2ZJGA

Crystal structural of mouse kynurenine aminotransferase iii
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
410
structure length
409
Chain Sequence
NAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine-oxoglutarate transaminase 3
publication title Structural and functional characterization of mouse kynurenine aminotransferase III
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 144
structure length 409
sequence length 410
chains with identical sequence B
ec nomenclature ec 2.6.1.63: Kynurenine--glyoxylate transaminase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2zjgA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zjgA01
1UU0A 2CANA 3NTJA 4DGTA 1IAYA 2HOYA 1Z7DA 3F6TA 1EJIA 3FFHA 4GE7A 2BI1A 3H14A 4ISYA 4OBVA 3TATA 3VP6A 1S07A 4IXSA 2VLFA 3NUIA 1QGNA 2X5DA 5G2PA 2CH1A 3NDNA 4N0BA 1MLYA 1AJRA 2GQNA 4F5LA 3NNKA 4OCAA 5AX8A 1B4XA 2EZ1A 2VMNA 3BWNA 3G8MA 3MKJA 3EI7A 1LC8A 1ASFA 4BHDA 4WYCA 3GZDA 2ZP7A 1C7GA 1WYVB 3JWBA 2BIGA 2VMTA 4A0HA 4E3RA 1GC0A 4LNLA 2R5EA 2WK8A 3FQAA 2FNUA 1DTYA 2YRIA 1XI9A 3MC6A 2VLHA 1FG7A 2CB1A 1GC3A 3K28A 1ECXA 4F4EA 3B1DA 1MDXA 3CQ5A 3RQ1A 3CBFA 3KE3A 1QISA 4JEXA 3FVXA 2QMAA 1JF9A 2DGLA 3OP7A 3NX3A 1Z3ZA 4OBUA 4TN4A 2OATA 2BYJA 4JE5D 2G6WA 2D61A 1SZSA 1BT4A 1W7LA 3F9TA 3FZ7A 2ZY2A 1D7VA 1M0QA 2AY4A 3VK3A 4GEBA 3PGYA 1RV4A 5EUEA 1CZEA 4B98A 1BJNA 1BQAA 3N5MA 2W8TA 1ZC9A 1QIRA 2AY2A 2C0RA 3IHJA 1AJSA 3G7QA 3NUBA 1YAAA 5IWQA 1KMKA 2VMOA 4PFFA 1J04A 5FT4A 1ASMA 3PD6A 4ZM3A 1D2FA 3DYDA 3EI5A 3PPLA 4PVFA 5G0AA 4ZDLA 3D6KA 3HVYA 3H7FA 4ITGA 4OYTA 5HHYA 9AATA 3PA9A 4F5HA 1YNUA 2VMRA 3BN1A 2DKBA 4MSOA 3FTBA 1ELQA 5TF5A 1BJOA 1KKJA 1GCKA 1CL1A 2PB0A 1LS3A 2AY7A 2W7KA 4A6RA 4E3QA 3BV0A 2YCNA 4PFNA 1IJIA 2W8VA 2Z9XA 5LH9A 4JEZA 3TFTA 1AIBA 4ZDOA 4WXFA 4WP0A 1I43A 2CINA 3FD0A 5I92A 1GEYA 3LVJA 1C4KA 3LY1A 1N2TA 4K2MA 3E77A 2Z9VA 3PD6B 4OMAA 2YKYA 2PO3A 3AOWA 3B8XA 1MGVA 3HT4A 4MGRA 4UHMA 1GEXA 3N75A 1D7RA 1LW4A 1D7SA 2ORDA 2PB2A 4ZWVA 2VMWA 5C6UA 3P6KA 2ZJGA 1DKAA 1MAPA 5DJ1A 1LK9A 2Z61A 3Q8NA 2VGUA 3NYTA 3R9AA 1AMAA 4A00A 3HMUA 4F5GA 5BJ3A 2FYFA 3A8UX 2OQXA 3LVMA 2OGAA 2AEUA 4U2HA 1AICA 2Z1ZA 4BQ0A 4RKDA 4WYEA 1X28A 3CAIA 2EGYA 1AHEA 2JJEA 1WSTA 2R5CA 2O1BA 3GJUA 3M5UA 4H51A 4WBTA 4WB0B 4XAUA 5J8QA 2GB3A 3UE8A 4HVKA 2C7TA 1CZCA 4KYOA 2JG2A 2VGSA 2WK7A 2VMQA 2YKUA 1ORDA 4NOGA 4MKKA 3B1CA 1G4XA 2DOUA 4XEWA 2EPJA 2O0RA 1AY5A 3AEOA 3MBBA 2YCPA 3RBFA 2CJGA 5D5SA 3MEBA 1AHFA 3LVKA 3JTXA 3QBOA 4PIWA 2CH2A 3UWCA 3WKRA 1ASGA 5EIGA 2Q7WA 2F8JA 2YCTA 4F5KA 2X3LA 3ELEA 3FKDA 1IAXA 2DKJA 3FDDA 3EIAA 2HORA 5D95A 4BMKA 4IX8A 1IX8A 3AEPA 4LW4A 4WLHA 2HOXA 4EMYA 1B5OA 3F0HA 4FL0A 1LW5A 3AENA 1V2DA 5M4BA 1M6SA 1E5FA 3BCXA 4AH3A 2ZSLA 4J8LA 3AELA 4GRXA 1E5EA 5G2QA 1AKCA 4WXGA 4AOAA 5EFSA 1PFFA 1S09A 1WKGA 2VGZA 3BWOA 3K7YA 2W7IA 4GE9A 3AATA 3DRDA 2AY1A 1SFFA 2VMSA 1BS0A 7AATA 2CTZA 3E9KA 5G4JA 1TARA 1GDEA 1QITA 3ZRPA 4W91A 2VMYA 1KL2A 4JE5A 3AEJC 3EZ1A 2VIBA 3MADA 2JJHA 4L0OA 1MDOA 2QA3A 4MKJA 2X8UA 3GR9A 2FN6A 1O4SA 4ADCA 3LVLB 4Q75A 2E54A 2W7FA 3AENB 1VEFA 4M2KA 3EIBA 3II0A 2AY6A 3KGWA 4F5MA 1UKJA 1ASNA 1N8PA 4N0WA 4ATPA 1I41A 3KGXA 3T32A 3DODA 4LNMA 3PAAA 4IYOA 3RBLA 3MAFA 4RKCA 3ZZJA 2OKKA 3EI9A 3JZLA 2D66A 3BCBA 1CL2A 1ASBA 1AAMA 1DJ9A 1YIZA 3E2YA 3G0TA 2BIAA 2Z20A 5EUDA 2JJFA 2VIAA 1ARTA 2X5FA 4OTLA 4RITA 2D5YA 1TOJA 4WYAA 1ASLA 2AATA 2W7EA 3USFA 3TQXA 4ADDA 2HP2A 1YJZA 1BKGA 2YOBA 3I5TA 3JU7A 4M2JA 1GC2A 4MQQA 1UU2A 3DXWA 4Q6RA 3TCMA 1MAQA 2YRRA 2E7UA 4RJYA 3AEMC 1DFOA 5DX5A 5F8VA 3ZRRA 4B9BA 1D7UA 1O61A 3L44A 1AKAA 3ECDA 5EAAA 1AJSB 1I48A 1H0CA 3JWAA 1BJ4A 2R2NA 4W1WA 1JS3A 1M0PA 1MLZA 1YJYA 1LC5A 3DXVA 4Y0HA 1AIAA 2AY3A 2XH1A 2BWPA 2FNIA 1SVVA 1WYUA 4RM1A 3NYUA 4LW2A 2RFVA 1M4NA 3FZ6A 3FVSA 3FQ7A 2OGEA 4W1VA 1AY4A 1YJSA 1TASA 3DU4A 4Y0DA 1BJOB 3FSLA 1B8GA 1RV3A 2ZC0A 3VK4A 1DGDA 4JEVA 8AATA 3GWPA 5FT5A 1O69A 3A9ZA 1TATA 1MDZA 4W8IA 4F5FA 3BS8A 3ACZA 3QGUA 1M7YA 1ASEA 3HBXA 4IXOA 4RIZA 4W1XA 4XK1A 2C44A 1S08A 3JW9A 3K40A 3QI6A 4ZDPA 4CXRA 3NRAA 3ASAA 4AO9A 2ZY3A 2ZY5A 2R0TA 2VMUA 1AHXA 2WK9A 4UHNA 1ARGA 4U1TA 1BQDA 1WKHA 4XJOA 4CVQA 1V2EA 3W1JA 3GSBA 5FT6A 5HDMA 4EB5A 1G7WA 3DR4A 3WKSA 1BW0A 2ZSMA 4RLGA 1W7NA 1W3UA 3DR7A 5DJ9A 1OHWA 2BHXA 3ISLA 4WYFA 1ASCA 3QPGA 2HZPA 1CQ8A 1FG3A 1SF2A 2ZYJA 4F5JA 4A6UA 3DC1A 2BIEA 1S0AA 2FQ6A 1H1CA 3A9XA 3E2ZA 1EG5A 2W7HA 4A0FA 3PDXA 4ATQA 3WCOA 1X2AA 3EUCA 4RAEA 2DGMA 2W7JA 2D64A 1C9CA 3PIUA 1KMJA 4OT8A 4WD2A 2Z9WA 1C0NA 4ZSWA 2BWNA 4CBRA 2R5CB 1PG8A 3R4TA 2BWOA 3NYSA 4IXZA 1PMOA 1TOKA 2D7ZA 2Z67A 4AZKA 4JEWA 4P7YA 5EQCA 3FDBA 2W7MA 2Z1YA 4TMRA 3ZRQA 4EU1A 3IF2A 3CQ6A 1DJEA 1G4VA 3FQ8A 1TPLA 4IY7A 1WYVA 1CS1A 3VAXA 1N31A 1BJWA 5FT8A 4ZWMA 4XJPA 5EAVA 4KAMA 1M0NA 4ZAHA 2BI9A 1VP4A 4BA5A 3E2FA 3FZ8A 1AMQA 1OHYA 1ASDA 1CJ0A 4HF8A 4XJMA 1AMSA 3HDOA 3AV7A 5EIGB 1G7XA 1AKBA 4IW7A 4EFFA 4E1OA 3ASBA 2BKWA 2HOZA 2AY5A 3VOMA 1TOEA 4W5KA 5G09A 3BWNC 4I8AA 1AY8A 1GC4A 2VI8A 2VGTA 2W8UA 3B46A 4KXKA 1I29A 2Z9UA 3WCNA 1RVUA 3GZDC 3HLMA 1AAWA 2QBTA 4R5ZA 1C7OA 1ASAA 1JS6A 4Q76A 3AEJA 1S06A 2DR1A 1GD9A 3MC6C 2QB2A 2W7LA 3WLXA 3I4JA 1ZODA 3BB8A 2EZ2A 3EI8A 4A0RA 3ELPA 4WLJA 1IX7A 2VI9A 4A72A 5EUNA 4ZSYA 2FM1A 1QZ9A 1W7MA 4R2NA 2BI2A 2CFBA 1X29A 1IX6A 3RCHA 3PJ0A 2D65A 1O62A 4MQPA 4DBCA 1ARSA 2VGVA 2QLRA 3QM2A 4WXBA 4AZJA 5LHAA 3L8AA 2VGWA 4UQVA 4XJLA 2E7IA 4QGRA 4ZM4A 1T3IA 2AEVA 2C81A 1B9IA 3PDBA 3COGA 4CXQA 1V2FA 5E3KA 5K8BA 2W8JA 4FFCA 1YOOA 5BJ4A 3EI6A 1M32A 1LKCA 3OKSA 4OC9A 4WYDA 2EH6A 1ARHA 2QB3A 3ATHA 1KKPA 2BI3A 1QJ3A 3N0LA 5HXXA 2YHKA 1IUGA 2XBNA 2CJHA 3E6GA 4IYOB 3MAFB 2BYLA 1B5PA 1OXOA 1DJUA 1P3WA 4GE4A 4ZASA 4ADEA 5M4DA 1M0OA 3BCAA 2D7YA 3RCHB 1CQ6A 2YKXA 1SZUA 4MY5A 3AEMA 2ZY4A 3W1IA 1AMRA 1ARIA 3WGCA 2CY8A 3CQ4A 4AO4A 3ZZKA 3GBXA 4ADBA 3PDBB 1TOGA 3GETA 5E4ZA 4A6TA 3TFUA 1OATA 4JEYA 4RJ0A 2VMZA 4CBSA 2HUUA 3EZSA 3LWSA 4R5FA 3LV2A 4GDYA 