2ZJOA

Crystal structure of hepatitis c virus ns3 helicase with a novel inhibitor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
444
structure length
444
Chain Sequence
NSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structure-Based Discovery of Triphenylmethane Derivatives as Novel Inhibitors of Hepatitis C Virus Helicase
rcsb
source organism Hepatitis c virus (isolate taiwan)
molecule tags Hydrolase
total genus 142
structure length 444
sequence length 444
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 2zjoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA01
1OW3B 5JI2E 1KI8A 3LH5A 1TUIA 5C2JB 3LLUA 3PJRA 4QOSA 1TMKA 3ZQ6A 1KK2A 3L8ZA 4Q01A 1T4GA 4F92B 2MSEB 4WIAA 5LPNA 2ZIAA 5JEDA 1KZGB 1MT0A 2HCJB 5IDVA 2XZLA 2YWFA 4NCJA 4PSAA 4DVGA 4LPKA 3WNDA 3U4QA 5C4GB 2X77A 5FTJA 2VP5A 1JR3E 1DADA 2QT1A 4BZXA 4DLWA 3BH6A 5JEEA 1RYFA 2XNDA 4IDPA 4C0HA 1W36C 4FCTA 4QM6A 1OHHA 5CK4A 2GJAA 1KSHA 2X19A 2BC9A 4RCZA 2WJIA 3GJ6A 3PCRB 3CBQA 4Q7MB 1YRBA 2WKPA 1JB1A 4XOIA 4LBVA 4BLTA 1NN0A 3H86A 2BEKA 2ZROA 5DN6A 2RGCA 1I4TD 1P9WA 1SXJE 1NIJA 3IHLA 2F1IA 3BIFA 4OKSA 5KDLA 5DGXA 1Q20A 3KZ1E 1L7VC 3THYA 3PR1A 1KO1A 2GCOB 1U81A 2AWOA 3KUCA 3T34A 4PFSA 4P0TA 4CEJA 3PEVA 3QOFA 2WMNB 3CX8A 4RD1A 1R8QA 3GLIB 4G5QA 3PEYA 3PEUA 3KFXA 3M6AA 2QBYA 3A4NA 5FPSA 4R7ZA 1XNJA 4BE7B 4OI1A 3Q9LA 4TWZA 3BORA 2N1BA 2AWNA 4BFUA 2GTPA 4O2RA 1HURA 3I92A 4S2EA 1S9HA 4FXPA 2I4IA 3NDBB 4R98A 2V6IA 3TGPA 1KHTA 4MQBA 4K81B 3VNUA 2DY1A 2AK2A 4P33A 1KSFX 4L16A 2IUSA 3SNHA 3K53A 2JJ1A 2OFXA 5JLJA 2ZUCA 2ORVA 3A6PC 4N0EA 3A1TA 4Q4JA 5KHOC 1E98A 1W4RA 1Z0AA 3UATA 5CITA 1A1VA 3MAAC 3U7FB 3CM0A 1ZU5A 1NVWQ 1XMSA 4JBXA 4OHZA 3IIMA 3B1ZA 1Z3IX 3RS4A 5BQ5A 1JECA 1T0HB 2AKAB 1U94A 5EP3A 4OK5A 4DSTA 2VHUA 5L8VA 1TTTA 3IO5A 4V0OA 1F2TA 4M1SA 1MKYA 1E9SA 1KZ7B 2PL3A 2Z4RA 4ZCIA 2ZRNA 3VR6A 2J9RA 4IXNA 5L3SA 1UBCA 3P4YA 4PHFA 2WWYA 3UMSA 4YMVA 221PA 2VHJA 1CR0A 3B85A 1GKUB 2R65A 2PT7A 1G291 4B6FA 3OESA 1WBDA 1XMJA 2I3BA 2IYVA 1OF1A 2BV3A 3AF4A 1FZQA 1M74A 3FVQA 1AS0A 3GJ7A 4OQNA 1T3SA 5EXSA 3AVPA 2XTNA 3U3KA 3CWZA 2J7KA 1NJFA 3GLFA 1G41A 3KKQA 1E2HA 1XCGB 5J40A 4CEIB 2HJGA 1XZPA 1FNNA 4BZPA 3BGWA 2RGNC 3QKRB 1X3SA 3BB4A 4KVGA 4BWYA 2XX3A 4WAUA 5HZHA 1XTIA 3E1SA 4M1KA 3BE4A 3CPHA 3GJ3A 1N6IA 2UZIR 2RMKA 3OEHA 1CF4A 5H70A 4CYMA 3FKQA 2ZRDA 3K70C 1SHZA 2QRZA 4QHTA 1MABA 2DB3A 4D25A 3UG6A 3I32A 1X86B 1KSGA 2CEAA 3A4MA 2IWRA 3U44B 4TT3A 1GRQA 1LVGA 4IOKA 3FMOB 1PLKA 1XU4A 4G5OA 4DBLC 3LVQE 3QKSA 5FTKA 1QVAA 2AR7A 2DFKB 2OAP1 4LHVA 3NBZC 3WHKA 5GADl 1HQYE 3QPVA 1JBKA 4D26A 4W5WA 1FTNA 5FOSA 3VMFA 1N0UA 2D3WA 2ZJZA 4AYWA 5HCNA 2CMKA 4IVRA 4Q4HA 2FN4A 5GJBA 2FMXA 3HPRA 3W8NA 3LQRA 3WY9A 1DAMA 2XOKA 5KSOA 3GP8A 2WMOB 4MRSA 4IRUB 2J3EA 1UM8A 3HU2A 2R62A 1R0ZA 1W1WA 4IJMA 4LPSA 4E5UA 1RRGA 1VCMA 1BYIA 1GTVA 4QFMA 3BD9A 1G19A 3W3ZB 4TZ6A 1NN5A 2HXYA 3I8SA 5FOWA 3ND8A 4DSUA 1N6RA 3L2OB 2FGKA 2XJ9A 2E9SA 1VG8A 3VKGA 3H0KA 2H5EA 3T1OA 1EFTA 2OCAA 2PX3A 3QNUA 1VCNA 2ZRPA 2JAQA 4DDUA 2XNDD 2NO7A 3K9HA 4DEYA 5CB6A 3PG5A 1OHHD 2BIFA 2WJJA 4CDGA 4KV9A 5LBIA 4MGKR 3C5CA 1GIAA 4JSTA 2FEMA 3BXZA 2IXFA 1S8FA 5DNYB 1JI0A 3ONWA 2QMEA 3SHWA 3EA5A 3K09C 4B44A 3SI7A 1DE0A 2H8KA 4ZCMA 4HZIA 2V3CC 2AL7A 4BEBA 3LAWA 4TSFD 1HA3A 2PCLA 4C0KA 2A78A 3EZ2A 2XNSA 4O2LA 4DSOA 1LNZA 5EP4A 121PA 3PUYA 2GBLC 3C4JA 1KK1A 3SJAA 2NGRA 3BFXA 1NIPA 2ZJ2A 1AKYA 1GILA 3CX7A 1II9A 1T91A 4MGYR 1G7TA 4B34A 4TL9A 4B75A 2A5YB 1WF3A 3HWSA 2OCPA 2VIIA 3L0IB 2WICA 3THWA 1PLLA 4MKHA 2B92A 4G01B 4LYHA 2I1QA 1WA5A 3HR7A 3TMKA 3ASYA 2O8DB 2RGNA 4QBGB 4Q4AB 5AJVB 2JLWA 2OXRA 3W5IA 2QENA 4EPXA 2WZQA 4NMMA 3W5JA 3W9YA 2J87A 3VR3A 1TQ2A 4Z54A 3KDSE 4PZYA 4YDHB 3KXKA 1UPTA 3CRQA 3TVTA 4TMXA 1E2EA 1OH6A 1E9EA 3KJEA 4X8MA 2BMFA 2H18A 2X8AA 2JJ1D 4HB0A 2A3RA 2ZI4A 3CRW1 1M6NA 4IFBA 4GL2A 1QG4A 4N3NA 1OXTA 5KSPA 3GEEA 2GEVA 4AD8A 1DO0A 3AGPA 1DEKA 2J7PA 1NBMA 4M9SA 2BM0A 3K1JA 4DUGA 1Z0KA 3BOSA 2JATA 2ZE7A 1R6BX 5F3WB 3KJGA 3HR8A 3PUVA 1E2KA 5DI9A 3NBFA 3BFKA 3GQBA 3CH5A 1ZIPA 1XD9A 3AB3A 3UKDA 1IJFA 3AF2A 2QP9X 5DE3A 4ITRC 4UXIA 4W5JA 1Z6TA 3WYFA 2D2FA 4BFYA 4Q00A 1KO4A 2QTFA 1N6HA 2AD1A 3QF4A 4KI0A 4JLDA 3S1AB 5B64A 4KYUA 4LJ8A 3WRXC 2QUZA 4GMDA 3B8HA 4IDOA 2OXCA 4Q02A 5DO9A 1P2TA 2W0SA 5FBRB 2AFHE 1M34E 4LHYA 4LCBA 5G53C 3HDTA 5J4LA 3QIAA 1QHHA 5JMTA 2OO7A 1F3OA 3OE7A 5KDDA 1YR6A 3RS3A 2ZR7A 1W36D 4KVAA 3RANA 5AUQA 4ZIRB 5FI0B 2J0UA 2ZAMA 2AX4A 4NE2A 3BERA 2CLCX 2HLDD 4KCGA 1ZM7A 3K09A 2MSDB 3AUXA 2EFEB 3OEHD 3T61A 3QKUA 2IS2A 1AJEA 1G9XA 1ZUNB 4POAA 4XD7A 2FZLA 1TF5A 3HJNA 1JJVA 3AEZA 4BGDA 4LHXA 4XWKA 4C0BA 5BYKA 1XBTA 4QBFA 1EG7A 3FB4A 2N46A 2OESA 1H8HA 3SFVA 2PZEA 2ZJAA 2GBLA 4DLXA 3BH7A 4TL8A 3LBNA 2F7SA 4RY2A 4TT3D 4A2PA 1LF0A 4P4SB 4Q9HA 1EX7A 1L2TA 5JWOA 2F1HA 5D3MA 3VR2A 5KNDA 3LW8A 1CS4C 2E87A 1US8A 1R0YA 1W4BA 3NIBA 2BVNA 3KQKA 4EPTA 4PX9A 3EZFA 3KQHA 1XJCA 4Z8YA 3VHXA 4DT1B 4DIDA 2V9PA 2XOKD 3K0CC 1W48A 3F3YA 3GFPA 1IXSB 3Q3JB 4FMCF 1QF9A 1ZYUA 1A7JA 1NVUQ 1Z0FA 3F5FA 3GLFE 1UBFA 4O0MA 1NVVQ 1G1MA 4UNNA 4RD2A 3TAUA 3NH6A 