2ZJOA

Crystal structure of hepatitis c virus ns3 helicase with a novel inhibitor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
444
structure length
444
Chain Sequence
NSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Discovery of Triphenylmethane Derivatives as Novel Inhibitors of Hepatitis C Virus Helicase
rcsb
molecule keywords Genome polyprotein
molecule tags Hydrolase
source organism Hepatitis c virus (isolate taiwan)
total genus 142
structure length 444
sequence length 444
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 2zjoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjoA01
1RRPA 4HYYA 2VSXA 4OHVA 4TMVA 2OLJA 1NNEA 1UKEA 4RZUA 1Z6XA 4C7OB 4EAQA 5GJBA 3S1AA 4OKSA 3D3QA 3ZIAA 2VLIA 2CMKA 2F55A 5FPSA 3SYLA 1H65A 3CUEF 4PAMA 2Y8EA 4WIAA 1E99A 2C9CA 4C0AC 3WXMA 1KAGA 3T15A 4Q66C 3PUYA 2ZE5A 1Q3HA 2AKYA 4LGMA 3C41J 1A1VA 4KAXA 1R0XA 3I92A 4PSAA 3Q8XB 4ZCIA 3C16C 1S3SA 2IA5A 3QBTA 3MWJA 1G7CA 2GJKA 1E9CA 2IYQA 3VMFA 1W46A 3IGFA 2DB3A 2IYRA 1E3MA 1DOAA 3BFVA 3ICEA 3BFKA 4X8HA 3G82C 1PJRA 2I1QA 4Q21A 2H5EA 3SFZA 1F2TA 2YWHA 5HZHA 5DHAA 1E32A 1W36C 3TNFA 1AZSC 4HAZA 3AVVA 5J4VA 4D0NA 4QJ3A 2EW1A 3QXSA 2YV5A 1JNYA 4PXAA 1FTNA 4IEEA 3SEAA 1EESA 4P3YA 1UKZA 3ZZUA 4I1SA 1KI8A 4HAVA 4KBFA 4UJ3A 5G40A 2HCBA 3BB4A 3IBYA 3PEUA 4F4JA 1UDXA 3NVAA 3NDPA 3ADBA 2OILA 2F9MA 3SJZA 4LPKA 1OFHA 3TVDA 1GL6A 3KQLA 4QGAA 1RYHA 3AVYA 3CRVA 4G5QA 5TY0A 4B3FX 4BLOA 3AKCA 1GL7A 1Z0JA 2QAGA 5AJWA 3U4QA 1IQPA 4M9SA 4TTRA 4PSKA 2JCSA 2HCJB 3CR8A 4I1VA 1CXZA 2AFHE 2J0UB 4DLSA 3KFXA 1OH8A 2CCKA 3K0AA 5FOTA 1TQDA 3KQKA 1U0JA 3F3YA 3PITA 4RVCA 1FX0A 4A82A 4JLMA 2V9PA 3MSXA 3LW8A 3RSOA 2GCPA 3H2YA 4QHSA 3K09C 2MSEB 4LBYA 1KMHA 3HU3A 1GKYA 4Q4AA 2FE4A 5AWFC 3SJCA 4F4CA 1DAFA 3C4JA 2AWNA 4MYUA 4N3NA 4A0GA 1F5NA 1Q1QA 2ZJ2A 2AL7A 3BOSA 3BH7A 3GJ8A 5FOVA 4C0QC 3OAAA 1H8HD 2IYTA 5G53C 4W5WA 4A0FA 2G0TA 3D8BA 5KPDA 1KK2A 3W6PA 2ODWA 2WKRA 5BQ5A 3K0CC 4XIGS 2RH5A 1IAQA 4F7WA 1BYIA 2JGNA 3LA6A 2JLZA 5TXGA 2WOJA 1KI6B 4DEXA 1P2UA 4BFXA 3EAQA 1NLFA 4JVLA 3GLIE 3AUYA 1A2BA 1E1RA 2O5VA 4TYNA 2FSIA 2VHQA 3FTQA 5F3WB 3B60A 1Z3IX 1OIVA 4BEBA 2ODEA 2WWHA 1BOFA 4NCHA 2GNOA 1II9A 2D7DA 4A2WA 4GFDA 1JXOA 1K6MA 2PCJA 2GWHA 2VF7A 5L3VA 3SR0A 5FPKA 1PLJA 1CKEA 3FPAA 1KSJA 3QEOA 4AYXA 2R6FA 2GVDC 3WNCA 1GNQA 1S96A 3P32A 4E09A 1TTTA 3BWDD 1QHYA 4O0MA 4V02A 4JL6A 2QG6A 2AD1A 2ZRFA 3UATA 1OE0A 1SKYB 4JZKA 3MG9A 2J3EA 2OLKA 3GLHA 3QKSA 3GMTA 5DISB 4PPGA 2YKGA 2QQ0A 1SVKA 5EZ5A 2H7VA 1GDDA 2VSOA 3CRQA 4RD3A 2PMDA 1YKSA 1NKSA 1NLYA 4DHEA 2WTUA 3BJIC 4ON9A 4B2LA 1KJYA 2CLCX 1SXJC 1VG9B 1XCMA 4RD0A 4ZKDA 4MA4A 2ZRAA 4XH9B 3TH5A 3T12A 1G1MA 3U3JA 3B9PA 4IVPA 1D2EA 1OXXK 3NBXX 4NU0A 1P73A 2LKDA 1BYUA 3L0OA 4D4KA 1II8B 3VU9B 2FPLA 4CRWB 2UZ3A 4HI0E 4NKRA 2OBMA 5EUMA 2ZXUA 1FP7A 3T1VA 3EW9A 3W5IA 2J46A 4Q03A 4WVFA 3RWMB 4A6XA 1E0SA 4B32A 4R2HA 