2O7CA 1VJOA 1AHYA 1W23A 2BI5A 2VMVA 3FCRA 5DB5A 2CJDA 1FC4A 1AX4A 2WKAA 3KKIA 3QHXA 4P3MA 5M46A 1DGEA 1Y4IA 3B1EA 4TV7A 3HQTA 4WB0A 4F5IA 1XEYA 5F9SA 5JAYA 2GSAA 4XQ2A 1IVRA 2CSTA 3FVUA 1YIYA 3WZFA 1PMMA 2OKJA 4E77A 2VMPA 2HP1A 4ITXA 2DGKA 4UHOA 1U08A 2GMUA 4M2MA 3WY7A 1LC7A 4R8DA 1WYUB 5G4IA 5M49A 2JJGA 3FRKA 1WYTA 3VK2A 1UU1A 1EQBA 3A2BA 1RVYA 2JISA 2GMSA 4GSAA 2EO5A 2VMXA 1SPAA 2NMPA 2V1PA 4A0GA 2AY9A 3HL2A 1B9HA 1AHGA 2HUFA 4Q31A 3GZCA 1OXPA 1SZKA 1IBJA 3A9YA 3FFRA 1ZOBA 1GEWA 1J32A 3P1TA 1QJ5A 1TOIA 3UAKA 4DQ6A 3NU8A 3AOVA 3DZZA 3WX9A 4MQRA 2VYCA 1GBNA 1OHVA 4JF0A 4WYGA 2E7JA 5E5IA 4K2BA 2JGTA 1V72A 3MAUA 4ZLVA 2W7DA 4Y0IA 1CQ7A 4BA4A 3NU7A 1KL1A 3LG0A 4LNJA 4K2IA 3I16A 2HUIA 3WGBA 1WYTB 2YKVA 2W8WA 2D63A 3QN6A 1ELUA 2TPLA 4O6ZA 4UOYA 3RI6A 1C7NA 2AY8A 2ZUKA 4LC3A 3W1HA 4EB7A 2V0YA 1X0MA 2W7GA 3BC8A 3E2ZB 4JF1A 1JG8A 3RUYA 4J5UA
chains in the Genus database with same CATH superfamily
1UU0A 2CANA 3NTJA 4DGTA 1IAYA 2HOYA 1Z7DA 3F6TA 1EJIA 3FFHA 4GE7A 2BI1A 3H14A 4ISYA 4OBVA 3TATA 3VP6A 1S07A 4IXSA 2VLFA 3NUIA 1QGNA 2X5DA 5G2PA 2CH1A 3NDNA 4N0BA 1MLYA 1AJRA 2GQNA 4F5LA 3NNKA 4OCAA 5AX8A 1B4XA 2EZ1A 2VMNA 3BWNA 3G8MA 3MKJA 3EI7A 1LC8A 1ASFA 4BHDA 4WYCA 3GZDA 2ZP7A 1C7GA 1WYVB 3JWBA 2BIGA 2VMTA 4A0HA 4E3RA 1GC0A 4LNLA 2R5EA 2WK8A 3FQAA 2FNUA 1DTYA 2YRIA 1XI9A 3MC6A 2VLHA 1FG7A 2CB1A 1GC3A 3K28A 1ECXA 4F4EA 3B1DA 1MDXA 3CQ5A 3RQ1A 3CBFA 3KE3A 1QISA 4JEXA 3FVXA 2QMAA 1JF9A 2DGLA 3OP7A 2EYQA 3NX3A 1Z3ZA 4OBUA 4TN4A 2OATA 2BYJA 4JE5D 2G6WA 2D61A 1SZSA 1BT4A 1W7LA 3F9TA 3FZ7A 2ZY2A 1D7VA 1M0QA 3H9XA 2AY4A 3VK3A 4GEBA 3PGYA 1RV4A 5EUEA 1CZEA 4B98A 1BJNA 1BQAA 3N5MA 2W8TA 1ZC9A 1QIRA 2AY2A 2C0RA 3IHJA 1AJSA 3G7QA 3NUBA 1YAAA 5IWQA 1KMKA 2VMOA 4PFFA 1J04A 5FT4A 1ASMA 3PD6A 4ZM3A 1D2FA 3DYDA 3EI5A 3PPLA 4PVFA 5G0AA 4ZDLA 3D6KA 3HVYA 3H7FA 4ITGA 4OYTA 5HHYA 9AATA 3PA9A 4F5HA 1YNUA 2VMRA 3BN1A 2DKBA 4MSOA 3FTBA 1ELQA 5TF5A 1BJOA 1KKJA 1GCKA 1CL1A 2PB0A 1LS3A 2AY7A 2W7KA 4A6RA 4E3QA 3BV0A 2YCNA 4PFNA 1IJIA 2W8VA 2Z9XA 5LH9A 4JEZA 3TFTA 1AIBA 4ZDOA 3N4RA 4WXFA 4WP0A 1I43A 2CINA 3FD0A 5I92A 1GEYA 3LVJA 1C4KA 3LY1A 1N2TA 4K2MA 3E77A 2Z9VA 3PD6B 4OMAA 2YKYA 2PO3A 3AOWA 3B8XA 1MGVA 3HT4A 4MGRA 4UHMA 1GEXA 3N75A 1D7RA 1LW4A 1D7SA 2ORDA 2PB2A 4ZWVA 2VMWA 2KFPA 5C6UA 3P6KA 2ZJGA 1DKAA 1MAPA 5DJ1A 1LK9A 2Z61A 3Q8NA 2VGUA 3NYTA 3R9AA 1AMAA 4A00A 3HMUA 4F5GA 5BJ3A 2QSRA 2FYFA 3A8UX 2OQXA 3LVMA 2OGAA 2AEUA 4U2HA 1AICA 2Z1ZA 4BQ0A 4RKDA 4WYEA 1X28A 3CAIA 2EGYA 1AHEA 2JJEA 1WSTA 2R5CA 2O1BA 3GJUA 3M5UA 4H51A 4WBTA 4WB0B 4XAUA 5J8QA 2GB3A 3UE8A 4HVKA 2C7TA 1CZCA 4KYOA 2JG2A 2VGSA 2WK7A 2VMQA 2YKUA 1ORDA 4NOGA 4MKKA 3B1CA 1G4XA 2DOUA 4XEWA 2EPJA 2O0RA 1AY5A 3AEOA 3MBBA 2YCPA 3RBFA 2CJGA 5D5SA 3MEBA 1AHFA 3LVKA 3JTXA 3QBOA 4PIWA 2CH2A 3UWCA 3WKRA 1ASGA 5EIGA 2Q7WA 2F8JA 2YCTA 4F5KA 2X3LA 3ELEA 3FKDA 1IAXA 2DKJA 3FDDA 3EIAA 2HORA 5D95A 4BMKA 4IX8A 1IX8A 3AEPA 4LW4A 4WLHA 2HOXA 4EMYA 1B5OA 3F0HA 4FL0A 1LW5A 3AENA 1V2DA 5M4BA 1M6SA 1E5FA 3BCXA 4AH3A 2ZSLA 4J8LA 3AELA 4GRXA 1E5EA 5G2QA 1AKCA 4WXGA 4AOAA 5EFSA 1PFFA 1S09A 1WKGA 2VGZA 3BWOA 3K7YA 2W7IA 4GE9A 3AATA 3DRDA 2AY1A 1SFFA 2VMSA 1BS0A 7AATA 4K05A 2CTZA 3E9KA 5G4JA 1TARA 1GDEA 1QITA 3ZRPA 4W91A 2VMYA 1KL2A 4JE5A 3AEJC 3EZ1A 2VIBA 3MADA 2JJHA 4L0OA 1MDOA 2QA3A 4MKJA 2X8UA 3GR9A 2FN6A 1O4SA 4ADCA 3LVLB 4Q75A 2E54A 2W7FA 3AENB 1VEFA 4M2KA 3EIBA 3II0A 2AY6A 3KGWA 4F5MA 1UKJA 1ASNA 1N8PA 4N0WA 4ATPA 1I41A 3KGXA 3T32A 3DODA 4LNMA 3PAAA 4IYOA 3RBLA 3MAFA 4RKCA 3ZZJA 2OKKA 3EI9A 3JZLA 2D66A 3BCBA 1CL2A 1ASBA 1AAMA 1DJ9A 1YIZA 3E2YA 3G0TA 2BIAA 2Z20A 5EUDA 2JJFA 2VIAA 1ARTA 2X5FA 4OTLA 4RITA 2D5YA 1TOJA 4WYAA 1ASLA 2AATA 2W7EA 3USFA 3TQXA 4ADDA 2HP2A 1YJZA 1BKGA 2YOBA 3I5TA 3JU7A 4M2JA 1GC2A 4MQQA 1UU2A 3DXWA 4Q6RA 3TCMA 1MAQA 2YRRA 2E7UA 4RJYA 3AEMC 1DFOA 5DX5A 5F8VA 3ZRRA 4B9BA 1D7UA 1O61A 3L44A 1AKAA 3ECDA 5EAAA 1AJSB 1I48A 1H0CA 3JWAA 3N7NA 1BJ4A 2R2NA 4W1WA 1JS3A 1M0PA 1MLZA 1YJYA 1LC5A 3DXVA 4Y0HA 1AIAA 2AY3A 2XH1A 2BWPA 2FNIA 1SVVA 1WYUA 4RM1A 3NYUA 4LW2A 2RFVA 1M4NA 3FZ6A 3FVSA 3FQ7A 2OGEA 4W1VA 1AY4A 1YJSA 1TASA 3DU4A 4Y0DA 1BJOB 3FSLA 1B8GA 1RV3A 2ZC0A 3VK4A 1DGDA 4JEVA 8AATA 3GWPA 5FT5A 1O69A 3A9ZA 1TATA 1MDZA 4W8IA 4F5FA 3BS8A 3ACZA 3QGUA 1M7YA 1ASEA 3HBXA 4IXOA 4RIZA 4W1XA 4XK1A 2C44A 1S08A 3JW9A 3K40A 3QI6A 4ZDPA 4CXRA 3NRAA 3ASAA 4AO9A 2ZY3A 2ZY5A 2R0TA 2VMUA 1AHXA 2WK9A 4UHNA 1ARGA 4U1TA 1BQDA 1WKHA 4XJOA 4CVQA 1V2EA 3W1JA 3GSBA 5FT6A 5HDMA 4EB5A 1G7WA 3DR4A 3WKSA 1BW0A 2ZSMA 4RLGA 3N4XA 1W7NA 1W3UA 3DR7A 5DJ9A 1OHWA 2BHXA 3ISLA 4WYFA 1ASCA 3QPGA 2HZPA 1CQ8A 1FG3A 1SF2A 2ZYJA 4F5JA 4A6UA 3DC1A 2BIEA 1S0AA 2FQ6A 1H1CA 3A9XA 3E2ZA 1EG5A 2W7HA 4A0FA 3PDXA 4ATQA 3WCOA 1X2AA 3EUCA 4RAEA 2DGMA 2W7JA 2D64A 1C9CA 3PIUA 1KMJA 4OT8A 4WD2A 2Z9WA 1C0NA 4ZSWA 2BWNA 4CBRA 2R5CB 1PG8A 3R4TA 2BWOA 3NYSA 4IXZA 1PMOA 1TOKA 2D7ZA 2Z67A 4AZKA 4JEWA 4P7YA 5EQCA 3FDBA 2W7MA 2Z1YA 4TMRA 3ZRQA 4EU1A 3IF2A 3CQ6A 1DJEA 1G4VA 3FQ8A 1TPLA 2WB6A 4IY7A 1WYVA 1CS1A 3VAXA 1N31A 1BJWA 5FT8A 4ZWMA 4XJPA 5EAVA 4KAMA 1M0NA 4ZAHA 2BI9A 1VP4A 4BA5A 3E2FA 3FZ8A 1AMQA 1OHYA 1ASDA 1CJ0A 4HF8A 4XJMA 1AMSA 3HDOA 3AV7A 2G7JA 5EIGB 1G7XA 1AKBA 4IW7A 4EFFA 4E1OA 3ASBA 2FKIA 2BKWA 2HOZA 2AY5A 3VOMA 1TOEA 4W5KA 5G09A 3BWNC 4I8AA 1AY8A 1GC4A 2VI8A 2VGTA 2W8UA 3B46A 4KXKA 1I29A 2Z9UA 3WCNA 1RVUA 3GZDC 3HLMA 4H63Q 1AAWA 2QBTA 4R5ZA 1C7OA 1ASAA 1JS6A 4Q76A 3AEJA 1S06A 2DR1A 1GD9A 3MC6C 2QB2A 2W7LA 3WLXA 3I4JA 1ZODA 3BB8A 2EZ2A 3EI8A 4A0RA 5KTBA 3ELPA 4WLJA 1IX7A 2VI9A 4A72A 5EUNA 4ZSYA 2FM1A 1QZ9A 1W7MA 4R2NA 2BI2A 2CFBA 1X29A 1IX6A 3RCHA 3PJ0A 2D65A 1O62A 4MQPA 4DBCA 1ARSA 2VGVA 2QLRA 3QM2A 4WXBA 4AZJA 5LHAA 3L8AA 2VGWA 4UQVA 4XJLA 2E7IA 4QGRA 4ZM4A 1T3IA 2AEVA 2C81A 1B9IA 3PDBA 3COGA 4CXQA 1V2FA 5E3KA 5K8BA 2W8JA 4FFCA 1YOOA 5BJ4A 3EI6A 1M32A 1LKCA 3OKSA 4OC9A 4WYDA 2EH6A 1ARHA 2QB3A 3ATHA 1KKPA 2BI3A 1QJ3A 3N0LA 5HXXA 2YHKA 