1X8KA 4PAMA 1I2DA 4FMCB 1N6LA 1K5DA 2DYKA 4B43A 2FEOA 5LD2B 3GLIA 2OV2A 5FBWB 4KAXA 1A5TA 3IIJA 4IKEA 4OI4A 3ZIAA 2OILA 3T1VA 3W6NA 1NG9A 2WJGA 3Q72A 5TY0A 5FOVA 1XXHA 1RYHA 2ZR0A 2HDNB 2VHQA 2J0VA 1AGPA 2AXPA 2IX3A 1NY6A 2IF2A 4IOMA 2OCBA 1T0JB 1VDZA 1VPLA 3Q5EA 1R5BA 3WBKA 2O8CB 3RAPR 4M22A 4EKDA 1XDBA 3CR7A 3I73A 3T5GA 4QKQA 2OEPA 3M0EA 5IT5A 1N6KA 3MG9A 1UEJA 2GJSA 2Q9AA 4ASUA 2CL7X 3RSLA 4LDJA 3FE2A 4KLZA 3WXMA 5JWRA 4YXWA 4DSNA 5TXGA 1ZNXA 1YVDA 1Y3AA 4PPFA 3U2QA 5IRCD 2XSZD 3CIOA 4UNSA 1H8EA 4RSGA 1XMIA 4HAYA 4RZ2A 5EXXA 4MRPA 1IBRA 1W5SA 1C4OA 1II0A 5AR1A 3TVDA 4C7OB 4AK9A 1UKVY 4M2LA 1E1RA 2PLRA 5H68A 3DM9B 3VU9B 5C18A 2X2EA 3B1WA 1RPZA 2QEQA 4CEHB 4OBEA 1OKKA 2ZJYA 1IOZA 4JVMA 1Y63A 1KI6B 1W0JA 2ZRGA 1BS1A 1KI2A 4V0KA 3SJCA 4URWR 1Z08A 3EPJA 1CJUC 4JJKA 2HJVA 4RVCA 4KYIB 3KJHA 2JLZA 2WSSD 2ZRIA 3QBVA 4W7SA 4IOJA 4S35A 3MWJA 2KSQA 4OHVA 1LS1A 4TN1A 3THXB 4NCIA 4XIGS 1QHGA 1SULA 4QGGA 1U0LA 1Q12A 2W58A 4OL0A 1NG1A 4DLRA 2D4HA 1SKYE 4KLNA 3T12A 3FHTA 2PX0A 2P6UA 4A1FA 3KXLA 1HY3A 2IYRA 4Z1MA 3TLXA 1AQUA 5FR2A 1KNXA 3AKDA 4OQFA 1MO3A 5F9HA 3U3MA 4P3YA 1OYWA 3FHCB 4D2IA 1P6XA 4C0LA 1QHIA 1YU9A 2CCJA 2AHOA 3K0CA 4UXHA 2VP6A 4DCNA 1EFRA 4DLUA 4URYR 2RB4A 4ESVA 1TADA 1ZC4A 2G77B 5AJWA 5K8LA 5JBQA 1N6NA 1W2GA 2GRJA 2BCGY 4IEEA 1P62B 2H7VA 621PA 1E0JA 3ZVLA 3CNOA 4ESHA 2ZRBA 4KXFB 4QJ4A 2GESA 1X6VA 4WZ6A 5CIWA 3RC8A 5C1BA 2VP4A 3ZZUA 2QM7A 3OE7D 2K5UA 1ZW6A 2UVQA 4PHTA 3PITA 1Z06A 3ZZ0A 1ZD1A 2DWOA 3P32A 2JJ2D 1KO7A 2AFIE 2O5VA 5E95A 2ZJ8A 2F1RA 3RLFA 3MGCA 2YWGA 1XJ0A 4AYXA 3A1SA 5EXPA 2YC4C 5FPTA 4KSCA 1AS2A 4V0NA 2OBNA 4XD7D 1GZSA 1T8UA 2J0QA 1NBME 4C3ZA 1L4UA 3VX3A 3A1UA 5JZVA 3CF2A 2BEJA 2ZUDA 5H1YA 2KBEA 4OI0A 1FQJA 5FUYA 3WP1B 4W5HA 3E2IA 1UFQA 5B30A 1YZGA 1JR6A 4A8JB 3KTAB 3IUYA 4UNPA 3VAAA 4LC0A 2RGDA 1OJLA 1S1MA 3DZ8A 4FMDF 4US0R 1E9BA 4M4SA 2GKSA 5J4VA 4HZUA 1NN3A 3MRSA 4GDFA 3VR4A 2CBZA 1E9DA 1TEXA 1WQ1R 3SEAA 4AG6A 1E9RA 1MRNA 1TF2A 3NHBA 2RKOA 2WPDD 4LX0A 5DSZA 5CYPA 1Z2CA 3CNLA 2BKUA 1IN7A 1X8JA 2BJVA 1G5RA 4NP6A 4M1WA 1OB5A 5IF9A 1ZIOA 4Q47A 3P4XA 3R9WA 3EC2A 4JVSB 1QVRA 2KJQA 2QA5A 5G3ZA 1BMFD 1KMHB 1PJRA 2CHQA 1EGAA 2CE2X 2ZAOA 3KKPA 4HB3A 5KPDA 2F43B 4US1R 3M4YA 3AVQA 3U6BA 2QPTA 2QG6A 3OAAA 3IBYA 2ZM5A 4RD0A 3G5UA 1MH1A 4TQAA 5JSZA 1NLFA 4EIWA 3EIEA 5D3QA 8OHMA 1MO5A 5E7IA 1DARA 4NONA 1N5KA 4K46A 3CR8A 3ZIAD 2IS4A 1HEIA 4HLUC 5FTLA 3UANA 1D2MA 2B8TA 1MO4A 2C03A 2FA9A 3N70A 4ABYA 2CL6X 4Q4AA 5HTKA 4FI3C 3FYHA 2IBMA 4TLDA 3PUXA 3QXXA 2LCFA 3AF3A 3VNVA 2QL6A 2G1KA 1RRFA 1HQCA 4ASUD 1GITA 4TLBA 3PFIA 3TBKA 4ZI2A 2WOJA 3ZZTA 1SXJD 4I1OA 4Q48A 3MJRA 2DWQA 2PEZA 4KBGA 3GJ8A 3UG7A 3K0FA 1LY1A 3JVVA 1R10A 1T3LA 4D4KA 3KQLA 2QQ0A 4BFTA 4B71A 3CLVA 4BLRA 721PA 1U2RA 1GVNB 1S0UA 1T5IA 2ZRMA 2PLFA 1Z07A 4MUAA 3VHLB 5L3VA 4NZYA 4L9SA 4AI6A 2LKCA 1T9HA 2Q0HA 1E1RD 3CPEA 1SGWA 3L0PA 4O25A 3FMPB 2IEYA 2IHBA 2ERYA 1UJ2A 4LI0A 5FPKA 3CONA 4IHQA 1OKKD 1J90A 4WVFA 2G88A 4W9MC 4HAXA 3GLIE 2OLJA 3AVVA 1VYUA 1IY2A 1W0JD 3RC3A 3KJIA 4MUBA 1RJ9A 2V7QA 4ZKEA 1UKYA 5F2EA 3I3SR 2IL1A 1SZPA 5K8IA 1XXHE 3QEOA 2GF0A 3MJHA 1KYIA 4DLYA 3T06B 1KAOA 2IT1A 4DDVA 4L9WA 5FPYA 3CWQA 4MGZR 4TMWA 4U02A 4RD3A 3ZVRA 4MDEA 3AUYA 1FOEB 1V5WA 2WAYA 3UWKA 2C8VA 5JJIA 1E96A 4B3FX 4TYPA 2FPMA 2VF8A 3BS4A 1G17A 1VMAA 4LGMA 3SHFA 1KMQA 1K8RA 1ODFA 2CNWA 2RGEA 5TV2A 1WB9A 2HT6A 4U00A 1XPRA 3ICQB 3V4RA 4FW9A 3A8TA 4HAWA 5DYGA 1NKTA 4CGZA 1U0HC 2QQEA 1RRPA 4B32A 3LO5A 2ZI3A 1ZMXA 2QT0A 2FPKA 2R8RA 3ZVNA 4HDOB 2W0MA 3X1XA 2FSIA 3AP2A 3IPXA 2ZYTX 3VKWA 1HE1C 1EFRD 1SVOA 1XFAA 2YHSA 3SR0A 4JSYA 3WP0A 3U3JA 3REGA 4F91B 3QXHA 2WKRA 2VHTA 4L4UA 1ZRHA 2L0XA 2NZ8A 4RD4A 1QHYA 2ZRHA 2HYIC 4L8GA 4P4SA 2IYSA 3FGNA 3GJ4A 4ERNA 2ZQ5A 1V43A 2XXAB 2CJWB 4AY2A 2GILA 4HLUA 4V0MA 3T1QA 2NTYC 2QORA 4WOPA 5BN3A 3CW2A 4MKIA 5IK2A 5JHHB 2YOFA 2VF7A 5FOXA 2XB2A 3I1FA 3ZS9A 5C46F 4Q1EA 3RHFA 3W6PA 4ZO4A 2V8OA 1UBGA 5SZIA 1NI3A 3V00A 1TU3A 1YHNA 4A92A 5KNBA 3DM5A 4RKEA 1Z6AA 2GCPA 2PJRA 2CHVA 2YZ2A 3ETLA 3BK7A 3FDIA 4JMPA 4C0QC 2YVUA 4EFLA 1Q3TA 4TQUS 5EP2A 4U7DA 4PANA 4XTRA 1F2UA 1S9DA 5EP1A 3B82A 4D4LA 4TYQA 5JJLA 1NJGA 4NCNA 4J0QA 3VTKA 3Q85A 3ZJYA 1O87A 3SS8A 1U8YA 2XB4A 4A9AA 1ZUIA 5TMPA 1FUUA 1GL9B 3IQXA 2MSCB 4GNKA 3R7WB 2V4ZA 3EIHA 3P1JA 521PA 1YR8A 3GLHB 3W8RA 1DAIA 3QKTA 4UNQA 2AXNA 3TRFA 1NN1A 2ZJOA 3OAAD 4QL3A 3AVOA 4TYNA 2AD5A 2JJ8A 2J5XA 1M7GA 5GVRA 4ARZB 3A58B 1QHSA 4JLKA 1P5ZB 4G5SA 1L8QA 1U98A 1KDPA 1Z6GA 2D62A 3NHAA 3K0AA 2F3TA 4JLPA 1HH4A 3RRYA 2KWIA 4C7OA 3TSWA 3IDQA 5EE5B 3REFA 2QMOA 3TUZC 4Y0AA 4BECA 1COWD 2Z83A 4ON9A 1GM5A 5GJVC 3BFVA 4NYMQ 2ZJ5A 4Q66C 1M1YE 3FKSA 2REXB 2G1JA 4JVLA 1B0UA 1WBBA 2H16A 3DKPA 2DFNA 1DAKA 3N2EA 4PPQA 4WW0A 4M1TA 3UPUA 1WDTA 3CNNA 3NDPA 3QXJA 5F98A 1LTQA 3OHMA 1TEVA 4PHHA 1CJVC 1QHNA 2VYFA 5JCPA 4TZ0A 1TQDA 3ADKA 3MUFA 1G6HA 4JLOA 3E5HA 1SVSA 1EFUA 1JQLB 2FG5A 4LWZA 4Q7JB 4F7WA 3R9XA 5L3QB 2QPAA 1F48A 3O47A 1KK3A 2WWFA 4CW7A 3B1YA 1GNPA 4G5GA 5CM9C 1N6OA 1GP2A 4B74A 1Z0IA 3I5XA 1X1SA 2ZS8A 2WOOA 1QDEA 4X8HA 4BLSA 2GETA 2OZEA 3MD0A 2YJTD 