2ZJGA

Crystal structural of mouse kynurenine aminotransferase iii
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
410
structure length
409
Chain Sequence
b'NAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine-oxoglutarate transaminase 3
publication title Structural and functional characterization of mouse kynurenine aminotransferase III
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 144
structure length 409
sequence length 410
chains with identical sequence B
ec nomenclature ec 2.6.1.63: Kynurenine--glyoxylate transaminase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2zjgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zjgA01
1YJZA 4JEZA 4M2KA 4PFFA 2R5EA 2D61A 3G8MA 2GB3A 3FTBA 3HVYA 1D7UA 3UE8A 4E1OA 5M46A 2QBTA 3ASBA 3FFRA 4W1XA 4BA5A 3FZ8A 1OATA 4A6UA 2EO5A 1AJRA 2BI9A 1E5FA 1PMOA 1ZOBA 3PD6A 4WXFA 1ELUA 4ZSWA 4HVKA 2AY4A 4F5JA 4F5HA 1ELQA 5FT5A 2Z9WA 2VMYA 5G09A 2HUUA 1IBJA 2Z9VA 1GC3A 3EIBA 3EI7A 1MAQA 3BN1A 1H1CA 4Y0DA 3BB8A 1AMAA 4P7YA 3TQXA 2AATA 9AATA 3WZFA 1YJYA 5EUEA 1BJOB 4H51A 4J5UA 4LW2A 3RI6A 2OKJA 3E2ZA 3AEJC 3FRKA 4OCAA 1AX4A 1ASCA 1IUGA 1MGVA 1FG3A 1I29A 3I5TA 4U2HA 4WLJA 1V2EA 3WLXA 5E3KA 1BKGA 5BJ4A 4N0BA 3WKSA 5EQCA 2BI5A 2FQ6A 2GMUA 8AATA 3AEMC 3EI9A 1LC8A 1WYTB 2ORDA 2VMWA 1KKPA 3GZDA 4ADDA 1YIYA 4ZAHA 1SZUA 1S08A 3GBXA 1DGDA 1KMJA 1OHYA 2AY5A 5E4ZA 1I43A 3IF2A 4E77A 4W8IA 2BWNA 3COGA 2CJHA 3MC6C 1M4NA 1QJ3A 2HUIA 4IXZA 1S06A 4BA4A 2AY3A 2DR1A 3FQAA 2C0RA 1Z3ZA 2V1PA 4GDYA 4XQ2A 3ZZKA 5IWQA 4W91A 3DYDA 5EIGA 2W7LA 2HP2A 3F9TA 2JJHA 1BJWA 1D7RA 2W7DA 2PO3A 2VGSA 3AOWA 1O61A 5D5SA 2D64A 2VI9A 1AHEA 2C7TA 4WP0A 2VGTA 2W7MA 4XAUA 1GD9A 1FC4A 4A6TA 4F5IA 4JEVA 2JISA 3R9AA 4ZSYA 4WB0B 1IX7A 1VP4A 1SFFA 4MKJA 2X8UA 1IJIA 1ASDA 1RV4A 2JJEA 1DKAA 3CAIA 4F5MA 2Z9UA 2WKAA 2X5FA 1V72A 3KGXA 4RIZA 3RBFA 3PDXA 3K28A 2ZP7A 4IY7A 2VMOA 1UU0A 2EH6A 2WK8A 4FL0A 4RM1A 1ARIA 2CTZA 3MKJA 3RQ1A 3NYTA 2FN6A 3E6GA 3L44A 1X2AA 4IXOA 4F5KA 1ASEA 1QIRA 2W7KA 1B5PA 1W7LA 3FCRA 2PB2A 4F5FA 1WYVA 5BJ3A 3BC8A 3USFA 2VMUA 1LK9A 2G6WA 4EB7A 3LY1A 2O7CA 2OKKA 2HZPA 2RFVA 3QN6A 2EZ2A 5DB5A 4MKKA 2BI3A 3DR4A 1PFFA 1RVUA 1Z7DA 4GRXA 1BJ4A 1AIBA 1CZCA 4RJYA 2JGTA 5C6UA 2CSTA 4N0WA 3GZDC 4NOGA 1IVRA 1GDEA 4XJLA 4ITXA 1AICA 4WYEA 3GSBA 3CBFA 1S07A 4F5GA 4WXBA 3AENB 2ZY2A 2FM1A 4TV7A 1ASNA 2BI1A 4JF1A 2WK9A 1WKHA 2FYFA 1EJIA 1AJSB 1DJUA 4MQPA 1X28A 2BI2A 2D63A 4PFNA 2VYCA 2YHKA 2VGVA 3FQ7A 2VMNA 4W1VA 3VOMA 3FDDA 3GZCA 3N0LA 2HOYA 1CL2A 3PIUA 4HF8A 4GE9A 3MC6A 2CB1A 2EGYA 1SVVA 4EU1A 1QJ5A 4LW4A 1H0CA 1V2FA 4A0RA 4R2NA 4MQQA 2W8VA 1M7YA 2W7GA 3ATHA 2BIEA 3PD6B 3VAXA 3E77A 3PDBA 1O62A 1GEXA 1B5OA 3IHJA 1QGNA 3G0TA 3L8AA 3NU7A 4LNLA 4TN4A 4R8DA 3A2BA 3NYUA 5HXXA 4RKCA 1CZEA 1VEFA 2DKBA 1O69A 2QB2A 4IX8A 2OGAA 4F5LA 4ADEA 1OXPA 3E9KA 4Y0IA 3KE3A 4B9BA 2R0TA 3E2ZB 4Q31A 4WYAA 1UU1A 2FNIA 1G7XA 2YKYA 1AKCA 3PAAA 3QHXA 2AY2A 4K2MA 4KXKA 2ZSLA 1ASGA 5G4JA 3AEOA 1MLZA 3PA9A 3BV0A 5FT6A 4ZM4A 4WXGA 2ZY3A 3QGUA 3BS8A 2E54A 1AMQA 1LC7A 2YKXA 3PJ0A 4R5ZA 4OC9A 4Y0HA 2BYLA 3FZ6A 4WYFA 2AY7A 2BYJA 3BWNC 5TF5A 1DFOA 1VJOA 1TOGA 1AKBA 4RLGA 3FZ7A 1ZC9A 3F0HA 4OTLA 1AHYA 1M0QA 2TPLA 2XBNA 3R4TA 2BIAA 2HOXA 2HUFA 4EFFA 4PVFA 1SZKA 3PPLA 4XJMA 1I41A 1AHXA 2JG2A 3FVXA 4WYCA 1LS3A 1AMSA 1JS3A 2JJGA 2Q7WA 4WYGA 2CFBA 5DJ9A 2YKVA 2CJGA 3WX9A 1XI9A 3WGBA 4IW7A 4DQ6A 1MDXA 4EMYA 2PB0A 1QITA 4TMRA 1GC0A 2DKJA 3M5UA 3P6KA 2AEVA 2BWPA 2BHXA 1GEWA 4IYOA 1E5EA 3BCBA 3MAFA 3RBLA 2CH2A 2EPJA 1TATA 4Q75A 1AY5A 1M6SA 2W8UA 5G2QA 4K2BA 1LC5A 4ZDOA 3QM2A 2CJDA 1IAXA 1B4XA 3JZLA 4B98A 1DGEA 2AY8A 1JS6A 1AKAA 1WYVB 2DOUA 4I8AA 3FKDA 3E2YA 3ZRRA 5M4BA 3HQTA 3P1TA 3LV2A 4ZM3A 1U08A 1BJNA 1TPLA 3B46A 1M0OA 4JE5A 4WLHA 1WSTA 2W8TA 1B8GA 3CQ5A 1IX6A 2D7YA 3KKIA 4ITGA 5M49A 1MDZA 1YIZA 3FVUA 4LC3A 4AZKA 2Z20A 1DJEA 1ARHA 3E2FA 1WYUA 4KAMA 3F6TA 4ZWMA 4ZWVA 2QLRA 1AHFA 3K40A 3NX3A 3BCXA 2R5CA 1BS0A 1P3WA 2HOZA 2VLHA 2W7FA 4OYTA 3VP6A 3VK4A 4CVQA 2OQXA 3JW9A 3W1IA 3DODA 1GC4A 3JU7A 3N5MA 3AV7A 1LW4A 2C44A 3HT4A 2E7UA 3CQ6A 4RKDA 3NYSA 3NUIA 3WY7A 1G4XA 1CQ7A 3BWNA 3LG0A 3UWCA 3VK2A 4MQRA 2JJFA 3QPGA 3HMUA 3JWAA 4AO4A 2VIBA 4A0HA 1ECXA 1S0AA 4Q6RA 4ATQA 3K7YA 3ZZJA 4A6RA 3B1EA 5FT8A 4IXSA 1ARGA 4AH3A 3PDBB 1AAWA 3EZ1A 4PIWA 1TOKA 3TCMA 2YRIA 2GMSA 1D7SA 3NDNA 2BKWA 4A00A 4XK1A 3B1CA 4DGTA 1MLYA 2X3LA 4AZJA 2VMXA 3DRDA 2FNUA 2DGLA 4R5FA 2VI8A 1T3IA 5F9SA 3WGCA 1QISA 1O4SA 2ZYJA 3FD0A 1ASAA 5HHYA 2GSAA 2VIAA 4AO9A 1AHGA 1ASFA 3MAUA 4UOYA 1B9HA 1SZSA 3JTXA 1I48A 2W7JA 3GJUA 2VGWA 5EFSA 4CBRA 2QA3A 5AX8A 1B9IA 1D7VA 4ISYA 1Y4IA 3EI8A 3TFUA 3LVLB 2W7HA 5LH9A 3A9YA 5D95A 1LKCA 4O6ZA 2YOBA 2YCTA 3LVJA 3II0A 2YCNA 2O1BA 2EZ1A 3ZRPA 3CQ4A 3NNKA 1IX8A 2D5YA 3EI5A 5EIGB 2R2NA 2D66A 3DXVA 4OBVA 1C7OA 1J32A 2CANA 3GR9A 4ZLVA 1CL1A 4EB5A 2D7ZA 2XH1A 7AATA 2ZUKA 1G7WA 1M0NA 3NU8A 3DU4A 3ASAA 4OBUA 5J8QA 1AAMA 3ACZA 2DGKA 3JWBA 2O0RA 4K2IA 1YJSA 2HP1A 2OATA 1TASA 4IYOB 3B8XA 3MBBA 5E5IA 4CBSA 1YOOA 2ZJGA 3MAFB 3ZRQA 3DC1A 3FQ8A 3RCHA 3BWOA 1GBNA 3AEPA 3WCNA 4CXQA 2Z1YA 4UHNA 3HLMA 1KL2A 2VMZA 4JEYA 2VMPA 2C81A 3EI6A 4BMKA 4F4EA 1W23A 4DBCA 1IAYA 3D6KA 4J8LA 1JF9A 4MSOA 2ZSMA 4UHOA 3I4JA 3NUBA 2CINA 3ECDA 3UAKA 5G0AA 3T32A 2AY9A 2W7IA 2D65A 3NRAA 4XEWA 1FG7A 3QI6A 3EIAA 1PG8A 1AMRA 1OHWA 1V2DA 2X5DA 4E3RA 2WK7A 2ZY5A 2Z67A 1C7NA 1KL1A 1ASBA 1ASLA 2VMVA 1SF2A 1W7MA 1QZ9A 1OXOA 1BT4A 1C4KA 1G4VA 2F8JA 1JG8A 2BWOA 4MY5A 2Z1ZA 5DX5A 4W1WA 4BHDA 1S09A 1TOEA 4CXRA 2BIGA 1WYUB 4OMAA 2NMPA 5G4IA 1UKJA 2W8WA 1BJOA 1C0NA 4W5KA 3LWSA 1GEYA 1DTYA 2VGUA 2R5CB 1GC2A 2E7IA 1KMKA 4RAEA 4WYDA 4ZASA 4A0GA 3FSLA 1TOIA 4ATPA 3AELA 3TFTA 1TOJA 1W7NA 5K8BA 3EZSA 2QMAA 2CH1A 4QGRA 2AY1A 1SPAA 1WYTA 1BQDA 2DGMA 1MAPA 4U1TA 1DJ9A 4KYOA 1CS1A 1BW0A 5JAYA 4JF0A 3LVKA 1CQ6A 2VMTA 1UU2A 4MGRA 1W3UA 4UQVA 2VMQA 1X29A 1C9CA 3AATA 1AIAA 4XJOA 1XEYA 1ZODA 5I92A 3ELPA 2Z9XA 3KGWA 3PGYA 