2ZJOA

Crystal structure of hepatitis c virus ns3 helicase with a novel inhibitor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
444
structure length
444
Chain Sequence
b'NSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structure-Based Discovery of Triphenylmethane Derivatives as Novel Inhibitors of Hepatitis C Virus Helicase
rcsb
source organism Hepatitis c virus (isolate taiwan)
molecule tags Hydrolase
total genus 142
structure length 444
sequence length 444
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 2zjoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA01
2GJKA 3I32A 2ODBA 2C9CA 2QGZA 2XOKD 2GDJA 2YWGA 4LUCA 4UNNA 3LFUA 1SKQA 2CJWB 4V03A 3U3OA 5JBQA 3BFKA 2CCKA 2R6GA 1XDBA 1CJMA 4C0LA 2E9SA 4DCSA 4KV9A 3UKDA 4NYMR 2O8BA 4PR0A 2GAAA 3FMPB 2PX3A 1G8GA 1Z08A 2ZRKA 3DKPA 3CB4A 2WOOA 4XTCS 1P2UA 3D31A 1PLJA 4O25A 1OPXA 2J0UB 3C8UA 4H1UA 3P1JA 5FBRB 1T3HA 4TYQA 4G5RA 1DG1G 1M7HA 4DDVA 4ZDWA 2A5FA 5LB2A 2VH5R 2VQSA 1G8YA 4D2IA 1KK3A 1KOFA 2ONKA 4URWR 4IDQA 3H0KA 1Z2AA 3HYTA 5DN6D 2E87A 1E79A 3ZQJA 4V0NA 3VX4A 1LTQA 3GFPA 4U00A 3QKTA 2ZI4A 3CR8A 4A0GA 1AS0A 3WP1B 1E2NA 3THWA 4L9SA 2QP9X 3RS7A 2NO0A 3LH5A 3N5CA 1TF7A 3RSLA 3GJ5A 3TVDA 2ORWA 3CRRA 4GT1A 4W5HA 1Q22A 4TMZA 3ZZ0A 3EPKA 1UBGA 2RMKA 4BECA 1G8HA 1UEJA 2CMKA 1CULC 1EFHA 2WPDD 4PC6A 4OHVA 1TMKA 5JWRA 1HQCA 1NY5A 2IYLD 3TE6A 4UNQA 4B35A 2I3BA 5KO2A 4M1SA 2HT1A 2WMNB 4DEYA 4EQ6B 4LRWA 3KFXA 4LJ5A 4ASUD 3TUIC 2KB0A 3BD9A 5IDVA 2XZPA 2YJTD 2W00A 4HAWA 4JJZA 4LYJA 1GNQA 2QY9A 2EWWA 3QEJA 4CEIA 1CEEA 5FUWA 1XB2A 4NCNA 4TMKA 2H16A 5TV2A 2ZPTX 3HU3A 3A1SA 4Q1CA 3IIJA 1F2TB 4MDFA 4RZXA 5DYIA 2DWQA 5H68A 4FCWA 4TZ6A 5JJIA 2VYFA 1SXJE 5JECA 1N6HA 2NPFA 3AKEA 3BOSA 1VG9B 3W34A 3KXLA 4DLWA 1J8MF 4P32A 3ZIAD 1DADA 3W6PA 4RZ3A 4BASA 4DLUA 4ACBA 5KDOA 2F1JA 4HLQB 3CW2A 1RYFA 4Y0VA 5L3SA 4B33A 3SJZA 5UKDA 2QNRA 4IVQA 3SR0A 3LXXA 2JDID 3KKQA 4JVLA 2JASA 3EZ2A 4I99A 4AKGA 2UKDA 4BFZA 1LW7A 2AWOA 2HJVA 2PL3A 3QE0A 2FZ4A 2O0KA 2QM7A 1Z22A 2LKCA 2ZR9A 4OQLA 3ADBA 1W7AA 1IONA 2WHXA 2VA8A 2ECKA 3D8BA 1GRQA 3IIMA 1R4AA 2AL7A 3PV0A 1G3IA 1EX6A 1XTJA 1QDEA 2QUZA 1QG4A 4DHEA 3DHWC 1W4AA 4RKEA 1TX4B 5A4JA 4LDJA 1G19A 4N3NA 1YZTA 3IPYA 1XNJA 2RGAA 2ZRIA 4QXAA 1NL3A 1SVMA 4OBEA 2I4IA 1OH6A 2WWGA 2GBLC 2HXSA 5ANRB 2FN4A 1AGPA 1IXRC 1RZ3A 1JR3A 1KO8A 1ZUHA 1HH4A 2GXQA 4LBVA 2A5GA 3ZD6A 1Z07A 4LV5B 1U90A 3IBGA 1SKYB 3TAUA 1LV7A 3OE7A 4JJKA 4TL9A 1T9HA 1XF9A 2OESA 4JLJA 3AKYA 2Q6TA 2FJUA 3FKQA 4YMSA 4ZKDA 3SEAA 2FPKA 1XEWX 1AN0A 3FHCB 4KI0A 5AJYA 3N70A 2FPLA 3WBKA 5KNCA 3VR3A 2JIZA 1RFLA 2WJHA 2IW3A 2GF0A 3OAAD 3SC3A 1EFRD 1N6KA 2W2XA 4QGAA 1I4LD 2DPXA 4LWZA 1G7SA 3LAWA 4V0MA 4WIAA 4UNSA 1VMAA 3SQWA 4N1AA 1JQLB 3QKRB 4QHTA 3NC1C 3W3AA 2DB3A 1X8LA 3PENA 3L0OA 4YLGA 3W5IA 2WWXA 1XZQA 2DFTA 3NEYA 3CPEA 1R0XA 1W0KA 2X1VA 3FB4A 1E9CA 4C4PA 2IYTA 3KKOA 3U3JA 2CXXA 4Q7JB 1NMZA 1XD9A 1NVXQ 2GXSA 3NBXX 2BBSA 5D3QA 4LZZA 4MKIA 1X3SA 4LY6A 4DLVA 4LPSA 4DZZA 3OEEA 1CU1A 1G3RA 1LF5A 1OW3B 2EFDB 1F6BA 1SHKA 3FMFA 4QGGA 3LQRA 3VR2A 4DLZA 5BN5A 4B2IA 1G3QA 1XMSA 1P75A 2RGBA 2D62A 2ZAMA 1JEDA 4ZDIA 4DSUA 1XPRA 3RNLA 2ZRPA 5EXSA 3CUEF 2X2FA 4NHOA 3AF0A 3D6TB 1H8HA 3P32A 4OK5A 1X8JA 2ZRLA 3NBFA 1SQ5A 1AQUA 4TLAA 4UJ5A 4ARZB 2O8CA 3JVVA 1F3OA 4B2LA 2R2AA 2Z83A 5EJEA 2CLDX 4NE2A 1QHGA 3WRYC 3T34A 2ATVA 5IRCD 5E3HA 2IUTA 2LWIA 3CZQA 3C41J 721PA 2WSSA 1OF1A 5J5CA 4OQXA 3U60B 2G9NA 5JWHA 3TKLA 1ZIPA 4BE7B 1JAHA 1OIWA 4DIEA 4TL8A 4KYIB 5EUMA 3X1YA 2H1LA 2WKPA 4K81B 3ZH9B 2OBLA 2OM2A 2YINC 3HYRA 2PT5A 3CNNA 1KNXA 4BLQA 2FMXA 1UM8A 1G5RA 4BZXA 3I4LA 4O3MA 4Q5IA 4YDSA 2IC5A 5HKKD 4Q7MB 1OE0A 4MA4A 3BFXA 1E2MA 2VL7A 1FMJA 4HEJA 4YC7A 3O8BA 1CXZA 1W49A 4JBYA 3WYGA 3TGPA 2VRWA 3QG5A 3A36A 4NYJR 5TB5A 1TUIA 2QL6A 1R0WA 4TMVA 2ODEA 3ZS9A 1W2HA 3K0AA 4RJLA 2V54A 4B6EA 1FMLA 2IYXA 4LC0A 2A5DA 1KDTA 1ZW6A 2OEPA 3ETLA 4C0QC 4EKDA 1X1SA 4LJ9A 3QBTA 4ZDKA 3QVVA 2JJ2A 3PEYA 2RH5A 1E2GA 2QEQA 2BMDA 1R5OA 2KBFA 1XBTA 3W5JA 1ZNYA 3U7EB 2E1RA 3BFVA 4M8NE 1Q3HA 1I4TD 2VP6A 1TPZA 1TADA 3NDPA 3X2SA 3SYKA 3KUCA 5EE9A 2OLKA 3P27A 2GJ9A 4DC9A 3PUZA 2IYYA 1P2VA 5L3QA 5J4KA 1GIAA 1JQJC 5GVRA 4F4CA 4MGZR 3BB1A 1YZKA 2EFHB 1BKDR 5EP4A 1WQ1R 4IDNA 3RRNA 3GLIE 4B74A 3QENA 4A36A 5F9HA 1NG1A 1SXJD 5FOSA 3K0AB 4GOKA 1CR0A 1Q12A 3AF3A 3RS0A 5KUTA 2AX4A 3CO5A 4FD2A 1PZNA 3BERA 3H86A 4KXFB 3KKNA 4R7ZA 4EFLA 1KTVA 2PCLA 1IY0A 3A6PC 2FOLA 4AKEA 5G53C 5CIWA 1UAAA 4JBWA 4YMUA 1MO3A 1QHSA 2V9PA 4JKIA 1YZNA 3FE2A 2ZSAA 2VHUA 3OFND 2WV9A 5H70A 3EA0A 1P7CA 3HR8A 2ZRHA 3VR1A 1E2IA 4OK6A 4PTLA 1P6XA 4M22A 2G1JA 4GOJA 3CWZA 4RD2A 2GETA 2NG1A 1ZUIA 1S2MA 2J7KA 5L3QB 3EC1A 1N0VC 4IDOA 3VU9A 1AJEA 2GNOA 5KDLA 1KZGB 2AHOA 1E2FA 3MAAC 3W3ZB 2GCOB 1M1YE 2VF7A 4QJ3A 2XZOA 2QT1A 4W9MC 2FGJA 2G1KA 1KSJA 4OJKA 3WNBA 2AD1A 1PLKA 4JLDA 3RYTC 3FHTA 1XD8A 1XRJA 1Z2CA 3CZPA 421PA 1G8FA 2I1QA 1N5LA 1E94E 3R8FA 1E96A 2HF8A 1E2PA 3MGCA 1KIMA 2YKGA 1CP2A 3EWSA 3SS8A 2ZI7A 1LB1B 3A4NA 3NHAA 2XSZA 1IY2A 3PEUA 2BEJA 4AC9A 1W0JD 2HDNB 2V7QD 4NYJQ 3UATA 2F3TA 3PR1A 2D4HA 2DCUA 1WRBA 