1VHTA 4ZI2A 3GEEA 2QP3A 1CJMA 4P32A 5IK2D 1S0UA 1IN4A 1DARA 3WHKA 1XTSA 3LLMA 3OIUA 4ESVA 3R20A 1XFAA 2OXRA 4JLBA 1G3QA 3C14C 1EWQA 5DI9A 2P5TB 5E3HA 2AN9A 1ZM9A 4U7DA 1Q3TA 3K09A 4LOAA 1W44A 5JBQA 4M1YA 4OQMA 1KZ7B 1EFCA 2Z6VA 5A0FA 3T06B 2GCOA 4B35A 2B7CA 4GZLA 1QHIA 3GJXC 2BBSA 4C0KA 3K0CA 2YHSA 5EE5B 4JL5A 2NPIA 1L4UA 2HXSA 3NXSA 3NIBA 3C15C 2WWXA 2ANBA 4RFSA 2IWHA 1BIFA 3TLXA 4ASUA 4F93B 1GRNA 2XNDA 5CDFE 3G0HA 1VG8A 1VPLA 3CNOA 3NBYC 1BMFD 1IOZA 3QKRB 2BJVA 4QRHA 1Q12A 1KZGB 4PAQA 1GRQA 2QU8A 2QRZA 4PANA 2Q6TA 1W4RA 8OHMA 4LHXA 5GVSA 4UNNA 2PL3A 1IY0A 3CNLA 5KOYA 3I73A 5H70A 2RGBA 2QEQA 3TQCA 3PFIA 3AVUA 3A1TA 3EC2A 3A4NA 4MRVA 1KKLA 3TBKA 2VSFA 2FX3A 3PEWA 1BH2A 5SZHB 3AKDA 2QPOA 1G8FA 1P9RA 2R2AA 4HB2A 1WDTA 4Q9LA 5CYOA 3LBIA 3QIAA 1ZW6A 2GXQA 2JJ2D 4HZIA 1XPUA 2GAAA 1XJ0A 1ZM4A 2GJAA 5G41A 1HURA 2WIAA 2XB4A 4Z8XA 3LX8A 5FR2A 2DFTA 3G5UA 4KFUA 5K8IA 3B5JA 2CK3D 3EZ7A 1UF9A 3OF5A 4IOLA 1CJKC 5B58C 3DMDA 3IHLA 2QTVB 4Q18A 1GUAA 4M22A 1SVWA 3TVTA 3VHXA 1QBKC 2QM7A 5AUQA 1KK1A 5EZ6B 2WM9B 1Z2AA 2C98A 3V4FA 1OLOA 4CF7A 2OG2A 2WPDD 1QG4A 1FUUA 2FWRA 1AA9A 2ERYA 3B85A 4C0JA 1G21E 4M53A 2BM0A 2HUPA 3MFYA 1NBMD 2XTNA 3W6NA 5JRZA 3A4MA 3AM1A 4LSGA 4B74A 1OYYA 4LJ5A 3A1UA 4NP6A 2ZUCA 4B76A 3U61B 4V03A 1XWIA 5KDDA 3K8YA 2WJVA 2B8WA 2WWIA 4OHWA 4Q1DA 2ZM5A 1JPNA 4Z8YA 2IEYA 2ZVQX 1K5DA 4TZ6A 4P4UA 1FOEB 4Z1MA 4D26A 2ODNA 1AQUA 2V7QA 4JL8A 3WHLA 4QBFA 3CO5A 3ONWA 4Q7JB 4LV8B 4EJSB 2WAYA 2YINC 4R71A 2VIIA 4B75A 2GDJA 4CEIA 1IM2A 4H9GA 3IQXA 4IFEA 4NL4H 4LBZA 3KFVA 1P2SA 4FCWA 4R98A 3OEEA 3RS5A 2ZETA 4RD4A 1W4AA 4R2IA 1S1CA 4FW9A 4KITB 2DWQA 4MYHA 4HSEA 4TMTA 2AXPA 5CYPA 3LXRA 3LQRA 2O8EA 4L9WA 1KDTA 2JLVA 1CTQA 5JZVA 1QF9A 1VYTA 2AKAB 3ZS9A 4TL7A 5TMPA 3A6PC 2V1UA 3EPHA 3WMGA 1E2FA 3K70C 2PLFA 3LBNA 2RHMA 4LPSA 4A9AA 4OI4A 1AM4D 4M4SA 1C4OA 2FZLA 4URYR 1OSNA 2QSYA 3U5ZB 4IDOA 5JS7A 1P7CA 2Z0MA 1Z47A 3U6KA 3GLFA 1TPZA 2G83A 4KBGA 4Q00A 5DNYB 2QY9A 1G9XA 1W0JD 4DDVA 2XZOA 1LS1A 3W8NA 1X8KA 4K46A 4UXIA 3L8YA 1US8A 1VYVA 3TUZC 4G5OA 4EQ6A 2PMKA 4DCNA 1P62B 3B1WA 4DRZA 4IOKA 3CH4B 3GEIA 2ZAOA 5DGXA 2VBCA 3JZAA 1J8YF 1LF5A 2W6IA 5BN4A 1XEXA 4IXMA 4ZV4A 3U44A 2ZYVX 1HTWA 4U00A 1WE2A 2QTHA 3KB2A 1KGDA 2ZJ5A 3AV0B 3NBZC 3SU8A 5KUTA 5LD2B 1Z08A 1D5CA 1ZD8A 1ELOA 5DN6A 3WMEA 4HATA 4D4JA 2YJTD 1WCV1 2WJIA 1P61B 1V43A 2IYUA 1JJVA 2WMOB 1KJZA 1XXHA 2OCBA 5DSZA 4PPQA 1UBGA 3IPXA 3PUVA 4DBLC 4TZ0A 3F0TA 3RYTC 4DLWA 4CYMA 1XEWX 2NPFA 4JVSB 4UXHA 2P2LA 4OQNA 2GHIA 2OEPA 1ZIOA 2QAJA 1SGWA 1U98A 1Q1BA 2YYZA 3LD9A 3T35A 3A37A 2W0SA 3D6TB 1L7VC 4PSVA 3CONA 3KB1A 3U7FB 3B78A 4KFSA 3QVUA 2MSDB 4WZAE 3UANA 4B33A 2AK3A 4FXPA 3EWAA 5KYKA 2VH5R 1E2MA 1R0WA 1G17A 1OIXA 1BKDR 1Z2CA 1G6HA 2OXCA 4ACBA 3BB3A 1WQ1R 3CPJB 4NYJR 2XJ9A 2C03A 4LJYA 4V0ME 5KU1A 1A5TA 2DHRA 3EWSA 4HZUA 3THXB 1HE1C 4XWAA 1MABB 2GJ8A 3CX6A 3I32A 3I8XA 3P4XA 4URXR 1JALA 