4GEBA 4A72A 4BQ0A 5EAVA 2Z61A 3FFHA 3VK3A 4ADCA 3A8UX 1AY8A 3W1HA 1TARA 2W7EA 4GE4A 4ADBA 2VGZA 3ELEA 2OGEA 1M32A 2YCPA 2YKUA 2GQNA 3I16A 1BQAA 5EUNA 3DZZA 4JEWA 2HORA 3NTJA 3RUYA 1AY4A 1ASMA 1EQBA 4WB0A 4WD2A 5G2PA 3HL2A 3EUCA 4RITA 3H7FA 3DXWA 3OP7A 4GSAA 4E3QA 3LVMA 1EG5A 3BCAA 4ZDLA 3TATA 3W1JA 1YNUA 2AY6A 3MEBA 5HDMA 4RJ0A 2YRRA 1KKJA 1OHVA 3GWPA 1CJ0A 2QB3A 3WKRA 1J04A 2VMSA 3B1DA 3G7QA 3GETA 3OKSA 1LW5A 3A9XA 1N31A 3HBXA 1N2TA 3Q8NA 4GE7A 3AEJA 4XJPA 5DJ1A 4JEXA 4A0FA 4LNJA 1CQ8A 3HDOA 5EUDA 3DR7A 3AOVA 1ORDA 3N75A 4WBTA 1X0MA 1RVYA 1WKGA 1RV3A 3FVSA 4P3MA 1D2FA 4AOAA 4M2JA 1GCKA 3AEMA 5EAAA 2VLFA 2W8JA 2AEUA 3A9ZA 4OT8A 1YAAA 4Q76A 1MDOA 2V0YA 2ZY4A 1C7GA 4M2MA 5LHAA 4ZDPA 3H14A 2CY8A 3RCHB 2ZC0A 1M0PA 1N8PA 5M4DA 4LNMA 3ISLA 4JE5D 3AENA 3MADA 4UHMA 2VMRA 3FDBA 4FFCA 1ARTA 5F8VA 3QBOA 4L0OA 3WCOA 1PMMA 1AJSA 5FT4A 2E7JA 1ARSA
chains in the Genus database with same CATH superfamily
1YJZA 4JEZA 4M2KA 4PFFA 2R5EA 2D61A 3G8MA 2GB3A 3FTBA 3HVYA 1D7UA 3UE8A 4E1OA 5M46A 2QBTA 3ASBA 3FFRA 4W1XA 4BA5A 3FZ8A 1OATA 4A6UA 2EO5A 1AJRA 2BI9A 1E5FA 1PMOA 1ZOBA 3PD6A 4WXFA 1ELUA 4ZSWA 4HVKA 2AY4A 4F5JA 4F5HA 1ELQA 5FT5A 2Z9WA 2VMYA 5G09A 2HUUA 1IBJA 2Z9VA 1GC3A 3EIBA 3EI7A 1KAFA 1MAQA 3BN1A 1H1CA 4Y0DA 3BB8A 1AMAA 4P7YA 3TQXA 2AATA 9AATA 3WZFA 1YJYA 5EUEA 1BJOB 4H51A 4J5UA 4LW2A 3RI6A 2OKJA 3E2ZA 3AEJC 3FRKA 4OCAA 1AX4A 1ASCA 1IUGA 1MGVA 1FG3A 1I29A 3I5TA 4U2HA 4WLJA 1V2EA 3WLXA 5E3KA 1BKGA 5BJ4A 4N0BA 3WKSA 5EQCA 2BI5A 2FQ6A 2GMUA 8AATA 3AEMC 3EI9A 1LC8A 1WYTB 2ORDA 2VMWA 1KKPA 3GZDA 4ADDA 1YIYA 4ZAHA 1SZUA 1S08A 3GBXA 1DGDA 1KMJA 1OHYA 2AY5A 5E4ZA 1I43A 3IF2A 4E77A 4W8IA 2BWNA 3COGA 2CJHA 3MC6C 1M4NA 1QJ3A 2HUIA 4IXZA 1S06A 4BA4A 2AY3A 2DR1A 3FQAA 2C0RA 1Z3ZA 2V1PA 4GDYA 4XQ2A 3ZZKA 5IWQA 4W91A 3DYDA 5EIGA 2W7LA 2HP2A 3F9TA 2JJHA 1BJWA 1D7RA 2W7DA 2PO3A 2VGSA 3AOWA 2FKIA 1O61A 5D5SA 2D64A 2VI9A 1AHEA 2C7TA 4WP0A 2VGTA 2W7MA 4XAUA 1GD9A 1FC4A 4A6TA 4F5IA 4JEVA 2JISA 3R9AA 4ZSYA 4WB0B 1IX7A 1VP4A 1SFFA 4MKJA 2X8UA 1IJIA 1ASDA 1RV4A 2JJEA 1DKAA 3CAIA 4F5MA 2Z9UA 2WKAA 2X5FA 1V72A 3KGXA 4RIZA 3RBFA 3PDXA 3K28A 2ZP7A 4IY7A 2VMOA 1UU0A 2EH6A 2WK8A 4FL0A 4RM1A 1ARIA 2CTZA 3MKJA 3RQ1A 3NYTA 2FN6A 3E6GA 3L44A 1X2AA 4IXOA 4F5KA 1ASEA 1QIRA 2W7KA 1B5PA 1W7LA 3FCRA 2PB2A 4F5FA 1WYVA 5BJ3A 3BC8A 3USFA 2VMUA 1LK9A 2G6WA 4EB7A 3LY1A 2O7CA 2OKKA 2HZPA 2RFVA 3QN6A 2EZ2A 5DB5A 4MKKA 2BI3A 3DR4A 1PFFA 1RVUA 1Z7DA 4GRXA 1BJ4A 1AIBA 1CZCA 4RJYA 2JGTA 5C6UA 2CSTA 4N0WA 3GZDC 4NOGA 4K05A 1IVRA 2G7JA 1GDEA 4XJLA 4ITXA 1AICA 4WYEA 3GSBA 3CBFA 1S07A 4F5GA 4WXBA 3AENB 2ZY2A 2FM1A 2EYQA 4TV7A 1ASNA 2BI1A 4JF1A 2WK9A 1WKHA 2FYFA 1EJIA 1AJSB 1DJUA 4MQPA 1X28A 2BI2A 2D63A 4PFNA 2VYCA 2YHKA 2VGVA 3FQ7A 2VMNA 4W1VA 3VOMA 3FDDA 3GZCA 3N0LA 2HOYA 1CL2A 3PIUA 4HF8A 4GE9A 3MC6A 2CB1A 2EGYA 1SVVA 4EU1A 1QJ5A 4LW4A 1H0CA 1V2FA 4A0RA 4R2NA 4MQQA 2W8VA 1M7YA 2W7GA 3ATHA 2BIEA 3PD6B 3VAXA 3E77A 3PDBA 1O62A 1GEXA 1B5OA 3IHJA 1QGNA 3G0TA 3L8AA 3NU7A 4LNLA 4TN4A 4R8DA 3A2BA 3NYUA 5HXXA 4RKCA 2WB6A 1CZEA 1VEFA 2DKBA 1O69A 2QB2A 4IX8A 2OGAA 4F5LA 4ADEA 1OXPA 3E9KA 4Y0IA 3KE3A 4B9BA 2R0TA 3E2ZB 4Q31A 4WYAA 1UU1A 2FNIA 1G7XA 2YKYA 1AKCA 3PAAA 3QHXA 2AY2A 4K2MA 4KXKA 2ZSLA 1ASGA 5G4JA 3AEOA 1MLZA 3PA9A 3BV0A 5FT6A 4ZM4A 4WXGA 2ZY3A 3QGUA 3BS8A 2E54A 1AMQA 1LC7A 2YKXA 3PJ0A 4R5ZA 4OC9A 4Y0HA 2BYLA 3FZ6A 4WYFA 2AY7A 2BYJA 3BWNC 5TF5A 1DFOA 1VJOA 1TOGA 1AKBA 4RLGA 3FZ7A 1ZC9A 3F0HA 5KTBA 4OTLA 1AHYA 1M0QA 2TPLA 2XBNA 3R4TA 2BIAA 2HOXA 2HUFA 4EFFA 4PVFA 1SZKA 3PPLA 4XJMA 1I41A 1AHXA 2JG2A 3FVXA 4WYCA 1LS3A 1AMSA 1JS3A 2JJGA 2Q7WA 4WYGA 2CFBA 5DJ9A 2YKVA 2CJGA 3WX9A 1XI9A 3WGBA 4IW7A 4DQ6A 1MDXA 4EMYA 2KFPA 2PB0A 1QITA 4TMRA 1GC0A 2DKJA 3M5UA 3P6KA 2AEVA 2BWPA 2BHXA 1GEWA 4IYOA 3N4RA 1E5EA 3BCBA 3MAFA 3RBLA 2CH2A 2EPJA 1TATA 4Q75A 1AY5A 1M6SA 2W8UA 5G2QA 4K2BA 1LC5A 4ZDOA 3QM2A 2CJDA 1IAXA 1B4XA 3JZLA 4B98A 1DGEA 2AY8A 1JS6A 1AKAA 4H63Q 1WYVB 2DOUA 4I8AA 3FKDA 3E2YA 3ZRRA 5M4BA 2A1VA 3HQTA 3P1TA 3LV2A 4ZM3A 1U08A 1BJNA 1TPLA 3B46A 1M0OA 4JE5A 4WLHA 1WSTA 2W8TA 1B8GA 3CQ5A 1IX6A 2D7YA 3KKIA 4ITGA 5M49A 1MDZA 1YIZA 3FVUA 4LC3A 4AZKA 2Z20A 1DJEA 1ARHA 3E2FA 1WYUA 4KAMA 3N4XA 3F6TA 4ZWMA 4ZWVA 2QLRA 1AHFA 3K40A 3NX3A 3BCXA 2R5CA 1BS0A 1P3WA 2HOZA 2VLHA 2W7FA 4OYTA 3VP6A 3VK4A 4CVQA 2OQXA 3JW9A 3W1IA 3DODA 1GC4A 3JU7A 3N5MA 3AV7A 1LW4A 2C44A 3HT4A 2E7UA 3CQ6A 4RKDA 3NYSA 3NUIA 3WY7A 1G4XA 1CQ7A 3BWNA 3LG0A 3UWCA 3VK2A 4MQRA 2JJFA 3QPGA 3HMUA 3JWAA 4AO4A 2VIBA 4A0HA 1ECXA 1S0AA 4Q6RA 4ATQA 3K7YA 3ZZJA 4A6RA 3B1EA 5FT8A 4IXSA 1ARGA 4AH3A 3PDBB 1AAWA 3EZ1A 4PIWA 1TOKA 3TCMA 2YRIA 2GMSA 1D7SA 3NDNA 2BKWA 4A00A 4XK1A 3B1CA 4DGTA 1MLYA 2X3LA 4AZJA 2VMXA 3DRDA 2FNUA 2DGLA 4R5FA 2VI8A 1T3IA 5F9SA 3WGCA 1QISA 1O4SA 2ZYJA 3FD0A 1ASAA 5HHYA 2GSAA 2VIAA 4AO9A 1AHGA 1ASFA 3MAUA 4UOYA 1B9HA 1SZSA 3JTXA 1I48A 2W7JA 3GJUA 2VGWA 5EFSA 4CBRA 2QA3A 5AX8A 1B9IA 1D7VA 4ISYA 1Y4IA 3EI8A 3TFUA 3LVLB 2W7HA 5LH9A 3A9YA 5D95A 1LKCA 4O6ZA 2YOBA 2YCTA 3LVJA 3II0A 2YCNA 2O1BA 2EZ1A 3ZRPA 3CQ4A 3NNKA 1IX8A 2D5YA 3EI5A 5EIGB 2R2NA 2D66A 3DXVA 4OBVA 1C7OA 1J32A 2CANA 3GR9A 4ZLVA 1CL1A 4EB5A 2D7ZA 2XH1A 7AATA 2ZUKA 1G7WA 1M0NA 3NU8A 3DU4A 3ASAA 4OBUA 5J8QA 1AAMA 3ACZA 2DGKA 3JWBA 2O0RA 4K2IA 1YJSA 2HP1A 2OATA 1TASA 4IYOB 3B8XA 3MBBA 5E5IA 4CBSA 1YOOA 2ZJGA 3MAFB 3ZRQA 3DC1A 3FQ8A 3RCHA 3BWOA 1GBNA 3AEPA 3WCNA 4CXQA 2Z1YA 4UHNA 3HLMA 1KL2A 2VMZA 4JEYA 2VMPA 2C81A 3H9XA 3EI6A 4BMKA 4F4EA 1W23A 4DBCA 1IAYA 3D6KA 4J8LA 1JF9A 4MSOA 2ZSMA 4UHOA 3N7NA 3I4JA 3NUBA 2CINA 3ECDA 3UAKA 5G0AA 3T32A 2AY9A 2W7IA 2D65A 3NRAA 4XEWA 1FG7A 3QI6A 3EIAA 1PG8A 1AMRA 1OHWA 1V2DA 2X5DA 4E3RA 2WK7A 2ZY5A 2Z67A 1C7NA 2QSRA 1KL1A 1ASBA 1ASLA 2VMVA 1SF2A 1W7MA 1QZ9A 1OXOA 1BT4A 1C4KA 1G4VA 2F8JA 1JG8A 2BWOA 4MY5A 2Z1ZA 5DX5A 4W1WA 4BHDA 1S09A 1TOEA 4CXRA 2BIGA 1WYUB 4OMAA 2NMPA 5G4IA 1UKJA 2W8WA 1BJOA 1C0NA 4W5KA 3LWSA 1GEYA 1DTYA 