2J59A 2WJGA 3BIFA 2W83A 3B1WA 3C5CA 3PITA 1BO6A 5KU1A 3T5GA 2ZYWX 2Z5FA 3BE4A 3QKUA 1JXOA 4PO8A 4IOJA 1NBME 2ZVQX 1EFCA 2J41A 1BIFA 1VKJA 4AKIA 2WWWA 3Q7PA 4DB2A 1QVAA 1WBBA 3A4MA 4I1SA 4D4LA 4NH0A 3NEJA 5FTJA 5FPYA 1YHNA 1A1VA 2QORA 4EPTA 3P20A 1E0KA 2RKOA 4XSGA 2Z0MA 1OYYA 1N6IA 3PQCA 4W5JA 3REGA 4RSGA 1COWA 4B76A 1TUEA 4HLDA 3SBDA 1GL6A 3UIEA 1KDOA 2CL6X 4QBFA 2AD5A 5C4MA 3P26A 1OT3A 5P21A 4Q1EA 2P5TB 3GPLA 1GITA 1E4YA 3ZQ6A 5B58C 2KJQA 2OCPA 2ZIAA 4QRHA 1QHYA 1A2KC 2VO1A 1R6BX 3A58B 4EPXA 3IEUA 4Q9KA 3OIUA 1D5CA 5JJLA 3I8SA 2JLVA 2QGNA 1ZUNB 4PC2A 1LY1A 2ODWA 4A2PA 4WZ6A 3BAFA 5CB6A 1IBRA 1U0HC 1YR9A 2EFEB 3EPLA 2FZLA 1AIPA 4GDFA 4KSCA 3D3QA 4DIDA 2GZDA 1ZNXA 1ZD1A 3B85A 4A0HA 1Z0IA 1G3UA 1QVRA 3OIYA 2MMCA 2W0MA 3LWNA 5IK2A 3WXMA 2GVDC 1EK0A 4CGZA 2G3YA 2ZANA 1A5TA 1DAMA 2H57A 3EC2A 1DEKA 1GNPA 2CCGA 3ZYCA 3SOPA 4RD0A 4LBWA 2BC9A 2YOHA 1EG7A 2HXYA 1T8UA 1US8A 3OHMA 4Q19A 1VCMA 3EWAA 1Z6TA 2W6JA 3QXCA 2NOAA 4NONA 5AUPB 3IDQA 2DFKB 5JEEA 1G64A 1Q44A 2WJJA 3A1TA 3AUXA 1O3YA 2G83A 4CEJA 2VP9A 3VR6A 1W5SA 3EZ6A 2DFNA 1M2OB 3GLGA 2QAJA 1G7RA 2QTHA 1G6OA 2ATXA 2QZ4A 3SU8A 1OKKA 4WAUA 5D3MA 1U8AA 3U6BA 4LCBA 3TR0A 2XXAB 2OCAA 1LS6A 3X1ZA 3T1OA 5FR2A 2P67A 3IBYA 3UANA 2WZQA 4EPYA 2IS1A 4B47A 3CIOA 4E07A 3BH7A 2B6HA 2OLJA 2VP0A 4HAVA 1XTSA 4Q4AA 1T4GA 4QHSA 4D4MA 4F4IA 4FCTA 4BLOA 2AXNA 4PHGA 3RRYA 2EYQA 3M1IA 2AN9A 3I92A 1Q1ZA 1US8B 4KU4A 2PMKA 2JCSA 2FA9A 2GEUA 2ZRAA 1Z6AA 2PBRA 4KFUA 3SFZA 4HUTA 2OAP1 4IXNA 4RD3A 1DO0A 4C2UA 5EZ5A 2AK3A 3KFVA 5J47A 5BN4A 1N5IA 3G82C 5FOWA 2IWRA 1AGRA 1ZM3A 4NU0A 3K70B 5C4GB 2BMEA 5TARA 4C0BA 3O8RA 2GK6A 2DHRA 1GTVA 2OXRA 1GM5A 3TAHA 4QG7A 5H8WA 1HYQA 3BC1A 2W2TA 1EX7A 5KPDA 4LC1A 4UNRA 2OZEA 4J0QA 2AR7A 2AFIE 3GLHE 1IJFA 1WB9A 1NSTA 4Q4AB 4ZIRA 2JLQA 1IN4A 5E7MA 3QF4B 2ZUDA 1Q1EA 4Q4HA 2PMDA 3AEZA 2IXGA 3GJ6A 3UMRA 1E98A 2C03A 4P4TA 3AF2A 4AD8A 5C2JB 4B3BA 3CBQA 2HLDD 2Q9CA 3EIHA 2HEIA 3VKHA 4MH0R 1G6HA 4URZR 4FMBB 4A0RA 1BMFA 2IS6A 4GPTA 4LX0A 2PH1A 4LJ6A 4CDGA 2ZS8A 1U9IC 2ZJYA 4H1VA 1XXHA 1YR7A 4PSKA 3PXGA 4UXJA 4FCVA 1KYIA 4XTRA 1XU4A 1S96A 1HTWA 3BH6A 4HUQA 5FL3A 3LW7A 2YV5A 1TF5A 3EZ7A 1S8FA 2FDCA 3PUXA 1G8PA 4C30A 1G1MA 1OV4A 4R98A 4TT3A 1X86B 2Q3MA 1OXXK 4ZIRB 3LBNA 4X8LA 1T5IA 1XEXB 4Z1MA 3AVXA 3C5HA 1KMHB 1MABB 2ERYA 4GRAA 5C1BA 3QQ5A 1DAIA 2IF0A 1YJ5A 4GOXA 5G40A 1G291 3EPHA 5DGXA 1S1CA 1ZP6A 4GL2A 4BLTA 4PQFA 5CLLA 2BBWA 1B0UA 4Q9HA 4BPBA 1CRQA 3CX7A 2HF9A 2IEYA 1L7VC 3ND9A 2J7PD 5AJWA 1U99A 1J8YF 2KWIA 5AJXA 5FI0B 4BLSA 3L0SA 1FP7A 5CYOA 4LYHA 4NBSA 5IHPA 3KJHA 4LJAA 1WMSA 1Z0DA 2GBLA 2L0XA 1TL7C 3U7HB 5JJKA 4DUGA 4XVUA 2JEOA 3EW9A 5JCPA 3RABA 1DO2A 2NGRA 4LHVA 4FXPA 4IKEA 4G1UC 2JA1A 4QGFA 2GK7A 1ZC3A 2A5YB 3E1SA 2WJYA 4MRSA 3T61A 4AKHA 2GKSA 2X77A 1W4CA 1M34E 4HB2A 1YQTA 1OB2A 1XTKA 3SDZA 3K70C 2FGKA 1KI2A 4HZIA 4YXWA 2O5VA 4MUBA 2QPOA 3VR4A 2Q21A 4TZ0A 3HJNA 3HP1A 4IJMA 3L82B 1FTSA 5E4FA 2MSCB 4DCTA 1L4UA 2O8EA 5EXXA 2ZRBA 2BMJA 1IM2A 3MWKA 4WOPA 4Q4JB 3V9PA 3OF5A 3RVBA 4OHZA 5L3RA 5DE3A 1KKLA 4AG5A 2CNWD 2CVHA 3U3KA 4BWYA 4D81A 5DISB 4Q9IA 3HDTA 5FBWB 1VECA 4LHWA 1VHTA 4TLCA 1JALA 2JJ8A 3THXB 2NO1A 1OH8A 4EQ6A 4EDHA 2IYVA 4IHQA 4POAA 4KFTA 4IRUB 4RKFA 1LVGA 4HAZA 2ZJZA 2TMKA 4WXRA 4OHWA 4A6PA 1W4RA 2QA5A 4GP7A 4XIGS 5FL7D 3BGWA 3VNVA 1C9KA 2GXUA 4URXR 4YDHB 2QROA 2WJVA 2QRNA 1F2TA 1OSNA 1HV8A 2KSQA 1MR3F 3DM9B 1RPZA 2V1UA 1ZMXA 2W0SA 3LBIA 2JLUA 1OXVA 1MO5A 2O8EB 4PQYA 2ZE8A 5L8VA 3VNUA 1P60A 5H1YA 1GZSA 1RJ9A 1AZSC 3W6OA 1IY1A 3EZFA 4QC2A 3QPWA 5DNYB 1F5NA 1XCMA 1ZM4A 2OCBA 3A4LA 4EAQA 2QPTA 3TUZC 2YZ2A 1BOFA 5FTMA 4G5OA 3AP1A 4IDPA 3FKSA 2GTPA 1E9RA 3SYNA 2FH5B 1P72A 4ESVA 2ZSDA 1R5NA 1VG1A 2XB4A 3T12A 5CM8B 4B3FX 2ZRFA 4KSBA 1T5LA 2HV8A 2WWFA 5HTKA 1R2QA 2AK2A 4PZZA 2ONJA 3R7WB 2DBYA 1E79D 1N6PA 3LA6A 1VG0B 1T3SA 4JS0A 4PAQA 3EASA 1T0JB 4FINA 1GKIA 1RRCA 4C3ZA 3KXKA 5FH9A 2C9OA 2ZUCA 2WICA 3AUYA 2XTMA 1EFTA 2BJVA 4YMWA 1TQ6A 1U2RA 4ILEA 3UMSA 3VKWA 2O0JA 4AK9A 3B82A 3M6AA 1JPJA 5AUQA 4URYR 4JYBA 2ZR7A 1RJ9B 2GXAA 1OH5A 3HR7A 4IVRA 2WWIA 5C18A 1QHXA 3HU2A 4KFRA 3WYFA 1G4AE 4JYCA 1YKSA 1L8QA 3D7MA 1OLOA 2IS2A 4LJ7A 2BIFA 2J46A 3FFAA 4NP6A 5K8IA 3FTQA 2VHCA 4EPWA 1HE8B 2XAUA 4X8MA 4X8OA 1HEIA 4TYNA 4WW0A 2ZTSA 1GL7A 4HSEA 3LRPA 4TYPA 4JMPA 3UG6A 4IFEA 1UKZA 4NYMQ 3ZVNA 2PEYA 3TW4A 3OIVA 3QKRA 1I2DA 1SGWA 1OFTA 1R8SA 1Z0AA 2OAQ1 3KJEA 4CW7A 1DARA 5CLQA 2R62A 4PSVA 2REBA 5BYKA 1II8B 4KCGA 4LJ8A 4XH9B 4PC1A 5E7JA 5E95A 221PA 1IN7A 3OEHD 3EARA 3OAAA 5HCNA 4OI1A 2ZRDA 2EVWX 3ONWA 5DYGA 5JI3E 4CVNA 4HLUA 4QM6A 2O8FB 3ADKA 2ZJ2A 4K8OA 4C2TA 4PAOA 4OQMA 3NVAA 5EP3A 5JEDA 1ZNWA 4RD1A 3U61B 3A37A 1WCV1 1ZINA 4DLXA 2UZIR 1NMYA 5EE1A 1J2JA 4LV6A 2DFLA 2IL1A 3QPVA 4ARZA 1ZYUA 4QNMA 3PCRB 4A92A 3WP0A 1ONBA 3LV8A 4MKHA 2GRJA 1GRRA 3T1VA 3OESA 1ZD8A 521PA 4L16A 1FZQA 1GL9B 2OXCA 2YNMA 3QKSB 1T6NA 4KLZA 2IYUA 4CIDA 1M6NA 2RAPA 4BZQA 4Z8XA 2J0QA 1JR3D 3HU1A 2B8WA 2KBEA 4MGIR 2ORVA 1IN5A 3ZD7A 1A4RA 1VYUA 1M74A 4ERNA 5BW8A 3SE0A 1QZXA 3BH0A 3OE7D 1ANKA 3GLFE 1UDXA 2YHSA 2G0TA 4LJYA 2FNAA 4M0LA 5FPTA 