4JLJA 1XEWX 1CTQA 4XTCS 4M0LA 1F60A 2OM2A 4DIEA 4BFZA 3QI2A 1W4AA 1YKSA 5KTYA 3IPYA 1OB2A 1ETUA 2VBCA 2V7QD 5BN5A 2ZPTX 421PA 4PC7A 4ZCLA 4CZ2A 4AYTA 1DTSA 3HP1A 3L43A 1DAHA 1OT3A 2C9CA 5EQTA 3X1YA 4QNMA 1U9IC 1P4SA 3SC3A 3W3AA 1GWNA 2ZYUX 1G4UR 4PAOA 1XRJA 1C9KA 1N6PA 2EVWX 4LV5B 1E1QA 1NVVR 1Q1EA 2D7CA 1ZD8A 5H8WA 1D8TA 2CNWD 4EQ6B 1GG2A 3WNBA 3AP1A 4URUR 4ZDJA 3HU3A 5DN6D 4YMWA 2GXQA 1P3JA 1R0WA 4FMBB 4B47A 4OI2A 1T3HA 5KDOA 1E2DA 3NG1A 2D2EA 1R8SA 1S1CA 3UXMA 1VTKA 1ZM9A 1K5GA 3FHOA 3C7KA 4D0GA 5HR5A 3N5CA 2A5FA 4B33A 4A2WA 1N5IA 4HAZA 3TR0A 2HUPA 2OT3B 2DCUA 1Z0DA 4I81A 4B3BA 1G8HA 1XX6A 2WWGA 2OBLA 2JASA 3VQTA 3C16C 2Q3HA 3LX5A 4O3MA 1Z29A 4OHWA 1BKDR 4BLQA 1BOFA 2R6AA 3LX8A 4M9QA 2QU8A 4QC2A 1R2QA 1G16A 1CULC 5E3HA 2ZU6A 2F55A 2QGZA 4JL6A 4EPYA 4A0GA 1NF3A 4HB2A 4H1VA 3NEYA 4UKDA 4Q7LA 4MRRA 5IK2D 3U60B 2GJ9A 1CXZA 4EJSB 1KMHA 3B7GA 4PPGA 3DZDA 3GLGB 1J70A 2F6RA 2NO9A 2REOA 1DBSA 4Q19A 2RH5A 1P9RA 4M9XA 4WBSA 3AVTA 4XWAA 1KOFA 3IIKA 1XCMA 2J41A 2REBA 4LYFA 4A0RA 3BBPA 4LSGA 5P21A 4F4CA 3OFNA 2R44A 2YV5A 1Z5ZA 1Q1QA 4DXAA 2JDIA 1S4QA 1X8LA 1RW4A 1RC8A 4LJ4A 4OJQA 3TJZA 3KFVA 4QM7A 3Q8XB 2WWHA 4GOKA 1LF5A 3LFUA 3QVUA 3I5YA 3DEFA 1MOZA 2Q3FA 2FE4A 4KHZA 3B6EA 2LWIA 2ZSDA 2SHKA 3U3OA 5JFGA 1HUQA 4DCUA 1E94E 2A5DA 4V0ME 1FL9A 1G6OA 1KDRA 2P5SA 1W0KA 2ZS9A 3EW9A 4G0NA 1U9IA 2BBWA 1YZKA 2YWEA 3BWDD 2B21A 2PH1A 1GKIA 2EU8A 5FL7A 5KU1A 3EPKA 1GKYA 3RNLA 4LBWA 4WA7A 3U7GA 3QVVA 2OG2A 2FFBA 1VIAA 2J46A 2ATXA 2Y8EA 2ZVQX 3EZ6A 4A6XA 3DL0A 1OXVA 1OXXK 4RFSA 5JRZA 1G20E 1NY5A 4D82A 2GNOA 1GFIA 1U99A 3O8RA 4HI0E 1NSFA 4A15A 1KY2A 2ZREA 3C8UA 3QBTA 2ZYVX 3RRNA 1JJ7A 4AURA 2YOGA 2ZE6A 4AKIA 1KI3A 2CLDX 5CLQA 3FKSD 1NMYA 1E2QA 3BJIC 2DPXA 4Q9LA 4B35A 2ZR9A 3CPJB 4E09A 1VIYA 2R6FA 1BYUA 3CZPA 2WKQA 2FF7A 3TAHA 3ZD7A 5FUXA 1A4RA 2OHFA 1AQYA 1J7KA 3SBEA 3EX7C 2FDCA 1IN6A 4G1UC 5BN4A 1AZTA 1CKEA 5L3RA 5JI3E 3THYB 4HDCA 4NYIQ 5J47A 2NO0A 2FNAA 4ZI3A 2R6GA 2JLVA 4CEJB 2EYQA 1CRQA 1E2LA 2AKYA 2C77A 3RRMA 4P32A 1XZQA 2QMUA 4UXJA 2QBYB 3EG5A 2EFHB 2P5TB 5JHGB 4QNRA 4Q9KA 1ZCAA 1A2KC 1G7CA 3AKEA 3IO3A 2P2LA 3U7EB 1N5JA 2GCOA 2IWHA 1TAGA 1HV8A 5AUOB 1YZLA 1EESA 1Q22A 3SOPA 1KJWA 3JVUA 4PSVA 1RVDA 4MA4A 3EZ9A 3MFYA 2KI5A 2P67A 1DG3A 4NDZA 4Y0VA 2FZ4A 1FNMA 4EFMA 4OK6A 5G3YA 2GXAA 4MH0R 1P60A 1P2UA 1P75A 1L4YA 2C78A 3KKMA 4MKFA 3QPWA 4LJAA 821PA 2GK6A 2CJWA 4GP7A 4JL8A 4JBWA 4Q1DA 4Q4JB 4OQXA 5FPHA 1P9NA 4GPTA 2ODBA 5J4YA 1Q1BA 3R8FA 4U5XA 5J4HA 1I4DD 2BBTA 3DPUA 1D6JA 4B3DA 2PBRA 1NKSA 3BAFA 1AKEA 2QN6A 1RRCA 5AJZA 1CRPA 1SVKA 3SU8A 3TR5A 4D4MA 3IEVA 2O8FB 2KBFA 1G5TA 1DVRA 1N3BA 2WSMA 4LJ6A 1AZSC 3AF0A 5FBLB 2QE7A 2VSFA 4TTRA 4Q9IA 4URVR 2CL0X 5CIQA 4EPRA 1UKEA 2QTHA 5G41A 4B2LA 4EFNA 3LBHA 5L3SB 1FTSA 1EK0A 3KX2A 1P61B 1SVIA 1VG0B 2H57A 3X2SA 5IHPA 3TE6A 4TL6A 2RGAA 5HE9A 2DR3A 5JS8A 4WXPA 1W46A 1MO6A 1XPOA 2CDNA 4HATA 4LK2A 2GZHA 1DAEA 1P72A 3GMTA 1XEXB 2HXSA 2GAAA 4LZZA 5DHAA 3D3QA 4GBMA 2C9OA 1C1YA 4UJ3A 1ZNWA 3GLFB 3K70D 2EFDB 4P31A 1U0JA 4Q03A 2QNRA 1W36B 2NQ2C 4LYAA 1ZD9A 1ZP6A 3GLHA 3O8BA 3DHWC 2BHRA 2HCBA 2ZS7A 3GEIA 5JWHA 4DEXA 1E9AA 4IEIA 4OQMA 3K8YA 2P6NA 4DCSA 1ZCBA 4PC1A 4DHEA 2J7PD 5FUWA 1NBMD 2A5JA 2WVJA 1WXQA 2WWWA 1E2FA 1NLYA 4DUGD 4CEIA 1MABB 1ZNYA 3LXXA 3QKRA 3D6TB 4Q1FA 3QSYA 3OFND 4V02A 2WHXA 1FW6A 1XWIA 3LA6A 4RFVA 4BFSA 2JIZA 1FUKA 4DZZA 3KQNA 3QKSB 5AUPB 2F9MA 1M7HA 4RD6A 2PZFA 4DKXA 1J8YF 1XD8A 3K9LA 3LBIA 4BPBA 1Q1ZA 2JLUA 5BWMA 1G8YA 1U8ZA 2EW1A 2OBMA 2HV8A 5FTNA 3SBDA 1VG1A 2O0JA 3Q7PA 5BXQC 5FR1A 3NWJA 4Q4HB 4NCHA 1CR2A 3U44A 1D2EA 2OFOA 2FFHA 5EZ5A 1GRRA 1GSIA 4FN5A 2GJ8A 1WCV1 2VRWA 3SFZA 2ONKA 1G18A 3WYGA 1W0KD 2YYZA 2OLKA 2BMDA 4I1SA 2ZU0C 3A4LA 4RKFA 5TB5A 1JAIA 4LBZA 5FL7D 5UKDA 5FOUA 5L3QA 4B2PA 4JT4A 1KJZA 1CR1A 2IYWA 4M53A 3B2EA 2RGXA 2XAUA 2OCYC 5EUMA 1TF7A 5LB4A 4NH0A 4C0AC 5FOTA 3TIFA 5DH9A 5TVKA 1AA9A 3FFBA 4TYYA 2A2ZA 1H8HD 3H84A 4EUNA 2Q9CA 3BB3A 3A1WA 3ZD6A 2G3YA 4RZ3A 4GZMA 2PMKA 5DIFA 1KSJA 5TARA 4XWOA 3C14C 3M1IA 3K0SA 1VCOA 4PSKA 2ZE5A 1XD2B 1E69A 5M04A 3AVWA 1LFDB 2NIPA 1XTQA 4JLVA 4KSBA 5JCZA 1Q44A 1XTKA 1D9XA 4FMDB 4EAQA 3AKCA 1GRNA 4TTPA 4AKGA 4LV8B 2R6CA 3QXSA 4JL5A 3L0OA 4AG5A 3DO6A 3IHWA 2PJZA 4XVQA 4PPNA 1KAGA 1ZAKA 4PQFA 3N2IA 3THWB 2W2TA 3AGQA 3ZYCA 3GJXC 1XF9A 2RGGA 4LBYA 2AN9A 1Z83A 1YZTA 2O8BB 1TQ6A 4KU4A 5FH9A 5CB8A 3G0HA 1XMVA 1RKBA 2Z6VA 4X8OA 4B3CA 5KSYA 4JJZA 3Q7QA 3EZ7A 3R20A 5KSZA 3EIQA 1E3MA 4IW3B 3CH4B 4D4JA 1HYQA 1N25A 3EWAA 5ELXA 3T35A 2WV9A 2Q6TA 3V4FA 2O8DA 2BJWA 2GXUA 2B7CA 4Q18A 1E2GA 2C2HA 2EYUA 2LKDA 2OSBA 4L15A 4BLPA 4DRZA 2IEZA 1RIFA 3QUSA 2ZRLA 1GDDA 4PZZA 2GXSA 1T6NA 4Q4LA 5DI3B 1E2NA 4OYHA 3ZVMA 1CBUA 1QRAA 5JECA 4UJ5A 1PVOA 1G8GA 4BFVA 1CIPA 3U7HB 4AKHA 4IDHA 1G3UA 5FFMA 1CLUA 1PLJA 5KYKA 4G3XA 1OYYA 2QE7D 3GLGA 4YXWD 5LD2C 1YR9A 3JZMA 2Q3MA 3RS7A 4JKIA 2Q9BA 4DCTA 3VR5A 1H8ED 3CUEF 4NYMR 1CP2A 3PUWA 3QF4B 4E07A 1IXZA 3BC1A 3LXRA 1TX4B 2B8WA 4URXR 3O8DA 5A5GA 2IS6A 2WJYA 2WBLC 2GEDA 4D6PA 3BB1A 2D7DA 3BH0A 1AIPA 2ZRCA 2C95A 5HZKA 1IY0A 4JZKA 2HYDA 3OEEA 4HEJA 3B60A 1GAJA 