2VGUA 2R5CB 1GC2A 2E7IA 1KMKA 4RAEA 4WYDA 4ZASA 4A0GA 3FSLA 1TOIA 4ATPA 3AELA 3TFTA 1TOJA 1W7NA 5K8BA 3EZSA 2QMAA 2CH1A 4QGRA 2AY1A 1SPAA 1WYTA 1BQDA 2DGMA 1MAPA 4U1TA 1DJ9A 4KYOA 1CS1A 1BW0A 5JAYA 4JF0A 3LVKA 1CQ6A 2VMTA 1UU2A 4MGRA 1W3UA 4UQVA 2VMQA 1X29A 1C9CA 3AATA 1AIAA 4XJOA 1XEYA 1ZODA 5I92A 3ELPA 2Z9XA 3KGWA 3PGYA 4GEBA 4A72A 4BQ0A 5EAVA 2Z61A 3FFHA 3VK3A 4ADCA 3A8UX 1AY8A 3W1HA 1TARA 2W7EA 4GE4A 4ADBA 2VGZA 3ELEA 2OGEA 1M32A 2YCPA 2YKUA 2GQNA 3I16A 1BQAA 5EUNA 3DZZA 4JEWA 2HORA 3NTJA 3RUYA 1AY4A 1ASMA 1EQBA 4WB0A 4WD2A 5G2PA 3HL2A 3EUCA 4RITA 3H7FA 3DXWA 3OP7A 4GSAA 4E3QA 3LVMA 1EG5A 3BCAA 4ZDLA 3TATA 3W1JA 1YNUA 2AY6A 3MEBA 5HDMA 4RJ0A 2YRRA 1KKJA 1OHVA 3GWPA 1CJ0A 2QB3A 3WKRA 1J04A 2VMSA 3B1DA 3G7QA 3GETA 3OKSA 1LW5A 3A9XA 1N31A 3HBXA 1N2TA 3Q8NA 4GE7A 3AEJA 4XJPA 5DJ1A 4JEXA 4A0FA 4LNJA 1CQ8A 3HDOA 5EUDA 3DR7A 3AOVA 1ORDA 3N75A 4WBTA 1X0MA 1RVYA 1WKGA 1RV3A 3FVSA 4P3MA 1D2FA 4AOAA 4M2JA 1GCKA 3AEMA 5EAAA 2VLFA 2W8JA 2AEUA 3A9ZA 4OT8A 1YAAA 4Q76A 1MDOA 2V0YA 2ZY4A 1C7GA 4M2MA 5LHAA 4ZDPA 3H14A 2CY8A 3RCHB 2ZC0A 1M0PA 1N8PA 5M4DA 4LNMA 3ISLA 4JE5D 3N4SA 3AENA 3MADA 4UHMA 2VMRA 3FDBA 4FFCA 1ARTA 5F8VA 3QBOA 4L0OA 3WCOA 1PMMA 1AJSA 5FT4A 2E7JA 1ARSA
chains in the Genus database with same CATH topology
1YJZA 4JEZA 4M2KA 4PFFA 2R5EA 2D61A 3G8MA 2GB3A 3FTBA 3HVYA 1D7UA 3UE8A 4E1OA 5M46A 2QBTA 3ASBA 3FFRA 4W1XA 4BA5A 3FZ8A 1OATA 4A6UA 2EO5A 1AJRA 2BI9A 1E5FA 1PMOA 1ZOBA 3PD6A 4WXFA 1ELUA 4ZSWA 4HVKA 2AY4A 4F5JA 4F5HA 1ELQA 5FT5A 2Z9WA 2VMYA 5G09A 2HUUA 1IBJA 2Z9VA 1GC3A 3EIBA 3EI7A 1MAQA 3BN1A 1H1CA 4Y0DA 3BB8A 1AMAA 4P7YA 3TQXA 2AATA 9AATA 3WZFA 1YJYA 5EUEA 1BJOB 4H51A 4J5UA 4LW2A 3RI6A 2OKJA 3E2ZA 3AEJC 3FRKA 4OCAA 1AX4A 1ASCA 1IUGA 1MGVA 1FG3A 1I29A 3I5TA 4U2HA 4WLJA 1V2EA 3WLXA 5E3KA 1BKGA 5BJ4A 4N0BA 3WKSA 5EQCA 2BI5A 2FQ6A 2GMUA 8AATA 3AEMC 3EI9A 1LC8A 1WYTB 2ORDA 2VMWA 1KKPA 3GZDA 4ADDA 1YIYA 4ZAHA 1SZUA 1S08A 3GBXA 1DGDA 1KMJA 1OHYA 2AY5A 5E4ZA 1I43A 3IF2A 4E77A 4W8IA 2BWNA 3COGA 2CJHA 3MC6C 1M4NA 1QJ3A 2HUIA 4IXZA 1S06A 4BA4A 2AY3A 2DR1A 3FQAA 2C0RA 1Z3ZA 2V1PA 4GDYA 4XQ2A 3ZZKA 5IWQA 4W91A 3DYDA 5EIGA 2W7LA 2HP2A 3F9TA 2JJHA 1BJWA 1D7RA 2W7DA 2PO3A 2VGSA 3AOWA 2FKIA 1O61A 5D5SA 2D64A 2VI9A 1AHEA 2C7TA 4WP0A 2VGTA 2W7MA 4XAUA 1GD9A 1FC4A 4A6TA 4F5IA 4JEVA 2JISA 3R9AA 4ZSYA 4WB0B 1IX7A 1VP4A 1SFFA 4MKJA 2X8UA 1IJIA 1ASDA 1RV4A 2JJEA 1DKAA 3CAIA 4F5MA 2Z9UA 2WKAA 2X5FA 1V72A 3KGXA 4RIZA 3RBFA 3PDXA 3K28A 2ZP7A 4IY7A 2VMOA 1UU0A 2EH6A 2WK8A 4FL0A 4RM1A 1ARIA 2CTZA 3MKJA 3RQ1A 3NYTA 2FN6A 3E6GA 3L44A 1X2AA 4IXOA 4F5KA 1ASEA 1QIRA 2W7KA 1B5PA 1W7LA 3FCRA 2PB2A 4F5FA 1WYVA 5BJ3A 3BC8A 3USFA 2VMUA 1LK9A 2G6WA 4EB7A 3LY1A 2O7CA 2OKKA 2HZPA 2RFVA 3QN6A 2EZ2A 5DB5A 4MKKA 2BI3A 3DR4A 1PFFA 1RVUA 1Z7DA 4GRXA 1BJ4A 1AIBA 1CZCA 4RJYA 2JGTA 5C6UA 2CSTA 4N0WA 3GZDC 4NOGA 4K05A 1IVRA 2G7JA 1GDEA 4XJLA 4ITXA 1AICA 4WYEA 3GSBA 3CBFA 1S07A 4F5GA 4WXBA 3AENB 2ZY2A 2FM1A 2EYQA 4TV7A 1ASNA 2BI1A 4JF1A 2WK9A 1WKHA 2FYFA 1EJIA 1AJSB 1DJUA 4MQPA 1X28A 2BI2A 2D63A 4PFNA 2VYCA 2YHKA 2VGVA 3FQ7A 2VMNA 4W1VA 3VOMA 3FDDA 3GZCA 3N0LA 2HOYA 1CL2A 3PIUA 4HF8A 4GE9A 3MC6A 2CB1A 2EGYA 1SVVA 4EU1A 1QJ5A 4LW4A 1H0CA 1V2FA 4A0RA 4R2NA 4MQQA 2W8VA 1M7YA 2W7GA 3ATHA 2BIEA 3PD6B 3VAXA 3E77A 3PDBA 1O62A 1GEXA 1B5OA 3IHJA 1QGNA 3G0TA 3L8AA 3NU7A 4LNLA 4TN4A 4R8DA 3A2BA 3NYUA 5HXXA 4RKCA 2WB6A 1CZEA 1VEFA 2DKBA 1O69A 2QB2A 4IX8A 2OGAA 4F5LA 4ADEA 1OXPA 3E9KA 4Y0IA 3KE3A 4B9BA 2R0TA 3E2ZB 4Q31A 4WYAA 1UU1A 2FNIA 1G7XA 2YKYA 1AKCA 3PAAA 3QHXA 2AY2A 4K2MA 4KXKA 2ZSLA 1ASGA 5G4JA 3AEOA 1MLZA 3PA9A 3BV0A 5FT6A 4ZM4A 4WXGA 2ZY3A 3QGUA 3BS8A 2E54A 1AMQA 1LC7A 2YKXA 3PJ0A 4R5ZA 4OC9A 4Y0HA 2BYLA 3FZ6A 4WYFA 2AY7A 2BYJA 3BWNC 5TF5A 1DFOA 1VJOA 1TOGA 1AKBA 4RLGA 3FZ7A 1ZC9A 3F0HA 5KTBA 4OTLA 1AHYA 1M0QA 2TPLA 2XBNA 3R4TA 2BIAA 2HOXA 2HUFA 4EFFA 4PVFA 1SZKA 3PPLA 4XJMA 1I41A 1AHXA 2JG2A 3FVXA 4WYCA 1LS3A 1AMSA 1JS3A 2JJGA 2Q7WA 4WYGA 2CFBA 5DJ9A 2YKVA 2CJGA 3WX9A 1XI9A 3WGBA 4IW7A 4DQ6A 1MDXA 4EMYA 2KFPA 2PB0A 1QITA 4TMRA 1GC0A 2DKJA 3M5UA 3P6KA 2AEVA 2BWPA 2BHXA 1GEWA 4IYOA 3N4RA 1E5EA 3BCBA 3MAFA 3RBLA 2CH2A 2EPJA 1TATA 4Q75A 1AY5A 1M6SA 2W8UA 5G2QA 4K2BA 1LC5A 4ZDOA 3QM2A 2CJDA 1IAXA 1B4XA 3JZLA 4B98A 1DGEA 2AY8A 1JS6A 1AKAA 4H63Q 1WYVB 2DOUA 4I8AA 3FKDA 3E2YA 3ZRRA 5M4BA 2A1VA 3HQTA 3P1TA 3LV2A 4ZM3A 1U08A 1BJNA 1TPLA 3B46A 1M0OA 4JE5A 4WLHA 1WSTA 2W8TA 1B8GA 3CQ5A 1IX6A 2D7YA 3KKIA 4ITGA 5M49A 1MDZA 1YIZA 3FVUA 4LC3A 4AZKA 2Z20A 1DJEA 1ARHA 3E2FA 1WYUA 4KAMA 3N4XA 3F6TA 4ZWMA 4ZWVA 2QLRA 1AHFA 3K40A 3NX3A 3BCXA 2R5CA 1BS0A 1P3WA 2HOZA 2VLHA 2W7FA 4OYTA 3VP6A 3VK4A 4CVQA 2OQXA 3JW9A 3W1IA 3DODA 1GC4A 3JU7A 3N5MA 3AV7A 1LW4A 2C44A 3HT4A 2E7UA 3CQ6A 4RKDA 3NYSA 3NUIA 3WY7A 1G4XA 1CQ7A 3BWNA 3LG0A 3UWCA 3VK2A 4MQRA 2JJFA 3QPGA 3HMUA 3JWAA 4AO4A 2VIBA 4A0HA 1ECXA 1S0AA 4Q6RA 4ATQA 3K7YA 3ZZJA 4A6RA 3B1EA 5FT8A 4IXSA 1ARGA 4AH3A 3PDBB 1AAWA 3EZ1A 4PIWA 1TOKA 3TCMA 2YRIA 2GMSA 1D7SA 3NDNA 2BKWA 4A00A 4XK1A 3B1CA 4DGTA 1MLYA 2X3LA 4AZJA 2VMXA 3DRDA 2FNUA 2DGLA 4R5FA 2VI8A 1T3IA 5F9SA 3WGCA 1QISA 1O4SA 2ZYJA 3FD0A 1ASAA 5HHYA 2GSAA 2VIAA 4AO9A 1AHGA 1ASFA 3MAUA 4UOYA 1B9HA 1SZSA 3JTXA 1I48A 2W7JA 3GJUA 2VGWA 5EFSA 4CBRA 2QA3A 5AX8A 1B9IA 1D7VA 4ISYA 1Y4IA 3EI8A 3TFUA 3LVLB 2W7HA 5LH9A 3A9YA 5D95A 1LKCA 4O6ZA 2YOBA 2YCTA 3LVJA 3II0A 2YCNA 2O1BA 2EZ1A 3ZRPA 3CQ4A 3NNKA 1IX8A 2D5YA 3EI5A 5EIGB 2R2NA 2D66A 3DXVA 4OBVA 1C7OA 1J32A 2CANA 3GR9A 4ZLVA 1CL1A 4EB5A 2D7ZA 2XH1A 7AATA 2ZUKA 1G7WA 1M0NA 3NU8A 3DU4A 3ASAA 4OBUA 5J8QA 1AAMA 3ACZA 2DGKA 3JWBA 2O0RA 4K2IA 1YJSA 2HP1A 2OATA 1TASA 4IYOB 3B8XA 3MBBA 5E5IA 4CBSA 1YOOA 2ZJGA 3MAFB 3ZRQA 3DC1A 3FQ8A 3RCHA 3BWOA 1GBNA 3AEPA 3WCNA 4CXQA 2Z1YA 4UHNA 3HLMA 1KL2A 2VMZA 4JEYA 2VMPA 2C81A 3H9XA 3EI6A 4BMKA 4F4EA 1W23A 4DBCA 1IAYA 3D6KA 4J8LA 1JF9A 4MSOA 2ZSMA 4UHOA 3N7NA 3I4JA 3NUBA 2CINA 3ECDA 3UAKA 5G0AA 3T32A 