2ZSBA 3E2IA 3T5GA 3RLFA 1GVNB 2A9KA 4DSUA 4DLZA 3FMPB 1U9IC 1NL3A 3TK1A 2PJRA 1HUQA 3H0KA 3CZPA 1MT0A 1R10A 4KJZA 5KO2A 2D2EA 3GPLA 5JHHB 4POAA 1G7RA 4BFYA 1II0A 1ZC3A 4N1AA 4TTQA 2PLRA 1VCIA 1M7BA 1RW4A 2HEIA 2BOVA 2NO7A 3MD0A 3M4YA 1VHLA 4TQUS 4DXAA 3KTAA 4PQYA 1E1QD 2HF8A 2C9YA 1E98A 4WZ6A 2C9OA 3VAAA 4PZYA 2C78A 1ESMA 4CT5A 3KXIA 4JKYA 1ZU5A 1HT1E 1E0JA 4KXFB 1W5TA 3RWOA 4NONA 4HAWA 3Q5DA 3QG1A 1K8RA 2BVNA 3K9LA 3RHFA 3X1XA 2IBMA 1DO0A 4EPYA 2X19A 3C7KA 4ARZB 4GOJA 3AVWA 4BLQA 1E9DA 4DB4A 2FDCA 3Q72A 3VR6A 1VECA 1HYQA 2EYUA 4M1SA 1LY1A 3H1TA 2X2EA 2GJ9A 3REGA 1R0YA 2W83A 2O8FB 4UNRA 1ZCAA 3LDAA 1W47A 2ZJAA 5AR1A 2NOAA 3THWA 3LNCA 3L82B 2VHJA 1KI1A 2G0NA 3OEHD 4W9MC 3VNVA 4Y0AA 3GLGA 4QGHA 1KO8A 2GJSA 3ICQB 1XCPA 2GZDA 2ZRGA 3AP3A 5CLQA 1O3YA 4YXWD 2RGXA 2Q21A 2OM2A 5FBRB 1D9XA 4IOJA 3KUCA 1J8MF 2ZJOA 2RGDA 4QBGB 4DC9A 4DT1A 5KSOA 5JJKA 4Z54A 2ZS9A 4OI2A 4Q7KA 4JS0A 5AJXA 1CR2A 2IWRA 2QBYB 1NJGA 5J5CA 1F6BA 1LVGA 3BD9A 3RS4A 1NSFA 2ZU0C 2ZYWX 3KJEA 3SI7A 1Z07A 2ZTSA 3GJ5A 4HUQB 4O25A 4TYPA 4RJLA 3O8BA 1ZYUA 1CF4A 3DHWC 4LZZA 2C04A 2XZPA 4DSNA 4PHFA 3IEUA 4Q4JB 2QE7D 3MLEA 3ZVNA 4CIDA 5AJZA 2GXUA 3LBHA 5AJVB 4JJKA 4WAUA 3T1OA 1JEEA 4IVRA 4TLDA 5EP1A 1WB9A 1W4BA 4TYWA 4GNKA 1QHXA 1U9IA 1ZNXA 3QXJA 1R8QA 5BN5A 3C8UA 4LJ4A 3EC1A 3L0SA 2BCJQ 5C2JB 5JCZA 3FMFA 3B2EA 4YMTA 4JVMA 3ND8A 3SQWA 2JDID 1OB5A 1OW3B 3U3KA 2OFWA 2OV2A 4PZLA 2RHDA 2XJ4A 5AUPB 1TU3A 3NH9A 5JEDA 2EU8A 1G41A 2WICA 2N46A 3B9QA 1N5LA 3UPUA 1AS0A 1J99A 4IW3B 4ILEA 2X2FA 1UPTA 4QM6A 5DI3A 3VHLB 3GFOA 4BE7B 3KKPA 5FFMA 1R0ZA 1P60A 3GCGA 2FGJA 1O87A 3I8SA 4CEJA 1DADA 4Q1FA 3ZVLA 3QKUA 5JSZB 1S9HA 4EFLA 3KQHA 1OFUX 3L2OB 2V6IA 1CR0A 4MDEA 1CR1A 2A30A 2ZI7A 1R5BA 1CJUC 5F9FA 2J41A 4JSYA 3T1TA 4M8NE 5J4HA 2WWFA 4LHZA 2KB0A 1PZNA 1AS2A 2WOOA 3TMKA 1P9WA 4URVR 4G5GA 3GJ0A 2FFAA 2C95A 4QNRA 1WMSA 3KQUA 3A1VA 1JR3D 4LJ6A 4BFVA 1EFTA 1YR8A 4US0R 5L3RA 3HU1A 2R9VA 4FN5A 4YMWA 5CIWA 3MAAC 1OFTA 2VP2A 4RD6A 2ZYUX 2XB2A 1E4VA 1W49A 2PT5A 5C18A 1EFRA 2GVZC 2A3RA 3QNUA 4JYCA 1KY3A 5FL3A 4MRNA 5CJPA 1U90A 2NO6A 2P67A 1Z06A 1F2UA 1GSIA 5CLLA 4I1OA 4MYTA 3CF6R 3SHWA 2FOLA 2VP4A 2ZJZA 2IF0A 3WBJA 3SDZA 2IYLD 4F4IA 2ZRMA 2Z83A 3QG5A 4BZXA 2PX0A 2TMKA 2IYWA 3FFAA 3AKEA 1XZQA 5TARA 5HTKA 2H92A 5L3SA 2BBWA 5FPHA 1E6CA 5UKDA 4RD2A 3O8RA 1IN6A 1F2TB 1X8JA 3RAPR 4L16A 3THYB 1KDPA 1CRQA 1S4QA 3WRXC 1HV8A 4US2R 1HQCA 3FKSD 3QPWA 4NH0A 5K8LA 5HZKA 1Y63A 2Q3FA 4LYFA 2Q3HA 1TUEA 1BO6A 1QVRA 4OK3A 5F9HA 2ZI5A 2W2TA 3KZ1E 2P0EA 4NCNA 4QNMA 2WJJA 1YRBA 4LJ8A 1X8LA 1UBFA 1PUJA 3I4LA 4ZDKA 2RKOA 5FBQB 2QN6A 4HEJA 4PC7A 1JBKA 3DDCA 2FFHA 1SVMA 2QT0A 3CB4A 2C77A 1Z29A 3H4MA 4KHZA 3N2IA 4QHYA 1CS4C 1EX6A 2OAP1 5IK2A 2JLXA 1G7SA 1AN0A 3EZ6A 421PA 4P4TA 1KIMA 3OESA 2FH5B 4ZPXA 5TDHA 4ZDWA 3QI2A 1XD8A 2YOFA 4C7OA 3Q85A 4QJ4A 2IK8A 4UJ5A 4CZ2A 1TF2A 3EIQA 3DM9B 4HB3A 3NHBA 1QDEA 3RRYA 