1E2PA 1KK0A 1NSTA 4DLTA 1QHHB 2ZANA 1NNEA 4LY6A 2NPIA 3K9NA 3S1AA 1FMLA 2CXXA 4IVPA 4I4LA 4LC1A 3U6KA 2G6BA 2JLSA 3CB4A 2GWHA 2J0UB 1P2SA 1PUJA 3HPQA 4I1VA 1WRBA 4DLSA 4B6EA 1II8B 3G82C 3VR1A 4QRHA 2C9YA 1ZM2A 2HF8A 2O52A 2IYZA 2B6HA 4KFUA 4MKGA 3T15A 2ASEA 2HEIA 4Z1MD 4ZIRA 3C41J 4R2HA 2ANBA 1N2CE 1NL3A 4BFWA 4CRWB 2JIZD 1E79A 1N5LA 2E1RA 2YC2C 1E2JA 4QHYA 1BO6A 1UDXA 4QGHA 5D3MB 2XZOA 4QGFA 4B2IA 2XGJA 2OUKA 3HYRA 1TNDA 1DG1G 2FFQA 3GEHA 3X1ZA 4KFTA 5FBVB 3I61A 1D9ZA 4YDSA 4KBFA 1US8B 1G3IA 1KY3A 1W7AA 3GFOA 1N0WA 1IY1A 1SVWA 1A82A 1Q57A 1KI4A 3SJZA 3TW4A 1FQKA 4Q21A 4EDHA 4PO9A 2C98A 1KO5A 1E2MA 3PEWA 5A0FA 4D80A 1YE8A 4KODA 1SVMA 2EWVA 4TSFA 1HT1E 2A7QA 1JAHA 1KI9A 3W6OA 2CK3A 1CJTC 1TPZA 2JLQA 1W49A 3UWOA 2C04A 1T8TA 2G83A 3T5DA 3ZLJA 4DT1A 1CU1A 1W47A 3GLHE 1OE0A 4X8LA 4US2R 3CRMA 4Q1CA 3AH8A 3LLMA 3P26A 4GOXA 2CHGA 2GCNA 4JLNA 1B23P 1ZM4A 1LB1B 1UEIA 3ASZA 4GI7A 2AK3A 4KFSA 4NTZA 4MDFA 1XTRA 2RHDA 1XXHB 2OAQ1 3JZAA 1Z63A 1IJEA 1JPJA 5CLLA 1UADA 4AWXA 1CR4A 4A82A 3EASA 3A1VA 5SZHB 4FCWA 2GK7A 4TTQA 4IDNA 2IXGA 1E0SA 5EE0A 5GJWC 1DPFA 2BMEA 2JLYA 3TUIC 4LHZA 4D81A 4TL7A 2ZUBA 1IHUA 5FUVA 2XTZA 4JYBA 4PC3A 1SXJB 3ADBA 5J4KA 1DS6A 3NEJA 2YNMA 1EX6A 2QP3A 2VQSA 4CF7A 1E4YA 4KO8A 2IF0A 1G3QA 2JLXA 2PMDA 3IBGA 1JEEA 1VYTA 2QY9A 5DHFA 1Q0UA 4QJ3A 2O8CA 3SN6A 1M8PA 1IONA 1OSNA 1JNYA 2QSZA 4M21A 2GA8A 4OQLA 2HF9A 1E99A 1XTSA 4HLCA 4LUCA 2PEYA 5E7MA 1YZUA 3KB1A 2GDJA 1SHKA 1FX0B 4MRVA 4ZPXA 1Z22A 2O8FA 2DFLA 4A8JC 4PQRA 1IQPA 1Q21A 2XJ4A 4A0HA 4JYCA 3KXIA 2PZGA 3TSOA 2BWJA 4YONB 4R9UC 4Q9JA 4BUJA 2R9VA 4DLZA 5EE3A 3K9GA 4HUTA 4NU0A 2IYTA 1KTVA 4C2UA 2DFTA 2G9NA 1S3SA 3RABA 4E22A 1IXRC 3VU9A 4PHGA 2QAGB 4BFXA 4XSGA 4CEHA 4GFDA 4NYJQ 5HE8A 3MWYW 1XEXA 5AUNB 3QQ5A 1F5NA 4C2TA 1KI6A 1GL7A 3TQCA 1SVLA 3FTQA 3QF7A 4NCKA 3I72A 4V0LA 3J81k 3KKNA 4LHWA 1ZJ6A 2O0HA 3IEUA 4HAUA 4TLEA 4TMVA 4QBHA 3TNFA 3X1WA 2QSYA 4RCYA 3PV0A 2KB0A 3CF0A 2ZITA 2VP0A 4ZV4A 4YMTA 1OPXA 5EE1A 1ANKA 3EA0A 1RZ3A 3LV8A 1MRSA 2VEDA 4A6PA 4C9BA 4HYYA 5A4JA 2HLDA 1IAQA 1ZINA 3THXA 4URZR 5CJ2A 3DMNA 4PR0A 1ESNA 4HB4A 4HLQB 1QHXA 2OE2A 3SQXA 1EWQA 1NRJB 4Z8XA 1AK2A 2X1VA 5EZ6B 5HPYB 2R2AA 2DHRA 1X1RA 3AKYA 4N1AA 4XJXA 2WTUA 4E03A 1MV5A 1GOTA 3OEED 2FOLA 3NC1C 2FV8A 4NL4H 1TUEA 4HUQB 3WRYC 1KNQA 1NMXA 2HT1A 2W6JA 5CYOA 4NYIR 2UKDA 1JEDA 3AQ4A 4FWTA 1DO2A 2IYUA 3AP3A 1YR7A 4MYCA 2IUUA 1OH7A 3SYNA 4YC7A 2WJHA 1G8PA 2IK8A 3CRVA 3OZXA 3WYAA 4XVUA 3NXSA 4CIDA 4B76A 1R5OA 1R5NA 2CCKA 2EQBA 2JLRA 4IVQA 1ZUHA 2Z4SA 3I8XA 3TW8B 2FSGA 3K0EA 1VKJA 2GF9A 2YWHA 4F4IA 3CZQA 3L82B 1FPMA 2CVFA 5HKKA 3QY0A 3B78A 3SJBA 1CJMA 4ACBA 3GLGE 1E79D 2VP2A 5SZKB 2ZETA 3U5ZB 2QTVB 3CKLA 2GZAA 2ZE8A 2ZEJA 2ATVA 2A5GA 4HZUB 2BBSA 4DB2A 3FFAA 2VL7A 3FMIA 4Q5IA 2ZI9A 4TYWA 4C30A 3W34A 4OJKA 2ZSAA 1JALA 5BYJA 4A8JA 3KTAA 1KIMA 1KI1A 3QG1A 3RDPA 4MRNA 1G64A 3GD7A 1CJKC 4M1MA 2IXEA 1E6CA 4FD2A 2O8EB 1Z28A 5B58C 3QENA 3TKLA 4A36A 2VSOA 2ERXA 1XD2A 4H1UA 2NMVA 1HT2E 3B13B 1KKLA 2CK3D 3NKVA 4IXMA 5GVSA 3R9IA 1KI7A 1FMJA 3HU1A 4QJ5A 1A2BA 1R4AA 4CT5A 4F38A 5JSZB 1ZM3A 1TQ4A 2VPPA 4IFEA 3ADDA 4MYTA 1YZNA 4QBIA 1OH5A 4WZBE 4OK3A 2XSZA 1E0KA 3H2YA 3RRZA 2MMGA 3WNCA 3DMDA 4C0SA 2V1UA 1WMSA 3VFDA 1I2MA 2F43A 3NBXX 4PAQA 3H4MA 3TUJC 2H92A 2WIAA 1Z2AA 1ONBA 3KKOA 1R0XA 3SDZA 2FU5C 2V54A 2PT5A 2G0NA 2QM8A 2O8BA 2ZI6A 4JLBA 4TMZA 3D31A 4PO8A 3RS0A 3DDCA 4BQSA 1J99A 1Z8FA 4ZDIA 2W2VA 1KGDA 2XTMA 3EWSA 4PXAA 1GNRA 1JXMA 4GSYA 3PENA 3LVRE 3LQQA 4I99A 3FWYA 4WZAE 2FJUA 5CDFA 3RSOA 1E4VA 2QGNA 4DCVA 3GPLA 1KJYA 2EWWA 2IHYA 2WSSA 1AGRA 3A36A 4I1UA 4GT1A 2JGNA 1S96A 2TMKA 4FIDA 3X1DA 3OIUA 2D74A 3K0FB 3NTUA 5KNCA 2FSHA 1XPUA 1MR3F 4QXAA 2JA1A 1HE8B 2P0EA 5DI3A 2C5LA 1RFLA 5KUTA 3I4LA 4L5BA 2W2XA 4TLCA 2ODNA 5LDDC 2RHMA 4PC6A 3LNCA 1XP8A 5AK0A 2GJKA 3VX4A 3MMPA 5E7JA 5LB2A 1LW7A 2QROA 2ZSEA 3OIYA 4LJYA 4BRWA 1W4CA 2I1VB 1FP7A 1RJ9B 3A37A 2XZPA 3QG5A 1ELOA 1TL7C 4BEJA 4JS0A 5K8TA 2RGBA 3U4QB 4M1OA 1SXJC 2ZRAA 3L8YA 5JRJA 1G4AE 1J2JA 4ZDWA 2FH5B 4BASA 3F8TA 3AVXA 5G40A 4B3GA 1QZXA 4BRUA 1XCPA 2ZI5A 4LJ7A 4LRWA 1D5CA 2JCSA 1BIFA 2WAXA 4XH9B 5CJPA 4NKRA 4QGAA 3ZH9B 3ADCA 1JXOA 3AM1A 4MITA 4QHSA 4IDQA 3QPUA 3KQUA 2DWPA 2JJ2A 2RAPA 1H65A 3AVYA 1W44A 4JVNA 3OIWA 4FWIB 3LW7A 2VHCA 4LYJA 1M7BA 5DISB 3U3RA 4A2QA 5B2ZA 1DELA 2IW3A 3FOZA 4YQFA 1Z6YA 3LY5A 1IN8A 1II8A 3HYTA 1OH8A 2C96A 5F9FA 1E9FA 3UMFA 5GJCA 2QZ4A 1WE2A 1RE0A 4BZQA 1G5PA 1KKMA 2EFCB 3GJ0A 4HAVA 2FPLA 3LDAA 2QMHA 1VYVA 4RZUA 5JJKA 2QAGC 2IS1A 2NO6A 3CO5A 3OF5A 5AJXA 3WMFA 1DAGA 2V1XA 1GUAA 2KE5A 2W6JD 2ZVPX 2CCGA 2BM1A 1J8MF 3PQCA 3I62A 3SYKA 4HLDA 4DC9A 4YLGA 1N0VC 1AN0A 5FL3A 3RS2A 3RWMB 1W5TA 2WPDA 4PO1A 2GHIA 4GRAA 2CE7A 3E70C 2ECKA 1EWRA 2ZSFA 5EUQB 1XEFA 5AWFC 6Q21A 4LV6A 3C15C 1XB2A 4ZKDA 1G7SA 1E1QD 1BMFA 1G7RA 1OFIA 5JS7A 2XXAA 4MYUA 4YMUA 3KL4A 2V6JA 4F93B 4TMKA 2W6IA 3MWLA 2UZ3A 3PXGA 2NOAA 2VA8A 5HKKD 4B73A 4C0JA 3B5JA 2CVHA 3L0SA 2FFAA 2VLIA 1LV7A 2GZDA 2ORIA 5CM8B 3EPHA 1IN5A 4A0FA 3UMRA 1OIVA 3TSZA 4UNRA 4B3XA 1OV4A 3IKJA 2FX3A 1F2TB 2J45A 3EXAA 1OFTA 1F2UB 