1KNQA 5DSZA 4D82A 1YRAA 3FMIA 2H7VA 4XVRA 4GZLA 2FPMA 1HY3A 4G3XA 2QE7A 4RZUA 4P0TA 2JIZD 1OJLA 4P31A 1UBFA 4I1UA 3RRMA 4D26A 1YZGA 1ZC4A 3T1TA 3LQQA 3NBZC 3LXRA 4CT5A 4US2R 3L8YA 2OFXA 5F2EA 3ZZUA 3EIEA 4HB0A 3PG5A 2BDTA 2PJZA 2H92A 1LNZA 1AK2A 1UBCA 1Z63A 4K46A 1KK0A 2ZJBA 1IQPA 2QBYA 4QFMA 1FUUA 3CX8A 2O0HA 4QGHA 1DAHA 1IJEA 2V55B 2F9MA 3LD9A 2D06A 3OEED 5M04A 2VIIA 4DLSA 3M0EA 2QT0A 2QQEA 5CK5A 4AYWA 2GJ8A 1QHHA 3ASYA 3CPHA 5EXPA 3Q3JB 4A1FA 2ZETA 4DLRA 2NPIA 2D3WA 2CHQA 3SHWA 2WWYA 5KHOC 4BFSA 1WP9A 4ZV4A 3C15C 4LK2A 1NIPA 3GEHA 3K0CC 1AA9A 3AKDA 3ADDA 4C7OB 1L4YA 1WA5A 1FX0B 2DWPA 1CR1A 5JRZA 3QY0A 3CF6R 2F1RA 4V0OA 1QHNA 3G0HA 2PLRA 3O8CA 1KK1A 4PPQA 4KVGA 2ZS9A 4MGKR 4R2IA 3TIFA 4DSOA 4NL4H 4I1VA 4JLBA 3KQNA 3GJ0A 3U3MA 1Z0FA 3CRMA 4V0LA 5AJVB 4AYTA 3B13B 3B2EA 4FMCF 1GRNA 2PLFA 5JFGA 2VSOA 1E9FA 1GP2A 4B6FA 2XTNA 4P4SB 3B1VA 2JJ1A 4D80A 4DSTA 4XD7A 3KKMA 1IAQA 1UBEA 2VHQA 4KFSA 1JNYA 2ZQ5A 3K0FB 3IO3A 2FEMA 3KB1A 1FNNA 5CJ2A 3QSYA 4Y0AA 2NO6A 4HB4A 2BVNA 3AV0B 4URVR 1U8YA 3R8CA 1HURA 1SXJA 1QHHB 5DLQC 3DM5A 2XNDA 3H1TA 4OI0A 4U02A 4QM7A 4BLRA 4DVGA 1M7GA 2AXPA 1V5WA 1KO7A 2PZGA 3B60A 1CJUC 3SBEA 3UWOA 3DZDA 4Q1BA 1MV5A 2HJGA 2GCOA 2X8AA 2XX3A 4B2PA 4DCUA 2IXFA 1RRFA 3NKVA 2W6IA 4ACAA 3IEVA 3WMEA 3OFNA 4IOLA 3W9YA 1UJ2A 2EQBA 1TF2A 4ZDJA 3CX6A 4Q9LA 1Q57A 5ELXA 5FBVB 2YC4C 3CM0A 2V4ZA 3V00A 1PLLA 4Z54A 4HLUC 2YC2C 4BQSA 5B57C 3I8XA 1GKYA 2PCJA 3QOFA 3R9XA 3QXXA 2OILA 1W5TA 5J4LA 4LYAA 1C4OA 1R0YA 1DAGA 3NBYC 3WYAA 3WMGA 2JJ2D 4F93B 5CDFE 3IUYA 1H8EA 3IPXA 1JI0A 4P3YA 4TN1A 2NZJA 5HE8A 4XWOA 3TQCA 1SXJB 3EZ9A 3ZVLA 2IK8A 1ZCBA 3K9HA 1W44A 4LYFA 3RRZA 4LPKA 3THYB 2GA8A 4G0NA 4P33A 2ZRMA 3NDBB 2CVFA 4ZO4A 4PFSA 4JVNA 2IA5A 5HZHA 1XMVA 4JLOA 1NLFA 1ZU4A 1S4QA 4LJ4A 3RWOA 2B7CA 4Q03A 5GVSA 1CF4A 3CRW1 3FDIA 1IXZA 1XJQA 3KQKA 3MWYW 5FOVA 4FWTA 2C9YA 2FFQA 1HUQA 4HAUA 5CJPA 1HE1C 2J9RA 1Q1QA 5B2ZA 2MSDB 1T0HB 3TLXA 3EXAA 1YZQA 2K5UA 5FUYA 2FE4A 1Q3TA 2J1LA 4XWAA 4BRWA 4TLDA 1U9IA 5AUNB 4NTZA 5AWFC 4AG6A 1N2CE 1XPOA 2Q3FA 1X8KA 4LOAA 4C0AC 3AVWA 5DH9A 4FMDF 2X2EA 3IILA 2ZYUX 4IEEA 5E7IA 2QMOA 2F1IA 2QAGB 2ODNA 3WBJA 3IHLA 5CITA 3EA5A 5B30A 4UXIA 1OH7A 1UADA 1E99A 4MYHA 4A9AA 3RWMB 1E9EA 1VG8A 4L15A 1KY3A 3RS4A 5TMPA 5HPYB 1KO4A 1CJTC 3T35A 3AVVA 4UXHA 3UK6A 1WXQA 4US0R 2PZFA 3WNCA 1F48A 4BUJA 3LY5A 2Z6VA 4GP6A 2FG5A 2Y8EA 4IVPA 2UVQA 4Q1AA 2WIAA 1AS2A 1W36B 3BS4A 8OHMA 3BORA 1G7CA 1T91A 1P73A 1HQYE 4Q00A 4EPRA 1E1RD 2ZJAA 5KTYA 1KSGA 5DIFA 2XXAA 1E6CA 1XX6A 4JL5A 2JLXA 3OIWA 4EJSB 2FFAA 1U8ZA 3I72A 1U0LA 1KAGA 3NTUA 4JL8A 4BFXA 1XEWY 4PPGA 1P62B 1SVOA 4WA7A 4Q9JA 3SJBA 2IS4A 4AI6A 4Q7LA 2P2LA 4MUAA 1KI8A 1R10A 1NG9A 1ZU5A 2R65A 2A3RA 3K09A 3GLFB 1G18A 2V8OA 1EFUA 2QQ0A 2D7CA 2A7QA 2Q3HA 2QP3A 4MRPA 4OI4A 2V6JA 1AKYA 3KX2A 3ECCA 1U0JA 4B43A 3WHLA 1GG2A 1NN5A 5JLJA 5FUVA 3VHXA 4HYYA 4E22A 2ZITA 1DTSA 1MT0A 3F0TA 3IQXA 3WHKA 1SXJC 1P5ZB 5AK0A 5LBIA 1FW6A 1NN3A 3E70C 4M9SA 4MKFA 4PO1A 4PPFA 5HCIA 2R8RA 3MJHA 4JKYA 4Z51A 5F98A 2A2ZA 1ZD9A 4WZBE 2VHJA 4G01B 4M1MA 1D6JA 1OXUA 1E0AA 2FSIA 4BFVA 3TH5A 4RVCA 5IF9A 4M1WA 3B9QA 4O2LA 3U7GA 5GJCA 5DI3B 1S0UA 3L43A 1V43A 2PX0A 1PV4A 2QMUA 2WSMA 5JHGB 4TYYA 1NLZA 4YMVA 2XJ9A 2CDNA 2CLCX 4DEXA 5IK2D 4A8JB 1MH1A 1MOZA 2ZR0A 4A15A 2R9VA 2EFCB 2C5LA 3QF4A 1N25A 4O2RA 1KI4A 4E09A 4FMCB 1KO1A 2BBTA 2ZSEA 2BOVA 1N5JA 5BYJA 1LS1A 2W6JD 2ANBA 3CRVA 4TL7A 4RFVA 1TQ2A 5K8TA 3K9NA 4IDHA 3U6KA 4WBSA 4WVFA 1YVDA 3AVOA 3VAAA 3B6EA 3DMDA 3LBHA 4DT1B 4C0JA 3ADCA 4RFSA 5EE0A 5J4HA 1PVOA 4A4DA 1Z0JA 1FQKA 2XEXA 4KITB 3B9PA 1OKKD 2J5XA 3MSXA 1RVDA 2AKAB 2QSZA 2CK3A 2ZROA 3KTAB 3AVUA 5FPSA 2QAGC 3AM1A 1D8TA 1S3SA 1S3GA 2FSHA 4ZI2A 3AQ4A 1RRGA 4TTRA 4TWZA 4CEHA 2JATA 2HLDA 1OFHA 2JAQA 3S1AB 1A2BA 5TVKA 4LV8B 3QNUA 3MD0A 4M1OA 1OHHA 4M9ZA 4Q18A 1DELA 3Q9LA 1Z0KA 4GBMA 5BWMA 121PA 3KXIA 1XEXA 1KMHA 1MABA 3DVLA 4M21A 3SNHA 4AWXA 1KGDA 6Q21A 2B92A 3RDPA 1LF0A 3MMPA 3TR5A 4BLPA 4B3CA 3Q8XB 1A7JA 5L3VA 1IN6A 1W36C 2KI5A 1CRPA 2C96A 1E9BA 4BFWA 1X1RA 2Z4RA 1Z6YA 2GJAA 3RS5A 2IUUA 3LW8A 4NCKA 3TBKA 1JR6A 1W4BA 2YWFA 3GLIB 1E1QA 2J0VA 3ZJYA 4F7WA 1ESMA 3KZ1E 4RFSB 4JSYA 3TSZA 4EJSC 2FFHA 4A82A 2CE2X 2QMHA 5EQTA 2NMVA 1SVWA 3DOFA 3U4QB 1JEEA 3PEVA 2ZE7A 4B71A 2GWHA 4ABYA 4CEHB 1E2LA 1GFIA 4XWKA 2EU8A 1U98A 4TSFD 5HR5A 3LDAA 3ZVRA 1N6RA 1SKYE 2FX3A 3MWLA 4G5SA 4U5XA 3QXHA 4QBIA 2VF8A 4A6XA 4C0HA 2IF2A 4V02A 1P9RA 5LPNA 1K5GA 4HDQB 3RC3A 4JVMA 1NBMA 4HB3A 1J99A 4CZ2A 2AWNA 1KJWA 5EXTA 3I61A 1D2EA 1M8PA 2OUKA 4W7SA 5BXQC 1EESA 4B3XA 1XTQA 1DS6A 4KODA 5EP2A 4JLPA 1BMFD 3AGPA 2JLYA 1JB1A 4RZ2A 1G9XA 2F6RA 4Q21A 3TK1A 3GFTA 1IN8A 3JVUA 1KJZA 3AVQA 4EFMA 4DDUA 4IXMA 5EUQB 4Q4JA 4M1KA 3DO6A 2ZU6A 3VFDA 4A8JC 3VTKA 5KYKA 3IKJA 1P3JA 2QM8A 3K09C 4OI2A 4PX9A 1JR3E 2FSFA 5HE9A 4FMDB 3UWKA 2J3EA 1YZLA 1II0A 2BHRA 3B7GA 4BRUA 1NJGA 2OG2A 3L0PA 1ELOA 3ZS8A 4BZPA 1XCGB 3W90A 3THXA 2IHYA 1MRSA 1T3LA 2XOKA 4TT3D 4TTPA 2XGJA 2J87A 2B7BA 2VHTA 1TU4A 1AZTA 3TNFA 4Z1MD 5J4VA 1K6MA 3ZZTA 1QG2A 2IXEA 5DHFA 5AR1A 4HDCA 3RHFA 2WBLC 1GILA 5DHAA 4OJQA 