2AY9A 2W7IA 2D65A 3NRAA 4XEWA 1FG7A 3QI6A 3EIAA 1PG8A 1AMRA 1OHWA 1V2DA 2X5DA 4E3RA 2WK7A 2ZY5A 2Z67A 1C7NA 2QSRA 1KL1A 1ASBA 1ASLA 2VMVA 1SF2A 1W7MA 1QZ9A 1OXOA 1BT4A 1C4KA 1G4VA 2F8JA 1JG8A 2BWOA 4MY5A 2Z1ZA 5DX5A 4W1WA 4BHDA 1S09A 1TOEA 4CXRA 2BIGA 1WYUB 4OMAA 2NMPA 5G4IA 1UKJA 2W8WA 1BJOA 1C0NA 4W5KA 3LWSA 1GEYA 1DTYA 2VGUA 2R5CB 1GC2A 2E7IA 1KMKA 4RAEA 4WYDA 4ZASA 4A0GA 3FSLA 1TOIA 4ATPA 3AELA 3TFTA 1TOJA 1W7NA 5K8BA 3EZSA 2QMAA 2CH1A 4QGRA 2AY1A 1SPAA 1WYTA 1BQDA 2DGMA 1MAPA 4U1TA 1DJ9A 4KYOA 1CS1A 1BW0A 5JAYA 4JF0A 3LVKA 1CQ6A 2VMTA 1UU2A 4MGRA 1W3UA 4UQVA 2VMQA 1X29A 1C9CA 3AATA 1AIAA 4XJOA 1XEYA 1ZODA 5I92A 3ELPA 2Z9XA 3KGWA 3PGYA 4GEBA 4A72A 4BQ0A 5EAVA 2Z61A 3FFHA 3VK3A 4ADCA 3A8UX 1AY8A 3W1HA 1TARA 2W7EA 4GE4A 4ADBA 2VGZA 3ELEA 2OGEA 1M32A 2YCPA 2YKUA 2GQNA 3I16A 1BQAA 5EUNA 3DZZA 4JEWA 2HORA 3NTJA 3RUYA 1AY4A 1ASMA 1EQBA 4WB0A 4WD2A 5G2PA 3HL2A 3EUCA 4RITA 3H7FA 3DXWA 3OP7A 4GSAA 4E3QA 3LVMA 1EG5A 3BCAA 4ZDLA 3TATA 3W1JA 1YNUA 2AY6A 3MEBA 5HDMA 4RJ0A 2YRRA 1KKJA 1OHVA 3GWPA 1CJ0A 2QB3A 3WKRA 1J04A 2VMSA 3B1DA 3G7QA 3GETA 3OKSA 1LW5A 3A9XA 1N31A 3HBXA 1N2TA 3Q8NA 4GE7A 3AEJA 4XJPA 5DJ1A 4JEXA 4A0FA 4LNJA 1CQ8A 3HDOA 5EUDA 3DR7A 3AOVA 1ORDA 3N75A 4WBTA 1X0MA 1RVYA 1WKGA 1RV3A 3FVSA 4P3MA 1D2FA 4AOAA 4M2JA 1GCKA 3AEMA 5EAAA 2VLFA 2W8JA 2AEUA 3A9ZA 4OT8A 1YAAA 4Q76A 1MDOA 2V0YA 2ZY4A 1C7GA 4M2MA 5LHAA 4ZDPA 3H14A 2CY8A 3RCHB 2ZC0A 1M0PA 1N8PA 5M4DA 4LNMA 3ISLA 4JE5D 3N4SA 3AENA 3MADA 4UHMA 2VMRA 3FDBA 4FFCA 1ARTA 5F8VA 3QBOA 4L0OA 3WCOA 1PMMA 1AJSA 5FT4A 2E7JA 1ARSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJZ A;  4JEZ A;  4M2K A;  4PFF A;  2R5E A;  2D61 A;  3G8M A;  2GB3 A;  3FTB A;  3HVY A;  1D7U A;  3UE8 A;  4E1O A;  5M46 A;  2QBT A;  3ASB A;  3FFR A;  4W1X A;  4BA5 A;  3FZ8 A;  1OAT A;  4A6U A;  2EO5 A;  1AJR A;  2BI9 A;  1E5F A;  1PMO A;  1ZOB A;  3PD6 A;  4WXF A;  1ELU A;  4ZSW A;  4HVK A;  2AY4 A;  4F5J A;  4F5H A;  1ELQ A;  5FT5 A;  2Z9W A;  2VMY A;  5G09 A;  2HUU A;  1IBJ A;  2Z9V A;  1GC3 A;  3EIB A;  3EI7 A;  1MAQ A;  3BN1 A;  1H1C A;  4Y0D A;  3BB8 A;  1AMA A;  4P7Y A;  3TQX A;  2AAT A;  9AAT A;  3WZF A;  1YJY A;  5EUE A;  1BJO B;  4H51 A;  4J5U A;  4LW2 A;  3RI6 A;  2OKJ A;  3E2Z A;  3AEJ C;  3FRK A;  4OCA A;  1AX4 A;  1ASC A;  1IUG A;  1MGV A;  1FG3 A;  1I29 A;  3I5T A;  4U2H A;  4WLJ A;  1V2E A;  3WLX A;  5E3K A;  1BKG A;  5BJ4 A;  4N0B A;  3WKS A;  5EQC A;  2BI5 A;  2FQ6 A;  2GMU A;  8AAT A;  3AEM C;  3EI9 A;  1LC8 A;  1WYT B;  2ORD A;  2VMW A;  1KKP A;  3GZD A;  4ADD A;  1YIY A;  4ZAH A;  1SZU A;  1S08 A;  3GBX A;  1DGD A;  1KMJ A;  1OHY A;  2AY5 A;  5E4Z A;  1I43 A;  3IF2 A;  4E77 A;  4W8I A;  2BWN A;  3COG A;  2CJH A;  3MC6 C;  1M4N A;  1QJ3 A;  2HUI A;  4IXZ A;  1S06 A;  4BA4 A;  2AY3 A;  2DR1 A;  3FQA A;  2C0R A;  1Z3Z A;  2V1P A;  4GDY A;  4XQ2 A;  3ZZK A;  5IWQ A;  4W91 A;  3DYD A;  5EIG A;  2W7L A;  2HP2 A;  3F9T A;  2JJH A;  1BJW A;  1D7R A;  2W7D A;  2PO3 A;  2VGS A;  3AOW A;  1O61 A;  5D5S A;  2D64 A;  2VI9 A;  1AHE A;  2C7T A;  4WP0 A;  2VGT A;  2W7M A;  4XAU A;  1GD9 A;  1FC4 A;  4A6T A;  4F5I A;  4JEV A;  2JIS A;  3R9A A;  4ZSY A;  4WB0 B;  1IX7 A;  1VP4 A;  1SFF A;  4MKJ A;  2X8U A;  1IJI A;  1ASD A;  1RV4 A;  2JJE A;  1DKA A;  3CAI A;  4F5M A;  2Z9U A;  2WKA A;  2X5F A;  1V72 A;  3KGX A;  4RIZ A;  3RBF A;  3PDX A;  3K28 A;  2ZP7 A;  4IY7 A;  2VMO A;  1UU0 A;  2EH6 A;  2WK8 A;  4FL0 A;  4RM1 A;  1ARI A;  2CTZ A;  3MKJ A;  3RQ1 A;  3NYT A;  2FN6 A;  3E6G A;  3L44 A;  1X2A A;  4IXO A;  4F5K A;  1ASE A;  1QIR A;  2W7K A;  1B5P A;  1W7L A;  3FCR A;  2PB2 A;  4F5F A;  1WYV A;  5BJ3 A;  3BC8 A;  3USF A;  2VMU A;  1LK9 A;  2G6W A;  4EB7 A;  3LY1 A;  2O7C A;  2OKK A;  2HZP A;  2RFV A;  3QN6 A;  2EZ2 A;  5DB5 A;  4MKK A;  2BI3 A;  3DR4 A;  1PFF A;  1RVU A;  1Z7D A;  4GRX A;  1BJ4 A;  1AIB A;  1CZC A;  4RJY A;  2JGT A;  5C6U A;  2CST A;  4N0W A;  3GZD C;  4NOG A;  1IVR A;  1GDE A;  4XJL A;  4ITX A;  1AIC A;  4WYE A;  3GSB A;  3CBF A;  1S07 A;  4F5G A;  4WXB A;  3AEN B;  2ZY2 A;  2FM1 A;  4TV7 A;  1ASN A;  2BI1 A;  4JF1 A;  2WK9 A;  1WKH A;  2FYF A;  1EJI A;  1AJS B;  1DJU A;  4MQP A;  1X28 A;  2BI2 A;  2D63 A;  4PFN A;  2VYC A;  2YHK A;  2VGV A;  3FQ7 A;  2VMN A;  4W1V A;  3VOM A;  3FDD A;  3GZC A;  3N0L A;  2HOY A;  1CL2 A;  3PIU A;  4HF8 A;  4GE9 A;  3MC6 A;  2CB1 A;  2EGY A;  1SVV A;  4EU1 A;  1QJ5 A;  4LW4 A;  1H0C A;  1V2F A;  4A0R A;  4R2N A;  4MQQ A;  2W8V A;  1M7Y A;  2W7G A;  3ATH A;  2BIE A;  3PD6 B;  3VAX A;  3E77 A;  3PDB A;  1O62 A;  1GEX A;  1B5O A;  3IHJ A;  1QGN A;  3G0T A;  3L8A A;  3NU7 A;  4LNL A;  4TN4 A;  4R8D A;  3A2B A;  3NYU A;  5HXX A;  4RKC A;  1CZE A;  1VEF A;  2DKB A;  1O69 A;  2QB2 A;  4IX8 A;  2OGA A;  4F5L A;  4ADE A;  1OXP A;  3E9K A;  4Y0I A;  3KE3 A;  4B9B A;  2R0T A;  3E2Z B;  4Q31 A;  4WYA A;  1UU1 A;  2FNI A;  1G7X A;  2YKY A;  1AKC A;  3PAA A;  3QHX A;  2AY2 A;  4K2M A;  4KXK A;  2ZSL A;  1ASG A;  5G4J A;  3AEO A;  1MLZ A;  3PA9 A;  3BV0 A;  5FT6 A;  4ZM4 A;  4WXG A;  2ZY3 A;  3QGU A;  3BS8 A;  2E54 A;  1AMQ A;  1LC7 A;  2YKX A;  3PJ0 A;  4R5Z A;  4OC9 A;  4Y0H A;  2BYL A;  3FZ6 A;  4WYF A;  2AY7 A;  2BYJ A;  3BWN C;  5TF5 A;  1DFO A;  1VJO A;  1TOG A;  1AKB A;  4RLG A;  3FZ7 A;  1ZC9 A;  3F0H A;  4OTL A;  1AHY A;  1M0Q A;  2TPL A;  2XBN A;  3R4T A;  2BIA A;  2HOX A;  2HUF A;  4EFF A;  4PVF A;  1SZK A;  3PPL A;  4XJM A;  1I41 A;  1AHX A;  2JG2 A;  3FVX A;  4WYC A;  1LS3 A;  1AMS A;  1JS3 A;  2JJG A;  2Q7W A;  4WYG A;  2CFB A;  5DJ9 A;  2YKV A;  2CJG A;  3WX9 A;  1XI9 A;  3WGB A;  4IW7 A;  4DQ6 A;  1MDX A;  4EMY A;  2PB0 A;  1QIT A;  4TMR A;  1GC0 A;  2DKJ A;  3M5U A;  3P6K A;  2AEV A;  2BWP A;  2BHX A;  1GEW A;  4IYO A;  1E5E A;  3BCB A;  3MAF A;  3RBL A;  2CH2 A;  2EPJ A;  1TAT A;  4Q75 A;  1AY5 A;  1M6S A;  2W8U A;  5G2Q A;  