1IUGA 2XBNA 2CJHA 3E6GA 4IYOB 3MAFB 2BYLA 1B5PA 1OXOA 1DJUA 1P3WA 4GE4A 4ZASA 4ADEA 5M4DA 1M0OA 3BCAA 2D7YA 3RCHB 1CQ6A 2YKXA 1SZUA 4MY5A 3AEMA 2ZY4A 3W1IA 1AMRA 1ARIA 3WGCA 2CY8A 3CQ4A 4AO4A 3ZZKA 3GBXA 4ADBA 3PDBB 1TOGA 3GETA 5E4ZA 4A6TA 3TFUA 1OATA 4JEYA 4RJ0A 2VMZA 4CBSA 2HUUA 3EZSA 3LWSA 4R5FA 3LV2A 4GDYA 2O7CA 1VJOA 1AHYA 1W23A 2BI5A 2VMVA 3FCRA 5DB5A 2CJDA 1FC4A 1AX4A 2WKAA 3KKIA 3QHXA 4P3MA 5M46A 1DGEA 1Y4IA 3B1EA 4TV7A 3HQTA 4WB0A 4F5IA 1XEYA 5F9SA 5JAYA 2GSAA 4XQ2A 1IVRA 2CSTA 3FVUA 1YIYA 3WZFA 1PMMA 2OKJA 1KAFA 4E77A 2VMPA 2HP1A 4ITXA 2DGKA 4UHOA 1U08A 2GMUA 4M2MA 3WY7A 1LC7A 4R8DA 1WYUB 5G4IA 5M49A 2JJGA 3FRKA 1WYTA 3VK2A 1UU1A 1EQBA 3A2BA 1RVYA 2JISA 2GMSA 4GSAA 2EO5A 2VMXA 1SPAA 2NMPA 3N4SA 2V1PA 4A0GA 2AY9A 3HL2A 1B9HA 1AHGA 2HUFA 4Q31A 3GZCA 1OXPA 1SZKA 1IBJA 3A9YA 3FFRA 1ZOBA 1GEWA 1J32A 3P1TA 1QJ5A 1TOIA 3UAKA 4DQ6A 3NU8A 3AOVA 3DZZA 3WX9A 4MQRA 2VYCA 1GBNA 1OHVA 4JF0A 4WYGA 2E7JA 5E5IA 4K2BA 2JGTA 1V72A 3MAUA 4ZLVA 2W7DA 4Y0IA 1CQ7A 4BA4A 3NU7A 1KL1A 3LG0A 4LNJA 4K2IA 3I16A 2HUIA 3WGBA 1WYTB 2YKVA 2W8WA 2D63A 3QN6A 1ELUA 2TPLA 4O6ZA 2A1VA 4UOYA 3RI6A 1C7NA 2AY8A 2ZUKA 4LC3A 3W1HA 4EB7A 2V0YA 1X0MA 2W7GA 3BC8A 3E2ZB 4JF1A 1JG8A 3RUYA 4J5UA
chains in the Genus database with same CATH topology
1UU0A 2CANA 3NTJA 4DGTA 1IAYA 2HOYA 1Z7DA 3F6TA 1EJIA 3FFHA 4GE7A 2BI1A 3H14A 4ISYA 4OBVA 3TATA 3VP6A 1S07A 4IXSA 2VLFA 3NUIA 1QGNA 2X5DA 5G2PA 2CH1A 3NDNA 4N0BA 1MLYA 1AJRA 2GQNA 4F5LA 3NNKA 4OCAA 5AX8A 1B4XA 2EZ1A 2VMNA 3BWNA 3G8MA 3MKJA 3EI7A 1LC8A 1ASFA 4BHDA 4WYCA 3GZDA 2ZP7A 1C7GA 1WYVB 3JWBA 2BIGA 2VMTA 4A0HA 4E3RA 1GC0A 4LNLA 2R5EA 2WK8A 3FQAA 2FNUA 1DTYA 2YRIA 1XI9A 3MC6A 2VLHA 1FG7A 2CB1A 1GC3A 3K28A 1ECXA 4F4EA 3B1DA 1MDXA 3CQ5A 3RQ1A 3CBFA 3KE3A 1QISA 4JEXA 3FVXA 2QMAA 1JF9A 2DGLA 3OP7A 2EYQA 3NX3A 1Z3ZA 4OBUA 4TN4A 2OATA 2BYJA 4JE5D 2G6WA 2D61A 1SZSA 1BT4A 1W7LA 3F9TA 3FZ7A 2ZY2A 1D7VA 1M0QA 3H9XA 2AY4A 3VK3A 4GEBA 3PGYA 1RV4A 5EUEA 1CZEA 4B98A 1BJNA 1BQAA 3N5MA 2W8TA 1ZC9A 1QIRA 2AY2A 2C0RA 3IHJA 1AJSA 3G7QA 3NUBA 1YAAA 5IWQA 1KMKA 2VMOA 4PFFA 1J04A 5FT4A 1ASMA 3PD6A 4ZM3A 1D2FA 3DYDA 3EI5A 3PPLA 4PVFA 5G0AA 4ZDLA 3D6KA 3HVYA 3H7FA 4ITGA 4OYTA 5HHYA 9AATA 3PA9A 4F5HA 1YNUA 2VMRA 3BN1A 2DKBA 4MSOA 3FTBA 1ELQA 5TF5A 1BJOA 1KKJA 1GCKA 1CL1A 2PB0A 1LS3A 2AY7A 2W7KA 4A6RA 4E3QA 3BV0A 2YCNA 4PFNA 1IJIA 2W8VA 2Z9XA 5LH9A 4JEZA 3TFTA 1AIBA 4ZDOA 3N4RA 4WXFA 4WP0A 1I43A 2CINA 3FD0A 5I92A 1GEYA 3LVJA 1C4KA 3LY1A 1N2TA 4K2MA 3E77A 2Z9VA 3PD6B 4OMAA 2YKYA 2PO3A 3AOWA 3B8XA 1MGVA 3HT4A 4MGRA 4UHMA 1GEXA 3N75A 1D7RA 1LW4A 1D7SA 2ORDA 2PB2A 4ZWVA 2VMWA 2KFPA 5C6UA 3P6KA 2ZJGA 1DKAA 1MAPA 5DJ1A 1LK9A 2Z61A 3Q8NA 2VGUA 3NYTA 3R9AA 1AMAA 4A00A 3HMUA 4F5GA 5BJ3A 2QSRA 2FYFA 3A8UX 2OQXA 3LVMA 2OGAA 2AEUA 4U2HA 1AICA 2Z1ZA 4BQ0A 4RKDA 4WYEA 1X28A 3CAIA 2EGYA 1AHEA 2JJEA 1WSTA 2R5CA 2O1BA 3GJUA 3M5UA 4H51A 4WBTA 4WB0B 4XAUA 5J8QA 2GB3A 3UE8A 4HVKA 2C7TA 1CZCA 4KYOA 2JG2A 2VGSA 2WK7A 2VMQA 2YKUA 1ORDA 4NOGA 4MKKA 3B1CA 1G4XA 2DOUA 4XEWA 2EPJA 2O0RA 1AY5A 3AEOA 3MBBA 2YCPA 3RBFA 2CJGA 5D5SA 3MEBA 1AHFA 3LVKA 3JTXA 3QBOA 4PIWA 2CH2A 3UWCA 3WKRA 1ASGA 5EIGA 2Q7WA 2F8JA 2YCTA 4F5KA 2X3LA 3ELEA 3FKDA 1IAXA 2DKJA 3FDDA 3EIAA 2HORA 5D95A 4BMKA 4IX8A 1IX8A 3AEPA 4LW4A 4WLHA 2HOXA 4EMYA 1B5OA 3F0HA 4FL0A 1LW5A 3AENA 1V2DA 5M4BA 1M6SA 1E5FA 3BCXA 4AH3A 2ZSLA 4J8LA 3AELA 4GRXA 1E5EA 5G2QA 1AKCA 4WXGA 4AOAA 5EFSA 1PFFA 1S09A 1WKGA 2VGZA 3BWOA 3K7YA 2W7IA 4GE9A 3AATA 3DRDA 2AY1A 1SFFA 2VMSA 1BS0A 7AATA 4K05A 2CTZA 3E9KA 5G4JA 1TARA 1GDEA 1QITA 3ZRPA 4W91A 2VMYA 1KL2A 4JE5A 3AEJC 3EZ1A 2VIBA 3MADA 2JJHA 4L0OA 1MDOA 2QA3A 4MKJA 2X8UA 3GR9A 2FN6A 1O4SA 4ADCA 3LVLB 4Q75A 2E54A 2W7FA 3AENB 1VEFA 4M2KA 3EIBA 3II0A 2AY6A 3KGWA 4F5MA 1UKJA 1ASNA 1N8PA 4N0WA 4ATPA 1I41A 3KGXA 3T32A 3DODA 4LNMA 3PAAA 4IYOA 3RBLA 3MAFA 4RKCA 3ZZJA 2OKKA 3EI9A 3JZLA 2D66A 3BCBA 1CL2A 1ASBA 1AAMA 1DJ9A 1YIZA 3E2YA 3G0TA 2BIAA 2Z20A 5EUDA 2JJFA 2VIAA 1ARTA 2X5FA 4OTLA 4RITA 2D5YA 1TOJA 4WYAA 1ASLA 2AATA 2W7EA 3USFA 3TQXA 4ADDA 2HP2A 1YJZA 1BKGA 2YOBA 3I5TA 3JU7A 4M2JA 1GC2A 4MQQA 1UU2A 3DXWA 4Q6RA 3TCMA 1MAQA 2YRRA 2E7UA 4RJYA 3AEMC 1DFOA 5DX5A 5F8VA 3ZRRA 4B9BA 1D7UA 1O61A 3L44A 1AKAA 3ECDA 5EAAA 1AJSB 1I48A 1H0CA 3JWAA 3N7NA 1BJ4A 2R2NA 4W1WA 1JS3A 1M0PA 1MLZA 1YJYA 1LC5A 3DXVA 4Y0HA 1AIAA 2AY3A 2XH1A 2BWPA 2FNIA 1SVVA 1WYUA 4RM1A 3NYUA 4LW2A 2RFVA 1M4NA 3FZ6A 3FVSA 3FQ7A 2OGEA 4W1VA 1AY4A 1YJSA 1TASA 3DU4A 4Y0DA 1BJOB 3FSLA 1B8GA 1RV3A 2ZC0A 3VK4A 1DGDA 4JEVA 8AATA 3GWPA 5FT5A 1O69A 3A9ZA 1TATA 1MDZA 4W8IA 4F5FA 3BS8A 3ACZA 3QGUA 1M7YA 1ASEA 3HBXA 4IXOA 4RIZA 4W1XA 4XK1A 2C44A 1S08A 3JW9A 3K40A 3QI6A 4ZDPA 4CXRA 3NRAA 3ASAA 4AO9A 2ZY3A 2ZY5A 2R0TA 2VMUA 1AHXA 2WK9A 4UHNA 1ARGA 4U1TA 1BQDA 1WKHA 4XJOA 4CVQA 1V2EA 3W1JA 3GSBA 5FT6A 5HDMA 4EB5A 1G7WA 3DR4A 3WKSA 1BW0A 2ZSMA 4RLGA 3N4XA 1W7NA 1W3UA 3DR7A 5DJ9A 1OHWA 2BHXA 3ISLA 4WYFA 1ASCA 3QPGA 2HZPA 1CQ8A 1FG3A 1SF2A 2ZYJA 4F5JA 4A6UA 3DC1A 2BIEA 1S0AA 2FQ6A 1H1CA 3A9XA 3E2ZA 1EG5A 2W7HA 4A0FA 3PDXA 4ATQA 3WCOA 1X2AA 3EUCA 4RAEA 2DGMA 2W7JA 2D64A 1C9CA 3PIUA 1KMJA 4OT8A 4WD2A 2Z9WA 1C0NA 4ZSWA 2BWNA 4CBRA 2R5CB 1PG8A 3R4TA 2BWOA 3NYSA 4IXZA 1PMOA 1TOKA 2D7ZA 2Z67A 4AZKA 4JEWA 4P7YA 5EQCA 3FDBA 2W7MA 2Z1YA 4TMRA 3ZRQA 4EU1A 3IF2A 3CQ6A 1DJEA 1G4VA 3FQ8A 1TPLA 2WB6A 4IY7A 1WYVA 1CS1A 3VAXA 1N31A 1BJWA 5FT8A 4ZWMA 4XJPA 5EAVA 4KAMA 1M0NA 4ZAHA 2BI9A 1VP4A 4BA5A 3E2FA 3FZ8A 1AMQA 1OHYA 1ASDA 1CJ0A 4HF8A 4XJMA 1AMSA 3HDOA 3AV7A 2G7JA 5EIGB 1G7XA 1AKBA 4IW7A 4EFFA 4E1OA 3ASBA 2FKIA 2BKWA 2HOZA 2AY5A 3VOMA 1TOEA 4W5KA 5G09A 3BWNC 4I8AA 1AY8A 1GC4A 2VI8A 2VGTA 2W8UA 3B46A 4KXKA 1I29A 2Z9UA 3WCNA 1RVUA 3GZDC 3HLMA 4H63Q 1AAWA 2QBTA 4R5ZA 1C7OA 1ASAA 1JS6A 4Q76A 3AEJA 1S06A 2DR1A 1GD9A 3MC6C 2QB2A 2W7LA 3WLXA 3I4JA 1ZODA 3BB8A 2EZ2A 3EI8A 4A0RA 5KTBA 3ELPA 4WLJA 1IX7A 2VI9A 4A72A 5EUNA 4ZSYA 2FM1A 1QZ9A 1W7MA 