3K0SA 4B3DA 1S1MA 2CNWA 3IIKA 4XVQA 1T8TA 3CKLA 1CBUA 1PJRA 2YWEA 1E0JA 4JZKA 4KVAA 4V0ME 4QL3A 2H17A 4D4KA 2QTVB 2RGGA 2P0EA 4DWJA 5JI2E 1KI7A 3QVUA 3CNLA 1NN0A 2VEDA 2FEOA 2VSXA 2C95A 2VP2A 5DN6A 2GAOA 1JECA 4LGMA 1SZPA 5G3YA 3SYLA 1KY2A 1ZIOA 3F3YA 5JHHB 3AVTA 3DL0A 3KL4A 2ZYVX 3KJGA 1VDZA 4DUGD 5JSZB 2QRZA 2AFHE 1XFAA 3WMFA 1RE0A 1KJYA 2UZ3A 4IOKA 1FPMA 3LNCA 3R7WA 2GILA 4UQOA 2GCPA 3GFOA 2ZXUA 5KNBA 1TAGA 1GSIA 3VQTA 2WPDA 3LVQE 3TVTA 3RC8A 2WTUA 2IX3A 3FVQA 4LHYA 1G17A 2DY1A 2RGXA 4GFDA 1XD2B 1JPNA 2CHGA 2ASEA 2NO7A 4MKGA 3X1DA 1TQDA 3IGFA 4N0DA 4BFTA 1N6OA 4YXWD 2ERXA 1BYIA 1P4SA 4M2LA 3A1VA 1FUKA 4L4UA 5J40A 2YWHA 4ASUA 1XPUA 4TLBA 1F60A 1GNRA 2C99A 1NJFA 4KAXA 3CH5A 3VMFA 4R71A 5GJVC 3QJYA 4E5UA 2ZJ8A 1MO6A 2ZVPX 3GJ3A 5SZIA 1AQYA 2HT6A 4JBXA 2LKDA 1K5DA 3AKCA 3TQFA 3MRSA 1QRAA 2V1XA 1OB5A 4XJXA 4A0FA 1E9SA 1R7RA 3RLFA 4MGYR 4DB4A 821PA 4O0MA 2JLRA 3ZIAA 3DEFA 5F3WB 3PEWA 1S9HA 3PIRA 4LHXA 2O8BB 1YE8A 2ZI9A 4KYUA 3BB4A 2JGNA 1SVKA 2JDIA 3GLHA 5KSZA 3U44A 1VCIA 3K0CA 2ZRJA 4JLVA 4UJ3A 1GOTA 5CK4A 4DCNA 1II8A 3AB3A 1Z28A 1G5PA 4RY2A 4M53A 1VYVA 1UDWA 1A82A 4D0GA 3KUDA 3RANA 1DAEA 4PZLA 3AP2A 2IBMA 4DBLC 2O8FA 4LSGA 5DI9A 2Q9AA 2I1VB 3PUVA 3FKSD 3THWB 2RGNC 1RIFA 3GJ8A 2BKEA 1XWIA 3Q7QA 3GQBA 3PUWA 5LDDC 4F38A 1YRBA 1VHLA 3FHOA 4DRZA 3FMOB 5K8LA 1E3MA 3GEEA 1E9AA 5AJZA 1DPFA 4G5GA 4IFBA 3OEHA 3T5DA 1ZJ6A 2RB4A 4D0LB 4DKXA 2ZI3A 2JLZA 3ZVMA 3TMKA 5A0FA 4CT4B 1K8RA 4C0SA 4OHYA 4JSTA 3GLHB 3U44B 3IHWA 2HUPA 1IOZA 3CPJB 2A5JA 1KI6A 3QKSA 3M4YA 3FWYA 3EPJA 4L9WA 2CLSA 4F4JA 2VPPA 2QG6A 3X1XA 1J90A 2XJ4A 1NSFA 4I1OA 1R0ZA 1G7TA 1EFRA 1D9ZA 2RGCA 1FFHA 2WWHA 3MLEA 4ZCLA 4CEIB 4AYXA 1E2EA 2OE2A 4NPHA 2GEDA 3ZLJA 3GMTA 4MQBA 3L8ZA 1Z29A 1CKEA 3BJIC 2GJSA 2H8KA 3QXJA 2IUSA 1ETUA 3I62A 4I4LA 1CJVC 1G41A 1W1WA 2KE5A 3B78A 4PANA 3X1WA 4DDWA 5B64A 4B34A 2VTKA 1TEXA 2VSFA 1W48A 5KSPA 1NVVR 3U3RA 4FI3C 5JRJA 2CCJA 3HPRA 3Q72A 3CLVA 5CIQA 5L3SB 2IEZA 3LX5A 3B1ZA 4IEIA 2QTFA 2QENA 3KQUA 5EE5B 3MUFA 1U94A 3A1UA 4DCVA 3UPUA 1KI6B 2P6UA 1C1YA 3GP8A 5JS8A 1NVWQ 2P6NA 4H9GA 1G5TA 3NIBA 3R20A 3DZ8A 2GVZC 4XOIA 3KJIA 5FTLA 2J0SA 2G0NA 2R6FA 3F5FA 1NLYA 1N0UA 5CB8A 4B44A 3CR7A 3RS2A 4NCHA 3CRQA 5FOTA 3L0IB 3CF0A 5CYPA 3W6NA 1N6LA 2NIPA 2PEZA 3NH9A 4II7A 1SVIA 2QP4A 3HPQA 2WAXA 4PHTA 2GESA 2ANCA 2W58A 4B48A 2XITA 4DDTA 4I81A 3NH6A 3BRWD 1KZ7B 1OIXA 4C7OA 5FBQB 4MITA 1FX0A 1Z47A 2DYKA 1WF3A 2HCJB 1E2KA 1VCOA 1XMIA 1LFDB 4A2WA 2QN6A 3BWDD 2YOFA 2OFWA 4KHZA 5G3ZA 4PPNA 1KI9A 2WIBA 1NF3A 2ZSFA 1VIAA 3Q5DA 3RSOA 1W0KD 4HAYA 1ODFA 4Q66C 1SHZA 1G21E 2IYQA 1I2MA 4RD6A 1NKTA 3AF4A 2IYSA 3LX8A 3W8NA 2REXB 1XEFA 4JVSB 1CLUA 5HKKA 3K0EA 1G20E 4P4SA 2RHMA 1E2QA 2W2VA 3MJRA 3K8YA 1Y3AA 1UKYA 1XTRA 2YYZA 3K0FA 3K1JA 4QHYA 1CR2A 1EWQA 2RHDA 2GHIA 3MFYA 4TMWA 5FTKA 5FI1B 5GJBA 2C98A 1G3MA 1NN1A 1BH2A 2A9KA 5KOYA 4EPVA 1TQ4A 2ZUBA 2OBMA 2F55A 1WE2A 1Y63A 2HYDA 2OCYC 2PZEA 1RC8A 2IYZA 2QU8A 2R44A 4Q01A 2QE7D 1H8HD 4B32A 4WZAE 3GJ4A 4PC3A 1JJ7A 4RD4A 3C7KA 3AVPA 1Z5ZA 3CF2A 4MRVA 1DG3A 1W46A 4KBGA 4EUNA 2G77B 2IT1A 2FF7A 5SZHB 3N2EA 5GJWC 3NXSA 3PVSA 4C0KA 2WSSD 3FOZA 2QPAA 3QIAA 3VKGA 3Q85A 4EFNA 5IT5A 2RCNA 2BCJQ 1NVVQ 1Z06A 3C4JA 3AP3A 2O8CB 1OFUX 2C78A 3HWSA 1XZPA 3L2OB 4FW9A 4OHXA 5TY0A 4KJZA 5JCZA 3BXZA 1Q20A 4NDZA 3GLGE 1UF9A 1BYUA 1KAOA 2JLSA 4TLEA 3K53A 3LVRE 1SVSA 2GZAA 2SHKA 1D2NA 3U2QA 4QJ4A 3THYA 3T15A 4AY2A 4BGDA 1M7BA 1NKSA 4KO8A 5TDHA 3V4RA 4URUR 2YVUA 4PSAA 1MO4A 2ZRCA 4BEJA 3FGNA 4Z8YA 4CYMA 1JXMA 4GZMA 1P2SA 4X8HA 3TSOA 4TL6A 1AM4D 2DWOA 5FPHA 1HT1E 3UXMA 2XTZA 4G5QA 3AF1A 4GSYA 3VR5A 2D2FA 2GEVA 3IQWA 5BQ5A 3A8TA 5J4YA 1XJCA 4QKQA 4MYUA 2BJWA 3MWJA 4MYCA 4TQ9A 4ZPXA 2JJ1D 4XD7D 3KDSE 2VLIA 1KMQA 3KKPA 3SJCA 5KPJA 2ZJ5A 1EXMA 3EAQA 1QHIA 1E2DA 1NRJB 4FWIB 4HDOB 4JL6A 4TMTA 4M9QA 5AUOB 4JT2A 4QOSA 1DBSA 1VTKA 5KDDA 1NIJA 2XNDD 4GI7A 1VPLA 2CL7X 2N1BA 1TNDA 3NHBA 4ZCIA 2EWVA 1D2MA 4B73A 3I5XA 1UPTA 2H18A 2AKYA 5FOUA 1NI3A 1W0JA 1Z83A 3TUJC 4D4JA 3UMFA 1FL9A 2V7QA 2QAGA 4OL0A 3SJAA 2B8TA 3I5YA 2W6ID 1AS3A 1NP6A 2H5EA 3VX3A 2DR3A 5SZKB 2Z4SA 2ZREA 4OK3A 4QBHA 2N46A 4YMTA 4S35A 1ZBDA 5SZJA 2ZEJA 2HYIC 2QSYA 1CR4A 2RGEA 5JMTA 4Q02A 2P5SA 2WAYA 4NYIR 3KQLA 2ZRGA 1XMJA 1DOAA 1KHTA 1KSHA 1NY6A 4CF7A 2CHVA 3EX7C 1DE0A 1XJ0A 4DLYA 1H8ED 4GMXA 4ZKEA 2QBYB 3NC0C 4HATA 1XXHE 1OIVA 3FYHA 2F1HA 1R5BA 3C16C 4M4SA 2GF9A 3LLMA 4EJSA 3GEIA 2A78A 2WMOB 1G4UR 2BMFA 3JZMA 4OKSA 2ZU0C 1UKVY 4CRWB 4TYWA 3DOEA 2O8DA 4BFYA 3GLFA 3WRXC 5KNDA 1TTTA 5CM9C 4PC7A 4PHHA 4WXPA 3C14C 1UEIA 2GZHA 4EIWA 1E1RA 2MSEB 4ESHA 2NO9A 3BBPA 1TU3A 4S2EA 1KI3A 1CTQA 3TRFA 3EIQA 2XSZD 3NG1A 3F8TA 3N2IA 4LI0A 4LHZA 2QI9C 1JJVA 3ND8A 3BK7A 1E4VA 3VU9B 1W47A 3ZGXA 4HLCA 3B1YA 4AIIA 4R2HA 4DXAA 2XZLA 2XB2A 1W36D 2OT3B 1J7KA 2D7DA 1QF9A 1DAFA 1E9DA 1OFIA 4QJ5A 4OQFA 4BEBA 2ZSBA 3E5HA 3QXSA 2BWJA 2ZE5A 1Q0UA 5DI3A 4MRRA 3P4YA 2WM9B 4Q47A 5EP1A 3LLUA 1WBDA 1Z6GA 3V4FA 3ICEA 1Z8FA 4A8JA 3SQXA 2QMEA 4Q1DA 2ZJOA 2OHFA 4A2QA 2O8DB 4NCIA 2WKRA 3NWJA 1E69A 1BS1A 3QEOA 1EGAA 2F7SA 4DLTA 5BN3A 2R6CA 2G88A 4AURA 2VP4A 