4AKEA 1SKQA 1XTJA 1IXRC 3CLVA 5AK0A 3ZD6A 1FX0B 4M9XA 2QT1A 4RKFA 4DJTA 2RGNC 1UDWA 2ZEJA 4BASA 4IJMA 4K81B 1FFHA 3P26A 2FV8A 3U2QA 3GLHE 4HDQB 1NVUQ 4ZO4A 5JWHA 2WKQA 2J5XA 4US1R 1YHNA 5CITA 1R5OA 4BRUA 2I1VB 3ND9A 5KNBA 1KI4A 1GG2A 1Q1EA 2C96A 2JJ8A 3VTKA 4AD8A 5IF9A 1P2VA 2NGRA 3RS2A 2GK6A 1Y3AA 3KL4A 2G1JA 4AWXA 4NYMR 1BMFA 1KSHA 1ZM7A 2H1LA 1MO3A 4N0EA 1KY2A 1RJ9B 3JZMA 4D82A 2R62A 2ZSAA 4MGIR 4FINA 3C5HA 4NYIR 2JA1A 3ASYA 1Z28A 2Q3MA 4FI3C 1XRJA 2IF2A 5H68A 4OQLA 4MRRA 1D8TA 5FOUA 2WWWA 2XX3A 2W00A 3Q5EA 3NC0C 3TSZA 4II7A 4TT3D 3BIFA 5FI1B 1T3SA 2OCPA 3I3SR 4FWTA 3SHFA 1AKEA 3LAWA 1QHHA 2EFCB 2JJ2A 2ZI6A 2ONKA 2IS1A 3EASA 1T0HB 4TQ9A 3MJHA 3U6BA 3U7HB 4A36A 4LX0A 1I2DA 2A5YB 3QF7A 3QKSB 4GRAA 4YDSA 2G3YA 1W1WA 2CK3A 2ZR0A 3O47A 2BV3A 1N6OA 3FWYA 2XAUA 1KK3A 1P75A 2J0QA 4H1VA 2YNMA 4BUJA 4JLPA 1I4DD 2FNAA 1T91A 3QE0A 4OHXA 4V0KA 3W8RA 2CJWB 3IEVA 1Q20A 4Q9JA 2AWOA 4JLKA 3AGQA 1CJVC 1H8ED 5EXSA 1ZAKA 3DM5A 1F60A 2WPDA 1GFIA 1T3HA 3QPVA 2EFGA 1YVDA 1AIPA 1KNXA 1M34E 1NBMA 4TLCA 1CLUA 3B1ZA 4E03A 2R6GA 1ZUHA 1NVVR 1LS6A 4Q4HB 1IXSB 2BMJA 4MRSA 5JWOA 4PFSA 4UNQA 2A5GA 2G88A 4G5RA 5FTMA 3D31A 4MQBA 3BRWD 1XCGB 2HJVA 5JMTA 4A15A 1GOTA 2VHUA 4TMWA 4TWZA 4X8OA 2V1XA 4NPHA 3TKLA 5KSZA 2ERXA 1QHNA 4FMDF 5FI0B 2BC9A 1EG7A 3LVRE 5AUOB 5KNCA 4GP7A 3IKJA 3C5CA 1FQKA 1GITA 3GLIB 2RGNA 1GTVA 2H8KA 1SHZA 1VG0B 1U81A 1VTKA 1KO4A 2VEDA 3KDSE 4Q1EA 4DDWA 3B82A 2ZRBA 4LYJA 4DLRA 4S2EA 5HR5A 1Q0UA 2FSHA 1UM8A 4L15A 2PZFA 2ZSDA 4XWKA 2ZPTX 1NP6A 4MUAA 1SXJE 2WBLC 3X1ZA 1KI3A 3RS0A 4HB0A 4DIEA 1FMLA 1TNDA 3B1VA 1DO2A 2CCGA 2XTMA 3ZH9B 1OB2A 4AG5A 5L3QB 3SNHA 1KO7A 3A1WA 4D2IA 2REXB 5GJWC 2DWOA 5HPYB 1T9HA 1R4AA 2REOA 3PQCA 4A4DA 1KI7A 2VL7A 3AVTA 2YZ2A 2IXEA 2N1BA 1W0JA 3TE6A 3DPUA 1M2OB 3ZS8A 2OUKA 5BXQC 4KSCA 3ZYCA 3VU9A 4BECA 5DO9A 1E2GA 2F3RA 3OE7D 1DAGA 3T1QA 4PQRA 1G3RA 1NIPA 4PO8A 2D2FA 4Q1CA 1XJQA 1GNRA 4MUBA 2JAQA 1A2KC 4YC7A 5C4GB 5J47A 3HDTA 4NYJQ 4BQSA 4A0HA 5JRJA 1XF9A 4GOXA 2WIBA 2F1JA 2O0HA 4G01B 1Z63A 3TAHA 3HPRA 1JJ7A 4NE2A 2ZJBA 3B13B 2EFHB 1ZD1A 2P6UA 3NTUA 1SXJB 3DMNA 1G8YA 3BH6A 1DPFA 4MITA 1FTSA 4YMUA 1TQ4A 3SZRA 1NRJB 3RNLA 4EJSC 3EPJA 1WXQA 4F92B 2F1IA 5KDLA 4C2UA 2JLWA 3A58B 2XXAB 1SHKA 2F43B 4Q4LA 3LH5A 1IN7A 1I2MA 3AH8A 3NKVA 1TUIA 4TL6A 3PCRB 2QGNA 2CHVA 2WSMA 2BM1A 4A2QA 2GTPA 3FMIA 4MYCA 2PBRA 4DDUA 4LV5B 4URWR 5J4KA 2GXAA 1MR3F 2PH1A 4HAXA 3GLFE 2GESA 1XD9A 4QGFA 2PEZA 4RZ2A 1S1MA 1EXMA 1IJEA 3QY0A 5B30A 1MO4A 3F5FA 4CEHA 5JHGB 1CR4A 3HYRA 4LJAA 2BEKA 2XEXA 4Q02A 4DSTA 4UXJA 1W5SA 1YE8A 3Q7QA 1EFUA 3HPQA 3NHAA 3R9XA 4Q7MB 1CJTC 3W3AA 5EP4A 4EDHA 4TTPA 3BGWA 3SS8A 4C0BA 3KUDA 4BFUA 3TRFA 3NH6A 5JI3E 3W5JA 3KXKA 4M0LA 3IDQA 1XD2B 1WBBA 3E70C 4ZIRA 1BS1A 4S35A 2EFDB 1E9FA 2QPAA 5HE8A 5K8TA 1E1QA 3WYGA 2O8EB 1OH5A 2ZI4A 3P27A 4GSYA 4JMPA 1YZQA 4UQOA 4A2PA 5LD2C 4TYQA 4X8MA 2O0KA 3LQQA 2EFEB 