4R2NA 2BI2A 2CFBA 1X29A 1IX6A 3RCHA 3PJ0A 2D65A 1O62A 4MQPA 4DBCA 1ARSA 2VGVA 2QLRA 3QM2A 4WXBA 4AZJA 5LHAA 3L8AA 2VGWA 4UQVA 4XJLA 2E7IA 4QGRA 4ZM4A 1T3IA 2AEVA 2C81A 1B9IA 3PDBA 3COGA 4CXQA 1V2FA 5E3KA 5K8BA 2W8JA 4FFCA 1YOOA 5BJ4A 3EI6A 1M32A 1LKCA 3OKSA 4OC9A 4WYDA 2EH6A 1ARHA 2QB3A 3ATHA 1KKPA 2BI3A 1QJ3A 3N0LA 5HXXA 2YHKA 1IUGA 2XBNA 2CJHA 3E6GA 4IYOB 3MAFB 2BYLA 1B5PA 1OXOA 1DJUA 1P3WA 4GE4A 4ZASA 4ADEA 5M4DA 1M0OA 3BCAA 2D7YA 3RCHB 1CQ6A 2YKXA 1SZUA 4MY5A 3AEMA 2ZY4A 3W1IA 1AMRA 1ARIA 3WGCA 2CY8A 3CQ4A 4AO4A 3ZZKA 3GBXA 4ADBA 3PDBB 1TOGA 3GETA 5E4ZA 4A6TA 3TFUA 1OATA 4JEYA 4RJ0A 2VMZA 4CBSA 2HUUA 3EZSA 3LWSA 4R5FA 3LV2A 4GDYA 2O7CA 1VJOA 1AHYA 1W23A 2BI5A 2VMVA 3FCRA 5DB5A 2CJDA 1FC4A 1AX4A 2WKAA 3KKIA 3QHXA 4P3MA 5M46A 1DGEA 1Y4IA 3B1EA 4TV7A 3HQTA 4WB0A 4F5IA 1XEYA 5F9SA 5JAYA 2GSAA 4XQ2A 1IVRA 2CSTA 3FVUA 1YIYA 3WZFA 1PMMA 2OKJA 4E77A 2VMPA 2HP1A 4ITXA 2DGKA 4UHOA 1U08A 2GMUA 4M2MA 3WY7A 1LC7A 4R8DA 1WYUB 5G4IA 5M49A 2JJGA 3FRKA 1WYTA 3VK2A 1UU1A 1EQBA 3A2BA 1RVYA 2JISA 2GMSA 4GSAA 2EO5A 2VMXA 1SPAA 2NMPA 3N4SA 2V1PA 4A0GA 2AY9A 3HL2A 1B9HA 1AHGA 2HUFA 4Q31A 3GZCA 1OXPA 1SZKA 1IBJA 3A9YA 3FFRA 1ZOBA 1GEWA 1J32A 3P1TA 1QJ5A 1TOIA 3UAKA 4DQ6A 3NU8A 3AOVA 3DZZA 3WX9A 4MQRA 2VYCA 1GBNA 1OHVA 4JF0A 4WYGA 2E7JA 5E5IA 4K2BA 2JGTA 1V72A 3MAUA 4ZLVA 2W7DA 4Y0IA 1CQ7A 4BA4A 3NU7A 1KL1A 3LG0A 4LNJA 4K2IA 3I16A 2HUIA 3WGBA 1WYTB 2YKVA 2W8WA 2D63A 3QN6A 1ELUA 2TPLA 4O6ZA 2A1VA 4UOYA 3RI6A 1C7NA 2AY8A 2ZUKA 4LC3A 3W1HA 4EB7A 2V0YA 1X0MA 2W7GA 3BC8A 3E2ZB 4JF1A 1JG8A 3RUYA 4J5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UU0 A;  2CAN A;  3NTJ A;  4DGT A;  1IAY A;  2HOY A;  1Z7D A;  3F6T A;  1EJI A;  3FFH A;  4GE7 A;  2BI1 A;  3H14 A;  4ISY A;  4OBV A;  3TAT A;  3VP6 A;  1S07 A;  4IXS A;  2VLF A;  3NUI A;  1QGN A;  2X5D A;  5G2P A;  2CH1 A;  3NDN A;  4N0B A;  1MLY A;  1AJR A;  2GQN A;  4F5L A;  3NNK A;  4OCA A;  5AX8 A;  1B4X A;  2EZ1 A;  2VMN A;  3BWN A;  3G8M A;  3MKJ A;  3EI7 A;  1LC8 A;  1ASF A;  4BHD A;  4WYC A;  3GZD A;  2ZP7 A;  1C7G A;  1WYV B;  3JWB A;  2BIG A;  2VMT A;  4A0H A;  4E3R A;  1GC0 A;  4LNL A;  2R5E A;  2WK8 A;  3FQA A;  2FNU A;  1DTY A;  2YRI A;  1XI9 A;  3MC6 A;  2VLH A;  1FG7 A;  2CB1 A;  1GC3 A;  3K28 A;  1ECX A;  4F4E A;  3B1D A;  1MDX A;  3CQ5 A;  3RQ1 A;  3CBF A;  3KE3 A;  1QIS A;  4JEX A;  3FVX A;  2QMA A;  1JF9 A;  2DGL A;  3OP7 A;  3NX3 A;  1Z3Z A;  4OBU A;  4TN4 A;  2OAT A;  2BYJ A;  4JE5 D;  2G6W A;  2D61 A;  1SZS A;  1BT4 A;  1W7L A;  3F9T A;  3FZ7 A;  2ZY2 A;  1D7V A;  1M0Q A;  2AY4 A;  3VK3 A;  4GEB A;  3PGY A;  1RV4 A;  5EUE A;  1CZE A;  4B98 A;  1BJN A;  1BQA A;  3N5M A;  2W8T A;  1ZC9 A;  1QIR A;  2AY2 A;  2C0R A;  3IHJ A;  1AJS A;  3G7Q A;  3NUB A;  1YAA A;  5IWQ A;  1KMK A;  2VMO A;  4PFF A;  1J04 A;  5FT4 A;  1ASM A;  3PD6 A;  4ZM3 A;  1D2F A;  3DYD A;  3EI5 A;  3PPL A;  4PVF A;  5G0A A;  4ZDL A;  3D6K A;  3HVY A;  3H7F A;  4ITG A;  4OYT A;  5HHY A;  9AAT A;  3PA9 A;  4F5H A;  1YNU A;  2VMR A;  3BN1 A;  2DKB A;  4MSO A;  3FTB A;  1ELQ A;  5TF5 A;  1BJO A;  1KKJ A;  1GCK A;  1CL1 A;  2PB0 A;  1LS3 A;  2AY7 A;  2W7K A;  4A6R A;  4E3Q A;  3BV0 A;  2YCN A;  4PFN A;  1IJI A;  2W8V A;  2Z9X A;  5LH9 A;  4JEZ A;  3TFT A;  1AIB A;  4ZDO A;  4WXF A;  4WP0 A;  1I43 A;  2CIN A;  3FD0 A;  5I92 A;  1GEY A;  3LVJ A;  1C4K A;  3LY1 A;  1N2T A;  4K2M A;  3E77 A;  2Z9V A;  3PD6 B;  4OMA A;  2YKY A;  2PO3 A;  3AOW A;  3B8X A;  1MGV A;  3HT4 A;  4MGR A;  4UHM A;  1GEX A;  3N75 A;  1D7R A;  1LW4 A;  1D7S A;  2ORD A;  2PB2 A;  4ZWV A;  2VMW A;  5C6U A;  3P6K A;  2ZJG A;  1DKA A;  1MAP A;  5DJ1 A;  1LK9 A;  2Z61 A;  3Q8N A;  2VGU A;  3NYT A;  3R9A A;  1AMA A;  4A00 A;  3HMU A;  4F5G A;  5BJ3 A;  2FYF A;  3A8U X;  2OQX A;  3LVM A;  2OGA A;  2AEU A;  4U2H A;  1AIC A;  2Z1Z A;  4BQ0 A;  4RKD A;  4WYE A;  1X28 A;  3CAI A;  2EGY A;  1AHE A;  2JJE A;  1WST A;  2R5C A;  2O1B A;  3GJU A;  3M5U A;  4H51 A;  4WBT A;  4WB0 B;  4XAU A;  5J8Q A;  2GB3 A;  3UE8 A;  4HVK A;  2C7T A;  1CZC A;  4KYO A;  2JG2 A;  2VGS A;  2WK7 A;  2VMQ A;  2YKU A;  1ORD A;  4NOG A;  4MKK A;  3B1C A;  1G4X A;  2DOU A;  4XEW A;  2EPJ A;  2O0R A;  1AY5 A;  3AEO A;  3MBB A;  2YCP A;  3RBF A;  2CJG A;  5D5S A;  3MEB A;  1AHF A;  3LVK A;  3JTX A;  3QBO A;  4PIW A;  2CH2 A;  3UWC A;  3WKR A;  1ASG A;  5EIG A;  2Q7W A;  2F8J A;  2YCT A;  4F5K A;  2X3L A;  3ELE A;  3FKD A;  1IAX A;  2DKJ A;  3FDD A;  3EIA A;  2HOR A;  5D95 A;  4BMK A;  4IX8 A;  1IX8 A;  3AEP A;  4LW4 A;  4WLH A;  2HOX A;  4EMY A;  1B5O A;  3F0H A;  4FL0 A;  1LW5 A;  3AEN A;  1V2D A;  5M4B A;  1M6S A;  1E5F A;  3BCX A;  4AH3 A;  2ZSL A;  4J8L A;  3AEL A;  4GRX A;  1E5E A;  5G2Q A;  1AKC A;  4WXG A;  4AOA A;  5EFS A;  1PFF A;  1S09 A;  1WKG A;  2VGZ A;  3BWO A;  3K7Y A;  2W7I A;  4GE9 A;  3AAT A;  3DRD A;  2AY1 A;  1SFF A;  2VMS A;  1BS0 A;  7AAT A;  2CTZ A;  3E9K A;  5G4J A;  1TAR A;  1GDE A;  1QIT A;  3ZRP A;  4W91 A;  2VMY A;  1KL2 A;  4JE5 A;  3AEJ C;  3EZ1 A;  2VIB A;  3MAD A;  2JJH A;  4L0O A;  1MDO A;  2QA3 A;  4MKJ A;  2X8U A;  3GR9 A;  2FN6 A;  1O4S A;  4ADC A;  3LVL B;  4Q75 A;  2E54 A;  2W7F A;  3AEN B;  1VEF A;  4M2K A;  3EIB A;  3II0 A;  2AY6 A;  3KGW A;  4F5M A;  1UKJ A;  1ASN A;  1N8P A;  4N0W A;  4ATP A;  1I41 A;  3KGX A;  3T32 A;  3DOD A;  4LNM A;  3PAA A;  4IYO A;  3RBL A;  3MAF A;  4RKC A;  3ZZJ A;  2OKK A;  3EI9 A;  3JZL A;  2D66 A;  3BCB A;  1CL2 A;  1ASB A;  1AAM A;  1DJ9 A;  1YIZ A;  3E2Y A;  3G0T A;  2BIA A;  2Z20 A;  5EUD A;  2JJF A;  2VIA A;  1ART A;  2X5F A;  4OTL A;  4RIT A;  2D5Y A;  1TOJ A;  4WYA A;  1ASL A;  2AAT A;  2W7E A;  3USF A;  3TQX A;  4ADD A;  2HP2 A;  1YJZ A;  1BKG A;  2YOB A;  3I5T A;  3JU7 A;  4M2J A;  1GC2 A;  4MQQ A;  1UU2 A;  3DXW A;  4Q6R A;  3TCM A;  1MAQ A;  2YRR A;  2E7U A;  4RJY A;  3AEM C;  1DFO A;  5DX5 A;  