2JLWA 1COWD 3U7FB 4JLMA 1ZM9A 4NZYA 3QG1A 4Q7KA 1VCNA 4QNRA 5G41A 3OZXA 2WJIA 2CEAA 4ZI3A 1Z3IX 4BFUA 4XSHA 1UFQA 3PFIA 1XTIA 4M1YA 5HZKA 1GDDA 4DT1A 2V3CC 1XCPA 1F2UA 1H65A 3GJXC 1GAJA 1HT2E 4GMDA 1KK2A 2ZE6A 1OYWA 1PUJA 2EYUA 1FOEB 3VHLB 2CBZA 3KTAA 3QBVA 2D2EA 1YU9A 3MCAA 2FV8A 4Q1FA 2WVJA 2B21A 5KSYA 4ZCMA 4NYIQ 3TSWA 3DMNA 3I3SR 1Q21A 3S1AA 3GJ7A 2IYRA 2Z43A 1W2GA 1CIPA 2FU5C 3I73A 4C9BA 3TJZA 4UNPA 2ZI6A 4R9UC 4DSNA 2FFBA 3PUYA 2F9LA 4JLKA 2VBCA 4JT4A 1KDRA 1GWNA 1G16A 3AH8A 1GVNB 4HZUA 2XNSA 1E2JA 4PHFA 2C77A 1PUIA 4PXAA 2F43A 4LBYA 1GKUB 2F3RA 4F92B 1ZRHA 1QBKC 2OSBA 3KQHA 2NQ2C 1E32A 4JLNA 4M9XA 3GLIA 4MDEA 3O8DA 1J70A 1JAIA 5JS7A 2Q0HA 3DPUA 4UKDA 3RAPR 1P9NA 1N6NA 3H4MA 1F2UB 2V6IA 3K9LA 3K70D 4GNKA 4HAXA 2OV2A 1I4DD 4W5WA 3ASZA 4NCJA 3U4QA 3FFBA 2PT7A 3QF7A 5LD2B 3QPUA 1U81A 2BEKA 2P65A 1IHUA 2ZAOA 4IOMA 2BV3A 2R6DA 3REFA 4FN5A 5JZVA 3U5ZB 5CDFA 3AVYA 1RRPA 4CEJB 1HA3A 1KO5A 5KSOA 2WKQA 1KDPA 1N0WA 1N3BA 3GLGB 3DKVA 1AKEA 1RKBA 1II9A 2Q9BA 5DO9A 1Q1BA 3SFVA 3JZAA 3RS3A 3UG7A 5D3MB 4HZUB 5C46F 1P61B 1FP6A 3WNDA 3P4XA 1CJKC 1KI1A 1GUAA 1NMXA 3EG5A 2O52A 3O47A 2F43B 4TTQA 3T06B 3B8HA 3LO5A 3W8RA 2LCFA 2REOA 4TQAA 3MG9A 2P6RA 1MRNA 1S9DA 2FWRA 4NMMA 5JWOA 2D74A 4MYTA 4TSFA 2CE7A 1O87A 1KSFX 5GADl 1R8QA 4KBFA 2HCBA 1WDTA 3FPAA 2EW1A 2BBOA 2OFOA 4HI0E 4IW3B 1ZM7A 3CONA 5TXGA 4US1R 5FPKA 1XP8A 5FUXA 4D6PA 1N5KA 1RW4A 3PJRA 3TW8B 2CK3D 4TMXA 3GCGA 5F9FA 4Q48A 1P9WA 1YR6A 1ZNZA 4RCZA 4Q4LA 1ZAKA 5EE3A 1OXTA 3B5JA 2WOJA 3H84A 2OO7A 3IO5A 1FTNA 1OHHD 3A1WA 1NVUQ 621PA 3QI2A 4M1TA 5K8UA 3SHFA 4JLAA 2J7PA 3SN6A 3SI7A 2VP5A 1DAKA 5FOXA 2ZI5A 3G5UA 1FNMA 2RGNA 3AGQA 1ZM2A 1D9XA 2RGDA 4F91B 1E1QD 4V0KA 3THOA 1FQJA 4NKRA 2N42A 3GD7A 4QBGB 2PJRA 4PZYA 4TQUS 3R9WA 2BKUA 4ITRC 5EZ6B 3K9GA 4P4UA 4Q4HB 1ZCAA 2BM0A 4D0NA 1NNEA 2CL0X 4PAMA 1Z6XA 1B23P 4DJTA 2X19A 2G6BA 1TEVA 3ICQB 1UKEA 2C8VA 5FTNA 4U7DA 3WY9A 4YONB 3H2YA 2GCNA 4E03A 1E2HA 5JSZA 4OYHA 1VYTA 4MRNA 2FSGA 3SZRA 4N0EA 2EFGA 4KLNA 4RCYA 2ZYTX 2IYWA 2ORIA 2CJWA 1XXHB 3Q5EA 1EWRA 2OBNA 2P3SA 4PO9A 2R6AA 2BCGY 1NBMD 4L8GA 1SVLA 4ON9A 1YR8A 3T1QA 2A30A 3E2IA 3I1FA 3B1XA 2J45A 3CH4B 4HUQB 3R9IA 2MMGA 1L2TA 1P2TA 1RYHA 4B75A 3BB3A 3KB2A 4LBZA 5LB4A 2BM1A 1XD2A 4B3GA 1JBKA 1KKMA 4FIDA 4PQRA 2IWHA 2C04A 2ZM5A 1CS4C 4L5BA 2NTYC 2ZS7A 5LD2C 2C2HA 1MKYA 2J0UA 2NZ8A 2ZRNA 4OQNA 1SULA 1OXSC 3QUSA 5FR1A 5FBLB 1ZVQA 1X6VA 1YZUA 5A5GA 1VIYA 2YOGA 3CNOA 1ESNA 3ZDQA 4JIMA 5FFMA 3CWQA 1IXSB 4YQFA 1E0SA 4D25A 5FL7A 1DVRA 2IHBA 3DDCA 3J81k
chains in the Genus database with same CATH superfamily
4HX9A 3U1TA 3I32A 5HVNA 1SRQA 4QE3A 1KEKA 2QJTA 2XOKD 4LUCA 2GDJA 4UNNA 4K87A 4RGBA 3IUNA 1SKQA 4OB6A 2I4RA 4V03A 3EWNA 3SS7X 3FOFC 2G9VA 3BFKA 4QOFA 1OFVA 3FFTA 1PT9A 2PMFA 4DCSA 1VHDA 3UKDA 2LNDA 1XZHA 2O8BA 3FR8A 4PR0A 2JRLA 3CKYA 2GAAA 4I4NA 2EBWA 1SUEA 2IX9A 3VO2A 3BFPA 1Z08A 1RKUA 2PHZA 3GXOA 1FUIA 2Y0DA 3M81A 5C7LO 1QTRA 1PT8A 2VXBA 3DBLB 5TPWA 4XTCS 4FFDA 4ZN6A 1FFAA 1O94D 3D31A 4MPJA 4J2OA 2J0UB 3MF4A 1AU9A 5H0IA 2IJGX 1C9YA 2QUBA 2Q6LA 4HZGA 4TYQA 3BDIA 4G5RA 1T36B 1DG1G 4ZDWA 4AJNA 2A5FA 4AJIA 3G1WA 1N2IA 2VAWA 5B1HA 5EJ4A 4FS3A 4IDQA 1HL3A 1OXKB 3HYTA 1J0BA 2HADA 1V11A 1ECCA 2IDZA 3ZQJA 1JSZA 1WXFA 4B3HA 3SE7A 1I1HA 3PWZA 2VNKA 4ZT2A 1LTQA 2JHFA 4I14A 4U00A 5HBRA 5L53A 2JB9A 3CR8A 1U4OA 1AS0A 1XZLA 4ZQGA 5JD3A 1YR1A 4L02A 4L2IB 5DNAA 2QP9X 3L0BA 5IKMA 1TF7A 4EI7A 3IDAA 3AU8A 5G0SA 3GJ5A 2H1IA 1Q22A 3Q6IA 2RMKA 4BECA 1W25A 1G8HA 3IMKA 4HNAA 1H2FA 3OZCA 5BV7A 2VSNA 3EODA 1QVZA 4OHVA 4JXXA 3FLBA 5JWRA 4IQGA 3B6JA 3QX7A 4HT3B 3R6GA 2X9NA 5KB3A 4J9VA 4J7CA 4Z7QB 4XIYA 1RAHA 4UNQA 4B35A 4MUXA 4L72A 4BNJA 4Z5XA 5KO2A 4M1SA 4ZOAA 1Y8CA 4R31A 1DQZA 1QTNA 2WMNB 3AMVA 3V2IA 3SIPA 3ZOKA 1GPLA 4JUIA 4K9KA 3MJCA 3RFCA 4BTVA 4LRWA 3QLJA 4LJ5A 3EXEA 4ASUD 2XZPA 4HAWA 2W00A 3EIOA 3O5AA 4O4IF 4BLSA 5F5NA 5JT1A 4OYYA 5CLGA 4GD3Q 3QEJA 2VK1A 4DQUA 5LQCA 4CEIA 1CEEA 5FUWA 5BSRA 1C30A 1XB2A 4LWOA 1NBEA 1YI0A 3HU3A 3QZUA 3A1SA 3HUEA 4IFIA 2PFSA 4NEGA 4MDFA 1TZMA 5FUBA 5DYIA 2VJNA 1TU0A 3V8VA 1E0DA 4FCWA 4TZ6A 4IMRA 5IABA 4H3HB 2ZT6A 4J0IA 5JECA 1L3IA 4ZK2A 3LRXA 4KVFA 5AVOA 4BASA 5K2OA 4DLUA 4ACBA 4EOGA 5CEJA 1OBCA 2D8MA 2DJ5A 5I9MA 2CYCA 1A98A 5EYPB 1RYFA 4DDKA 4B33A 1TCBA 2NTNA 3BGVA 3H0EA 1VJ1A 2RHGB 2P68A 3OZFA 4IVQA 3SJZA 1XO1A 2X41A 1C0PA 1BKYA 3EZ2A 1ZMTA 1EXNA 3VI4B 3DWFA 3SLKA 3F4LA 3GJYA 3QE0A 4GICA 4DSZA 1G2IA 2O0KA 1Y6ZA 1KEZA 4RF4A 1HGXA 1IONA 1T1GA 2C8JA 1ULHA 2NUPB 4DIKA 1VKZA 5KX5B 5BP7A 2RAFA 2HMSA 3I01M 2HH9A 2W6ZA 1QG4A 4DHEA 3GP3A 3DHWC 3BRCA 3O8OA 4QQNA 2VTBB 1Y6JA 3A27A 2JAOA 1G19A 1TZKA 1JAYA 4IRMA 4LDJA 2ERCA 5JH7F 2NUBA 1Y4DE 3TTVA 2EATA 1TECE 2RGAA 2ZRIA 4KVZA 4C7KA 2VBFA 3IXMA 4OBEA 4ZCPA 1CUYA 3RR2A 3KWFA 1RQNA 2C1ZA 4KAJA 1PT5A 2GBLC 3DMPA 3NTXA 1R9JA 3ABSB 2YJ3A 1BAPA 2FG6C 3C3DA 3G6KA 3MYYA 4QUBA 1KO8A 4F3NA 3QUTA 4HRVA 1EK2A 1NJ1A 1BGWA 4LV5B 2XGSA 5AVYA 5IJ9B 2KM1A 1YZ3A 3IBGA 5L9AA 1MQ8B 2H5IA 4TL9A 2HW8A 1A50B 2FRDC 3DTNA 4IQ8A 4XR9A 3QLEA 2ZB7A 4JLJA 4JYMA 2EF0A 3FKQA 2FJUA 2FQ1A 4P2GA 