2O8BA 1YZKA 1RC8A 4PX9A 1HY3A 3ASZA 1HQYE 1KNQA 1TL7C 4HDOB 2JLSA 3R7WB 3CNNA 2QA5A 3WYAA 3RRZA 5KPJA 2CLSA 1N6RA 4BGDA 5KNDA 1E2NA 1G7TA 2RGGA 4GI7A 3MGCA 3UWOA 4EPWA 3DOFA 4XWOA 2PT7A 2B92A 2IS4A 2GILA 3UIEA 2F1RA 5EXTA 1TQ6A 1B0UA 2VHTA 3EZ2A 3K0FB 3NWJA 2VP0A 4G1UC 4BLSA 2AFIE 3H86A 3OIYA 2B6HA 3BAFA 4EQ6B 5BYKA 2KI5A 4B3GA 1G8HA 3VR1A 1JXMA 4OQFA 1S9DA 1Z6YA 2GAOA 4M1WA 4OL0A 4C0LA 2G9NA 1OHHD 1XEXB 2E87A 1E79A 3OEHA 4MGYR 4BFTA 4CT4B 1AS3A 2KSQA 3EARA 1VIYA 1OJLA 3KX2A 1ZUNB 3RABA 1FUKA 3REFA 1FNNA 1N6KA 3BK7A 4M1OA 3V9PA 5CB6A 4Q1BA 2DFKB 3ZQ6A 2X8AA 4WZBE 3TUIC 1N2CE 2YWEA 4YXWA 3ZZTA 1R6BX 5FUYA 4EJSA 1TEVA 1NLZA 1NSTA 4H1UA 2IX3A 2ZJ8A 1G6OA 1M74A 1F3OA 3U3MA 3WP1B 5JEEA 3L0PA 2W6JD 3B1XA 3WYFA 2B7BA 3IO3A 4NZYA 4QFMA 4A1FA 4BZQA 4Q1AA 1VKJA 3OIVA 4JLOA 2VHCA 3IIKA 4M9QA 2D74A 4BLPA 4B71A 2PZEA 2DBYA 1J90A 1EWRA 4AIIA 4B3BA 4XVUA 1QVAA 3QXCA 1P5ZB 2NO1A 1YZUA 3LVQE 3SYKA 3M0EA 4JIMA 3ZQJA 2QE7A 4BLRA 4TMZA 1YZGA 3ZDQA 1KDRA 3QEJA 1T5LA 1XZPA 4CVNA 1HE8B 2BIFA 2CLDX 3V4RA 2IHYA 1JQLB 2AX4A 4JLDA 4YMSA 2GRJA 4D25A 2ZSFA 5FTNA 2C8VA 1DAEA 2DWPA 821PA 2Z5FA 1T8TA 2HYDA 1UJ2A 3UMRA 2CXXA 4LHWA 2HF9A 1DAIA 1JEDA 4JJZA 2JDIA 3SOPA 4DCTA 5C46F 4OYHA 2OCAA 2DCUA 1GWNA 3W90A 3HWSA 2Q9BA 4IVQA 4P31A 1VYUA 4KYIB 1N3BA 1PLLA 1TU4A 3VKWA 3GLGE 4GL2A 3A1SA 3DZ8A 2R44A 2WJGA 1RKBA 2GZAA 3PUZA 2J7KA 4TL8A 2MMCA 3RDPA 4HLCA 2GKSA 5LPNA 2QORA 4OK6A 2QPTA 1IY2A 1ZD9A 1D2NA 1G18A 3MWLA 3VFDA 4M1MA 2HLDD 2RB4A 2OE2A 2DR3A 4DWJA 2CE2X 2FGKA 3LRPA 3DO6A 3CX7A 3EZFA 1HA3A 1SXJD 2ZROA 1JR6A 1M7HA 4TLBA 5DLQC 1CP2A 4QBHA 3KXLA 1L2TA 1YZTA 5BWMA 3FHTA 1YZLA 2J0VA 1YRAA 2AK2A 2JJ1D 2J7PD 1OH7A 2YC2C 4TLAA 1NN1A 1N0UA 5DHFA 3UG7A 3MCAA 4IKEA 4ESHA 2JIZD 1GIAA 1SVOA 1IBRA 2ZIAA 4U5XA 3OFND 1CBUA 4ABYA 1JR3A 2R6AA 4IDHA 4OQXA 3BS4A 3ZZ0A 3CX8A 3RSLA 2ZRIA 521PA 3HR7A 3MUFA 2QP4A 5CK4A 3W6OA 4A8JB 4DIDA 5HCNA 1E0AA 3GLGB 2GZHA 5FTKA 2CL0X 3RVBA 5KTYA 3THXA 1EK0A 3CF0A 3RS7A 1MABA 2HYIC 1ZP6A 2ZRCA 4J0QA 1ZCBA 3LY5A 4QOSA 3QF4B 1G5TA 4UNSA 5E7JA 3WBKA 2NZJA 1XEWY 3ADDA 3A4LA 2I4IA 1LTQA 1OF1A 4KLNA 3SN6A 5EE0A 2ECKA 1COWD 4TYYA 2EVWX 4AYTA 1G291 1ZNYA 2QMUA 3OEED 3AQ4A 1T6NA 5FPYA 4I1UA 1M1YE 4JLJA 1G8GA 1U8YA 4EPVA 5P21A 5FTLA 1NN3A 2QTFA 4QGGA 1X3SA 1U94A 2RCNA 1N6NA 3FHOA 3RS3A 1J2JA 1MRSA 3FKSA 4RCZA 1IHUA 4A6PA 2RGEA 2Z43A 4FMCF 1G20E 1J7KA 2O8DB 3VX4A 4BFZA 4Q9KA 4XTRA 4BZPA 3AUXA 4P33A 1XJCA 4PO9A 2QMOA 5JLJA 4GDFA 1NY5A 5L8VA 3B8HA 2IUTA 2J45A 1G5RA 1TX4B 4EPXA 2IW3A 3EXAA 4IDQA 4NYMQ 4E07A 3UG6A 3BXZA 4BFWA 4RD1A 1M6NA 1E2PA 5FUWA 3R9IA 1GAJA 3BB1A 4NYIQ 4PAOA 1KYIA 2HJGA 2XZLA 5EXXA 1RRGA 721PA 3CF2A 5B57C 4AKIA 1Z0KA 4JLNA 621PA 3PEYA 2O8CB 4XOIA 2P6RA 3AF1A 1LW7A 2FPKA 1NF3A 3SBEA 5KSYA 5EXPA 1T3LA 4AC9A 5DI3B 1XPRA 2G6BA 1XB2A 3BE4A 2QRNA 1KDOA 2F3TA 4CEJB 1FQJA 1M8PA 4HB4A 4LUCA 4TL9A 3J81k 1TEXA 4TSFD 2ANCA 1PUIA 