4K2B A;  1LC5 A;  4ZDO A;  3QM2 A;  2CJD A;  1IAX A;  1B4X A;  3JZL A;  4B98 A;  1DGE A;  2AY8 A;  1JS6 A;  1AKA A;  1WYV B;  2DOU A;  4I8A A;  3FKD A;  3E2Y A;  3ZRR A;  5M4B A;  3HQT A;  3P1T A;  3LV2 A;  4ZM3 A;  1U08 A;  1BJN A;  1TPL A;  3B46 A;  1M0O A;  4JE5 A;  4WLH A;  1WST A;  2W8T A;  1B8G A;  3CQ5 A;  1IX6 A;  2D7Y A;  3KKI A;  4ITG A;  5M49 A;  1MDZ A;  1YIZ A;  3FVU A;  4LC3 A;  4AZK A;  2Z20 A;  1DJE A;  1ARH A;  3E2F A;  1WYU A;  4KAM A;  3F6T A;  4ZWM A;  4ZWV A;  2QLR A;  1AHF A;  3K40 A;  3NX3 A;  3BCX A;  2R5C A;  1BS0 A;  1P3W A;  2HOZ A;  2VLH A;  2W7F A;  4OYT A;  3VP6 A;  3VK4 A;  4CVQ A;  2OQX A;  3JW9 A;  3W1I A;  3DOD A;  1GC4 A;  3JU7 A;  3N5M A;  3AV7 A;  1LW4 A;  2C44 A;  3HT4 A;  2E7U A;  3CQ6 A;  4RKD A;  3NYS A;  3NUI A;  3WY7 A;  1G4X A;  1CQ7 A;  3BWN A;  3LG0 A;  3UWC A;  3VK2 A;  4MQR A;  2JJF A;  3QPG A;  3HMU A;  3JWA A;  4AO4 A;  2VIB A;  4A0H A;  1ECX A;  1S0A A;  4Q6R A;  4ATQ A;  3K7Y A;  3ZZJ A;  4A6R A;  3B1E A;  5FT8 A;  4IXS A;  1ARG A;  4AH3 A;  3PDB B;  1AAW A;  3EZ1 A;  4PIW A;  1TOK A;  3TCM A;  2YRI A;  2GMS A;  1D7S A;  3NDN A;  2BKW A;  4A00 A;  4XK1 A;  3B1C A;  4DGT A;  1MLY A;  2X3L A;  4AZJ A;  2VMX A;  3DRD A;  2FNU A;  2DGL A;  4R5F A;  2VI8 A;  1T3I A;  5F9S A;  3WGC A;  1QIS A;  1O4S A;  2ZYJ A;  3FD0 A;  1ASA A;  5HHY A;  2GSA A;  2VIA A;  4AO9 A;  1AHG A;  1ASF A;  3MAU A;  4UOY A;  1B9H A;  1SZS A;  3JTX A;  1I48 A;  2W7J A;  3GJU A;  2VGW A;  5EFS A;  4CBR A;  2QA3 A;  5AX8 A;  1B9I A;  1D7V A;  4ISY A;  1Y4I A;  3EI8 A;  3TFU A;  3LVL B;  2W7H A;  5LH9 A;  3A9Y A;  5D95 A;  1LKC A;  4O6Z A;  2YOB A;  2YCT A;  3LVJ A;  3II0 A;  2YCN A;  2O1B A;  2EZ1 A;  3ZRP A;  3CQ4 A;  3NNK A;  1IX8 A;  2D5Y A;  3EI5 A;  5EIG B;  2R2N A;  2D66 A;  3DXV A;  4OBV A;  1C7O A;  1J32 A;  2CAN A;  3GR9 A;  4ZLV A;  1CL1 A;  4EB5 A;  2D7Z A;  2XH1 A;  7AAT A;  2ZUK A;  1G7W A;  1M0N A;  3NU8 A;  3DU4 A;  3ASA A;  4OBU A;  5J8Q A;  1AAM A;  3ACZ A;  2DGK A;  3JWB A;  2O0R A;  4K2I A;  1YJS A;  2HP1 A;  2OAT A;  1TAS A;  4IYO B;  3B8X A;  3MBB A;  5E5I A;  4CBS A;  1YOO A;  2ZJG A;  3MAF B;  3ZRQ A;  3DC1 A;  3FQ8 A;  3RCH A;  3BWO A;  1GBN A;  3AEP A;  3WCN A;  4CXQ A;  2Z1Y A;  4UHN A;  3HLM A;  1KL2 A;  2VMZ A;  4JEY A;  2VMP A;  2C81 A;  3EI6 A;  4BMK A;  4F4E A;  1W23 A;  4DBC A;  1IAY A;  3D6K A;  4J8L A;  1JF9 A;  4MSO A;  2ZSM A;  4UHO A;  3I4J A;  3NUB A;  2CIN A;  3ECD A;  3UAK A;  5G0A A;  3T32 A;  2AY9 A;  2W7I A;  2D65 A;  3NRA A;  4XEW A;  1FG7 A;  3QI6 A;  3EIA A;  1PG8 A;  1AMR A;  1OHW A;  1V2D A;  2X5D A;  4E3R A;  2WK7 A;  2ZY5 A;  2Z67 A;  1C7N A;  1KL1 A;  1ASB A;  1ASL A;  2VMV A;  1SF2 A;  1W7M A;  1QZ9 A;  1OXO A;  1BT4 A;  1C4K A;  1G4V A;  2F8J A;  1JG8 A;  2BWO A;  4MY5 A;  2Z1Z A;  5DX5 A;  4W1W A;  4BHD A;  1S09 A;  1TOE A;  4CXR A;  2BIG A;  1WYU B;  4OMA A;  2NMP A;  5G4I A;  1UKJ A;  2W8W A;  1BJO A;  1C0N A;  4W5K A;  3LWS A;  1GEY A;  1DTY A;  2VGU A;  2R5C B;  1GC2 A;  2E7I A;  1KMK A;  4RAE A;  4WYD A;  4ZAS A;  4A0G A;  3FSL A;  1TOI A;  4ATP A;  3AEL A;  3TFT A;  1TOJ A;  1W7N A;  5K8B A;  3EZS A;  2QMA A;  2CH1 A;  4QGR A;  2AY1 A;  1SPA A;  1WYT A;  1BQD A;  2DGM A;  1MAP A;  4U1T A;  1DJ9 A;  4KYO A;  1CS1 A;  1BW0 A;  5JAY A;  4JF0 A;  3LVK A;  1CQ6 A;  2VMT A;  1UU2 A;  4MGR A;  1W3U A;  4UQV A;  2VMQ A;  1X29 A;  1C9C A;  3AAT A;  1AIA A;  4XJO A;  1XEY A;  1ZOD A;  5I92 A;  3ELP A;  2Z9X A;  3KGW A;  3PGY A;  4GEB A;  4A72 A;  4BQ0 A;  5EAV A;  2Z61 A;  3FFH A;  3VK3 A;  4ADC A;  3A8U X;  1AY8 A;  3W1H A;  1TAR A;  2W7E A;  4GE4 A;  4ADB A;  2VGZ A;  3ELE A;  2OGE A;  1M32 A;  2YCP A;  2YKU A;  2GQN A;  3I16 A;  1BQA A;  5EUN A;  3DZZ A;  4JEW A;  2HOR A;  3NTJ A;  3RUY A;  1AY4 A;  1ASM A;  1EQB A;  4WB0 A;  4WD2 A;  5G2P A;  3HL2 A;  3EUC A;  4RIT A;  3H7F A;  3DXW A;  3OP7 A;  4GSA A;  4E3Q A;  3LVM A;  1EG5 A;  3BCA A;  4ZDL A;  3TAT A;  3W1J A;  1YNU A;  2AY6 A;  3MEB A;  5HDM A;  4RJ0 A;  2YRR A;  1KKJ A;  1OHV A;  3GWP A;  1CJ0 A;  2QB3 A;  3WKR A;  1J04 A;  2VMS A;  3B1D A;  3G7Q A;  3GET A;  3OKS A;  1LW5 A;  3A9X A;  1N31 A;  3HBX A;  1N2T A;  3Q8N A;  4GE7 A;  3AEJ A;  4XJP A;  5DJ1 A;  4JEX A;  4A0F A;  4LNJ A;  1CQ8 A;  3HDO A;  5EUD A;  3DR7 A;  3AOV A;  1ORD A;  3N75 A;  4WBT A;  1X0M A;  1RVY A;  1WKG A;  1RV3 A;  3FVS A;  4P3M A;  1D2F A;  4AOA A;  4M2J A;  1GCK A;  3AEM A;  5EAA A;  2VLF A;  2W8J A;  2AEU A;  3A9Z A;  4OT8 A;  1YAA A;  4Q76 A;  1MDO A;  2V0Y A;  2ZY4 A;  1C7G A;  4M2M A;  5LHA A;  4ZDP A;  3H14 A;  2CY8 A;  3RCH B;  2ZC0 A;  1M0P A;  1N8P A;  5M4D A;  4LNM A;  3ISL A;  4JE5 D;  3AEN A;  3MAD A;  4UHM A;  2VMR A;  3FDB A;  4FFC A;  1ART A;  5F8V A;  3QBO A;  4L0O A;  3WCO A;  1PMM A;  1AJS A;  5FT4 A;  2E7J A;  1ARS A; 
#chains in the Genus database with same CATH topology
 1YJZ A;  4JEZ A;  4M2K A;  4PFF A;  2R5E A;  2D61 A;  3G8M A;  2GB3 A;  3FTB A;  3HVY A;  1D7U A;  3UE8 A;  4E1O A;  5M46 A;  2QBT A;  3ASB A;  3FFR A;  4W1X A;  4BA5 A;  3FZ8 A;  1OAT A;  4A6U A;  2EO5 A;  1AJR A;  2BI9 A;  1E5F A;  1PMO A;  1ZOB A;  3PD6 A;  4WXF A;  1ELU A;  4ZSW A;  4HVK A;  2AY4 A;  4F5J A;  4F5H A;  1ELQ A;  5FT5 A;  2Z9W A;  2VMY A;  5G09 A;  2HUU A;  1IBJ A;  2Z9V A;  1GC3 A;  3EIB A;  3EI7 A;  1KAF A;  1MAQ A;  3BN1 A;  1H1C A;  4Y0D A;  3BB8 A;  1AMA A;  4P7Y A;  3TQX A;  2AAT A;  9AAT A;  3WZF A;  1YJY A;  5EUE A;  1BJO B;  4H51 A;  4J5U A;  4LW2 A;  3RI6 A;  2OKJ A;  3E2Z A;  3AEJ C;  3FRK A;  4OCA A;  1AX4 A;  1ASC A;  1IUG A;  1MGV A;  1FG3 A;  1I29 A;  3I5T A;  4U2H A;  4WLJ A;  1V2E A;  3WLX A;  5E3K A;  1BKG A;  5BJ4 A;  4N0B A;  3WKS A;  5EQC A;  2BI5 A;  2FQ6 A;  2GMU A;  8AAT A;  3AEM C;  3EI9 A;  1LC8 A;  1WYT B;  2ORD A;  2VMW A;  1KKP A;  3GZD A;  4ADD A;  1YIY A;  4ZAH A;  