4YMSA 4B3RB 4B17A 3N2ZB 1L7OA 1AN0A 3FHCB 1J5XA 2FPLA 3KOWA 5C7YA 1ICIA 3E9NA 3B3JA 2WJHA 1A27A 2C29D 3SC3A 2TSYB 2G76A 2W2XA 4MJXA 2XVZA 4UUOA 4WIAA 3IEVA 2SKCA 3SQWA 4N1AA 3NC1C 4A91A 1E1CB 4YLGA 1IVSA 3NEYA 3QFFA 2WUGA 1NT4A 2SNIE 1HLFA 1TK3A 4C4PA 3GROA 2DPHA 5D3QA 1NVXQ 3NBXX 2ZBRA 3H5VA 4KXYA 4MP3A 1ZN7A 1L7QA 5EJIA 3ZCUA 1AK9A 4CMBA 4JP2A 4ED9A 1YC5A 4DZZA 2R5NA 4QDUA 4YR7A 4LNHA 1M5TA 3OLYA 5BN5A 2EFDB 1XA4A 2AFHA 4K0RA 3LQRA 5CYFA 2PX8A 4AICA 1ATZA 1P75A 3HL0A 5BWLA 2ZAMA 3BA6A 1O95D 4LDAA 4PPYA 1PG2A 3VUEA 4DSUA 4H08A 1V4VA 1XQ9A 4JC0A 3RNLA 4NHOA 2X2FA 1QP0A 4CMIA 3R1IA 3KIPA 3T0IA 3EXHA 2ZYIA 4U7WA 3D6TB 3IPLA 3P32A 4KGZA 3U1VA 1FA9A 4XLLA 3HVIA 3KHUA 4TLAA 4A8TA 4PYIA 4EJ6A 4F3CA 3M1LA 4B2LA 2Y67A 3FSRA 5EJEA 1EE9A 1AUQA 4IHJF 3A14A 2BSQA 1NSYA 1QHGA 1VLJA 2XDWA 3PNPA 2WYHA 1XZCA 2J4CA 5E3HA 3WAKA 4DA6A 4OGKA 4WOBA 1PR4A 3DV0A 5HKBA 5K0TA 3O8NA 4FFMA 3DMYA 1RZRD 1QDLB 3H6HA 1SH7A 5J5CA 2C59A 4IKOA 3U60B 1K8XB 4EG1A 3QVMA 1ZIPA 4P83A 4BE7B 1QTQA 4TL8A 1NKVA 2H1LA 3WYEA 2WKPA 4K81B 5HIMA 2QAIA 3QSYA 4RTLA 4OD0A 5L6LB 4UMDA 1GCOA 5COQA 3E3MA 1C4WA 2PT5A 1BCRB 3FROA 4RMJA 1U3DA 4P7KA 1F3LA 1XZJA 4DNQA 1W75A 2YN0A 3LGAA 2XCRB 2O8VA 1CY1A 3L46A 4DYHA 4MMXB 4B82A 2Q4TA 4MA4A 3BFXA 2I4TA 2X3FA 4MW4A 1KOLA 1DMSA 3PRJA 4OHPA 2GCIA 3VDQA 4D9HA 3RH0A 4E2FA 3HUUA 3TGPA 4R8RA 4UASA 1E1MA 2HWXA 2MR5A 1R0WA 4JUDX 3RKRA 3LXUX 1EM8B 5EZSA 4TMVA 2V54A 3IEPA 3OO0A 2PA0A 3GIDA 4GWLA 1QLJA 2EKPA 1ACMA 1FMLA 1GY8A 1CUSA 2IYXA 2IIVA 4X1YB 5H3CA 2A5DA 4Y1GA 3OMWA 1CS0B 5JDCA 2OEPA 3ETLA 4NMHA 4IJVA 3R2JA 3G5TA 3UHPA 4CI0B 1X1SA 4MVJP 1P29A 4NNOA 2WY2D 3W5VA 3E8XA 2FSVA 5JXWA 2VJKA 5J2UF 3C39A 4YRIA 3QVVA 1FU8A 3PEYA 2RH5A 4R1QA 3QFRA 1A9YA 1R5OA 2CWDA 4K5QA 3W5JA 1CCWA 4H6VA 1IY9A 4KAAA 1IUPA 2RGUA 3U7EB 4C88A 4EHHA 4QAJA 4WEQA 1L8OA 1I4TD 2VP6A 2HF7A 5F4BA 1TADA 4C87A 3UXEA 1GCAA 4GM1A 3VNSA 4BP1A 3PUZA 3O90A 4Y1EA 4R6XA 4GXNA 3RU7A 5J4KA 2B94A 1JQJC 1WPQA 1ZDMA 1F06A 3QYJA 5GVRA 2TMYA 4F4CA 4MGZR 2FZ5A 2JBAB 2QS9A 4HDKA 1PZXA 3HRIA 2OXTA 4BNZA 2YR0A 2IY9A 1TLLA 2Y92A 3L8FA 1D2GA 3QENA 2AJLI 4PW0A 1NG1A 1HNXB 4GOKA 1CR0A 3LGSA 3C70A 1NC1A 1Q12A 3HKDB 3NHUA 3FNHA 3RS0A 1ZEMA 2AX4A 4NK5A 2JK0A 4LVNA 1PZNA 1WSWA 5AKYA 1OZAA 3IAS6 2ZUTA 3H86A 1Q0SA 3CS3A 3KKNA 3DHNA 3N0TA 2PCLA 3NRCA 4Q3KA 3UGTA 3ZV3A 3B6KA 4AKEA 5JFTA 4CXMA 3JD4A 4KWEA 5E1BA 1V6CA 2FDXA 4AO6A 3F98A 1GQRA 2V9PA 4JKIA 4EM6A 1RHKA 2P5UA 3FE2A 4KKVA 4J49A 5DTMA 4ZYTA 4AP6A 4JGGA 2GGSA 3HR8A 2JGRA 3OLVA 5AXAA 3S4YA 2E4WA 3C1TA 2HPHA 3LQKA 4PTLA 1ZWKA 4ZGGA 3QJ5A 2Z8XA 4GOJA 5EWLB 4EMBA 5IVKA 4YAWA 2R87A 1DBVO 1ABEA 4RD2A 1Y89A 2NG1A 1ZUIA 2OV4A 4RM2A 1XNGA 4N76A 2J7KA 1CQIA 3W5HA 3MPOA 2VA9A 4ADSG 2RIPA 4F04A 3VU9A 1P4GA 4JU8A 4I66A 1JU3A 6LDHA 4EY4A 2XZOA 3UB4A 3AUKA 2QT1A 1D5WA 4ISBA 5HMLA 3NAQA 4OJKA 5LOVF 1WCYA 1XRJA 3CZPA 1G8FA 1C0KA 2EX0A 3U56A 4KNYA 3HJGA 5CA0A 2GAIA 1PS0A 1T6ZA 1A7KA 3HDHA 3EWSA 5I5GA 1CUFA 1V25A 2TYSB 4NY1A 4FZ5A 4RWZA 2XMSA 1KIAA 3ND5A 1QZTA 3QEKA 4CIWA 5HW0A 3OQBA 5KAMA 3ZPXA 1R66A 1W0JD 3KSBC 4OHKA 4ZO6A 2AOUA 3HZRA 5AHKA 3UATA 3WKBA 4DUPA 1OWPA 1JKFA 3NJRA 1N8NA 2WJGA 1B0PA 1ZL0A 5COBA 3PITA 5JSFA 3OMLA 5E6RA 3AEQA 3FYSA 4YRQA 2X4GA 5JPIA 3AEKA 1F38A 4LAFA 4Q3BA 1IUOA 4DLAA 1I80A 3G2JA 4LRYA 1FDVA 1X0XA 5J2TF 3SK0A 1VKJA 3AM5A 3K0BA 3I0ZA 5KWSA 1QVAA 2AW5A 4BNWA 4CM8A 4TXNA 4C7JA 1WBBA 1C1XB 5FPYA 1VL5A 5IXSA 2QORA 4YGYA 2IE0A 2P11A 3K1ZA 1IOWA 4EPTA 2H2AA 2OUIA 4ES6A 3A3KA 1NBWB 3IBFA 3MBIA 2Z0MA 4QQ8A 4HCJA 3PQCA 1G6Q1 2BHTA 4RY0A 1EJ2A 4W5JA 4X3OA 4ZOEA 5E6SA 5EG5A 4OIMA 3SSOA 1U0GA 4G8BA 1GL6A 2QRVB 3GT4A 1KDOA 2F17A 1BC5A 4RIIA 2FFJA 5A2QA 1VSUA 1M10A 2WUWE 1RTKA 5B6JA 3QUAA 4Q1EA 1QGUB 1FU4A 4DBVO 2YVLA 4JIGA 2F4NA 3WRWA 3L18A 5EHQA 3GOQA 4QRHA 3RJ9A 3WIUA 1A2KC 5JU6A 1JZQA 2WJZB 5DTQA 4Y67A 2C2ZA 5CYGA 3WHIA 3AR7A 3UV6A 4V39A 2ACEA 5BMVB 4HVLA 1KVQA 5DNDA 3VA7A 1ZUNB 2ODWA 2QYOA 3KDPA 1CQJB 4WZ6A 5F21A 1IBRA 4M0DA 5U4QA 3IR6A 1WY5A 3PC2A 3UOAB 4RU1A 2VATA 1KZ4A 3D54D 3OWHA 3B85A 3LGXA 5KYXB 4OGWA 5EWMB 4EUHA 3OIYA 4JJ7A 3TDKA 2P3QA 4AQ7A 2BKVA 4R1TA 2PL9A 4DNOA 4CGZA 1DAMA 3S2YA 2O7QA 2WD7A 3TNLA 3C5WP 1L5QA 2AOWA 4MRMB 5I51A 4LBWA 3HCAA 2QX7A 4QTXA 3LSYA 5KHLB 2FSVC 3ELYA 1LRKA 1AO3A 3B89A 5SY6A 3MTEA 4FR2A 2H4HA 4MQ5A 2WIJA 2NOAA 4Z4EA 5A6VA 4AX4A 1R88A 4FQ5A 2WJJA 3AUXA 5LBUA 2G83A 3EHEA 4NCXA 4X3CA 5K45A 3VR6A 5HM6A 1ISFA 3CVUA 1M2OB 3QIVA 1QR6A 1OROA 2QTHA 2HSGA 4Q34A 3P9NA 3HB4X 1WPGA 1ZISA 4CTMA 5ICEA 1QMPA 1OKKA 4WAUA 5D3MA 5DW0A 1U8AA 4L4XA 3U6BA 3SX4A 4ODIA 1AUPA 4WZAB 3BSSA 3P2KA 4LZNA 4E30A 1LS6A 1RAAA 3DE7X 3QVSA 3RUCA 2P67A 1DRKA 1EE2A 3FRHA 3T1OA 3VYSB 3NVDA 1KAHA 2HU2A 1Y34E 2DG2A 2QTCA 1XJ5A 2WZQA 3JU3A 4DA7A 4EPYA 3B9BA 3IYLW 3PT9A 2C3UA 3AO0B 2PIDA 3L5OA 5L51A 1QFYA 4W5OA 4QHSA 3PQ4A 4MAAA 3GN1A 3QMVA 5JNUA 1QKKA 1GHTA 2EYQA 2Q5CA 3RRYA 1GQSA 3ETCA 3PJDA 3HKCA 4RK4A 2PE5A 2RJNA 2HFJA 4MW2A 4WPGA 4BNFA 4CLRA 3P2JA 4IDAA 3RC2A 1ZOPA 2WINI 3DVSX 4MIOA 4D41A 5LA6B 1UWLA 1Z6AA 3SICE 3ZY3A 3SFZA 4HUTA 3K6RA 4W5QA 4FNMA 3TECE 1XZGA 