5F8V A;  3ZRR A;  4B9B A;  1D7U A;  1O61 A;  3L44 A;  1AKA A;  3ECD A;  5EAA A;  1AJS B;  1I48 A;  1H0C A;  3JWA A;  1BJ4 A;  2R2N A;  4W1W A;  1JS3 A;  1M0P A;  1MLZ A;  1YJY A;  1LC5 A;  3DXV A;  4Y0H A;  1AIA A;  2AY3 A;  2XH1 A;  2BWP A;  2FNI A;  1SVV A;  1WYU A;  4RM1 A;  3NYU A;  4LW2 A;  2RFV A;  1M4N A;  3FZ6 A;  3FVS A;  3FQ7 A;  2OGE A;  4W1V A;  1AY4 A;  1YJS A;  1TAS A;  3DU4 A;  4Y0D A;  1BJO B;  3FSL A;  1B8G A;  1RV3 A;  2ZC0 A;  3VK4 A;  1DGD A;  4JEV A;  8AAT A;  3GWP A;  5FT5 A;  1O69 A;  3A9Z A;  1TAT A;  1MDZ A;  4W8I A;  4F5F A;  3BS8 A;  3ACZ A;  3QGU A;  1M7Y A;  1ASE A;  3HBX A;  4IXO A;  4RIZ A;  4W1X A;  4XK1 A;  2C44 A;  1S08 A;  3JW9 A;  3K40 A;  3QI6 A;  4ZDP A;  4CXR A;  3NRA A;  3ASA A;  4AO9 A;  2ZY3 A;  2ZY5 A;  2R0T A;  2VMU A;  1AHX A;  2WK9 A;  4UHN A;  1ARG A;  4U1T A;  1BQD A;  1WKH A;  4XJO A;  4CVQ A;  1V2E A;  3W1J A;  3GSB A;  5FT6 A;  5HDM A;  4EB5 A;  1G7W A;  3DR4 A;  3WKS A;  1BW0 A;  2ZSM A;  4RLG A;  1W7N A;  1W3U A;  3DR7 A;  5DJ9 A;  1OHW A;  2BHX A;  3ISL A;  4WYF A;  1ASC A;  3QPG A;  2HZP A;  1CQ8 A;  1FG3 A;  1SF2 A;  2ZYJ A;  4F5J A;  4A6U A;  3DC1 A;  2BIE A;  1S0A A;  2FQ6 A;  1H1C A;  3A9X A;  3E2Z A;  1EG5 A;  2W7H A;  4A0F A;  3PDX A;  4ATQ A;  3WCO A;  1X2A A;  3EUC A;  4RAE A;  2DGM A;  2W7J A;  2D64 A;  1C9C A;  3PIU A;  1KMJ A;  4OT8 A;  4WD2 A;  2Z9W A;  1C0N A;  4ZSW A;  2BWN A;  4CBR A;  2R5C B;  1PG8 A;  3R4T A;  2BWO A;  3NYS A;  4IXZ A;  1PMO A;  1TOK A;  2D7Z A;  2Z67 A;  4AZK A;  4JEW A;  4P7Y A;  5EQC A;  3FDB A;  2W7M A;  2Z1Y A;  4TMR A;  3ZRQ A;  4EU1 A;  3IF2 A;  3CQ6 A;  1DJE A;  1G4V A;  3FQ8 A;  1TPL A;  4IY7 A;  1WYV A;  1CS1 A;  3VAX A;  1N31 A;  1BJW A;  5FT8 A;  4ZWM A;  4XJP A;  5EAV A;  4KAM A;  1M0N A;  4ZAH A;  2BI9 A;  1VP4 A;  4BA5 A;  3E2F A;  3FZ8 A;  1AMQ A;  1OHY A;  1ASD A;  1CJ0 A;  4HF8 A;  4XJM A;  1AMS A;  3HDO A;  3AV7 A;  5EIG B;  1G7X A;  1AKB A;  4IW7 A;  4EFF A;  4E1O A;  3ASB A;  2BKW A;  2HOZ A;  2AY5 A;  3VOM A;  1TOE A;  4W5K A;  5G09 A;  3BWN C;  4I8A A;  1AY8 A;  1GC4 A;  2VI8 A;  2VGT A;  2W8U A;  3B46 A;  4KXK A;  1I29 A;  2Z9U A;  3WCN A;  1RVU A;  3GZD C;  3HLM A;  1AAW A;  2QBT A;  4R5Z A;  1C7O A;  1ASA A;  1JS6 A;  4Q76 A;  3AEJ A;  1S06 A;  2DR1 A;  1GD9 A;  3MC6 C;  2QB2 A;  2W7L A;  3WLX A;  3I4J A;  1ZOD A;  3BB8 A;  2EZ2 A;  3EI8 A;  4A0R A;  3ELP A;  4WLJ A;  1IX7 A;  2VI9 A;  4A72 A;  5EUN A;  4ZSY A;  2FM1 A;  1QZ9 A;  1W7M A;  4R2N A;  2BI2 A;  2CFB A;  1X29 A;  1IX6 A;  3RCH A;  3PJ0 A;  2D65 A;  1O62 A;  4MQP A;  4DBC A;  1ARS A;  2VGV A;  2QLR A;  3QM2 A;  4WXB A;  4AZJ A;  5LHA A;  3L8A A;  2VGW A;  4UQV A;  4XJL A;  2E7I A;  4QGR A;  4ZM4 A;  1T3I A;  2AEV A;  2C81 A;  1B9I A;  3PDB A;  3COG A;  4CXQ A;  1V2F A;  5E3K A;  5K8B A;  2W8J A;  4FFC A;  1YOO A;  5BJ4 A;  3EI6 A;  1M32 A;  1LKC A;  3OKS A;  4OC9 A;  4WYD A;  2EH6 A;  1ARH A;  2QB3 A;  3ATH A;  1KKP A;  2BI3 A;  1QJ3 A;  3N0L A;  5HXX A;  2YHK A;  1IUG A;  2XBN A;  2CJH A;  3E6G A;  4IYO B;  3MAF B;  2BYL A;  1B5P A;  1OXO A;  1DJU A;  1P3W A;  4GE4 A;  4ZAS A;  4ADE A;  5M4D A;  1M0O A;  3BCA A;  2D7Y A;  3RCH B;  1CQ6 A;  2YKX A;  1SZU A;  4MY5 A;  3AEM A;  2ZY4 A;  3W1I A;  1AMR A;  1ARI A;  3WGC A;  2CY8 A;  3CQ4 A;  4AO4 A;  3ZZK A;  3GBX A;  4ADB A;  3PDB B;  1TOG A;  3GET A;  5E4Z A;  4A6T A;  3TFU A;  1OAT A;  4JEY A;  4RJ0 A;  2VMZ A;  4CBS A;  2HUU A;  3EZS A;  3LWS A;  4R5F A;  3LV2 A;  4GDY A;  2O7C A;  1VJO A;  1AHY A;  1W23 A;  2BI5 A;  2VMV A;  3FCR A;  5DB5 A;  2CJD A;  1FC4 A;  1AX4 A;  2WKA A;  3KKI A;  3QHX A;  4P3M A;  5M46 A;  1DGE A;  1Y4I A;  3B1E A;  4TV7 A;  3HQT A;  4WB0 A;  4F5I A;  1XEY A;  5F9S A;  5JAY A;  2GSA A;  4XQ2 A;  1IVR A;  2CST A;  3FVU A;  1YIY A;  3WZF A;  1PMM A;  2OKJ A;  4E77 A;  2VMP A;  2HP1 A;  4ITX A;  2DGK A;  4UHO A;  1U08 A;  2GMU A;  4M2M A;  3WY7 A;  1LC7 A;  4R8D A;  1WYU B;  5G4I A;  5M49 A;  2JJG A;  3FRK A;  1WYT A;  3VK2 A;  1UU1 A;  1EQB A;  3A2B A;  1RVY A;  2JIS A;  2GMS A;  4GSA A;  2EO5 A;  2VMX A;  1SPA A;  2NMP A;  2V1P A;  4A0G A;  2AY9 A;  3HL2 A;  1B9H A;  1AHG A;  2HUF A;  4Q31 A;  3GZC A;  1OXP A;  1SZK A;  1IBJ A;  3A9Y A;  3FFR A;  1ZOB A;  1GEW A;  1J32 A;  3P1T A;  1QJ5 A;  1TOI A;  3UAK A;  4DQ6 A;  3NU8 A;  3AOV A;  3DZZ A;  3WX9 A;  4MQR A;  2VYC A;  1GBN A;  1OHV A;  4JF0 A;  4WYG A;  2E7J A;  5E5I A;  4K2B A;  2JGT A;  1V72 A;  3MAU A;  4ZLV A;  2W7D A;  4Y0I A;  1CQ7 A;  4BA4 A;  3NU7 A;  1KL1 A;  3LG0 A;  4LNJ A;  4K2I A;  3I16 A;  2HUI A;  3WGB A;  1WYT B;  2YKV A;  2W8W A;  2D63 A;  3QN6 A;  1ELU A;  2TPL A;  4O6Z A;  4UOY A;  3RI6 A;  1C7N A;  2AY8 A;  2ZUK A;  4LC3 A;  3W1H A;  4EB7 A;  2V0Y A;  1X0M A;  2W7G A;  3BC8 A;  3E2Z B;  4JF1 A;  1JG8 A;  3RUY A;  4J5U A; 
#chains in the Genus database with same CATH topology
 1UU0 A;  2CAN A;  3NTJ A;  4DGT A;  1IAY A;  2HOY A;  1Z7D A;  3F6T A;  1EJI A;  3FFH A;  4GE7 A;  2BI1 A;  3H14 A;  4ISY A;  4OBV A;  3TAT A;  3VP6 A;  1S07 A;  4IXS A;  2VLF A;  3NUI A;  1QGN A;  2X5D A;  5G2P A;  2CH1 A;  3NDN A;  4N0B A;  1MLY A;  1AJR A;  2GQN A;  4F5L A;  3NNK A;  4OCA A;  5AX8 A;  1B4X A;  2EZ1 A;  2VMN A;  3BWN A;  3G8M A;  3MKJ A;  3EI7 A;  1LC8 A;  1ASF A;  4BHD A;  4WYC A;  3GZD A;  2ZP7 A;  1C7G A;  1WYV B;  3JWB A;  2BIG A;  2VMT A;  4A0H A;  4E3R A;  1GC0 A;  4LNL A;  2R5E A;  2WK8 A;  3FQA A;  2FNU A;  1DTY A;  2YRI A;  1XI9 A;  3MC6 A;  2VLH A;  1FG7 A;  2CB1 A;  1GC3 A;  3K28 A;  1ECX A;  4F4E A;  3B1D A;  1MDX A;  3CQ5 A;  3RQ1 A;  3CBF A;  3KE3 A;  1QIS A;  4JEX A;  3FVX A;  2QMA A;  1JF9 A;  2DGL A;  3OP7 A;  2EYQ A;  3NX3 A;  1Z3Z A;  4OBU A;  4TN4 A;  2OAT A;  2BYJ A;  4JE5 D;  2G6W A;  2D61 A;  1SZS A;  1BT4 A;  1W7L A;  3F9T A;  3FZ7 A;  2ZY2 A;  1D7V A;  1M0Q A;  3H9X A;  