4NPHA 4Q1AA 4G5RA 3ICEA 1KO8A 1OIWA 5ANRB 5HCIA 1VHLA 2NO1A 1JR3A 4DJTA 4R71A 1ZBDA 5FBQB 3SZRA 3PUZA 3MWKA 1O3YA 2J0SA 4AIIA 3UK6A 2QRNA 4OHXA 2GVZC 3SE0A 1OXSC 1WP9A 4PQYA 2F3RA 1M2OB 1G3RA 5AJYA 3VKHA 3CF6R 2VP9A 2WWXA 2ZJBA 4M9ZA 4ZDKA 1YZQA 4P4TA 1SXJA 2PCJA 3RWOA 4EPVA 1UBEA 2X2FA 1BH2A 3EC1A 5TDHA 1OXUA 2GEUA 4DDWA 3KUDA 2ZRKA 3F0TA 3THOA 1OLOA 4RZXA 1S3GA 3K0AB 3Q5DA 2IYLD 3R7WA 2ANCA 1G21E 2BBOA 2RCNA 4JT2A 3FMFA 4N0DA 3PVSA 2NG1A 4Q7KA 1FX0A 4YMSA 5CK5A 3GJ5A 4ACAA 4TMTA 3B1VA 5BW8A 5KPJA 2ODWA 4ARZA 2IYYA 2V55B 4II7A 1Z0JA 4IOLA 2FGJA 1E2IA 1JPNA 2BCJQ 2Q21A 2WJVA 1Q3HA 1VG9B 4GP6A 2VSXA 4Q1BA 1P2VA 3WHLA 2QAJA 4LJ9A 3EARA 5EJEA 2JDID 1KDTA 1SKQA 2VTKA 3O8CA 1OIXA 2ORWA 3FPAA 3CX6A 3W90A 4EPWA 5FI1B 2QAGA 2A9KA 4DB4A 4LJ5A 1VHTA 1QG2A 3R8CA 2IUTA 4EJSC 4PTLA 1E32A 1P7CA 3ECCA 2JEOA 3RVBA 1R7RA 2BMJA 3IQWA 2CLSA 4LOAA 3ZS8A 2QPOA 4ILEA 4CVNA 1YQTA 2BDTA 2J59A 3ZGXA 4HDQB 1XEWY 5E4FA 5SZJA 1ZNZA 1UF9A 1UKZA 1GNQA 5DYIA 2GVDC 4M8NE 1EFCA 4FINA 2ONJA 2J1LA 4P4UA 1TU4A 2NPFA 1NLZA 1NVXQ 2ODEA 1S2MA 2XITA 4FCVA 4GZLA 3EAQA 1KDOA 1OFHA 4AC9A 5K8UA 3NC0C 4TLAA 3NH9A 3ZDQA 1DAFA 4OHYA 3V9PA 5DLQC 1NMZA 3P20A 1T5LA 4HUQA 3DKVA 4D0NA 2BOVA 4F4JA 3EPLA 1JQJC 2P3SA 2O0KA 3P27A 2OFWA 3OIVA 1ZU4A 3TK1A 2IYQA 4C4PA 4PZLA 2ZSBA 1K6MA 1U8AA 3TQFA 2WWIA 1QBKC 5CDFE 1HTWA 4MGIR 4KJZA 4GOJA 1XJQA 2ZRJA 1SKYB 3T1TA 1FP6A 1ZC3A 2YKGA 1G3MA 1LS6A 4DWJA 2ZRFA 3GCGA 4B48A 2FSFA 1ESMA 5EXTA 1IN4A 4PC2A 4EQ6A 4QG7A 4RJLA 4NHOA 3QEJA 4Z51A 1YJ5A 1U90A 3LD9A 2W00A 3AF1A 1PZNA 2EFGA 3WMEA 3MLEA 1D2NA 2Z5FA 3DVLA 1F6BA 3NVAA 1DOAA 1Z6XA 4UQOA 3SYLA 1E0AA 2IYXA 4KFRA 4KITB 3DOFA 2H17A 2ZYWX 4HSEA 4MYHA 5KOYA 2DBYA 1Z47A 4JLAA 1GL6A 4GMXA 2MMCA 3B9PA 1UDWA 3D7MA 2VH5R 3NBYC 3K70B 1I4LD 4R2IA 1PUIA 3IILA 3QXCA 2QI9C 2ZTSA 3B1XA 2O8EA 2G0TA 2W83A 1P73A 3MCAA 2BKEA 3GFTA 3PIRA 1W2HA 2P65A 2YINC 5C4MA 4XSHA 3C5HA 3CRRA 5FTMA 3B9QA 3WMGA 2H1LA 2W6ID 1FFHA 1AS3A 1VCIA 1SQ5A 1VECA 1YRAA 1XTJA 2Z43A 3QE0A 4XVRA 2D06A 2C99A 2WIBA 4JBYA 4JKYA 3RS5A 2YOHA 3RYTC 2R6DA 4AKEA 2XEXA 1UAAA 1ZVQA 2GAOA 4EJSA 2P6RA 2N42A 3AV0B 2VO1A 3AVUA 3U61B 5KO2A 2B7BA 5B57C 1CEEA 2Z0MA 1COWA 2QP4A 2NZJA 4NYJR 3IGFA 1JR3D 4M1YA 1PV4A 4JLMA 1AM4D 3MSXA 3LWNA 4A4DA 4DLVA 4WXRA 2FWRA 4BLOA 2ZXUA 3KB2A 3SQWA 1E9CA 2IC5A 4H9GA 5J5CA 3TH5A 5EE9A 4JIMA 1G8FA 1IM2A 4V03A 2A30A 3ZQJA 3UIEA 3DOEA 2IA5A 3QJYA 2WM9B 1EXMA 1NP6A 2F1JA 3H1TA 3WBJA 4RFSB 3BRWD 3LRPA 4D0LB 2ZI7A 1EFHA 4K8OA 2F9LA 3D8BA 4TQ9A 3ND9A 4DDTA 4NBSA 1OFUX 4CT4B
chains in the Genus database with same CATH superfamily
2VPIA 5JI2E 1DFIA 2PM8A 2PVSA 3MTJA 2OLEA 5JZ9A 1TMKA 1H9AA 2V6BA 4I1RA 4DQUA 1LDMA 2MSEB 2I2DA 2PSHA 1MT0A 2YWFA 4DVGA 1D4ZA 2O1XA 5FI3A 1Z36A 3IVCA 3HL0A 2BFDA 3G2LA 3U4QA 1KBOA 2G76A 3TRKA 4F8YA 13PKA 5JADA 3ZE0B 5FTJA 5TIIA 4DLWA 5BN4B 1MPTA 3IMEA 4C0HA 1NJ8A 2CJYA 1ZIDA 5B12A 3TZBA 3WTBA 1YRLA 3D1JA 5CXUA 2E37A 2KX7A 1F7VA 3V42A 1SBQA 1P33A 2WJIA 3GJ6A 1NSYA 2Y1KA 1E5VA 1YIOA 3IUNA 2GI4A 1DLJA 1UWCA 1JB1A 4Y9UA 4XOIA 4LBVA 4BLTA 4CT0A 2ZROA 5DN6A 3NGXA 5L53A 3IP8A 4NWIA 4QTXA 1NIJA 2DG2A 3IHLA 4L22A 4R9RA 3A1EA 3M9XA 1SG0A 1TXGA 2WUFA 5DGXA 1Q20A 3A9WA 3FYSA 1QZZA 4G07A 4IS2A 2E82A 3PR1A 4D96A 4ZMRA 5IBPA 5HOQA 1L7EA 5EZYB 1KJNA 4P0TA 4XYGA 3L1HA 5K20A 1AK9A 2CFSA 3CVVA 1CVLA 1WOMA 5E9AA 1TU0A 3CX8A 3IR7A 4PX3A 3P0HA 2J0EA 1E1KA 2R1UA 2I91A 5C8YA 3EPRA 2X6QA 3BZUA 3W05A 2Z98A 2BPOA 3WI7A 2GBPA 4CBVA 1SXPA 1K0UA 1JHUA 1YDHA 1ISJA 1UMKA 1QE5A 3DV0B 4BQRA 3ST7A 3EXG2 2CYBA 2GTPA 2P41A 2Q9UA 3L0YA 2J6CA 4NBKA 3EISA 1MTZA 2I4IA 1PZMA 2TECE 3GRAA 3KVYA 2V6IA 2P4QA 2POQX 1R6VA 2X1MA 4P33A 2CFTA 1KSFX 2H5LA 4L16A 3NYRA 4PONA 3CEPB 3DAPA 3JPWA 2JHFA 3K53A 1PYDA 3MTIA 1NNUA 3IAEA 1L4FA 2QVYX 1YS2X 2ZUCA 4G9BA 1K86A 1OAOA 3O8OA 3A1TA 1Y3DE 4U2KA 2DHCA 1IEXA 1LTKA 4QQFA 1E8DA 2WAMA 3ZY6A 1LQTA 2YCBA 3CV3A 2BHLA 3CM0A 1PW7A 3HYLA 5F51A 1NVWQ 1YS7A 4PLYA 5IM5A 3IIMA 1P4HA 5DHUA 3B1ZA 1V8DA 1T9CA 2ST1A 3G2OA 1UPCA 2WJPA 1NI4A 4RPIA 1PTJC 4JODA 3M4XA 1VIVA 1DTWA 1IHDA 1U94A 2V8BA 5EP3A 4LEIA 5JCOA 2C7OA 4DANA 4YP7A 2CZGA 1C3OA 1P2FA 1L3CA 1YACA 4Z4IA 3LYLA 4M1SA 3OUUA 4MIYA 3KPYA 1E9SA 3WLMA 4BJHB 4BQPA 4E15A 4FFNA 4WBNB 1EX1A 2ZRQA 4XLZA 3VR6A 3T4XA 1JPUA 3A04A 2VF4X 1Q6ZA 2VZ0A 5TGDA 1UBCA 1PI3A 1Y1SA 1FTYA 2AR9A 2W6PA 1IBKB 4YJFB 1PJCA 3OFKA 3VVMA 3B85A 1HLFA 3KQQA 3G2JA 4Q4DA 4Z0HO 4EVSA 5BWCA 3F2IA 2R65A 2PT7A 2VKQA 4FX5A 1T4MA 4LNUB 4G63A 4ND6A 5AOCA 5FO1A 1WBDA 1H2HA 2IYVA 4YT2A 1AC5A 2CYAA 4O63O 4UE6A 4PBSA 2AF3C 3ESZA 4OQNA 1YE3A 3KU4A 3D3EA 5IC4A 2A88A 3Q6NA 3C48A 3U3KA 2XZDA 4PO3X 4RU1A 3RK4A 5B5SA 2JCBA 1I13A 3VYSB 3AHJA 2Z3VA 3EGEA 2HJGA 1XZPA 4G4JA 2D5AA 3E9MA 2Q2NA 3DLAA 2A94A 2RGNC 3BB4A 4WOKA 4HEHA 3NWBA 3E1SA 1RYMA 1IM5A 4ER0A 4PTYA 4PLWA 2FMUA 1GSHA 3M70A 4JUBA 2UZIR 3MQ2A 3LOPA 4J7CA 4DR3B 1CF4A 2W8ZA 2YMPA 1DT3A 3CKKA 3FKQA 3TLBA 1TVMA 4NABA 2XVZA 4E46A 4R9SA 3FUCA 3KVRA 3PDHA 4QHTA 4D25A 1S3FA 4DCPA 3VJMA 1P44A 4DNFA 4JU9A 1K7XB 2XKBA 4EG8A 4OIMA 2CF5A 1U7PA 1DIBA 3FWPA 1X86B 3I32A 1KSGA 5E2AA 2CEAA 