4BMDA 5U9CA 1VZ3A 3FPFA 3IUPA 3BHNA 4RD3A 5HZGA 5ECWA 3RD5A 3AY0A 3KFVA 1H9AA 1RBQA 4OAQA 5BN4A 1XVIA 1FYWA 1IPEA 1N5IA 2KS6A 2IWRA 3GVCA 4N41A 1C3JA 3MINA 5GQSA 1H2RS 4QPPA 4EHFA 3HXQA 1TPYA 2BMEA 2PUWA 5PNTA 2DUNA 5TARA 3JALA 3PYMA 4DFDA 5M7EA 3BAZA 5IKXA 1R6DA 1T4BA 5KVSA 1LZLA 1QANA 3RSQA 1J2TA 1LZKA 1V7QA 3K1YA 1FUEA 1FFBA 3BQMB 3MGKA 3ETEA 3M7IA 3TAHA 4BQEA 1YO6A 2W2TA 3BWCA 1E7RA 5CW2A 5DASA 3NBUA 2PRKA 3F47A 3HCCA 1BXZA 1QH0A 4K88A 5G0TA 4EYKA 5JZBA 3PPWA 1HTBA 2YZGA 4F1KA 4OQDA 5E7MA 2FZCA 3M5CA 3QF4B 4NBNA 4Q4HA 3NJ8A 2R8BA 5HBGA 1ZIDA 1ZXXA 1V6SA 1JMYA 2C03A 2X0KA 4P4TA 5HFJA 4G24A 3UUEA 4Z2AA 4LFAB 4RIGA 2DECA 1H0SA 1IVNA 5AOVA 4B3BA 3SEZA 4HGOA 5AKZA 1Z38A 5H82A 2Q9CA 2PQMA 2HEIA 1JLRA 4MH0R 4URZR 1YSCA 1V9LA 1D1SA 2CVQA 4LX0A 5CG2A 4LJ6A 2ZIWB 2ZS8A 4IILA 1U9IC 3RS9A 3FMVA 5AW6A 5DM1A 4A1OA 2GHQA 1Y3IA 3D6AA 3TQSA 1C14A 3AIMA 1M6WA 2EF1A 1QPGA 1T2UA 1XU4A 2Q2VA 3L6DA 1HTWA 1MIOA 3KPYA 2R0QC 3LW7A 4YUZA 5E4JA 1TF5A 2RHRA 3K6JA 3EZ7A 2BDEA 3LT4A 3O8LA 4TV9A 1V6AA 1VLHA 1B8VA 2IXBA 1BQ4A 1JX6A 4BVFA 4Z3DA 3K5PA 3KSDO 4KB5A 3PUXA 5SICE 3S2ZA 2JI6A 1G8PA 1M8FA 4LXQA 4C30A 3NMUF 4R98A 4JUBA 3STYA 1T2NA 3H05A 2BJHA 3ROKA 1CPYA 4DR6B 1OXXK 4WLOA 2IYFA 3HDYA 2M2IA 1ORVA 4ZIRB 1XEXB 2E4UA 3DEIA 1TYEB 5DCYA 1KMHB 2ERYA 2HSJA 4QNNA 1DDOA 3DEKA 5FHRA 3ER8A 1DAIA 2IF0A 5G40A 3UGQA 1CUEA 2Q2WA 3CLSD 4YRFA 5ITZB 4MR8A 3OIFA 1KAQA 3FXAA 1HETA 4OJNA 3PE4A 5A5EA 1KY4A 1PL7A 4PQFA 1E4OA 2BBWA 5CLLA 1OAOC 2NT4A 1VSVA 4XYMA 4JNKA 2I3AA 4QXOA 1N0HA 1EFVB 4D02A 4UAGA 2VZ8A 4DUYB 4U6NA 4O8ZA 3ND9A 5ES3A 1EWYA 2HFKA 1VQ1A 2LP4Y 3HVHA 4FN4A 5JSYA 5AJWA 1WSAA 2ZYSA 4D46A 4EEKA 1NYRA 1NXPA 2QZSA 4RTPA 3L0SA 1L1RA 5CFPA 4ZVMA 5I4CA 2H31A 3HLYA 4I36A 1Q74A 2ZUVA 3M4JA 4LJAA 2YFHA 1WMSA 3DDHA 5DNWA 4I46A 3KC2A 3DAOA 1TL7C 5LR6A 3SPXA 1KQGA 3ABRB 2JANA 4JK3A 1IG0A 4KIFA 3RABA 5LNK1 4MWEA 2OFPA 1V8FA 5EPUA 3KZOA 4BNMA 1DUSA 2NGRA 3AJ9A 3UKOA 3NTQA 4HAOA 5AKGA 3H8WA 4GWGA 4Y98A 1NBAA 2A5YB 4OF4A 1O03A 3MRXA 1F4VA 4P98A 3MLAA 1P81A 4YWHA 1DV1A 3WTCA 3G9ZA 1LX6A 4HB2A 2H1CA 2R7NA 1E62A 5DRTA 5LVAA 1QPBA 3BHJA 4C5BA 4HZIA 5CP8A 4MUBA 1XZIA 4PX5A 1WTAA 3HJNA 1OI3A 4K9MA 4WZBA 4TZ0A 2OD7A 2MSCB 4IJKA 5D1NA 3G3EA 2V7UA 3FSGA 1B16A 4I5IA 4G0VA 5EIEA 3O84A 1L5LA 5KKAA 5TPZA 2ZWIA 2HB6A 2QRPA 4KUEA 2YY7A 4QPJC 2V7VA 4AG5A 4OVKA 2CNWD 1IXKA 5TMEA 3UJ7A 3HV0A 5D01A 4Q9IA 4G4GA 6GPBA 2ZBQA 3DLAA 3DBIA 4GYKA 2OECA 4BVKA 3PDCA 4LZOA 2FMHA 5ALFA 5I9TA 1OT5A 1X1BA 3P0FA 5DPMA 5LXTF 5BUSA 4CQMA 1RCUA 3GMSA 1XRQA 4CF5A 3EGEA 1INLA 3KQTA 3DMHA 3HCFA 1J1ZA 2C4UA 2P9FA 3ZY5A 3VZRA 5K3FB 5BY2A 1UBOS 1HRDA 1ORRA 4UMEA 3SIWA 2ZJZA 4E13A 3R0XA 3OURA 3PR3A 4G1VA 3R7DA 2H0QA 3VNVA 2R47A 2GXUA 1PSWA 2QRNA 3W77A 1C9DB 1HV8A 5ALEA 4MQ6A 2V1UA 1VL1A 3O92A 5GM2A 3LBIA 2JLUA 2COKA 4MP8A 1QQBA 3EBLA 3L9XA 5LQRA 3DH0A 1IHXA 2ZE8A 2B5WA 3HGTA 5L8VA 5H1YA 3VNUA 5MGBA 2YYYA 1V9SA 5DWDA 2WF6A 2QQFA 3E7WA 3ZU6A 5C3UA 3LU1A 5BT8A 4EAQA 3KZXA 4KE9A 3RT7A 4G37A 5D00A 2GSDA 3C5VA 5CD1A 3NU1A 2I67A 5K99A 2ZAYA 3T6KA 4IDPA 3QUQA 2GTPA 4JJEA 2G40A 3LK7A 1GQOA 2QX6A 2DBQA 1UOOA 4QUHA 1FFEA 3T12A 4TTVA 4KSBA 3RYCB 1R2QA 4PZZA 3PRYA 4J90A 4AKTA 3PBKA 3RT9A 1XZDA 5H83A 1IZYA 2HU8A 1VBFA 4AQDA 4ALJA 1T3SA 1FIUA 3IMEA 1Y3BE 3E7PA 1SBYA 4EH1A 1APBA 3MCZA 1Y8RA 5FH9A 5I01A 1H2HA 2WICA 4YMWA 1TVMA 5HEKA 2X0EA 1NP7A 1FYDA 4DAEA 2O0JA 3R74A 4MULA 4QO8A 1ZOIA 2PR7A 1JPJA 1Z8DA 5AUQA 1EDEA 3GF4A 5EGNA 4OQZA 5ENDA 4P08A 4BS9A 4D8YA 4W5NA 3BZWA 1RJ9B 4UEJA 2GXAA 2XECA 4OXQA 4RMGA 5AESA 2R00A 3HR7A 4IVRA 1TI7A 1QHXA 2BFEB 1I1QB 4EX7A 3MOSA 4JYCA 1ZGAA 3G2MA 5HYVA 1USVA 2GPTA 3EVAA 1OLOA 2B4AA 2I6QA 4L8LA 3WO1A 1BFDA 1QUFA 1PFYA 3FFAA 1AT1A 3GG9A 3FTQA 4BIMA 3JAWA 1HEIA 3L7OA 4TYNA 1GNTA 3KT3A 1UP7A 5HP4A 4JR1A 4BAGA 4JEMA 3BDAA 2D8AA 4NBUA 3U4HA 5C32A 3M5DA 4AP9A 4F3TA 1AGXA 1JE1A 3M3HA 2OYCA 3TW4A 1F9EA 4S04A 4XUEA 1UFKA 5HJ5A 3D43A 1IK4A 1JQ3A 2NUTB 3A1DA 3L8DA 4RA6A 1I2DA 3WLAA 3MEQA 1N92A 1OFTA 2Y2UA 2OAQ1 3KJEA 3R0ZA 3T5BA 3U3DA 1DARA 2NXEA 5CLQA 4K2AA 3DOIA 2REBA 5AXCA 1U7DA 1YI8A 3PHGA 4J7AA 4XDZA 4B3SB 2NXWA 4RHCA 5ALJA 4AF6A 2X42A 2Z58A 2G8LA 2ZIEA 2QV7A 3FM9A 4OCZA 5E95A 3SYRA 3ZU3A 4GPZA 1F6DA 1UWKA 4WLNA 5HCNA 3OTIA 4AZ0A 5DHSA 5FYDA 3OOYA 5JYEA 2ZTMA 2J9GA 4WY5A 3ADKA 2ZJ2A 2C5AA 2Q27A 2WV7A 2C5BA 3DGFC 4IIFA 3OPMA 4PZ9A 4E1VA 2HR1A 3O3NB 4X6YA 1GUYA 4F4UA 5JEDA 1ZNWA 4RD1A 4KXXA 3TIVA 1WCV1 1BMTA 4KPGA 1ZINA 4JB3A 5A4AA 2C4VA 2BFCB 4KQXA 1JLLA 3FNQA 1G5IA 1JU4A 2IL1A 5IT0A 1YI1A 3DE4X 4MLPA 1FMTA 1FQWA 4QNMA 1Q83A 2C58A 4IZ6A 5ITWA 4ENVA 3COVA 2GRJA 4JMLA 5A7HA 1L5HB 3N05A 1XDDA 2WR8A 1P5FA 3T1VA 3FF1A 4KR9A 4FOTA 2QUAA 5DTRA 3LK6A 1GL9B 3A9TA 3DDNA 3KYIB 5JNRA 1IFXA 1SPBS 3QKSB 4KLZA 4ER7A 5G2OA 1M6NA 3IUJA 5DSXA 3T1NA 1UBTS 1JPVA 1NNUA 3HU1A 2B8WA 3PDIA 4KYVA 3GRZA 3Q3EA 1NQ5A 2ORVA 3ZD7A 3BMXA 1J2YA 1F9AA 1M74A 3D4IA 3C8HA 4WNYA 4ERNA 5A1JA 3OM9A 1T29A 3AESB 4Y9DA 5ERYA 2B20A 2NVBA 5T3UA 2Q7DA 1ANKA 3WXBA 3GPCA 3HCWA 1LVUA 5ALSA 3GLFE 2G0TA 5HRAA 4XB6B 2FNAA 2BLLA 1H0KA 4OYRA 4PIVA 1ZKDA 3TD6A 