2PCLA 4GOKA 4UNPA 1WRBA 1NIJA 3EX7C 2ZITA 1XTRA 2I3BA 3I1FA 2QGZA 2ZUDA 4HUQA 5FUVA 1JQJC 4NDZA 2J1LA 3LWNA 1DBSA 2VP5A 2R65A 4A0RA 3DVLA 4G0NA 2IYXA 4Q4JA 1MKYA 2NZ8A 5JI2E 4KLZA 2ONJA 1L4YA 221PA 2ZE8A 5CIQA 4DUGD 2ODBA 1QRAA 2BBTA 1HH4A 1E2DA 1KSGA 1H8HA 6Q21A 3CR7A 3ZVRA 4O3MA 1NVVQ 3N5CA 5LB4A 4CDGA 3GJ3A 3KJIA 2Z4SA 1A4RA 4TT3A 4M1KA 5JECA 4LI0A 2EWWA 2RMKA 1I4LD 3AKYA 3FGNA 3HR8A 1DG1G 3VNUA 3DL0A 3I72A 5EUQB 2JLUA 3HU2A 1U99A 1OFIA 4B2IA 4D6PA 5HKKD 3IBGA 1E94E 4L4UA 1LNZA 1UKYA 2V55B 2WSSD 1GP2A 2D62A 4MRPA 2G1KA 4Q5IA 3S1AB 3QUSA 2KE5A 3CH5A 4GP6A 3BFXA 3UKDA 1XU4A 1JECA 4PPFA 1ZRHA 3L8ZA 2OFOA 3ZD7A 1CIPA 1E0KA 2UKDA 2D3WA 5KDOA 4YONB 2FSFA 2OFXA 1SVLA 2W2XA 1H8EA 5FL7D 4MGZR 4KFTA 1RPZA 2CEAA 4QM7A 4Q47A 5JSZA 4LYHA 2HT6A 4IXNA 3TR0A 5HE9A 2W2VA 4HDCA 3TAUA 1SQ5A 3GJ6A 1DAKA 5JCPA 3IPYA 4JT4A 5CB8A 4PO1A 4NCKA 1NMZA 4PPNA 3CWZA 4QBIA 3WMFA 1KSFX 1NY6A 5FR1A 4P4SA 3FB4A 1W2HA 5D3MA 2PEYA 4B73A 4KSBA 1ZJ6A 4O2RA 3CRMA 1GRRA 1OKKD 2ORVA 3Q3JB 4QL3A 2XOKD 5GJVC 2QP9X 3X1DA 2BMEA 1VCOA 3A8TA 2ZRDA 1YJ5A 1SZPA 4FCVA 4PC1A 3EPLA 5DIFA 4DCVA 3ECCA 1RE0A 3IUYA 3I62A 3K0EA 2O52A 2ZU6A 4B48A 2B21A 1MRNA 4V0LA 2FMXA 4MKGA 3W9YA 1G3UA 1KI9A 2DY1A 4RFVA 1ZINA 3AP2A 4CGZA 1D6JA 3VR4A 1ZM2A 3VKGA 2CNWD 2P6NA 5J40A 2LCFA 1N6PA 1NJFA 3I5YA 3U4QB 2QAGB 1P4SA 2IYZA 4LC0A 2CVHA 3AF3A 1T8UA 3K0AB 4B44A 3IQWA 1G64A 3V00A 3QQ5A 2V6JA 4FMCB 2IHBA 3THYA 1R2QA 3TGPA 1OH6A 2VQSA 1R5NA 1EGAA 3FYHA 1KMHB 2V8OA 1UBEA 3MJRA 4Q4AB 2LWIA 3RC3A 2D4HA 3UXMA 5GADl 5FPTA 1NBME 4KFRA 5EQTA 4F91B 3GFTA 1YZNA 2WWGA 5F2EA 3OE7A 2BMDA 5J4LA 1KJWA 3PG5A 3TW8B 2XITA 1E2HA 1YR7A 4LC1A 3TSWA 1N6HA 2KJQA 1N5JA 1IY1A 1KMQA 2J9RA 4R7ZA 1AZTA 3P20A 1QHHB 2QENA 5TB5A 3FE2A 2FF7A 4M2LA 5FOWA 2H18A 2CE7A 1RRCA 4D4MA 1ZVQA 2ZANA 4XSGA 4DSOA 1ZMXA 3LV8A 2AXNA 3E5HA 1YR6A 2A5JA 3EIHA 4IOMA 2GA8A 3TQFA 3GP8A 1N5KA 4OJQA 4GZMA 2BKEA 1OXTA 3BH0A 3T34A 3WNBA 1Z6GA 2D06A 1SKYE 3AB3A 4IHQA 3LXXA 2B8TA 4Q48A 1GL9B 3NDBB 2BJWA 2CVFA 4ERNA 1CRPA 2UVQA 5E7MA 3L0IB 2JLYA 2ZUBA 2ZS7A 1Q21A 1S3GA 1FZQA 4GT1A 3GLHB 3QSYA 5B2ZA 1PLKA 1ZC4A 1G8PA 2EQBA 1MH1A 1XMVA 3QBVA 2J0UA 4XD7D 1W36B 5FH9A 4P0TA 4OHYA 3T61A 2XNSA 1E69A 2P5SA 3EA0A 2XSZD 4I4LA 4NCJA 4QXAA 1AK2A 3KQNA 1RJ9A 4TN1A 3SJBA 1UFQA 2RGCA 3QJYA 3W3ZB 4QG7A 1D9ZA 1OIWA 1QZXA 1SULA 2F9LA 4G3XA 1G4AE 1U2RA 3RANA 1E9AA 4D4LA 4M9ZA 3EG5A 1OXUA 2Q0HA 3VKHA 5EP3A 4K8OA 3DKPA 3JVUA 2VYFA 2OO7A 5IDVA 1J70A 2IYSA 4E22A 2VP6A 2NO9A 1VG1A 2ZVPX 4JLVA 1W0KD 2VA8A 2ZYTX 2D7CA 3ZVMA 1EFRD 1W7AA 1VIAA 3I61A 4PC3A 2BDTA 5JJLA 4RSGA 3CPHA 3HP1A 3K9NA 1KI6A 5EE1A 5D3QA 4QJ5A 1A7JA 4B34A 2ZI9A 1DS6A 4BPBA 3R9WA 1DVRA 2FU5C 4KYUA 5TV2A 4M1TA 1FMJA 2ZREA 3UMFA 2R6DA 3ZIAD 5G3YA 4LK2A 1ZBDA 2GK7A 2YWFA 1KAOA 1F48A 2ZRLA 1IN5A 3UMSA 1V5WA 4DEYA 3K9GA 3ZJYA 2FJUA 1XNJA 4TMKA 4U02A 4URZR 5FOSA 4OHZA 4WA7A 1PVOA 1QG2A 2CJWA 