1SZU A;  1S08 A;  3GBX A;  1DGD A;  1KMJ A;  1OHY A;  2AY5 A;  5E4Z A;  1I43 A;  3IF2 A;  4E77 A;  4W8I A;  2BWN A;  3COG A;  2CJH A;  3MC6 C;  1M4N A;  1QJ3 A;  2HUI A;  4IXZ A;  1S06 A;  4BA4 A;  2AY3 A;  2DR1 A;  3FQA A;  2C0R A;  1Z3Z A;  2V1P A;  4GDY A;  4XQ2 A;  3ZZK A;  5IWQ A;  4W91 A;  3DYD A;  5EIG A;  2W7L A;  2HP2 A;  3F9T A;  2JJH A;  1BJW A;  1D7R A;  2W7D A;  2PO3 A;  2VGS A;  3AOW A;  2FKI A;  1O61 A;  5D5S A;  2D64 A;  2VI9 A;  1AHE A;  2C7T A;  4WP0 A;  2VGT A;  2W7M A;  4XAU A;  1GD9 A;  1FC4 A;  4A6T A;  4F5I A;  4JEV A;  2JIS A;  3R9A A;  4ZSY A;  4WB0 B;  1IX7 A;  1VP4 A;  1SFF A;  4MKJ A;  2X8U A;  1IJI A;  1ASD A;  1RV4 A;  2JJE A;  1DKA A;  3CAI A;  4F5M A;  2Z9U A;  2WKA A;  2X5F A;  1V72 A;  3KGX A;  4RIZ A;  3RBF A;  3PDX A;  3K28 A;  2ZP7 A;  4IY7 A;  2VMO A;  1UU0 A;  2EH6 A;  2WK8 A;  4FL0 A;  4RM1 A;  1ARI A;  2CTZ A;  3MKJ A;  3RQ1 A;  3NYT A;  2FN6 A;  3E6G A;  3L44 A;  1X2A A;  4IXO A;  4F5K A;  1ASE A;  1QIR A;  2W7K A;  1B5P A;  1W7L A;  3FCR A;  2PB2 A;  4F5F A;  1WYV A;  5BJ3 A;  3BC8 A;  3USF A;  2VMU A;  1LK9 A;  2G6W A;  4EB7 A;  3LY1 A;  2O7C A;  2OKK A;  2HZP A;  2RFV A;  3QN6 A;  2EZ2 A;  5DB5 A;  4MKK A;  2BI3 A;  3DR4 A;  1PFF A;  1RVU A;  1Z7D A;  4GRX A;  1BJ4 A;  1AIB A;  1CZC A;  4RJY A;  2JGT A;  5C6U A;  2CST A;  4N0W A;  3GZD C;  4NOG A;  4K05 A;  1IVR A;  2G7J A;  1GDE A;  4XJL A;  4ITX A;  1AIC A;  4WYE A;  3GSB A;  3CBF A;  1S07 A;  4F5G A;  4WXB A;  3AEN B;  2ZY2 A;  2FM1 A;  2EYQ A;  4TV7 A;  1ASN A;  2BI1 A;  4JF1 A;  2WK9 A;  1WKH A;  2FYF A;  1EJI A;  1AJS B;  1DJU A;  4MQP A;  1X28 A;  2BI2 A;  2D63 A;  4PFN A;  2VYC A;  2YHK A;  2VGV A;  3FQ7 A;  2VMN A;  4W1V A;  3VOM A;  3FDD A;  3GZC A;  3N0L A;  2HOY A;  1CL2 A;  3PIU A;  4HF8 A;  4GE9 A;  3MC6 A;  2CB1 A;  2EGY A;  1SVV A;  4EU1 A;  1QJ5 A;  4LW4 A;  1H0C A;  1V2F A;  4A0R A;  4R2N A;  4MQQ A;  2W8V A;  1M7Y A;  2W7G A;  3ATH A;  2BIE A;  3PD6 B;  3VAX A;  3E77 A;  3PDB A;  1O62 A;  1GEX A;  1B5O A;  3IHJ A;  1QGN A;  3G0T A;  3L8A A;  3NU7 A;  4LNL A;  4TN4 A;  4R8D A;  3A2B A;  3NYU A;  5HXX A;  4RKC A;  2WB6 A;  1CZE A;  1VEF A;  2DKB A;  1O69 A;  2QB2 A;  4IX8 A;  2OGA A;  4F5L A;  4ADE A;  1OXP A;  3E9K A;  4Y0I A;  3KE3 A;  4B9B A;  2R0T A;  3E2Z B;  4Q31 A;  4WYA A;  1UU1 A;  2FNI A;  1G7X A;  2YKY A;  1AKC A;  3PAA A;  3QHX A;  2AY2 A;  4K2M A;  4KXK A;  2ZSL A;  1ASG A;  5G4J A;  3AEO A;  1MLZ A;  3PA9 A;  3BV0 A;  5FT6 A;  4ZM4 A;  4WXG A;  2ZY3 A;  3QGU A;  3BS8 A;  2E54 A;  1AMQ A;  1LC7 A;  2YKX A;  3PJ0 A;  4R5Z A;  4OC9 A;  4Y0H A;  2BYL A;  3FZ6 A;  4WYF A;  2AY7 A;  2BYJ A;  3BWN C;  5TF5 A;  1DFO A;  1VJO A;  1TOG A;  1AKB A;  4RLG A;  3FZ7 A;  1ZC9 A;  3F0H A;  5KTB A;  4OTL A;  1AHY A;  1M0Q A;  2TPL A;  2XBN A;  3R4T A;  2BIA A;  2HOX A;  2HUF A;  4EFF A;  4PVF A;  1SZK A;  3PPL A;  4XJM A;  1I41 A;  1AHX A;  2JG2 A;  3FVX A;  4WYC A;  1LS3 A;  1AMS A;  1JS3 A;  2JJG A;  2Q7W A;  4WYG A;  2CFB A;  5DJ9 A;  2YKV A;  2CJG A;  3WX9 A;  1XI9 A;  3WGB A;  4IW7 A;  4DQ6 A;  1MDX A;  4EMY A;  2KFP A;  2PB0 A;  1QIT A;  4TMR A;  1GC0 A;  2DKJ A;  3M5U A;  3P6K A;  2AEV A;  2BWP A;  2BHX A;  1GEW A;  4IYO A;  3N4R A;  1E5E A;  3BCB A;  3MAF A;  3RBL A;  2CH2 A;  2EPJ A;  1TAT A;  4Q75 A;  1AY5 A;  1M6S A;  2W8U A;  5G2Q A;  4K2B A;  1LC5 A;  4ZDO A;  3QM2 A;  2CJD A;  1IAX A;  1B4X A;  3JZL A;  4B98 A;  1DGE A;  2AY8 A;  1JS6 A;  1AKA A;  4H63 Q;  1WYV B;  2DOU A;  4I8A A;  3FKD A;  3E2Y A;  3ZRR A;  5M4B A;  2A1V A;  3HQT A;  3P1T A;  3LV2 A;  4ZM3 A;  1U08 A;  1BJN A;  1TPL A;  3B46 A;  1M0O A;  4JE5 A;  4WLH A;  1WST A;  2W8T A;  1B8G A;  3CQ5 A;  1IX6 A;  2D7Y A;  3KKI A;  4ITG A;  5M49 A;  1MDZ A;  1YIZ A;  3FVU A;  4LC3 A;  4AZK A;  2Z20 A;  1DJE A;  1ARH A;  3E2F A;  1WYU A;  4KAM A;  3N4X A;  3F6T A;  4ZWM A;  4ZWV A;  2QLR A;  1AHF A;  3K40 A;  3NX3 A;  3BCX A;  2R5C A;  1BS0 A;  1P3W A;  2HOZ A;  2VLH A;  2W7F A;  4OYT A;  3VP6 A;  3VK4 A;  4CVQ A;  2OQX A;  3JW9 A;  3W1I A;  3DOD A;  1GC4 A;  3JU7 A;  3N5M A;  3AV7 A;  1LW4 A;  2C44 A;  3HT4 A;  2E7U A;  3CQ6 A;  4RKD A;  3NYS A;  3NUI A;  3WY7 A;  1G4X A;  1CQ7 A;  3BWN A;  3LG0 A;  3UWC A;  3VK2 A;  4MQR A;  2JJF A;  3QPG A;  3HMU A;  3JWA A;  4AO4 A;  2VIB A;  4A0H A;  1ECX A;  1S0A A;  4Q6R A;  4ATQ A;  3K7Y A;  3ZZJ A;  4A6R A;  3B1E A;  5FT8 A;  4IXS A;  1ARG A;  4AH3 A;  3PDB B;  1AAW A;  3EZ1 A;  4PIW A;  1TOK A;  3TCM A;  2YRI A;  2GMS A;  1D7S A;  3NDN A;  2BKW A;  4A00 A;  4XK1 A;  3B1C A;  4DGT A;  1MLY A;  2X3L A;  4AZJ A;  2VMX A;  3DRD A;  2FNU A;  2DGL A;  4R5F A;  2VI8 A;  1T3I A;  5F9S A;  3WGC A;  1QIS A;  1O4S A;  2ZYJ A;  3FD0 A;  1ASA A;  5HHY A;  2GSA A;  2VIA A;  4AO9 A;  1AHG A;  1ASF A;  3MAU A;  4UOY A;  1B9H A;  1SZS A;  3JTX A;  1I48 A;  2W7J A;  3GJU A;  2VGW A;  5EFS A;  4CBR A;  2QA3 A;  5AX8 A;  1B9I A;  1D7V A;  4ISY A;  1Y4I A;  3EI8 A;  3TFU A;  3LVL B;  2W7H A;  5LH9 A;  3A9Y A;  5D95 A;  1LKC A;  4O6Z A;  2YOB A;  2YCT A;  3LVJ A;  3II0 A;  2YCN A;  2O1B A;  2EZ1 A;  3ZRP A;  3CQ4 A;  3NNK A;  1IX8 A;  2D5Y A;  3EI5 A;  5EIG B;  2R2N A;  2D66 A;  3DXV A;  4OBV A;  1C7O A;  1J32 A;  2CAN A;  3GR9 A;  4ZLV A;  1CL1 A;  4EB5 A;  2D7Z A;  2XH1 A;  7AAT A;  2ZUK A;  1G7W A;  1M0N A;  3NU8 A;  3DU4 A;  3ASA A;  4OBU A;  5J8Q A;  1AAM A;  3ACZ A;  2DGK A;  3JWB A;  2O0R A;  4K2I A;  1YJS A;  2HP1 A;  2OAT A;  1TAS A;  4IYO B;  3B8X A;  3MBB A;  5E5I A;  4CBS A;  1YOO A;  2ZJG A;  3MAF B;  3ZRQ A;  3DC1 A;  3FQ8 A;  3RCH A;  3BWO A;  1GBN A;  3AEP A;  3WCN A;  4CXQ A;  2Z1Y A;  4UHN A;  3HLM A;  1KL2 A;  2VMZ A;  4JEY A;  2VMP A;  2C81 A;  3H9X A;  3EI6 A;  4BMK A;  4F4E A;  1W23 A;  4DBC A;  1IAY A;  3D6K A;  4J8L A;  1JF9 A;  4MSO A;  2ZSM A;  4UHO A;  3N7N A;  3I4J A;  3NUB A;  