3SHVA 3FMIA 2ZJ7A 2FPMA 1HY3A 2I78A 4G3XA 1E77A 1WXHA 5I45A 2H65A 1OJLA 1M83A 1CY4A 1OXBB 2NU9B 1UBFA 4PX3A 2K87A 1N36B 5HA5A 4N47A 3LQQA 1DKLA 4LXYA 4OLHA 5IM4A 1SCAA 1S7CA 5EZYB 4K05A 3W3AD 3CA8A 2B4KA 5BR8B 1GSHA 3O9MA 3FWZA 3ILSA 5HK8A 3ZZUA 2QTTA 5BMOA 4HB0A 3WGKA 2A1UB 2PJZA 3PJFA 1TVKB 4C5AA 2L69A 4KKXB 1NV8A 2H92A 4L22A 5AIBA 3C3WA 2IHKA 3H4VA 2FRXA 1Z63A 2BFBA 2QQ5A 3C24A 2ZJBA 1QCDA 4TV8F 1K68A 1FUUA 2M6SA 2YUTA 3CX8A 2O0HA 4XEHA 3OEED 3EBPA 2HA4A 5M04A 3ELBA 4DLSA 4AYWA 1KH3A 2VQFB 2CWWA 3WJAA 4FZVA 1QHHA 2HA3A 4DPKA 4BB9A 3PQEA 2VZ0A 1VP9A 4A1FA 2ZETA 3SC2A 2X0FA 4GE3A 1IM5A 3SHWA 2WWYA 1QK5A 2FP4B 2WF5A 2JKVA 4YRAA 5JD6A 2ZUFA 4LK2A 1C8BA 3GEHA 5LDGA 1GCGA 3PKJA 4BNGA 4E5KA 5IVDA 2CLFB 2BEWB 3WGQA 4DWOA 1O96A 1WA5A 4PF1A 4RSRA 2V6FA 3BF7A 5F51A 1CR1A 3QY0A 4CTNA 4YRSA 2MDTA 2Y27A 1QHNA 3QV1A 5CCEA 3OQMA 4QDJA 5CX1B 2ZS9A 3GLSA 3TIFA 1SG9A 1ODCA 3JYPA 4JLBA 4RIEA 4BKOA 1OTXA 1U3WA 3B13B 4AYTA 4J4HA 1PQ4A 2RHTA 3TOCA 1BEZA 5CT6A 5JFGA 3I5UA 2A0UA 5FQOA 2C92A 1BWSA 2FVXA 4MQUA 1PJAA 1IAQA 4R9RA 3AHGA 1UBEA 1BDJA 4KFSA 1CW2B 5HFNA 2EWMA 1MZPA 2FVYA 3LHDA 4M7RA 3BMOA 5DXFA 4JI5B 4URVR 2PL1A 3TL6A 4G0YA 5IJ0B 1VLMA 2WI8A 1U3UA 2XNDA 4BKQA 4U02A 3JQ8B 4DVGA 2AXPA 5JISA 3VR6H 1UK7A 1V5WA 3GUVA 2WT9A 2JFQA 4GBGA 4P93A 5TLSA 1CJUC 2HSZA 4MV9A 3G8DA 4MUFA 4ZVOA 2GLTA 2IYEA 3CZCA 1JZSA 1MV5A 2FWNA 2GCOA 2X8AA 3GI1A 4HWOA 3U4DA 2NXNA 2Q6IA 2IXFA 3U7IA 4B2PA 1O6BA 3MWDA 3H2KA 3WMEA 3K31A 4GM0A 3FOAA 4DMRA 2Y0PA 2ZYDA 1NDQA 1Z6PA 4IOLA 1WCIA 1UJ2A 4Y1FA 4CF4A 5BSUA 2C5SA 1B2RA 1DTWA 4GLJA 3NAMA 1LBIA 1DO8A 1H1TA 1GZ7A 1H2BA 2ADOA 2YC4C 3DBRA 2K2WA 2V4ZA 4J16A 1SBNE 2ECQA 3FH0A 1TEHA 4TTSA 4PYMA 1N2JA 5B57C 1GAWA 3F7NA 4IXDA 4IDEA 4EGFA 1QM5A 3V2HA 1SA0B 5J4LA 4LYAA 2RONA 4EA7A 3CSSA 3AXTA 1DAGA 1UINA 3IQHX 2SBTA 3IUYA 4DMHA 4J07A 3I6IA 1SXJB 2JH9A 3QE3A 3EZ9A 4FKZA 4JN6B 3ZV5A 3OOHA 1XTBA 3P7MA 3B20A 4DDMA 1BXKA 1VSBA 3KR2A 3ISTA 3EH2A 3ANYB 3UN1A 4BDTA 4BN5A 4G0NA 2A5LA 1N78A 4FHZA 3R3YA 1R4MB 4JVNA 4OREX 5D3KA 1RKXA 2QRQA 4NRDA 2GPAA 4I9FA 5FPQA 1NLFA 3UPDA 5CXUA 4LJ4A 5JH7B 1F7UA 2HJRA 4UATA 4WDQA 3RHZA 3CMMA 3OKCA 4Q03A 2VJAA 5GVSA 1CF4A 3ZYZA 1VJCA 3CRW1 1U3GA 2NP6A 4EJ2A 1PVVA 1YBMA 4FT2A 2XA9A 2I80A 2J67A 2YL2A 3NEPX 4HWSA 2O2XA 4MR9A 4UPVA 5FOVA 2P40A 5C31A 3TLGB 1OAKA 3W2GA 4DQXA 4UTRA 1CY0A 1ILWA 1NULA 4AMVA 1L3CA 4NICA 3SOZA 1CUAA 4HAUA 2JBWA 1JHDA 1H6DA 3ZH2A 5IWAB 5CJPA 1HE1C 3PTZA 3TBFA 1Q1QA 2HKIA 2DBRA 3NWOA 4BQNA 2OZPA 1Y1TA 1T9GR 2O2CA 4MVJG 4YJ3F 1C2TA 1FVXA 1YZQA 1UH5A 2FEPA 2GQ0A 2H9IA 3EXAA 4FHEA 4LTMA 5FUYA 5JNVA 2GN4A 3WK7A 2V5AA 2G67A 2J1LA 3ITNA 1FXWA 1Z5GA 3KAQA 4R1SA 4BRWA 4OKIA 4PG7A 4FILA 3ZDBA 3ZHOA 1YCHA 5FWNA 4NTZA 3PXBA 1XPOA 1NI4A 4DARA 4EG7A 1HZZA 3RHSA 3PA8A 4Q3NA 5KYWB 3D7SA 3K2EA 1Z5WA 3MT9A 4PGFA 5HX7A 2PX4A 1ZD2P 2X2EA 4FMDF 5FADA 3TZKA 1LFAA 1JUDA 1RC1A 4IEEA 2ODNA 1BHQ1 4K7JA 5CITA 1GGNA 1GUDA 1G21A 1ZI9A 3OMXA 1AD2A 3AFMA 4BMYA 4DPMA 4MYHA 5F1YA 5KYTA 1E9EA 1VG8A 4L15A 1KY3A 3EEQA 3RS4A 4KRYA 5ILOA 3HBJA 4YB8A 5FWDA 1NR5A 2CLOB 3FWHA 4Z9FA 1ODLA 2O0LA 4IL5A 3UK6A 2QVCA 4K9PA 3C7TA 4BUJA 2INGX 4IIJF 4DSAA 2GS9A 4MCHA 4PCLA 2FG5A 2H59A 3N86A 4EJFA 1QHEA 1V8BA 2WIAA 1DBPA 4O1MA 4KTVE 8OHMA 4WASA 3RK0A 3TN7A 2PRIA 3NWBA 4N4AA 1HQYE 3WKDA 4HV4A 1SC4A 4EPRA 3QTLA 3F6PA 3SC6A 1GN8A 5B2EA 2XXAA 5DIFA 4FGWA 2GNPA 4IEFB 2PS1A 3MBOA 3T5TA 1UMDB 1NVKA 3I72A 3QW2A 5C1OA 4MW5A 4JL8A 4BFXA 4LMPA 4PPGA 5B1IA 2J9XB 1R37A 2CFIA 3EOBI 2OHGA 2IS4A 1EBFA 5CDSA 1KI8A 4I4TF 1IRIA 4FUQA 3EIFA 3TSAA 4RH1A 1G18A 2O05A 2V8OA 4JXKA 4L5IA 3VO9A 4AF7A 1OVGA 5JNTA 1RIIA 4DUZB 4BO9A 1AKYA 1F0NA 2I29A 1OU0A 3ECCA 4BPRA 1U0JA 2NXJA 4B43A 4PLWA 2ESRA 2V65A 2VF4X 3E53A 1I5EA 4E22A 2ZITA 2PQ0A 4QUAA 3HB7A 4IZHA 4EMUA 1YBHA 4IG4A 5JJ5A 1NN3A 3I83A 4M9SA 2ZIXA 3EEIA 4LWPA 4UARA 5HCIA 4Z3OA 5JQGB 1Z6QA 4JKYA 4MB6A 4Z51A 5F98A 2A2ZA 1H6AA 1HQKA 1ZD9A 4G01B 2DWCA 3ZWBA 3QVGA 1SHUX 1E0AA 4RVCA 4CMHA 4EARA 5IF9A 1EP9A 1O4WA 2G80A 4ND8A 5BVHB 3B9QA 4O2LA 1NQTA 2G04A 3EVTA 3U7GA 2H1OA 2C0PA 2PX0A 1M6EX 1NLMA 2QMUA 3INRA 3IAAA 1NLZA 2QRKA 2FPIB 4JJ6A 2WF9A 1JTFA 4RDXA 2C2XA 1V71A 3GDFA 1E3SA 2JG3A 4KZKA 4J16C 1MH1A 1OILA 5LWHA 2ZR0A 4HDRB 4FR0A 4A15A 2R9VA 4XWTA 1VMIA 2C5LA 2OOSA 1N25A 3FUUA 4EFKA 2YYAA 1KZHA 4B6SA 2XKBA 2FF5A 1KI4A 4ND1A 4FMCB 4PYJA 3E05A 2FEAA 1N5JA 1XQYA 2I91A 3ZBUA 3NATA 1OA0A 4E2XA 1TQ2A 1CZKA 1P5HA 2RI1A 2YJ5A 3K9NA 3VU3A 2F8SA 3QWIA 3FAZA 1U80A 3AVOA 3E3OA 2GEFA 3LQFA 3VAAA 4F86A 1E59A 3DMDA 2VJBA 1X1DA 3ESCA 4C0JA 4EF5A 5I7EA 5KNBH 3C3KA 4ID9A 5EE0A 2QLLA 1Z0JA 3B9PA 1MEJA 1ML4A 4J1SA 4BQIA 5LL6P 2AKAB 2QSZA 2IKSA 2PTGA 3N6RA 3V8BA 4LK3A 5FPSA 1RYMA 5EJAA 3ZZNA 1D8TA 1X7GA 1S3GA 3PNOA 5I9IA 3AQ4A 1TM4E 4CEHA 2ZXEA 1YKFA 2JATA 1TMGE 4KP7A 4F5ZA 3OZBA 4JBGA 2JAQA 4AUNA 3S1AB 4M0EA 1A2BA 1A9ZA 4L3WA 1VJGA 2ADMA 5A02A 3UJNA 3R0IA 1OHHA 3Q9LA 4A2CA 4GBMA 4KIWA 1EJBA 4Q3LA 121PA 3QELA 4K6FA 3JW8A 4Q9NA 3LOQA 3ZXXA 5BWMA 4OX9B 3GNLA 1MABA 3HHEA 3HNPA 4RA9A 4Q9LA 4K1LA 1LBEA 2OC4A 4RF5A 3P9KA 2YXPX 4OQPA 4QBKA 4TTJA 3TZ6A