4RIFA 1I36A 3FMOB 1PLKA 1NUQA 3ZWQA 2ZT7A 5C5IA 2ZT6A 5MFZA 1U0FA 4DABA 1ID1A 2J3JA 1M72A 3AF6A 1EB8A 5EKSA 3WHKA 2ZYDA 1PVVA 2W8BB 3RRXA 3T38A 1UFOA 3ISJA 3CSSA 3QPVA 4FTWA 1XNHA 1Y1PA 4LVOA 1KVUA 1FTNA 1SOAA 4PLVA 5G0WA 2N3ZA 2FN9A 2PRZA 3MFQA 3UYKA 1DQYA 4YQEA 1RYEA 3K8OE 3PICA 4N01A 2BKVA 2FN4A 2JARA 4L3WA 2HU2A 1T10A 3BWMA 5KSOA 3W8NA 2CNOA 3C6BA 5EAIA 1XTBA 4R5MA 3IE0A 1KWKA 5LL6P 3S70A 3MCTA 5EKTA 3LPCA 3F71A 1PT6A 2R62A 1R0ZA 3FW1A 4LPSA 2ZSKA 4TRNA 5IARA 1BYIA 1NAIA 2I1LA 4P7KA 4OBXA 3WKEA 2WT4A 2GZSA 2H11A 1G19A 4MI6A 5IPFA 3CVWA 3BCSA 1KYQA 4NG5A 4LJLA 2OAEA 3LFTA 2LZ0A 1SKMA 2Z95A 2H5EA 4FKZA 4BO9A 4RGQA 3GNLA 2PX3A 1HLGA 1IATA 3GRZA 2JAQA 4DDUA 4LFBB 2XNDD 3MTGA 1NBHA 3MJ4A 3UFXA 3OA2A 1UC5B 3PG5A 4DEYA 2BIFA 2OP0A 1NJ6A 2FWIA 1Z4PX 4H7HA 2OY0A 4ZD6A 1L4LA 1JBQA 1UMDB 5DNYB 1JI0A 3H1AA 3EA5A 2ODQA 3K4QA 3R0ZA 1E5XA 2CNKA 4ZCMA 3V4OA 4ITUA 3DCIA 3JAMA 4J0FA 2AL7A 1RP7A 3CZ9A 4QFCA 3LAWA 4RELA 5IVDA 1HA3A 3GA0A 2OHIA 4BRWA 2XNSA 1CUXA 3PDUA 3M83A 1XLVA 3G2QA 2BUAA 2Q3DA 1ZMTA 5AKGA 4DSOA 3FI0A 1U02A 2GBLC 1ODJA 4I4TF 5HQ3B 3ZDCA 3BFXA 4FR0A 5T6BA 3BHMA 3CX7A 2ZJ2A 1AKYA 2AX3A 3EMDA 3ZWDA 1II9A 1W4ZA 3D43A 3GVPA 2IV2X 2HNAA 1T91A 1BMTA 3H5AA 4B75A 4I4TB 3COPA 4MVJG 2VIIA 4D46A 2WICA 1IH8A 1WMFA 2BFEB 1HNNA 1JE1A 4IV0A 1CVRA 4MDHA 2ADOA 3IUMA 5E0KB 2AXEA 3UT0A 4GC5A 3K72B 2FMIA 3P2JA 5FYQA 2LE0A 4EPXA 1YH3A 2WZQA 3HSKA 3SSOA 3W5JA 3AOEC 3FMGA 1TYCA 3UA3A 1TQ2A 3D4NA 3MW8A 4CV2A 1Y4SA 3G02A 4YDHB 4HGQA 4LYGA 3KXKA 3DDNA 3RUHA 3TVTA 3H8JA 4TMXA 1OH6A 2ZYHA 1E9EA 2UUAB 4X8MA 2BMFA 2H18A 2V6MA 2ZI4A 5EIBC 4XPIA 4IFBA 5AKHA 4GL2A 2HPVA 4N3NA 4FGKA 2M9MA 4V3CA 2Y6VA 2GEVA 1CQJA 3ZTYA 3EIOA 1ZL0A 3ABZA 1OBFO 2Q8PA 1FSZA 3AG6A 1N5OX 2G06A 2GAFA 4RE6A 2G8NA 4URFA 4A0SA 1B1CA 1V8ZA 2FCRA 3T1YB 2BM0A 4TLMB 5JDIA 3KS9A 5DU2A 1VJRA 2ZE7A 2C94A 1EQ2A 3DVAB 1J9GA 3HR8A 3PUVA 1KAMA 3QUQA 5DI9A 2PX5A 3NETA 2ECPA 3BFKA 1KU0A 4AO6A 1JG1A 2A0XA 1QFYA 2R25B 1P7WA 3WNVA 1IJFA 1PFYA 4ZT5A 4ZQCB 1ZPDA 2O1WA 3S4YA 4ANFA 2CKDA 2WB2A 4ALJA 2B0JA 3BUSA 1PWHA 3HMQA 3HV0A 4X1KA 2NXNA 1C3JA 5BXYA 4BFYA 2O8NA 4Q00A 2QVZX 1YRQA 2QTFA 3DXYA 3QF4A 4JLDA 5TMEA 9LDTA 5LZ5A 3KKZA 1Q2XA 4GMDA 1MCZA 2R1TA 3ZWVA 1PE0A 2W0SA 2SCUB 2W90A 2F4VB 2AFHE 3DFFA 4RY0A 4WZBB 4EHJA 4LHYA 3GHHA 2IUFA 2NXEA 3I2KA 3KLBA 3HDTA 4IILA 3TLKA 2C31A 1BQEA 3QIAA 4XR4A 4XUEA 2OO7A 5DRTA 3OE7A 1LGYA 1GTZA 1Q14A 2M6LA 1YR6A 3RS3A 3BMCA 2XW6A 1F0YA 2QU7A 1W36D 4KVAA 1Y9EA 2J3KA 1SUFA 3O5AA 1V3QE 4ISBA 5AM5A 4KKVA 5FI0B 4AICA 1CZOA 2J0UA 4CM1A 1F2VA 5LDHA 3TSCA 1H94A 1JDVA 1DP4A 1O6ZA 1GPDG 1I2CA 3AUXA 1HEYA 1NXTA 1MG0A 1G9XA 1YRYE 2G9RA 3AXTA 3JWGA 3H9JA 3WGJA 4CMEC 1TF5A 3HHEA 3SHOA 1VL5A 1GA1A 3O73A 2ZSUA 1IL0A 2QN1A 3UC5A 3ERCA 4I6GA 4FYYA 3ZDRA 1POWA 4WZAB 4C0BA 1XBTA 4QBFA 1IK6A 2F59A 3FB4A 2N46A 4KQ1A 5FQNA 4Q7EA 4V24A 2OPHA 3SFVA 2PZEA 4LC9A 4F3CA 4DLXA 4HDSB 4A2PA 2V97A 3LBNA 3E9ZA 4RY2A 3UXHA 1LF0A 4Q9HA 4C6HA 1TYAE 5A4FS 8ADHA 5LU9A 1L2TA 2A0KA 2ICAA 3OURA 2F1HA 3KZVA 4RA9B 5D3MA 5DNAA 3ZD9A 1YVEI 3DMFA 3NQ41 5KNDA 1J7JA 2IXAA 3FSGD 2XQJA 2E87A 3Q0TA 1PQWA 1O54A 1TVEA 4XFJA 4EJ2A 2VPQA 4BNVA 5KIAA 4ZOLF 3VNSA 4DLAA 3C3CA 4RPJA 3KVNA 1FEZA 4C4AA 4EPTA 1AXEA 3PQ2A 3EZFA 2NX2A 1GNVA 3OIGA 2V9PA 1Y8CA 2C7VA 3TL3A 1X3LA 1NQOA 1E9VA 5BSWA 4NU8X 4ZOLB 1ZD3A 5HQTA 5DWDA 3R5KA 2NP7A 2YFHA 1SUDA 3ENKA 1Z0FA 4WLEA 4Y6OA 4YCJA 3GLFE 4DR7B 5G1OA 4AS1A 2EERA 1NVVQ 3JATA 4O0MA 3H5RA 2B4YA 5BSVA 4YRCA 4CDMA 2WRZA 3TAUA 5DBGA 1I2DA 1XPJA 3UBMA 2VATA 5T4EA 1PD1A 5PNTA 3WSVA 2DYKA 2B25A 3BL8A 2FEOA 3GGDA 3PRJA 1NNSA 4O2AA 1UL1X 5SYMA 4EY4A 4ZEMA 2X0KA 1I7NA 1W4LA 1UDRA 3FOFC 1A5TA 4JR2A 4DIMA 4IKEA 4H3VA 1L5GB 1IYZA 3ZIAA 4BTVA 1XZGA 2CJPA 5JAHA 1NG9A 3DUFA 1Q6YA 1GY8A 1JLHA 3F7NA 1J8DA 3KP1A 4RC9A 5JUWA 1EFVA 1CUIA 2G82A 1NXXA 2PFSA 5FQOA 2H3HA 2ZR0A 3RR2A 3TOZA 4NJEA 1SUAA 2IF2A 2Q4EA 4NOJA 1T0JB 1ZK4A 3MWEB 3Q5EA 2AJBA 5JCXA 4UMVA 1WW2A 5F7ZA 3U7IA 2YJ3A 4K9DA 4E5KA 5CBPB 4M22A 5BNTA 4HQFA 1F0KA 4BNIA 4O1IA 2V98A 2GJSA 2PRJA 3JX9A 3L4BC 2CL7X 1NQVA 5FYDA 2PZ8A 2CMFA 2PWBA 2XUZA 2PANA 1BN6A 3Q7IA 4LDJA 2C07A 3T5PA 3CVUA 4OQDA 5TXGA 4NAUA 4CDNA 1HYHA 3R6GA 1GCAA 2VOJA 4PPFA 4RW0A 5DSXA 4ZRNA 3RO7A 4CMJA 5C7LO 4UTNA 3CIOA 4RSGA 4ARCA 2XGMA 4HAYA 5BPFA 2JIDA 2QN7A 3HO6A 1I0LA 1KMMA 2QRMA 4C7OB 4N7JA 2O20A 2GWRA 1E1RA 1HX7A 4DR2B 4QTUB 4OVKA 3VU9B 5B3JA 1TECE 2VJQA 3B1WA 3NPAA 3OZTA 4NATA 4G67A 3I64A 1RM0A 3CRNA 4MJLA 1N2XA 2FYTA 1OKKA 4MTCA 2XKJE 1ILWA 3IQGX 4YAOA 1Z33A 4NS4A 3S6JA 3WFIA 2FR8A 2QRPA 2HWXA 4UASA 3AX6A 1Y1TA 3SJCA 2ZUFA 4J4HA 4U7HA 5C34B 3AW8A 2D13A 1CCWA 3I4FA 4URWR 2ID7A 5CFRA 1Z08A 3EPJA 1CJUC 4MVJM 3FZQA 1I9GA 2BFCA 3KJHA 2J6IA 2ZRIA 3QBVA 4W7SA 2BISA 4ALKA 3MWJA 4OHVA 3R9XB 3N7UA 1LS1A 1B8VA 1JU3A 3THXB 1H1LB 4NCIA 3PGVA 1Z5WA 4OXNA 3JTEA 1U0LA 2WJAA 1Q12A 2W58A 2YN0A 2R4TA 3CQ9A 3HVUA 3PRYA 4IRMA 4MYDA 1NG1A 5ALZA 5I7EA 4FOTA 1E4EA 4EEZA 5M2QA 3RVRA 3L7IA 2Q4RA 1JVNA 4KLNA 1ORVA 1PT5A 2PX0A 3P0EA 3WJAA 1RXEA 2H59A 4XKJA 4Z1MA 4ZCSA 5FR2A 1KNXA 5IEBA 4IV5A 4NDAA 3AKDA 4RADA 1MO3A 