2AY4 A;  3VK3 A;  4GEB A;  3PGY A;  1RV4 A;  5EUE A;  1CZE A;  4B98 A;  1BJN A;  1BQA A;  3N5M A;  2W8T A;  1ZC9 A;  1QIR A;  2AY2 A;  2C0R A;  3IHJ A;  1AJS A;  3G7Q A;  3NUB A;  1YAA A;  5IWQ A;  1KMK A;  2VMO A;  4PFF A;  1J04 A;  5FT4 A;  1ASM A;  3PD6 A;  4ZM3 A;  1D2F A;  3DYD A;  3EI5 A;  3PPL A;  4PVF A;  5G0A A;  4ZDL A;  3D6K A;  3HVY A;  3H7F A;  4ITG A;  4OYT A;  5HHY A;  9AAT A;  3PA9 A;  4F5H A;  1YNU A;  2VMR A;  3BN1 A;  2DKB A;  4MSO A;  3FTB A;  1ELQ A;  5TF5 A;  1BJO A;  1KKJ A;  1GCK A;  1CL1 A;  2PB0 A;  1LS3 A;  2AY7 A;  2W7K A;  4A6R A;  4E3Q A;  3BV0 A;  2YCN A;  4PFN A;  1IJI A;  2W8V A;  2Z9X A;  5LH9 A;  4JEZ A;  3TFT A;  1AIB A;  4ZDO A;  3N4R A;  4WXF A;  4WP0 A;  1I43 A;  2CIN A;  3FD0 A;  5I92 A;  1GEY A;  3LVJ A;  1C4K A;  3LY1 A;  1N2T A;  4K2M A;  3E77 A;  2Z9V A;  3PD6 B;  4OMA A;  2YKY A;  2PO3 A;  3AOW A;  3B8X A;  1MGV A;  3HT4 A;  4MGR A;  4UHM A;  1GEX A;  3N75 A;  1D7R A;  1LW4 A;  1D7S A;  2ORD A;  2PB2 A;  4ZWV A;  2VMW A;  2KFP A;  5C6U A;  3P6K A;  2ZJG A;  1DKA A;  1MAP A;  5DJ1 A;  1LK9 A;  2Z61 A;  3Q8N A;  2VGU A;  3NYT A;  3R9A A;  1AMA A;  4A00 A;  3HMU A;  4F5G A;  5BJ3 A;  2QSR A;  2FYF A;  3A8U X;  2OQX A;  3LVM A;  2OGA A;  2AEU A;  4U2H A;  1AIC A;  2Z1Z A;  4BQ0 A;  4RKD A;  4WYE A;  1X28 A;  3CAI A;  2EGY A;  1AHE A;  2JJE A;  1WST A;  2R5C A;  2O1B A;  3GJU A;  3M5U A;  4H51 A;  4WBT A;  4WB0 B;  4XAU A;  5J8Q A;  2GB3 A;  3UE8 A;  4HVK A;  2C7T A;  1CZC A;  4KYO A;  2JG2 A;  2VGS A;  2WK7 A;  2VMQ A;  2YKU A;  1ORD A;  4NOG A;  4MKK A;  3B1C A;  1G4X A;  2DOU A;  4XEW A;  2EPJ A;  2O0R A;  1AY5 A;  3AEO A;  3MBB A;  2YCP A;  3RBF A;  2CJG A;  5D5S A;  3MEB A;  1AHF A;  3LVK A;  3JTX A;  3QBO A;  4PIW A;  2CH2 A;  3UWC A;  3WKR A;  1ASG A;  5EIG A;  2Q7W A;  2F8J A;  2YCT A;  4F5K A;  2X3L A;  3ELE A;  3FKD A;  1IAX A;  2DKJ A;  3FDD A;  3EIA A;  2HOR A;  5D95 A;  4BMK A;  4IX8 A;  1IX8 A;  3AEP A;  4LW4 A;  4WLH A;  2HOX A;  4EMY A;  1B5O A;  3F0H A;  4FL0 A;  1LW5 A;  3AEN A;  1V2D A;  5M4B A;  1M6S A;  1E5F A;  3BCX A;  4AH3 A;  2ZSL A;  4J8L A;  3AEL A;  4GRX A;  1E5E A;  5G2Q A;  1AKC A;  4WXG A;  4AOA A;  5EFS A;  1PFF A;  1S09 A;  1WKG A;  2VGZ A;  3BWO A;  3K7Y A;  2W7I A;  4GE9 A;  3AAT A;  3DRD A;  2AY1 A;  1SFF A;  2VMS A;  1BS0 A;  7AAT A;  4K05 A;  2CTZ A;  3E9K A;  5G4J A;  1TAR A;  1GDE A;  1QIT A;  3ZRP A;  4W91 A;  2VMY A;  1KL2 A;  4JE5 A;  3AEJ C;  3EZ1 A;  2VIB A;  3MAD A;  2JJH A;  4L0O A;  1MDO A;  2QA3 A;  4MKJ A;  2X8U A;  3GR9 A;  2FN6 A;  1O4S A;  4ADC A;  3LVL B;  4Q75 A;  2E54 A;  2W7F A;  3AEN B;  1VEF A;  4M2K A;  3EIB A;  3II0 A;  2AY6 A;  3KGW A;  4F5M A;  1UKJ A;  1ASN A;  1N8P A;  4N0W A;  4ATP A;  1I41 A;  3KGX A;  3T32 A;  3DOD A;  4LNM A;  3PAA A;  4IYO A;  3RBL A;  3MAF A;  4RKC A;  3ZZJ A;  2OKK A;  3EI9 A;  3JZL A;  2D66 A;  3BCB A;  1CL2 A;  1ASB A;  1AAM A;  1DJ9 A;  1YIZ A;  3E2Y A;  3G0T A;  2BIA A;  2Z20 A;  5EUD A;  2JJF A;  2VIA A;  1ART A;  2X5F A;  4OTL A;  4RIT A;  2D5Y A;  1TOJ A;  4WYA A;  1ASL A;  2AAT A;  2W7E A;  3USF A;  3TQX A;  4ADD A;  2HP2 A;  1YJZ A;  1BKG A;  2YOB A;  3I5T A;  3JU7 A;  4M2J A;  1GC2 A;  4MQQ A;  1UU2 A;  3DXW A;  4Q6R A;  3TCM A;  1MAQ A;  2YRR A;  2E7U A;  4RJY A;  3AEM C;  1DFO A;  5DX5 A;  5F8V A;  3ZRR A;  4B9B A;  1D7U A;  1O61 A;  3L44 A;  1AKA A;  3ECD A;  5EAA A;  1AJS B;  1I48 A;  1H0C A;  3JWA A;  3N7N A;  1BJ4 A;  2R2N A;  4W1W A;  1JS3 A;  1M0P A;  1MLZ A;  1YJY A;  1LC5 A;  3DXV A;  4Y0H A;  1AIA A;  2AY3 A;  2XH1 A;  2BWP A;  2FNI A;  1SVV A;  1WYU A;  4RM1 A;  3NYU A;  4LW2 A;  2RFV A;  1M4N A;  3FZ6 A;  3FVS A;  3FQ7 A;  2OGE A;  4W1V A;  1AY4 A;  1YJS A;  1TAS A;  3DU4 A;  4Y0D A;  1BJO B;  3FSL A;  1B8G A;  1RV3 A;  2ZC0 A;  3VK4 A;  1DGD A;  4JEV A;  8AAT A;  3GWP A;  5FT5 A;  1O69 A;  3A9Z A;  1TAT A;  1MDZ A;  4W8I A;  4F5F A;  3BS8 A;  3ACZ A;  3QGU A;  1M7Y A;  1ASE A;  3HBX A;  4IXO A;  4RIZ A;  4W1X A;  4XK1 A;  2C44 A;  1S08 A;  3JW9 A;  3K40 A;  3QI6 A;  4ZDP A;  4CXR A;  3NRA A;  3ASA A;  4AO9 A;  2ZY3 A;  2ZY5 A;  2R0T A;  2VMU A;  1AHX A;  2WK9 A;  4UHN A;  1ARG A;  4U1T A;  1BQD A;  1WKH A;  4XJO A;  4CVQ A;  1V2E A;  3W1J A;  3GSB A;  5FT6 A;  5HDM A;  4EB5 A;  1G7W A;  3DR4 A;  3WKS A;  1BW0 A;  2ZSM A;  4RLG A;  3N4X A;  1W7N A;  1W3U A;  3DR7 A;  5DJ9 A;  1OHW A;  2BHX A;  3ISL A;  4WYF A;  1ASC A;  3QPG A;  2HZP A;  1CQ8 A;  1FG3 A;  1SF2 A;  2ZYJ A;  4F5J A;  4A6U A;  3DC1 A;  2BIE A;  1S0A A;  2FQ6 A;  1H1C A;  3A9X A;  3E2Z A;  1EG5 A;  2W7H A;  4A0F A;  3PDX A;  4ATQ A;  3WCO A;  1X2A A;  3EUC A;  4RAE A;  2DGM A;  2W7J A;  2D64 A;  1C9C A;  3PIU A;  1KMJ A;  4OT8 A;  4WD2 A;  2Z9W A;  1C0N A;  4ZSW A;  2BWN A;  4CBR A;  2R5C B;  1PG8 A;  3R4T A;  2BWO A;  3NYS A;  4IXZ A;  1PMO A;  1TOK A;  2D7Z A;  2Z67 A;  4AZK A;  4JEW A;  4P7Y A;  5EQC A;  3FDB A;  2W7M A;  2Z1Y A;  4TMR A;  3ZRQ A;  4EU1 A;  3IF2 A;  3CQ6 A;  1DJE A;  1G4V A;  3FQ8 A;  1TPL A;  2WB6 A;  4IY7 A;  1WYV A;  1CS1 A;  3VAX A;  1N31 A;  1BJW A;  5FT8 A;  4ZWM A;  4XJP A;  5EAV A;  4KAM A;  1M0N A;  4ZAH A;  2BI9 A;  1VP4 A;  4BA5 A;  3E2F A;  3FZ8 A;  1AMQ A;  1OHY A;  1ASD A;  1CJ0 A;  4HF8 A;  4XJM A;  1AMS A;  3HDO A;  3AV7 A;  2G7J A;  5EIG B;  1G7X A;  1AKB A;  4IW7 A;  4EFF A;  4E1O A;  3ASB A;  2FKI A;  2BKW A;  2HOZ A;  2AY5 A;  3VOM A;  1TOE A;  4W5K A;  5G09 A;  3BWN C;  4I8A A;  1AY8 A;  1GC4 A;  2VI8 A;  2VGT A;  2W8U A;  3B46 A;  4KXK A;  1I29 A;  2Z9U A;  3WCN A;  1RVU A;  3GZD C;  3HLM A;  4H63 Q;  1AAW A;  2QBT A;  4R5Z A;  1C7O A;  1ASA A;  1JS6 A;  4Q76 A;  3AEJ A;  1S06 A;  2DR1 A;  1GD9 A;  3MC6 C;  2QB2 A;  2W7L A;  3WLX A;  3I4J A;  1ZOD A;  3BB8 A;  2EZ2 A;  3EI8 A;  4A0R A;  5KTB A;  3ELP A;  4WLJ A;  1IX7 A;  2VI9 A;  4A72 A;  5EUN A;  