2CIN A;  3ECD A;  3UAK A;  5G0A A;  3T32 A;  2AY9 A;  2W7I A;  2D65 A;  3NRA A;  4XEW A;  1FG7 A;  3QI6 A;  3EIA A;  1PG8 A;  1AMR A;  1OHW A;  1V2D A;  2X5D A;  4E3R A;  2WK7 A;  2ZY5 A;  2Z67 A;  1C7N A;  2QSR A;  1KL1 A;  1ASB A;  1ASL A;  2VMV A;  1SF2 A;  1W7M A;  1QZ9 A;  1OXO A;  1BT4 A;  1C4K A;  1G4V A;  2F8J A;  1JG8 A;  2BWO A;  4MY5 A;  2Z1Z A;  5DX5 A;  4W1W A;  4BHD A;  1S09 A;  1TOE A;  4CXR A;  2BIG A;  1WYU B;  4OMA A;  2NMP A;  5G4I A;  1UKJ A;  2W8W A;  1BJO A;  1C0N A;  4W5K A;  3LWS A;  1GEY A;  1DTY A;  2VGU A;  2R5C B;  1GC2 A;  2E7I A;  1KMK A;  4RAE A;  4WYD A;  4ZAS A;  4A0G A;  3FSL A;  1TOI A;  4ATP A;  3AEL A;  3TFT A;  1TOJ A;  1W7N A;  5K8B A;  3EZS A;  2QMA A;  2CH1 A;  4QGR A;  2AY1 A;  1SPA A;  1WYT A;  1BQD A;  2DGM A;  1MAP A;  4U1T A;  1DJ9 A;  4KYO A;  1CS1 A;  1BW0 A;  5JAY A;  4JF0 A;  3LVK A;  1CQ6 A;  2VMT A;  1UU2 A;  4MGR A;  1W3U A;  4UQV A;  2VMQ A;  1X29 A;  1C9C A;  3AAT A;  1AIA A;  4XJO A;  1XEY A;  1ZOD A;  5I92 A;  3ELP A;  2Z9X A;  3KGW A;  3PGY A;  4GEB A;  4A72 A;  4BQ0 A;  5EAV A;  2Z61 A;  3FFH A;  3VK3 A;  4ADC A;  3A8U X;  1AY8 A;  3W1H A;  1TAR A;  2W7E A;  4GE4 A;  4ADB A;  2VGZ A;  3ELE A;  2OGE A;  1M32 A;  2YCP A;  2YKU A;  2GQN A;  3I16 A;  1BQA A;  5EUN A;  3DZZ A;  4JEW A;  2HOR A;  3NTJ A;  3RUY A;  1AY4 A;  1ASM A;  1EQB A;  4WB0 A;  4WD2 A;  5G2P A;  3HL2 A;  3EUC A;  4RIT A;  3H7F A;  3DXW A;  3OP7 A;  4GSA A;  4E3Q A;  3LVM A;  1EG5 A;  3BCA A;  4ZDL A;  3TAT A;  3W1J A;  1YNU A;  2AY6 A;  3MEB A;  5HDM A;  4RJ0 A;  2YRR A;  1KKJ A;  1OHV A;  3GWP A;  1CJ0 A;  2QB3 A;  3WKR A;  1J04 A;  2VMS A;  3B1D A;  3G7Q A;  3GET A;  3OKS A;  1LW5 A;  3A9X A;  1N31 A;  3HBX A;  1N2T A;  3Q8N A;  4GE7 A;  3AEJ A;  4XJP A;  5DJ1 A;  4JEX A;  4A0F A;  4LNJ A;  1CQ8 A;  3HDO A;  5EUD A;  3DR7 A;  3AOV A;  1ORD A;  3N75 A;  4WBT A;  1X0M A;  1RVY A;  1WKG A;  1RV3 A;  3FVS A;  4P3M A;  1D2F A;  4AOA A;  4M2J A;  1GCK A;  3AEM A;  5EAA A;  2VLF A;  2W8J A;  2AEU A;  3A9Z A;  4OT8 A;  1YAA A;  4Q76 A;  1MDO A;  2V0Y A;  2ZY4 A;  1C7G A;  4M2M A;  5LHA A;  4ZDP A;  3H14 A;  2CY8 A;  3RCH B;  2ZC0 A;  1M0P A;  1N8P A;  5M4D A;  4LNM A;  3ISL A;  4JE5 D;  3N4S A;  3AEN A;  3MAD A;  4UHM A;  2VMR A;  3FDB A;  4FFC A;  1ART A;  5F8V A;  3QBO A;  4L0O A;  3WCO A;  1PMM A;  1AJS A;  5FT4 A;  2E7J A;  1ARS A; 
#chains in the Genus database with same CATH homology
 1YJZ A;  4JEZ A;  4M2K A;  4PFF A;  2R5E A;  2D61 A;  3G8M A;  2GB3 A;  3FTB A;  3HVY A;  1D7U A;  3UE8 A;  4E1O A;  5M46 A;  2QBT A;  3ASB A;  3FFR A;  4W1X A;  4BA5 A;  3FZ8 A;  1OAT A;  4A6U A;  2EO5 A;  1AJR A;  2BI9 A;  1E5F A;  1PMO A;  1ZOB A;  3PD6 A;  4WXF A;  1ELU A;  4ZSW A;  4HVK A;  2AY4 A;  4F5J A;  4F5H A;  1ELQ A;  5FT5 A;  2Z9W A;  2VMY A;  5G09 A;  2HUU A;  1IBJ A;  2Z9V A;  1GC3 A;  3EIB A;  3EI7 A;  1MAQ A;  3BN1 A;  1H1C A;  4Y0D A;  3BB8 A;  1AMA A;  4P7Y A;  3TQX A;  2AAT A;  9AAT A;  3WZF A;  1YJY A;  5EUE A;  1BJO B;  4H51 A;  4J5U A;  4LW2 A;  3RI6 A;  2OKJ A;  3E2Z A;  3AEJ C;  3FRK A;  4OCA A;  1AX4 A;  1ASC A;  1IUG A;  1MGV A;  1FG3 A;  1I29 A;  3I5T A;  4U2H A;  4WLJ A;  1V2E A;  3WLX A;  5E3K A;  1BKG A;  5BJ4 A;  4N0B A;  3WKS A;  5EQC A;  2BI5 A;  2FQ6 A;  2GMU A;  8AAT A;  3AEM C;  3EI9 A;  1LC8 A;  1WYT B;  2ORD A;  2VMW A;  1KKP A;  3GZD A;  4ADD A;  1YIY A;  4ZAH A;  1SZU A;  1S08 A;  3GBX A;  1DGD A;  1KMJ A;  1OHY A;  2AY5 A;  5E4Z A;  1I43 A;  3IF2 A;  4E77 A;  4W8I A;  2BWN A;  3COG A;  2CJH A;  3MC6 C;  1M4N A;  1QJ3 A;  2HUI A;  4IXZ A;  1S06 A;  4BA4 A;  2AY3 A;  2DR1 A;  3FQA A;  2C0R A;  1Z3Z A;  2V1P A;  4GDY A;  4XQ2 A;  3ZZK A;  5IWQ A;  4W91 A;  3DYD A;  5EIG A;  2W7L A;  2HP2 A;  3F9T A;  2JJH A;  1BJW A;  1D7R A;  2W7D A;  2PO3 A;  2VGS A;  3AOW A;  2FKI A;  1O61 A;  5D5S A;  2D64 A;  2VI9 A;  1AHE A;  2C7T A;  4WP0 A;  2VGT A;  2W7M A;  4XAU A;  1GD9 A;  1FC4 A;  4A6T A;  4F5I A;  4JEV A;  2JIS A;  3R9A A;  4ZSY A;  4WB0 B;  1IX7 A;  1VP4 A;  1SFF A;  4MKJ A;  2X8U A;  1IJI A;  1ASD A;  1RV4 A;  2JJE A;  1DKA A;  3CAI A;  4F5M A;  2Z9U A;  2WKA A;  2X5F A;  1V72 A;  3KGX A;  4RIZ A;  3RBF A;  3PDX A;  3K28 A;  2ZP7 A;  4IY7 A;  2VMO A;  1UU0 A;  2EH6 A;  2WK8 A;  4FL0 A;  4RM1 A;  1ARI A;  2CTZ A;  3MKJ A;  3RQ1 A;  3NYT A;  2FN6 A;  3E6G A;  3L44 A;  1X2A A;  4IXO A;  4F5K A;  1ASE A;  1QIR A;  2W7K A;  1B5P A;  1W7L A;  3FCR A;  2PB2 A;  4F5F A;  1WYV A;  5BJ3 A;  3BC8 A;  3USF A;  2VMU A;  1LK9 A;  2G6W A;  4EB7 A;  3LY1 A;  2O7C A;  2OKK A;  2HZP A;  2RFV A;  3QN6 A;  2EZ2 A;  5DB5 A;  4MKK A;  2BI3 A;  3DR4 A;  1PFF A;  1RVU A;  1Z7D A;  4GRX A;  1BJ4 A;  1AIB A;  1CZC A;  4RJY A;  2JGT A;  5C6U A;  2CST A;  4N0W A;  3GZD C;  4NOG A;  4K05 A;  1IVR A;  2G7J A;  1GDE A;  4XJL A;  4ITX A;  1AIC A;  4WYE A;  3GSB A;  3CBF A;  1S07 A;  4F5G A;  4WXB A;  3AEN B;  2ZY2 A;  2FM1 A;  2EYQ A;  4TV7 A;  1ASN A;  2BI1 A;  4JF1 A;  2WK9 A;  1WKH A;  2FYF A;  1EJI A;  1AJS B;  1DJU A;  4MQP A;  1X28 A;  2BI2 A;  2D63 A;  4PFN A;  2VYC A;  2YHK A;  2VGV A;  3FQ7 A;  2VMN A;  4W1V A;  3VOM A;  3FDD A;  3GZC A;  3N0L A;  2HOY A;  1CL2 A;  3PIU A;  4HF8 A;  4GE9 A;  3MC6 A;  2CB1 A;  2EGY A;  1SVV A;  4EU1 A;  1QJ5 A;  4LW4 A;  1H0C A;  1V2F A;  4A0R A;  4R2N A;  4MQQ A;  2W8V A;  1M7Y A;  2W7G A;  3ATH A;  2BIE A;  3PD6 B;  3VAX A;  3E77 A;  3PDB A;  1O62 A;  1GEX A;  1B5O A;  3IHJ A;  1QGN A;  3G0T A;  3L8A A;  3NU7 A;  4LNL A;  4TN4 A;  4R8D A;  3A2B A;  3NYU A;  5HXX A;  4RKC A;  2WB6 A;  1CZE A;  1VEF A;  2DKB A;  1O69 A;  2QB2 A;  4IX8 A;  2OGA A;  4F5L A;  4ADE A;  1OXP A;  3E9K A;  4Y0I A;  3KE3 A;  4B9B A;  2R0T A;  3E2Z B;  4Q31 A;  4WYA A;  1UU1 A;  2FNI A;  1G7X A;  2YKY A;  1AKC A;  3PAA A;  3QHX A;  2AY2 A;  4K2M A;  4KXK A;  2ZSL A;  1ASG A;  5G4J