4WJKB 3U3MA 4E5PA 3KSRA 4WOBA 1NRXA 2G71A 4D2IA 5JDCA 3PUHA 2CCJA 4UEOA 5GGXA 5CEJA 1XDGA 1Y8RB 1RHKA 1MPXA 2VP6A 4UXHA 3IPAA 1RLOA 4DLUA 4RZSA 1PK7A 1TADA 4DAOA 2HQ1A 3Q8WA 3LPLA 3C70A 2BP7B 3W3AH 3AEKB 1P62B 3ZKWA 4IIHA 5KOHB 3A25A 2Z04A 3BK2A 1U3TA 2DUNA 1L5QA 1UT6A 3E58A 3FB1A 3JQ9A 1QPZA 1WF6A 2YBEA 5ALPA 1UDCA 2PGOA 4WZ6A 3MT8A 4OGFA 4FFWA 3L7CA 1WCYA 5CIWA 5AK5A 1EAYA 3ZZNA 2QM7A 4H27A 3TL2A 3VZCA 2Q28A 5IKEA 2K5UA 4DNQA 1ZW6A 2UVQA 1FP2A 3U4AA 2D2XA 1X14A 2GYYA 3IAFA 3PITA 2DWOA 1UC4B 4GKJB 3B6MA 2HO4A 3ON5A 4ND3A 4R4JA 1D03A 1XZ8A 1YOVA 3RLFA 3F98A 3IP1A 5TNXA 3KZMA 4PNEA 4JB0A 4MUMA 2WWYA 1YQEA 5A0TA 1Z26A 4AYXA 4J6EA 4ARBA 4PGHA 3KJQA 2E48A 1QAMA 2G1AA 4Q82A 2G9VA 4R2WA 2OGWA 4YWJA 2OBNA 1T8UA 1NBME 1VE9A 4B7CA 3A1UA 5B53A 1W85A 2BCEA 5JZVA 1UOQA 1R4NA 4Z9XA 2KBEA 3QOXA 1FQJA 2ES4A 4MVJI 3TZ6A 3B5EA 1Z75A 1NTRA 2Q6OA 3OOYA 4W5HA 1EDDA 1YZGA 2B0CA 3PXAA 3KTAB 4RY9A 1T9GS 2J3LA 4S2UA 3ZDXB 1NMEA 2DQKA 1JWLA 1KEPA 4PW0A 4C7KA 4U7GA 1B8PA 2MR6A 4A2CA 2PA3A 2GM4A 2WU3A 4FMDF 2COUA 3PFFA 4US0R 3TD2A 4DCOA 4M4SA 3OJWA 4HZUA 1V1JA 1F4LA 4MYSA 3MRSA 1LWNA 1ADJA 4MMXB 4S12A 2X86A 3CXRA 1WQ1R 4GDFA 3FUXA 2R97A 1PO7A 5AIAA 2X1HA 4BVGA 1E1CB 1M1NB 1XV5A 1RAIA 2KLBA 3DVQX 3MJEA 3CLTC 3NHBA 3PEEA 4G41A 4IGFA 4LX0A 1TLLA 3VNQA 4LMAA 4IKPA 3CNLA 5CYPA 4LXTA 5C32A 2Y76A 4OJMX 1X8JA 1U0EA 1VXOA 3GVHA 4NP6A 5BUCA 1ZJYA 2IKSA 3N0VA 4YV0A 1FU7A 2YWJA 4JVSB 4CCAA 1OT5A 3F9CA 3KU1A 4X3PA 4ZXPA 2PNJA 1O03A 2G9QA 3KKPA 4HB3A 5KPDA 4US1R 5JQGB 5F1KA 4TSRA 1Z8NA 1V8FA 3AVQA 4R2XA 4CLEA 2PUEA 3FX2A 4WFJA 3OAAA 3WFZA 3UJPA 1NLFA 3W9UA 1TQHA 4LNAA 1MJHA 4WHMA 5L6LB 4O59O 5CTAA 3EIEA 5CDSA 1MO5A 3WNQA 4EO4A 4FPXA 4KXNA 1CR6A 2IS4A 3TCKA 3G5AA 1KRHA 1UEXC 4HLUC 5LYJF 3UPTA 3ZTTA 3UANA 1UODA 2C03A 3KQYA 3N70A 4Y3UA 1AUOA 4ZEWA 4ABYA 5JMWA 1GCOA 3ORSA 1F4VA 4GWGA 4LWQA 4O5AA 2ZIWB 5LUAA 4PN3A 3IB6A 2B94A 2LCFA 4BV9A 3DB2A 3GEMA 3D3NA 1ENZA 3ZBTA 1XA3A 2VBGA 4CF6A 2NZXA 1UT8A 3DCYA 1SVUA 4YGXB 1LBHA 1HQCA 2NW6A 4ND7A 4ASUD 4TLBA 3MT0A 1Q0SA 1QFJA 2PKRA 2CFIA 2ZWAA 4WKOA 2Q7XA 1HDXA 2VR1A 4L5JA 4ZI2A 1FXWF 4W6ZA 2WOJA 1YHZA 4FGJA 3Q0IA 4I1OA 5LKAA 3OC6A 4K87A 2PDAA 8LDHA 5DHTA 3IIEA 3NKFA 3TCXB 3GJ8A 4DMHA 3OZDA 3K0FA 1R10A 1Y7LA 2F00A 4PZEA 2WF8A 5BW6B 3DLIA 1RTKA 4HDKB 4EUFA 4ZHQF 1I7QB 1GVNB 1O6GA 1SWWA 5JNSA 2PLFA 1Z07A 1OBOA 2HA6A 2BGKA 4MPTA 4MUAA 4NZYA 4L9SA 3WLRA 4AJOA 4AI6A 2LKCA 4LHSA 1N9GA 4S1NA 1VMKA 4CHGA 2X0RA 2IHBA 2YNMC 1NX9A 1UJ2A 1BXKA 1ZMOA 1O7JA 2IYNA 1S2OA 2IEGA 3ESBA 3ITKA 1FDUA 4JOSA 1RWKA 3OFSA 2GUGA 3NCHA 4UARA 2G88A 4UCXA 4CU5A 4RL4A 4W9MC 3CEHA 5EHXA 1J20A 1IY2A 1GZUA 1AGYA 5HS6A 5A5EA 2DAPA 2VT3A 1RJ9A 1CJCA 2WAAA 8GPBA 1L1RA 1UKYA 4HWPA 4ZKEA 1CSEE 3BE8A 1HDCA 1OWPA 5EYPA 3W7BA 5K8IA 1U5BA 2A7XA 2GARA 2GF0A 4LDRA 1XQYA 2WA2A 3UHPA 1KYIA 4GI1A 1KAOA 2IT1A 3K9CA 4MGZR 1MX9A 1YKGA 3ONVA 1KOLA 2W2KB 3I9LA 4RNCA 2II6A 2VF8A 3BS4A 1G17A 1VMAA 2E18A 4LGMA 3NOOA 4INOA 2Z2KA 4JA2A 4M54A 1Y8QB 5J5AA 1ZCZA 1MMFB 2HT6A 4U00A 2WTAA 1XPRA 3ICVA 2RKBA 1GT91 4NQZA 3M1AA 5JPDA 1KYZA 4N3AA 2XPCA 3OTIA 4BO5A 3GA5A 2NUPA 5E3IA 1ZMXA 2FPKA 2Q5OA 3QLVC 3ANNA 3L9XA 3RKSA 4B3SB 1LPOA 5F5NA 3OM0A 4NS1A 4YAJA 4HQ6A 3VKWA 1HE1C 1EFRD 1I6LA 1VZ2A 1XFAA 2A1TS 2H1RA 2YHSA 3EJWA 4N5DA 4JSYA 4Y7CA 5J3JA 4Y2YA 4F91B 3QXHA 4PFKA 5FUBA 4MQFA 3TZLA 1E3EA 1ZRHA 2NZ8A 3EVNA 1BX3A 3QEKA 5CT8A 4LE1A 2ZRHA 3IERA 4DGSA 2UVDA 2CF6A 4L8GA 4P4SA 1EM8A 2XMZA 3K9QO 2OOSA 1O95A 2X15A 2HLHA 1OV6A 3MTQA 4KRGA 4RGBA 5CH8A 4E30A 1SFRA 4IMRA 4O2AF 5GIOE 4FDMA 4G97A 3WO0A 1EI9A 1G63A 4FFSA 3ZE2B 1V8OA 2NO4A 1VM6A 4M1QA 3WK5A 5EPOA 3OMXA 2JFNA 1PK8A 2Q27A 2WINI 2ZUEA 4JC0A 4NCXA 1HBJA 4U7JA 2VQ6A 1B2RA 4HEA1 1RWMA 4IL5A 4XUDA 3V34A 2JVJA 3I1FA 3RHFA 1FBTA 1PQYA 5LQSA 3S2SA 3W6PA 3PF9A 1BTOA 1U80A 5DGTA 2NUTA 5SZIA 4IHJA 3V3TA 2PBFA 2GCGA 4BB5A 4A92A 2P7IA 5K3EA 3GVCA 4RK5A 5KNBA 4M0FA 1NMSA 3DM5A 4KQIA 2QUIA 3NIDB 4Y98A 1C9JA 1A5SB 1PVDA 1WMAA 4ZOAA 2FI1A 1HG0A 3HB0A 4BKPA 2PJRA 3ETLA 3G9QA 5DVZA 4RK7A 2YVUA 4KWIA 3WGLA 3ZW9A 2XRMA 4J9UE 4L4RA 4EB3A 3ZDZB 4TQUS 4S05A 2BEVA 4HKTA 3PNKA 3ROKA 5K8VA 1F2UA 2N1MA 3WK9A 3L0ZA 4R5HA 4D4LA 1RLJA 2J4DA 1PSZA 3AI7A 4NCNA 5AT1A 3ZNQA 4WCFB 3LDUA 2VXYA 3Q85A 4M76B 3LUKA 3E2MA 1U8YA 3UB3A 1ZUIA 4DA4A 2JGIA 1B00A 4MOWA 1TK3A 1FUUA 3HDQA 4QICA 4F86A 4FNGA 3OU7A 4LXHA 5KVCA 1PS9A 2FW1A 4U7PB 4AJHA 3ZJTA 3G2IA 3QEMB 3LT5A 3HJAA 2BYTA 2P9QA 1VKHA 3OQNA 1CZUA 3VNAA 3AVOA 4RK6A 2JFOA 4DUPA 3D7KA 4Q3LA 5GVRA 1M7GA 3EXHB 2DUWA 4KYVA 3KPVA 5BSKA 4CJXA 1UWLA 5B1SA 3MMZA 2YS6A 1IRXA 3B8EA 3HKCB 4JLKA 1G4HA 2VUUA 3DT6A 4LMRA 3RC1A 1L8QA 3UJ8A 3KR2A 3D1LA 1KDPA 3JTMA 4YP0A 2RI6A 2EIXA 2F3TA 3PUJA 1HH4A 1VJ5A 2QD5A 3TOCA 4W8GA 3RRYA 3E27A 3TSWA 3EEFA 3IJPA 3WOHA 2I4MA 1P18A 1W75A 5HK9A 2Z83A 4ON9A 3I39X 4NENA 4BFLA 2XUQA 3BFVA 4KR0A 4CIAA 4Q66C 4BWGA 3FKSA 2BUBA 2P7HA 1GSOA 4JQZA 3WA7A 3C3DA 4EK9A 1KZ4A 1UXIA 1B0UA 2FZKA 1X39A 2WTNA 4MQLA 3DKPA 3ROQA 1L5ZA 1V47A 3N2EA 3NCTA 4PPQA 3UPUA 3P2IA 4DR4B 1WDTA 2W4QA 3NDPA 4J8PA 4H77A 3SF8B 1K6JA 1TM3E 1LTQA 3OHMA 