4ZSY A;  2FM1 A;  1QZ9 A;  1W7M A;  4R2N A;  2BI2 A;  2CFB A;  1X29 A;  1IX6 A;  3RCH A;  3PJ0 A;  2D65 A;  1O62 A;  4MQP A;  4DBC A;  1ARS A;  2VGV A;  2QLR A;  3QM2 A;  4WXB A;  4AZJ A;  5LHA A;  3L8A A;  2VGW A;  4UQV A;  4XJL A;  2E7I A;  4QGR A;  4ZM4 A;  1T3I A;  2AEV A;  2C81 A;  1B9I A;  3PDB A;  3COG A;  4CXQ A;  1V2F A;  5E3K A;  5K8B A;  2W8J A;  4FFC A;  1YOO A;  5BJ4 A;  3EI6 A;  1M32 A;  1LKC A;  3OKS A;  4OC9 A;  4WYD A;  2EH6 A;  1ARH A;  2QB3 A;  3ATH A;  1KKP A;  2BI3 A;  1QJ3 A;  3N0L A;  5HXX A;  2YHK A;  1IUG A;  2XBN A;  2CJH A;  3E6G A;  4IYO B;  3MAF B;  2BYL A;  1B5P A;  1OXO A;  1DJU A;  1P3W A;  4GE4 A;  4ZAS A;  4ADE A;  5M4D A;  1M0O A;  3BCA A;  2D7Y A;  3RCH B;  1CQ6 A;  2YKX A;  1SZU A;  4MY5 A;  3AEM A;  2ZY4 A;  3W1I A;  1AMR A;  1ARI A;  3WGC A;  2CY8 A;  3CQ4 A;  4AO4 A;  3ZZK A;  3GBX A;  4ADB A;  3PDB B;  1TOG A;  3GET A;  5E4Z A;  4A6T A;  3TFU A;  1OAT A;  4JEY A;  4RJ0 A;  2VMZ A;  4CBS A;  2HUU A;  3EZS A;  3LWS A;  4R5F A;  3LV2 A;  4GDY A;  2O7C A;  1VJO A;  1AHY A;  1W23 A;  2BI5 A;  2VMV A;  3FCR A;  5DB5 A;  2CJD A;  1FC4 A;  1AX4 A;  2WKA A;  3KKI A;  3QHX A;  4P3M A;  5M46 A;  1DGE A;  1Y4I A;  3B1E A;  4TV7 A;  3HQT A;  4WB0 A;  4F5I A;  1XEY A;  5F9S A;  5JAY A;  2GSA A;  4XQ2 A;  1IVR A;  2CST A;  3FVU A;  1YIY A;  3WZF A;  1PMM A;  2OKJ A;  1KAF A;  4E77 A;  2VMP A;  2HP1 A;  4ITX A;  2DGK A;  4UHO A;  1U08 A;  2GMU A;  4M2M A;  3WY7 A;  1LC7 A;  4R8D A;  1WYU B;  5G4I A;  5M49 A;  2JJG A;  3FRK A;  1WYT A;  3VK2 A;  1UU1 A;  1EQB A;  3A2B A;  1RVY A;  2JIS A;  2GMS A;  4GSA A;  2EO5 A;  2VMX A;  1SPA A;  2NMP A;  3N4S A;  2V1P A;  4A0G A;  2AY9 A;  3HL2 A;  1B9H A;  1AHG A;  2HUF A;  4Q31 A;  3GZC A;  1OXP A;  1SZK A;  1IBJ A;  3A9Y A;  3FFR A;  1ZOB A;  1GEW A;  1J32 A;  3P1T A;  1QJ5 A;  1TOI A;  3UAK A;  4DQ6 A;  3NU8 A;  3AOV A;  3DZZ A;  3WX9 A;  4MQR A;  2VYC A;  1GBN A;  1OHV A;  4JF0 A;  4WYG A;  2E7J A;  5E5I A;  4K2B A;  2JGT A;  1V72 A;  3MAU A;  4ZLV A;  2W7D A;  4Y0I A;  1CQ7 A;  4BA4 A;  3NU7 A;  1KL1 A;  3LG0 A;  4LNJ A;  4K2I A;  3I16 A;  2HUI A;  3WGB A;  1WYT B;  2YKV A;  2W8W A;  2D63 A;  3QN6 A;  1ELU A;  2TPL A;  4O6Z A;  2A1V A;  4UOY A;  3RI6 A;  1C7N A;  2AY8 A;  2ZUK A;  4LC3 A;  3W1H A;  4EB7 A;  2V0Y A;  1X0M A;  2W7G A;  3BC8 A;  3E2Z B;  4JF1 A;  1JG8 A;  3RUY A;  4J5U A; 
#chains in the Genus database with same CATH homology
 1UU0 A;  2CAN A;  3NTJ A;  4DGT A;  1IAY A;  2HOY A;  1Z7D A;  3F6T A;  1EJI A;  3FFH A;  4GE7 A;  2BI1 A;  3H14 A;  4ISY A;  4OBV A;  3TAT A;  3VP6 A;  1S07 A;  4IXS A;  2VLF A;  3NUI A;  1QGN A;  2X5D A;  5G2P A;  2CH1 A;  3NDN A;  4N0B A;  1MLY A;  1AJR A;  2GQN A;  4F5L A;  3NNK A;  4OCA A;  5AX8 A;  1B4X A;  2EZ1 A;  2VMN A;  3BWN A;  3G8M A;  3MKJ A;  3EI7 A;  1LC8 A;  1ASF A;  4BHD A;  4WYC A;  3GZD A;  2ZP7 A;  1C7G A;  1WYV B;  3JWB A;  2BIG A;  2VMT A;  4A0H A;  4E3R A;  1GC0 A;  4LNL A;  2R5E A;  2WK8 A;  3FQA A;  2FNU A;  1DTY A;  2YRI A;  1XI9 A;  3MC6 A;  2VLH A;  1FG7 A;  2CB1 A;  1GC3 A;  3K28 A;  1ECX A;  4F4E A;  3B1D A;  1MDX A;  3CQ5 A;  3RQ1 A;  3CBF A;  3KE3 A;  1QIS A;  4JEX A;  3FVX A;  2QMA A;  1JF9 A;  2DGL A;  3OP7 A;  2EYQ A;  3NX3 A;  1Z3Z A;  4OBU A;  4TN4 A;  2OAT A;  2BYJ A;  4JE5 D;  2G6W A;  2D61 A;  1SZS A;  1BT4 A;  1W7L A;  3F9T A;  3FZ7 A;  2ZY2 A;  1D7V A;  1M0Q A;  3H9X A;  2AY4 A;  3VK3 A;  4GEB A;  3PGY A;  1RV4 A;  5EUE A;  1CZE A;  4B98 A;  1BJN A;  1BQA A;  3N5M A;  2W8T A;  1ZC9 A;  1QIR A;  2AY2 A;  2C0R A;  3IHJ A;  1AJS A;  3G7Q A;  3NUB A;  1YAA A;  5IWQ A;  1KMK A;  2VMO A;  4PFF A;  1J04 A;  5FT4 A;  1ASM A;  3PD6 A;  4ZM3 A;  1D2F A;  3DYD A;  3EI5 A;  3PPL A;  4PVF A;  5G0A A;  4ZDL A;  3D6K A;  3HVY A;  3H7F A;  4ITG A;  4OYT A;  5HHY A;  9AAT A;  3PA9 A;  4F5H A;  1YNU A;  2VMR A;  3BN1 A;  2DKB A;  4MSO A;  3FTB A;  1ELQ A;  5TF5 A;  1BJO A;  1KKJ A;  1GCK A;  1CL1 A;  2PB0 A;  1LS3 A;  2AY7 A;  2W7K A;  4A6R A;  4E3Q A;  3BV0 A;  2YCN A;  4PFN A;  1IJI A;  2W8V A;  2Z9X A;  5LH9 A;  4JEZ A;  3TFT A;  1AIB A;  4ZDO A;  3N4R A;  4WXF A;  4WP0 A;  1I43 A;  2CIN A;  3FD0 A;  5I92 A;  1GEY A;  3LVJ A;  1C4K A;  3LY1 A;  1N2T A;  4K2M A;  3E77 A;  2Z9V A;  3PD6 B;  4OMA A;  2YKY A;  2PO3 A;  3AOW A;  3B8X A;  1MGV A;  3HT4 A;  4MGR A;  4UHM A;  1GEX A;  3N75 A;  1D7R A;  1LW4 A;  1D7S A;  2ORD A;  2PB2 A;  4ZWV A;  2VMW A;  2KFP A;  5C6U A;  3P6K A;  2ZJG A;  1DKA A;  1MAP A;  5DJ1 A;  1LK9 A;  2Z61 A;  3Q8N A;  2VGU A;  3NYT A;  3R9A A;  1AMA A;  4A00 A;  3HMU A;  4F5G A;  5BJ3 A;  2QSR A;  2FYF A;  3A8U X;  2OQX A;  3LVM A;  2OGA A;  2AEU A;  4U2H A;  1AIC A;  2Z1Z A;  4BQ0 A;  4RKD A;  4WYE A;  1X28 A;  3CAI A;  2EGY A;  1AHE A;  2JJE A;  1WST A;  2R5C A;  2O1B A;  3GJU A;  3M5U A;  4H51 A;  4WBT A;  4WB0 B;  4XAU A;  5J8Q A;  2GB3 A;  3UE8 A;  4HVK A;  2C7T A;  1CZC A;  4KYO A;  2JG2 A;  2VGS A;  2WK7 A;  2VMQ A;  2YKU A;  1ORD A;  4NOG A;  4MKK A;  3B1C A;  1G4X A;  2DOU A;  4XEW A;  2EPJ A;  2O0R A;  1AY5 A;  3AEO A;  3MBB A;  2YCP A;  3RBF A;  2CJG A;  5D5S A;  3MEB A;  1AHF A;  3LVK A;  3JTX A;  3QBO A;  4PIW A;  2CH2 A;  3UWC A;  3WKR A;  1ASG A;  5EIG A;  2Q7W A;  2F8J A;  2YCT A;  4F5K A;  2X3L A;  3ELE A;  3FKD A;  1IAX A;  2DKJ A;  3FDD A;  3EIA A;  2HOR A;  5D95 A;  4BMK A;  4IX8 A;  1IX8 A;  3AEP A;  4LW4 A;  4WLH A;  2HOX A;  4EMY A;  1B5O A;  3F0H A;  4FL0 A;  1LW5 A;  3AEN A;  1V2D A;  5M4B A;  1M6S A;  1E5F A;  3BCX A;  4AH3 A;  2ZSL A;  4J8L A;  3AEL A;  4GRX A;  1E5E A;  5G2Q A;  1AKC A;  4WXG A;  4AOA A;  5EFS A;  1PFF A;  1S09 A;  1WKG A;  2VGZ A;  3BWO A;  3K7Y A;  2W7I A;  4GE9 A;  3AAT A;  3DRD A;  2AY1 A;  1SFF A;  2VMS A;  1BS0 A;  7AAT A;  4K05 A;  2CTZ A;  3E9K A;  5G4J A;  1TAR A;  1GDE A;  1QIT A;  3ZRP A;  4W91 A;  2VMY