A;  3AEO A;  1MLZ A;  3PA9 A;  3BV0 A;  5FT6 A;  4ZM4 A;  4WXG A;  2ZY3 A;  3QGU A;  3BS8 A;  2E54 A;  1AMQ A;  1LC7 A;  2YKX A;  3PJ0 A;  4R5Z A;  4OC9 A;  4Y0H A;  2BYL A;  3FZ6 A;  4WYF A;  2AY7 A;  2BYJ A;  3BWN C;  5TF5 A;  1DFO A;  1VJO A;  1TOG A;  1AKB A;  4RLG A;  3FZ7 A;  1ZC9 A;  3F0H A;  5KTB A;  4OTL A;  1AHY A;  1M0Q A;  2TPL A;  2XBN A;  3R4T A;  2BIA A;  2HOX A;  2HUF A;  4EFF A;  4PVF A;  1SZK A;  3PPL A;  4XJM A;  1I41 A;  1AHX A;  2JG2 A;  3FVX A;  4WYC A;  1LS3 A;  1AMS A;  1JS3 A;  2JJG A;  2Q7W A;  4WYG A;  2CFB A;  5DJ9 A;  2YKV A;  2CJG A;  3WX9 A;  1XI9 A;  3WGB A;  4IW7 A;  4DQ6 A;  1MDX A;  4EMY A;  2KFP A;  2PB0 A;  1QIT A;  4TMR A;  1GC0 A;  2DKJ A;  3M5U A;  3P6K A;  2AEV A;  2BWP A;  2BHX A;  1GEW A;  4IYO A;  3N4R A;  1E5E A;  3BCB A;  3MAF A;  3RBL A;  2CH2 A;  2EPJ A;  1TAT A;  4Q75 A;  1AY5 A;  1M6S A;  2W8U A;  5G2Q A;  4K2B A;  1LC5 A;  4ZDO A;  3QM2 A;  2CJD A;  1IAX A;  1B4X A;  3JZL A;  4B98 A;  1DGE A;  2AY8 A;  1JS6 A;  1AKA A;  4H63 Q;  1WYV B;  2DOU A;  4I8A A;  3FKD A;  3E2Y A;  3ZRR A;  5M4B A;  2A1V A;  3HQT A;  3P1T A;  3LV2 A;  4ZM3 A;  1U08 A;  1BJN A;  1TPL A;  3B46 A;  1M0O A;  4JE5 A;  4WLH A;  1WST A;  2W8T A;  1B8G A;  3CQ5 A;  1IX6 A;  2D7Y A;  3KKI A;  4ITG A;  5M49 A;  1MDZ A;  1YIZ A;  3FVU A;  4LC3 A;  4AZK A;  2Z20 A;  1DJE A;  1ARH A;  3E2F A;  1WYU A;  4KAM A;  3N4X A;  3F6T A;  4ZWM A;  4ZWV A;  2QLR A;  1AHF A;  3K40 A;  3NX3 A;  3BCX A;  2R5C A;  1BS0 A;  1P3W A;  2HOZ A;  2VLH A;  2W7F A;  4OYT A;  3VP6 A;  3VK4 A;  4CVQ A;  2OQX A;  3JW9 A;  3W1I A;  3DOD A;  1GC4 A;  3JU7 A;  3N5M A;  3AV7 A;  1LW4 A;  2C44 A;  3HT4 A;  2E7U A;  3CQ6 A;  4RKD A;  3NYS A;  3NUI A;  3WY7 A;  1G4X A;  1CQ7 A;  3BWN A;  3LG0 A;  3UWC A;  3VK2 A;  4MQR A;  2JJF A;  3QPG A;  3HMU A;  3JWA A;  4AO4 A;  2VIB A;  4A0H A;  1ECX A;  1S0A A;  4Q6R A;  4ATQ A;  3K7Y A;  3ZZJ A;  4A6R A;  3B1E A;  5FT8 A;  4IXS A;  1ARG A;  4AH3 A;  3PDB B;  1AAW A;  3EZ1 A;  4PIW A;  1TOK A;  3TCM A;  2YRI A;  2GMS A;  1D7S A;  3NDN A;  2BKW A;  4A00 A;  4XK1 A;  3B1C A;  4DGT A;  1MLY A;  2X3L A;  4AZJ A;  2VMX A;  3DRD A;  2FNU A;  2DGL A;  4R5F A;  2VI8 A;  1T3I A;  5F9S A;  3WGC A;  1QIS A;  1O4S A;  2ZYJ A;  3FD0 A;  1ASA A;  5HHY A;  2GSA A;  2VIA A;  4AO9 A;  1AHG A;  1ASF A;  3MAU A;  4UOY A;  1B9H A;  1SZS A;  3JTX A;  1I48 A;  2W7J A;  3GJU A;  2VGW A;  5EFS A;  4CBR A;  2QA3 A;  5AX8 A;  1B9I A;  1D7V A;  4ISY A;  1Y4I A;  3EI8 A;  3TFU A;  3LVL B;  2W7H A;  5LH9 A;  3A9Y A;  5D95 A;  1LKC A;  4O6Z A;  2YOB A;  2YCT A;  3LVJ A;  3II0 A;  2YCN A;  2O1B A;  2EZ1 A;  3ZRP A;  3CQ4 A;  3NNK A;  1IX8 A;  2D5Y A;  3EI5 A;  5EIG B;  2R2N A;  2D66 A;  3DXV A;  4OBV A;  1C7O A;  1J32 A;  2CAN A;  3GR9 A;  4ZLV A;  1CL1 A;  4EB5 A;  2D7Z A;  2XH1 A;  7AAT A;  2ZUK A;  1G7W A;  1M0N A;  3NU8 A;  3DU4 A;  3ASA A;  4OBU A;  5J8Q A;  1AAM A;  3ACZ A;  2DGK A;  3JWB A;  2O0R A;  4K2I A;  1YJS A;  2HP1 A;  2OAT A;  1TAS A;  4IYO B;  3B8X A;  3MBB A;  5E5I A;  4CBS A;  1YOO A;  2ZJG A;  3MAF B;  3ZRQ A;  3DC1 A;  3FQ8 A;  3RCH A;  3BWO A;  1GBN A;  3AEP A;  3WCN A;  4CXQ A;  2Z1Y A;  4UHN A;  3HLM A;  1KL2 A;  2VMZ A;  4JEY A;  2VMP A;  2C81 A;  3H9X A;  3EI6 A;  4BMK A;  4F4E A;  1W23 A;  4DBC A;  1IAY A;  3D6K A;  4J8L A;  1JF9 A;  4MSO A;  2ZSM A;  4UHO A;  3N7N A;  3I4J A;  3NUB A;  2CIN A;  3ECD A;  3UAK A;  5G0A A;  3T32 A;  2AY9 A;  2W7I A;  2D65 A;  3NRA A;  4XEW A;  1FG7 A;  3QI6 A;  3EIA A;  1PG8 A;  1AMR A;  1OHW A;  1V2D A;  2X5D A;  4E3R A;  2WK7 A;  2ZY5 A;  2Z67 A;  1C7N A;  2QSR A;  1KL1 A;  1ASB A;  1ASL A;  2VMV A;  1SF2 A;  1W7M A;  1QZ9 A;  1OXO A;  1BT4 A;  1C4K A;  1G4V A;  2F8J A;  1JG8 A;  2BWO A;  4MY5 A;  2Z1Z A;  5DX5 A;  4W1W A;  4BHD A;  1S09 A;  1TOE A;  4CXR A;  2BIG A;  1WYU B;  4OMA A;  2NMP A;  5G4I A;  1UKJ A;  2W8W A;  1BJO A;  1C0N A;  4W5K A;  3LWS A;  1GEY A;  1DTY A;  2VGU A;  2R5C B;  1GC2 A;  2E7I A;  1KMK A;  4RAE A;  4WYD A;  4ZAS A;  4A0G A;  3FSL A;  1TOI A;  4ATP A;  3AEL A;  3TFT A;  1TOJ A;  1W7N A;  5K8B A;  3EZS A;  2QMA A;  2CH1 A;  4QGR A;  2AY1 A;  1SPA A;  1WYT A;  1BQD A;  2DGM A;  1MAP A;  4U1T A;  1DJ9 A;  4KYO A;  1CS1 A;  1BW0 A;  5JAY A;  4JF0 A;  3LVK A;  1CQ6 A;  2VMT A;  1UU2 A;  4MGR A;  1W3U A;  4UQV A;  2VMQ A;  1X29 A;  1C9C A;  3AAT A;  1AIA A;  4XJO A;  1XEY A;  1ZOD A;  5I92 A;  3ELP A;  2Z9X A;  3KGW A;  3PGY A;  4GEB A;  4A72 A;  4BQ0 A;  5EAV A;  2Z61 A;  3FFH A;  3VK3 A;  4ADC A;  3A8U X;  1AY8 A;  3W1H A;  1TAR A;  2W7E A;  4GE4 A;  4ADB A;  2VGZ A;  3ELE A;  2OGE A;  1M32 A;  2YCP A;  2YKU A;  2GQN A;  3I16 A;  1BQA A;  5EUN A;  3DZZ A;  4JEW A;  2HOR A;  3NTJ A;  3RUY A;  1AY4 A;  1ASM A;  1EQB A;  4WB0 A;  4WD2 A;  5G2P A;  3HL2 A;  3EUC A;  4RIT A;  3H7F A;  3DXW A;  3OP7 A;  4GSA A;  4E3Q A;  3LVM A;  1EG5 A;  3BCA A;  4ZDL A;  3TAT A;  3W1J A;  1YNU A;  2AY6 A;  3MEB A;  5HDM A;  4RJ0 A;  2YRR A;  1KKJ A;  1OHV A;  3GWP A;  1CJ0 A;  2QB3 A;  3WKR A;  1J04 A;  2VMS A;  3B1D A;  3G7Q A;  3GET A;  3OKS A;  1LW5 A;  3A9X A;  1N31 A;  3HBX A;  1N2T A;  3Q8N A;  4GE7 A;  3AEJ A;  4XJP A;  5DJ1 A;  4JEX A;  4A0F A;  4LNJ A;  1CQ8 A;  3HDO A;  5EUD A;  3DR7 A;  3AOV A;  1ORD A;  3N75 A;  4WBT A;  1X0M A;  1RVY A;  1WKG A;  1RV3 A;  3FVS A;  4P3M A;  1D2F A;  4AOA A;  4M2J A;  1GCK A;  3AEM A;  5EAA A;  2VLF A;  2W8J A;  2AEU A;  3A9Z A;  4OT8 A;  1YAA A;  4Q76 A;  1MDO A;  2V0Y A;  2ZY4 A;  1C7G A;  4M2M A;  5LHA A;  4ZDP A;  3H14 A;  2CY8 A;  3RCH B;  2ZC0 A;  1M0P A;  1N8P A;  5M4D A;  4LNM A;  3ISL A;  4JE5 D;  3N4S A;  3AEN A;  3MAD A;  4UHM A;  2VMR A;  3FDB A;  4FFC A;  1ART A;  5F8V A;  3QBO A;  4L0O A;  3WCO A;  1PMM A;  1AJS A;  5FT4 A;  2E7J A;  1ARS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...