1TEVA 1CJVC 3DEZA 2VYFA 3GROA 4LOKA 4ZN6A 1TQDA 3MUFA 5CEFA 3X3HA 4ITVA 3E5HA 1SVSA 1CUCA 1EFUA 1JQLB 2F62A 4JZYA 1Q7CA 2FHPA 4CQMA 4F7WA 2ZIUB 2IPLA 5JATA 4XWWA 3ZU4A 2VYND 3ZHRA 4HN9A 4D8WA 4EI7A 2AKEA 5HXAA 1QVVA 2WWFA 3DYVA 3LBYA 2G8LA 3OLQA 3RTDA 2HRCA 3R7DA 1SXIA 1AKVA 1UKCA 3I5XA 3F5QA 3H8SA 2D6FA 2WOOA 4FYKA 3VPGA 3D1VA 1DRVA 4O08A 3TMYA 1WU7A 3REOA 4QYWA 1F20A 1Q84A 3I76A 2HTFA 2OM2A 3QI2A 1OB2A 5FWNA 1KPHA 1ZD2P 1PEYA 1PS8A 2AF4C 3P0JA 1YDFA 4GEGA 1KARA 2ZPTX 4I8XA 4WADA 1NP3A 4DMLA 4FMPA 1SUWA 3HP1A 4TV8A 1OT3A 1YQ9A 2ZWVA 1B6SA 1F17A 4NI5A 1MAHA 4M0MA 1K98A 4HOYA 4AY6A 2LIPA 1I4EB 2ZYUX 4TXJA 4RTPA 3WLIA 1OBHA 4PAOA 5F7JA 1N6PA 1XCJA 2D1FA 2OO3A 1KEEB 1DKPA 5H8WA 3E22B 4I19A 5IG2A 5U1PA 3NBUA 3N0XA 3PC4A 1GG2A 4JXZA 3AP1A 1VBNA 5EWJB 4LVUA 4URUR 2ZZNA 3PJFA 3HU3A 4DA9A 5B1YA 2JD1A 3QU4A 1HE4A 1ZEMA 2WFLB 4R3NA 1R0WA 2BTQB 5EJAA 1Q19A 1T3HA 1DWQA 1ULUA 3A11A 3CJQA 3M49A 4MV9A 3SNHA 3ZHSA 2ACKA 3UXMA 2VK2A 3KSUA 3UAYA 1VTKA 1ZM9A 4WUTA 5HR5A 3FHOA 3D2BA 4D0GA 1JAZA 5F5XA 3HCDA 2A5FA 2PGAA 2GQ0A 1JQDA 3F46A 4B33A 1YJAA 1DUSA 4UZEA 2VN8A 1SA0B 2HUPA 3TR0A 4HVLA 1XNRB 4I81A 4B3BA 3MHTA 3NPMA 1GPNA 2P8SA 4FFLA 4J91A 3OCXA 5AVVA 2QVGA 1WPXA 2OORA 2WWGA 3AF5A 3SZGA 2ZJ6A 3GJSA 1Z68A 3WQQA 1GPAA 2DHQA 3LZCA 2EX1A 1PFGA 3LX5A 4O3MA 1Z29A 2X0IA 4OX9B 3L6BA 1YQDA 1ID8A 1AHIA 1OLXB 3FHJA 1Z56C 5A6SA 1R2QA 4G6ZA 5E3HA 4RORA 4PHCA 4FZ5A 1BHQ1 2H1HA 3GPBA 3PHJA 4C22A 4JEIA 2FMKA 3LT2A 1V5EA 4BNNA 3P9XA 2TYSB 1ULSA 2JRCA 3A10A 1SC6A 4Q7LA 1PKEA 4MRRA 1NX6A 1EDZA 3TRJA 1KIAA 1W5FA 4K5QA 4AZ0B 1FP1D 1CXZA 4ZVLA 3U7JA 4IGEA 2QTNA 4AMYA 3B7GA 3QBDA 1ZJ4A 1XVIA 1JN0A 3DZDA 3VR5H 5FLXA 1QHFA 4OB6A 3SXUB 3FNGA 1ZEJA 4C4RA 4DMKA 3FRIA 1WHTB 1DBSA 3S81A 3KTOA 4Q19A 2B5OA 1U9JA 3B20A 2Q45A 1OWLA 4MQUA 3AVTA 1FS6A 4IO1A 1XCMA 2Z5VA 5CA0A 1D6MA 2VPZA 2OXEA 4LYFA 4J1TA 3BBPA 4FGZA 4INZA 3D8UA 2VF5X 3B6JA 4YRGA 2JDIA 1X8LA 3NDIA 1RW4A 1U3WA 4MI1A 3O2QB 4EBFA 4LJ4A 4UTVA 4OJQA 4RMNA 3DWIA 3P9CA 3P9QA 5DHQA 4Y1RB 1E3DA 4Y2RA 4B5KA 3GT4A 3TO5A 3SX2A 2WYIA 2XVAA 2Z2IA 3KLMX 4CKWB 4LOJA 1ISIA 4CM9A 4JQSA 2HM7A 3FUTA 3DEFA 1MOZA 3ZWAA 3WKAA 2CYCA 3WWYA 1MGPA 5A7GA 2C4TA 4D3FA 3B6EA 1H2EA 2ZBQA 1HUQA 3G59A 2OD7A 3JRXA 1FL9A 4GU5A 4Q3DA 5IU6A 2I4LA 3OMWA 1RM4A 4IGAA 4ZCTA 1HNZB 3UMMA 3EW9A 1M5RA 3TRIA 4G0NA 2JGMA 4ARAA 1YRWA 3OQMA 2BBWA 2YWEA 3BWDD 3DTVD 2B21A 4JMLA 1TJYA 3EPKA 5FL7A 4P80A 3JD2A 4A26A 1VIAA 2J46A 1RLMA 2ATXA 4MR9B 1E3JA 4A6XA 1OXVA 1OXXK 4RFSA 2JEYA 4I5DA 5JRZA 2EIHA 4OXXA 3UHAA 2XV1A 4D82A 2GBGA 4QGSA 3O8RA 4KN5A 5E1BA 1M1UA 2DH6A 1J8VA 4DZRA 4YA6A 1PR5A 1KY2A 3QBTA 1RPTA 1JJ7A 4HRXA 3UT5B 1KYXA 2YOGA 2ZE6A 3JARA 3D6UA 1ZK1A 3QH4A 2W4IA 5I7VA 4AKIA 2OV4A 5CLQA 1NMYA 2C20A 3BJIC 3DEHA 3OM9A 3ZHYA 5H83A 1HYEA 3CPJB 4E09A 1BYUA 3GLRA 1HFKA 2JW5A 4EYEA 1D0SA 2CWWA 3TAHA 5JZBA 2QTMA 4RLSA 1I5RA 4QOIA 1ZO8A 3OJCA 1CNEA 1X19A 4D02A 2JKVA 2FDCA 1VBKA 3AINA 1QGDA 4ZI7F 1KOJA 5LMCA 3DHVA 1AZTA 4R9VA 5C8XA 1BXRB 1E6EA 1KPGA 1FNSA 3T9EA 4GYJA 4JB2A 5AXBA 4JA0A 1Q11A 4QFBA 5J47A 1RPAA 2NO0A 2PGJA 3I52A 5T8KA 1BCRA 3S2GA 3KLOA 4PZ9A 2EYQA 1E2LA 2AKYA 2PKQP 3RRMA 1PJ4A 3E61A 3THRA 3R7NA 1OYVA 4QJIA 2J32A 1W73A 1X1EA 2I7VA 3MOSA 4Q9KA 2Q2VA 1A4XA 4EHFA 1G7CA 3IO3A 3JSXA 5EL0A 4L28A 2GCOA 1PGJA 3R23A 4X66B 5KYVA 3PF8A 4FP9A 2F3PA 5THXA 1SOVA 5EA2A 2KI5A 4ZHQB 1E6LA 3L7OA 1FNMA 2YXEA 1CF2O 4YYZA 4MHTA 2DU8A 4YACA 2EOAA 1RQPA 5G3YA 3BJZA 4ZYZA 2O3UA 1CUDA 3KKMA 4FDAA 4AJJA 3LLSA 1Y6FA 1S2IA 4PRKA 1RWPA 3ESDA 2QSUA 2CJWA 3HEMA 5FPPA 2PWYA 5BV2P 3LRTA 4E0BA 2WD8A 3FPKA 2V7UA 3T0GA 3EYWA 1P1JA 2YR0A 4RDXA 1H0HA 5J4YA 2KLHA 1Q1BA 3CE6A 3F5SA 4JJFA 2G80A 1K6EA 2EKDA 4U5XA 4F9TA 5J4HA 3R8FA 1FFYA 4KIJA 2VAXA 3MK31 3RIYA 4QE3A 1E3WA 3F6CA 1L4HA 5AJZA 1AXGA 1SVKA 4KDCA 3SU8A 3M6XA 4C1NA 2O8FB 3WK8A 1G5TA 2WSMA 1EGVB 1Q17A 1AZSC 1OFVA 2YHIB 4HQKA 4Q9IA 4Z4HA 2ZJFA 2CL0X 3CGGA 2PSEA 3OCCA 4R7GA 4EPRA 1UKEA 2C7GA 4YMGA 4DWWA 1HORA 2NXJA 3ED5A 2X3YA 1PR9A 5I9TA 1ZQ1A 3KX2A 3U3XA 1TEZA 4BMVA 4RHCA 3B1KA 1SU7A 3O8QA 5HE9A 3N75A 4A5SA 5CFQA 1MFZA 4WXPA 4LW8A 4MVJE 1MO6A 5B6IA 4LXQA 5DBHX 2DKOA 3UFBA 2OGSA 4OUKX 4LK2A 1C0EA 1DAEA 1JEOA 1P81A 1FVXA 3MB8A 4MAMA 1XOIA 3HRKA 4AN1A 1OWNA 2GAAA 4LZZA 3RG8A 3W2FA 4MNTA 5JYBA 1TO2E 2CUNA 2C9OA 3FCUB 3MWGA 1JEYA 4EYKA 5K3FB 3F90A 3BSFA 1JDUA 1RBZA 3K70D 1JA1A 1JG3A 1SH7A 4CLRB 4ZYVA 2YWRA 4U0JA 5ICMA 3UV6A 1EGMB 4M0CA 1Z25A 1UIMA 3SQMA 1DWOA 2HHJA 1USKA 1X9GA 3QVXA 4JVOA 4WWHA 3V80A 4MS4B 2BHRA 4XW2A 1ZAYA 2KYRA 1QLJA 1HSOA 5IM4A 5AH0A 1IXKA 1G2OA 1V9LA 1ZCBA 1EINA 3QEAZ 1NBMD 4UVEA 2A5JA 2WVJA 1NBWB 4EHLA 4O4JF 2XUAA 1CQIB 3D8NA 1E2FA 3QVGB 1F38A 5C5DA 1NLUA 4H4CA 5AHXA 4CFYA 5KYYB 3W78A 2WILA 3ZV7A 4XIYA 4DIKA 3OFND 3GJRA 3OD1A 1XWIA 3LA6A 4RFVA 4LRTB 3SQDA 1HG1A 3NAZA 2PQMA 4GUAA 3FYUC 4IEFB 3R3VA 4OHOA 2I7DA 1XA4A 3AFIA 3LQ4A 3WWCA 4JBIA 3BILA 3HNRA 4HX9A 3I45A 4PRZA 4CG3A 3TX2A 2PUCA 4RIGA 2QYTA 4A27A 1HO3A 1GGNA 1Q1ZA 2NVBA 3U17A 3P5BA 5BWMA 1UBMS 2HV8A 2P8JA 6AT1A 4QXOA 1V16A 4WINA 2AG5A 4W5TA 3ICOA 1AQIA 4P22A 5FR1A 4Q4HB </