A;  1KL2 A;  4JE5 A;  3AEJ C;  3EZ1 A;  2VIB A;  3MAD A;  2JJH A;  4L0O A;  1MDO A;  2QA3 A;  4MKJ A;  2X8U A;  3GR9 A;  2FN6 A;  1O4S A;  4ADC A;  3LVL B;  4Q75 A;  2E54 A;  2W7F A;  3AEN B;  1VEF A;  4M2K A;  3EIB A;  3II0 A;  2AY6 A;  3KGW A;  4F5M A;  1UKJ A;  1ASN A;  1N8P A;  4N0W A;  4ATP A;  1I41 A;  3KGX A;  3T32 A;  3DOD A;  4LNM A;  3PAA A;  4IYO A;  3RBL A;  3MAF A;  4RKC A;  3ZZJ A;  2OKK A;  3EI9 A;  3JZL A;  2D66 A;  3BCB A;  1CL2 A;  1ASB A;  1AAM A;  1DJ9 A;  1YIZ A;  3E2Y A;  3G0T A;  2BIA A;  2Z20 A;  5EUD A;  2JJF A;  2VIA A;  1ART A;  2X5F A;  4OTL A;  4RIT A;  2D5Y A;  1TOJ A;  4WYA A;  1ASL A;  2AAT A;  2W7E A;  3USF A;  3TQX A;  4ADD A;  2HP2 A;  1YJZ A;  1BKG A;  2YOB A;  3I5T A;  3JU7 A;  4M2J A;  1GC2 A;  4MQQ A;  1UU2 A;  3DXW A;  4Q6R A;  3TCM A;  1MAQ A;  2YRR A;  2E7U A;  4RJY A;  3AEM C;  1DFO A;  5DX5 A;  5F8V A;  3ZRR A;  4B9B A;  1D7U A;  1O61 A;  3L44 A;  1AKA A;  3ECD A;  5EAA A;  1AJS B;  1I48 A;  1H0C A;  3JWA A;  3N7N A;  1BJ4 A;  2R2N A;  4W1W A;  1JS3 A;  1M0P A;  1MLZ A;  1YJY A;  1LC5 A;  3DXV A;  4Y0H A;  1AIA A;  2AY3 A;  2XH1 A;  2BWP A;  2FNI A;  1SVV A;  1WYU A;  4RM1 A;  3NYU A;  4LW2 A;  2RFV A;  1M4N A;  3FZ6 A;  3FVS A;  3FQ7 A;  2OGE A;  4W1V A;  1AY4 A;  1YJS A;  1TAS A;  3DU4 A;  4Y0D A;  1BJO B;  3FSL A;  1B8G A;  1RV3 A;  2ZC0 A;  3VK4 A;  1DGD A;  4JEV A;  8AAT A;  3GWP A;  5FT5 A;  1O69 A;  3A9Z A;  1TAT A;  1MDZ A;  4W8I A;  4F5F A;  3BS8 A;  3ACZ A;  3QGU A;  1M7Y A;  1ASE A;  3HBX A;  4IXO A;  4RIZ A;  4W1X A;  4XK1 A;  2C44 A;  1S08 A;  3JW9 A;  3K40 A;  3QI6 A;  4ZDP A;  4CXR A;  3NRA A;  3ASA A;  4AO9 A;  2ZY3 A;  2ZY5 A;  2R0T A;  2VMU A;  1AHX A;  2WK9 A;  4UHN A;  1ARG A;  4U1T A;  1BQD A;  1WKH A;  4XJO A;  4CVQ A;  1V2E A;  3W1J A;  3GSB A;  5FT6 A;  5HDM A;  4EB5 A;  1G7W A;  3DR4 A;  3WKS A;  1BW0 A;  2ZSM A;  4RLG A;  3N4X A;  1W7N A;  1W3U A;  3DR7 A;  5DJ9 A;  1OHW A;  2BHX A;  3ISL A;  4WYF A;  1ASC A;  3QPG A;  2HZP A;  1CQ8 A;  1FG3 A;  1SF2 A;  2ZYJ A;  4F5J A;  4A6U A;  3DC1 A;  2BIE A;  1S0A A;  2FQ6 A;  1H1C A;  3A9X A;  3E2Z A;  1EG5 A;  2W7H A;  4A0F A;  3PDX A;  4ATQ A;  3WCO A;  1X2A A;  3EUC A;  4RAE A;  2DGM A;  2W7J A;  2D64 A;  1C9C A;  3PIU A;  1KMJ A;  4OT8 A;  4WD2 A;  2Z9W A;  1C0N A;  4ZSW A;  2BWN A;  4CBR A;  2R5C B;  1PG8 A;  3R4T A;  2BWO A;  3NYS A;  4IXZ A;  1PMO A;  1TOK A;  2D7Z A;  2Z67 A;  4AZK A;  4JEW A;  4P7Y A;  5EQC A;  3FDB A;  2W7M A;  2Z1Y A;  4TMR A;  3ZRQ A;  4EU1 A;  3IF2 A;  3CQ6 A;  1DJE A;  1G4V A;  3FQ8 A;  1TPL A;  2WB6 A;  4IY7 A;  1WYV A;  1CS1 A;  3VAX A;  1N31 A;  1BJW A;  5FT8 A;  4ZWM A;  4XJP A;  5EAV A;  4KAM A;  1M0N A;  4ZAH A;  2BI9 A;  1VP4 A;  4BA5 A;  3E2F A;  3FZ8 A;  1AMQ A;  1OHY A;  1ASD A;  1CJ0 A;  4HF8 A;  4XJM A;  1AMS A;  3HDO A;  3AV7 A;  2G7J A;  5EIG B;  1G7X A;  1AKB A;  4IW7 A;  4EFF A;  4E1O A;  3ASB A;  2FKI A;  2BKW A;  2HOZ A;  2AY5 A;  3VOM A;  1TOE A;  4W5K A;  5G09 A;  3BWN C;  4I8A A;  1AY8 A;  1GC4 A;  2VI8 A;  2VGT A;  2W8U A;  3B46 A;  4KXK A;  1I29 A;  2Z9U A;  3WCN A;  1RVU A;  3GZD C;  3HLM A;  4H63 Q;  1AAW A;  2QBT A;  4R5Z A;  1C7O A;  1ASA A;  1JS6 A;  4Q76 A;  3AEJ A;  1S06 A;  2DR1 A;  1GD9 A;  3MC6 C;  2QB2 A;  2W7L A;  3WLX A;  3I4J A;  1ZOD A;  3BB8 A;  2EZ2 A;  3EI8 A;  4A0R A;  5KTB A;  3ELP A;  4WLJ A;  1IX7 A;  2VI9 A;  4A72 A;  5EUN A;  4ZSY A;  2FM1 A;  1QZ9 A;  1W7M A;  4R2N A;  2BI2 A;  2CFB A;  1X29 A;  1IX6 A;  3RCH A;  3PJ0 A;  2D65 A;  1O62 A;  4MQP A;  4DBC A;  1ARS A;  2VGV A;  2QLR A;  3QM2 A;  4WXB A;  4AZJ A;  5LHA A;  3L8A A;  2VGW A;  4UQV A;  4XJL A;  2E7I A;  4QGR A;  4ZM4 A;  1T3I A;  2AEV A;  2C81 A;  1B9I A;  3PDB A;  3COG A;  4CXQ A;  1V2F A;  5E3K A;  5K8B A;  2W8J A;  4FFC A;  1YOO A;  5BJ4 A;  3EI6 A;  1M32 A;  1LKC A;  3OKS A;  4OC9 A;  4WYD A;  2EH6 A;  1ARH A;  2QB3 A;  3ATH A;  1KKP A;  2BI3 A;  1QJ3 A;  3N0L A;  5HXX A;  2YHK A;  1IUG A;  2XBN A;  2CJH A;  3E6G A;  4IYO B;  3MAF B;  2BYL A;  1B5P A;  1OXO A;  1DJU A;  1P3W A;  4GE4 A;  4ZAS A;  4ADE A;  5M4D A;  1M0O A;  3BCA A;  2D7Y A;  3RCH B;  1CQ6 A;  2YKX A;  1SZU A;  4MY5 A;  3AEM A;  2ZY4 A;  3W1I A;  1AMR A;  1ARI A;  3WGC A;  2CY8 A;  3CQ4 A;  4AO4 A;  3ZZK A;  3GBX A;  4ADB A;  3PDB B;  1TOG A;  3GET A;  5E4Z A;  4A6T A;  3TFU A;  1OAT A;  4JEY A;  4RJ0 A;  2VMZ A;  4CBS A;  2HUU A;  3EZS A;  3LWS A;  4R5F A;  3LV2 A;  4GDY A;  2O7C A;  1VJO A;  1AHY A;  1W23 A;  2BI5 A;  2VMV A;  3FCR A;  5DB5 A;  2CJD A;  1FC4 A;  1AX4 A;  2WKA A;  3KKI A;  3QHX A;  4P3M A;  5M46 A;  1DGE A;  1Y4I A;  3B1E A;  4TV7 A;  3HQT A;  4WB0 A;  4F5I A;  1XEY A;  5F9S A;  5JAY A;  2GSA A;  4XQ2 A;  1IVR A;  2CST A;  3FVU A;  1YIY A;  3WZF A;  1PMM A;  2OKJ A;  4E77 A;  2VMP A;  2HP1 A;  4ITX A;  2DGK A;  4UHO A;  1U08 A;  2GMU A;  4M2M A;  3WY7 A;  1LC7 A;  4R8D A;  1WYU B;  5G4I A;  5M49 A;  2JJG A;  3FRK A;  1WYT A;  3VK2 A;  1UU1 A;  1EQB A;  3A2B A;  1RVY A;  2JIS A;  2GMS A;  4GSA A;  2EO5 A;  2VMX A;  1SPA A;  2NMP A;  3N4S A;  2V1P A;  4A0G A;  2AY9 A;  3HL2 A;  1B9H A;  1AHG A;  2HUF A;  4Q31 A;  3GZC A;  1OXP A;  1SZK A;  1IBJ A;  3A9Y A;  3FFR A;  1ZOB A;  1GEW A;  1J32 A;  3P1T A;  1QJ5 A;  1TOI A;  3UAK A;  4DQ6 A;  3NU8 A;  3AOV A;  3DZZ A;  3WX9 A;  4MQR A;  2VYC A;  1GBN A;  1OHV A;  4JF0 A;  4WYG A;  2E7J A;  5E5I A;  4K2B A;  2JGT A;  1V72 A;  3MAU A;  4ZLV A;  2W7D A;  4Y0I A;  1CQ7 A;  4BA4 A;  3NU7 A;  1KL1 A;  3LG0 A;  4LNJ A;  4K2I A;  3I16 A;  2HUI A;  3WGB A;  1WYT B;  2YKV A;  2W8W A;  2D63 A;  3QN6 A;  1ELU A;  2TPL A;  4O6Z A;  2A1V A;  4UOY A;  3RI6 A;  1C7N A;  2AY8 A;  2ZUK A;  4LC3 A;  3W1H A;  4EB7 A;  2V0Y A;  1X0M A;  2W7G A;  3BC8 A;  3E2Z B;  4JF1 A;  1JG8 A;  3RUY A;  4J5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...