2DFNA 3LX5A 1GZSA 2V3CC 3WNDA 4LY6A 1UEJA 1G16A 4JKIA 4D81A 2GCOB 1UADA 2FFBA 1TF5A 1T4GA 4XVQA 3HYTA 1NVXQ 2J87A 2OHFA 3BBPA 3VQTA 4PR0A 1ESNA 3X1WA 4Q19A 2ZRJA 1U8AA 5C1BA 2WHXA 2JATA 4RFSB 1XP8A 3CW2A 4B3XA 2AR7A 5EJEA 3GEHA 2F6RA 4FD2A 4Q4HA 4UKDA 1ODFA 1OHHA 1XEFA 1LB1B 3PIRA 3Q7PA 4ZCLA 1UBCA 2RGAA 3PENA 1S2MA 2H16A 3CZQA 1KHTA 3AF4A 4DLXA 4DZZA 1II8A 2ZR7A 1KO1A 1Q22A 3SC3A 1K5GA 3I5XA 3WP0A 1N6LA 5FUXA 5FBVB 2J0SA 4HUTA 3GLIA 2A5FA 2NMVA 1X1RA 2JEOA 3U7EB 2G77B 5E7IA 4KO8A 1CEEA 3RRNA 3CRRA 3N2EA 2W6JA 4CW7A 4RZ3A 5GVRA 3U7GA 4GMXA 4W5HA 3O8DA 4ZCMA 4NHOA 1NG1A 2IUSA 3NBFA 4N0DA 4QKQA 3PR1A 2EWVA 4ITRC 4PZZA 4EKDA 1NN5A 3HJNA 3TJZA 2YVUA 2REBA 1N25A 2DPXA 1Q1ZA 3AP1A 2VO1A 3K9HA 2QUZA 4IDNA 3SJAA 2MSCB 2FEMA 4KI0A 5DE3A 1VMAA 1N0VC 2ATVA 5L3QA 4E5UA 4C3ZA 4DKXA 2A7QA 3M6AA 2GCNA 2YOHA 3BORA 4D0GA 4ZI3A 1DE0A 1X6VA 1RYFA 3GJ4A 1Q44A 2IS6A 4PC6A 1Z0FA 3FVQA 4BWYA 2W0MA 3TW4A 5CM8B 2QQEA 4LHYA 4MDFA 5EE3A 1UAAA 3O8CA 1FPMA 5JFGA 4CEHB 3THOA 1UKVY 2E9SA 4HAYA 3VR2A 1RRFA 2YOGA 4HAUA 1HT2E 2JLQA 4BLTA 2MMGA 1YU9A 1VDZA 2F1HA 2OSBA 1G19A 1JPJA 4JLAA 4V0OA 3OAAD 3U3RA 4DDTA 1LFDB 4AG6A 3PV0A 3W34A 3ADKA 3QKRA 3DZDA 2FEOA 2NTYC 3CM0A 2KBFA 2CL7X 2VTKA 3JVVA 3QXXA 1QHGA 4ZKEA 4KCGA 2OBLA 2VF8A 1U0LA 2HLDA 4ZIRB 2IS2A 1G3MA 1FP6A 3DEFA 4JBXA 1E1RD 2QI9C 3D7MA 3LLUA 3QVVA 1VCNA 1SXJA 1KTVA 2O8BB 2FG5A 5TVKA 4LWZA 2ZR9A 4CEIB 4W7SA 3L43A 3KKQA 2BHRA 3KKMA 3WRYC 1X86B 1YQTA 1T0JB 4DLUA 5A4JA 1MO5A 2JJ1A 2J7PA 3QXHA 4KVAA 1DEKA 2WAXA 3X1YA 2EYQA 1W4CA 4C30A 4HLUC 2GBLC 1P72A 2XXAA 2F43A 1NI3A 2GF0A 1XTIA 2OBNA 2JIZA 1XXHE 1G5PA 3OFNA 2E1RA 5BW8A 2CL6X 4LV6A 4NBSA 4KVGA 2QL6A 4PC2A 4AY2A 4Q01A 1XTQA 2GETA 3PUWA 1XMIA 1TAGA 3R8CA 1W36D 1MO6A 5IT5A 1Z0DA 5CM9C 1OXSC 4OBEA 1IXZA 5CDFA 2P65A 3B7GA 3F8TA 1FW6A 4PTLA 3GLFB 3Q9LA 3TR5A 1Z6AA 4AKHA 1M7GA 1US8B 4EFNA 4ACAA 5LDDC 1E2KA 2BKUA 4LCBA 1AGRA 3P1JA 1E9BA 5FBLB 2HV8A 1LF0A 1YR9A 2O0JA 5EE9A 1COWA 1GKUB 1CU1A 3PJRA 1NKTA 4OJKA 4Q7LA 1B23P 3UWKA 2ORWA 2A78A 4BRWA 5B64A 3U44B 2BEJA 1JI0A 2IUUA 1ANKA 2QM8A 4O2LA 3ZLJA 4FMDB 1IN8A 1XD2A 2OZEA 3A36A 2WJHA 2FPMA 2OCYC 3IO5A 1LV7A 1E2IA 4D0LB 5H1YA 4PQFA 1NVWQ 1FL9A 3VR3A 4B43A 4QC2A 2GEDA 4GMDA 4B47A 3KJHA 1XXHB 3LO5A 3LFUA 4FMBB 3R7WA 4C0HA 1XX6A 1DAMA 1RVDA 2K5UA 3IILA 4IEIA 4KODA 3UK6A 1ZUIA 5BN3A 2L0XA 4DCSA 1GNPA 5J4YA 4KV9A 4PHGA 1RZ3A 2A5DA 1Z83A 3K0FA 3QPUA 4DCUA 1E96A 4FWIB 4B6FA 1DG3A 2XTZA 2FFQA 1JR3E 1JAIA 4FCTA 2CBZA 1W48A 3AVXA 3CKLA 3MRSA 3TIFA 2WWYA 3SYNA 2FA9A 2GF9A 2GXSA 5GJCA 3RC8A 5CK5A 4ASUD 3NG1A 2XNDD 4R9UC 3KKOA 4G5SA 1JAHA 1AJEA 2IYVA 4JSTA 2V4ZA 2R6CA 5FOXA 4JT2A 2WZQA 4HZUB 4I81A 1DELA 4A92A 1Z6TA 1C9KA 4GBMA 4LBWA 4F38A 3MWYW 4L8GA 3FDIA 3TSOA 4OI0A 2XGJA 4A8JC 1P3JA 4JBWA 4B6EA 1FNMA 2NIPA 3SBDA 4AYWA 2WMNB 2ZRKA 4TSFA 4HLUA 2GBLA 2GEUA 4TMXA 2ZE7A 2WJYA 2X1VA 3P4YA 1G4UR 1E4YA 5ELXA 3H84A 