A;  4E3K A;  1FCN A;  3UDF A;  4QJG A;  3VP2 A;  4X69 A;  2E8I A;  1G6A A;  2WAE A;  2ZM8 A;  5KSH A;  4LV1 A;  4L0L A;  4BQM A;  5FQK A;  3BFC A;  3IXD A;  2ZQ8 A;  3UPP A;  3Q07 A;  1K55 C;  1LL5 A;  2A3U A;  2V20 A;  1HTZ A;  1M40 A;  3VP3 A;  3W4P A;  4DE1 A;  1BLH A;  3VP0 A;  4GZB A;  4NET A;  4QU3 A;  5GL9 A;  5CXW A;  1IKG A;  2C5W B;  4UA9 A;  4OKP A;  3M6H A;  4RX2 A;  5E2G A;  3IF6 A;  4R3B A;  3WRT A;  2WUQ A;  1DJC A;  4WZ5 A;  3UE0 A;  3O86 A;  3MZE A;  5CHU A;  2XR0 A;  4IED A;  2QZ6 A;  3LY4 A;  1XPB A;  4JXV A;  2ZM0 A;  1I2W A;  1FCM A;  4E3I A;  2ZQD A;  1IEM A;  1KVL A;  3N8R A;  4HBT A;  4K91 A;  4WBG A;  1N4O A;  1YLP A;  1E25 A;  1XKZ A;  4S2N C;  2X01 A;  5FA7 A;  4EUZ A;  3G2Y A;  1SCW A;  4PM5 A;  2DCF A;  4PM8 A;  4QY6 A;  1GA0 A;  3HBR A;  4OPZ A;  5EOO A;  2CC1 A;  3IQA A;  3SH7 A;  2WGV A;  1W8Y A;  2Y2M A;  3SS5 A;  4DKI A;  3FYZ A;  1O7E A;  3UN7 A;  5DVA A;  4LCL A;  1I5Q A;  2Y2H A;  4UAA A;  5KMW A;  1L0D A;  4RA7 A;  4OVD A;  1DJA A;  1L0E A;  5JYO A;  1MWS A;  4JLF A;  4ZBE A;  3GV9 A;  3SH8 A;  3ISG A;  1MBL A;  1YMS A;  2XD5 A;  3HLE A;  4K0W A;  5CTM A;  3GQZ A;  1K57 A;  4FSF A;  5AQB A;  4DE3 A;  3A3J A;  3SS4 A;  1NY0 A;  4DF6 A;  4S2M A;  4DDY A;  5JYP A;  5DTT A;  2XFT A;  1BLP A;  2ZQ7 A;  3IF6 C;  3PBO A;  1YLT A;  5CER A;  3VP4 A;  1PZO A;  2X02 A;  5D3O A;  1M6K A;  3SH9 A;  4EBL A;  2Y55 A;  4R4R A;  5CGW A;  3G34 A;  4MBK A;  3ZVT A;  1K38 A;  3MBZ A;  3QNB A;  1Q2P A;  4BD1 A;  2HP9 A;  3CG5 A;  4FCF A;  1E3U D;  3AGF A;  4EWF A;  1EI5 A;  3LY3 A;  4P87 A;  2J7V A;  4N9L A;  4RX3 A;  1PI5 A;  4BL2 A;  3P09 A;  1H5X A;  3O3V A;  4R0Q A;  4UA6 A;  5FSR A;  2Y2L A;  3S1Y A;  3V50 A;  1DJB A;  2X71 A;  5CEB A;  1K54 A;  1GHP A;  5EUA A;  1K25 A;  4E3O A;  1JWP A;  3IWQ A;  2RCX A;  2J9P A;  2JBF A;  2P9V B;  5EOE A;  4EBN A;  5FAS A;  3S22 A;  3VFF A;  3FKV A;  5HAR A;  1L0F A;  5U47 A;  1GA9 A;  1JWV A;  3CMZ A;  4PPR A;  4UA7 A;  4UHU A;  3MXR A;  3V5M A;  4MBF A;  4JF4 A;  1I2S A;  3G35 A;  4OLD A;  5EVI B;  5DF7 A;  1E4D A;  4LV0 A;  3VP1 A;  4BLM A;  1ALQ A;  1ERQ A;  4H8R A;  3BFE A;  4KQO A;  4M3K A;  1NXY A;  4OQ0 A;  4WEJ A;  1Q2Q A;  2XH9 A;  1SDE A;  2FFY A;  2BG1 A;  3P98 A;  4LEN A;  5GLD A;  1FR1 A;  3VSK A;  1PYY A;  3NI9 A;  3PBS A;  4WM9 A;  3TOI A;  2HPB A;  5E2H A;  4KZ7 A;  3OPR A;  3BFD A;  2WZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...