1P6XA 1EX7A 3FHCB 3K70B 2H17A 4RY2A 3KTAB 2YC4C 4TQAA 2X77A 4W5JA 1N0WA 1XMSA 4MGKR 1PV4A 3FMOB 4NTZA 2UZIR 2SHKA 2OESA 1KOFA 3EZ9A 4AKGA 3GQBA 4RCYA 5E95A 2HT1A 2BBOA 5SZKB 5KSPA 5G3ZA 2QZ4A 3MMPA 1KKMA 4BEJA 4DUGA 4YMVA 2ZQ5A 2OAQ1 1X1SA 3IIJA 4Y0VA 1N6IA 3B1YA 1RIFA 4WW0A 3FFBA 3K1JA 2ATXA 4WBSA 4NCIA 1S8FA 1Z22A 1KI2A 4PHTA 2QMHA 2IEZA 4HLDA 2HDNB 4LJ7A 1ONBA 5AUNB 1R8SA 1T5IA 5HKKA 3AF2A 3CBQA 1ZIPA 2VPPA 1Z5ZA 1P9NA 2KWIA 3FOZA 1IONA 2NG1A 2WSSA 3OHMA 4L9SA 1IJFA 3THWB 2CCJA 1L8QA 1RFLA 1OT3A 4EUNA 1WA5A 2FN4A 3KKNA 4M21A 5KHOC 2WKPA 2IXGA 4MKFA 3N70A 1MV5A 1N5IA 2RAPA 3CRW1 2NQ2C 4MH0R 4Z1MD 3CIOA 1ETUA 4JYBA 2V7QD 4JBYA 2BMFA 5H8WA 5FL7A 4YQFA 3GJ7A 4Q9HA 4DT1B 4C2TA 1E2JA 5LBIA 2ZRHA 4LHVA 3LW7A 4JVNA 4Z51A 1GILA 3M1IA 1GKIA 2CHGA 2ZSEA 3NEYA 3U3OA 3FKQA 4ZDJA 3R8FA 2ZRPA 5EP2A 2Z4RA 4WXPA 4I99A 4XJXA 3VR5A 4BFSA 2VP9A 1VCMA 1D2MA 2N42A 5AJYA 4HLQB 3AEZA 4EPTA 4B3CA 4DLTA 2V54A 3PUXA 2BWJA 4C9BA 3E1SA 2YWGA 2GEVA 2IL1A 4EPRA 4B3DA 1OKKA 2AD5A 2PX3A 1XPOA 1ZU4A 1SVSA 2Q9CA 2XOKA 2ORIA 4NMMA 4WXRA 1TADA 2ZAMA 5E4FA 1E79D 1XBTA 1WBDA 3B6EA 4A8JA 4ARZA 3AVPA 1Z0IA 3BC1A 4DLVA 2KBEA 4PHHA 2H57A 5IRCD 1AKYA 3K53A 1SVIA 2P3SA 2ZJYA 1GM5A 1OXVA 4V0MA 3PEVA 3QF4A 1WP9A 3PXGA 2O8FA 3DOEA 4L5BA 1E9EA 3EPKA 3GFPA 3VX3A 5SZJA 2ZRNA 3QKTA 2C2HA 2CNWA 1XMJA 3CPEA 4URUR 4X8LA 4DVGA 4IRUB 1G3IA 2CHQA 3TUJC 3X2SA 1UEIA 2JLRA 2R8RA 3AVQA 3DKVA 2W6ID 2F7SA 5DH9A 2IC5A 1CULC 1E9SA 2FZ4A 5F98A 4C4PA 4GPTA 2PJZA 1C1YA 5DN6D 5ANRB 4TLEA 2WVJA 3IHWA 3CWQA 5M04A 4XSHA 5C4MA 2FSGA 3BERA 5JS8A 4Q9IA 1KK0A 2O8DA 121PA 3SFVA 1A82A 1XTKA 5CJ2A 1E9RA 4RKEA 3SE0A 4D80A 4YLGA 2QBYA 2QMEA 4RZXA 1OV4A 1QHSA 4YDHB 3OZXA 3OIWA 4AURA 5IHPA 4IDPA 1U8ZA 2ZE6A 2C99A 4DLYA 3SQXA 1TMKA 4XTCS 2W58A 4EFMA 2A2ZA 2C5LA 3AGPA 5SZIA 3PVSA 1E2EA 1E2QA 4LYAA 4WOPA 1AGPA 3K0SA 1ZM3A 2VRWA 1JB1A 2DFLA 3NC1C 4MKHA 2IXFA 1R7RA 3MWKA 5DYIA 3NEJA 1MOZA 2O8CA 3AF0A 1OYWA 5BYJA 1U0HC 2Q9AA 5FBWB 5LB2A 2NO0A 2JASA 2ZS8A 1OPXA 3EA5A 1DTSA 3GD7A 1ZNWA 3RRMA 2ASEA 4B2PA 1P2TA 2IT1A 2HXYA 1WF3A 1F2UB 2IYYA 1Q57A 5FTJA 4EIWA 2PZGA 1E2LA 3T5DA 3QENA 1TF7A 2QROA 4LDJA 3KJGA 1DAHA 4XD7A 4ZDIA 2BCGY 3ETLA 3WY9A 5JWRA 1TQ2A 5L3SB 1ZNZA 2ZI3A 4DB2A 3K70D 3AVOA 4OK5A 2DYKA 2QAGC 2XSZA 4OI1A 3U60B 2QNRA 3ZGXA 4P4SB 4LBVA 5HCIA 4FIDA 5D3MB 5DYGA 4AI6A 2LKCA 1NN0A 1EFHA 3EIEA 1XDBA 4QHTA 2WV9A 1NMXA 4LRWA 1NMYA 4AK9A 1NG9A 5A5GA 4LJ9A 4V0NA 1KO5A 2CDNA 3QOFA 1W2GA 2OT3B 4XVRA 3IIMA 1Z0AA 2AHOA 1HEIA 4KU4A 5K8UA 1W0KA 4MKIA 4IFBA 1AQYA 2QSZA 3ADCA 5JJIA 4C0SA 1Z8FA 1I4TD 2J59A
chains in the Genus database with same CATH superfamily
3V7YA 2O2ZA 4OHVA 3GDOA 4EGAA 2WTXA 3JTMA 1UMBA 3FZQA 4RZUA 4HBZA 1MB4A 3H04A 3FPCA 1T2EA 2GPSA 3PF9A 1EK5A 3RVLA 3N8GA 4R8RA 3W5HA 2E6UX 3H8VA 3SZ3A 2PIAA 3ZNQA 1SA0B 4J1NA 5BV0A 5EG5A 3IVCA 4EM6A 4MWOA 1K1EA 1RWWA 1S7GA 2AJCA 4PAMA 2QTBA 4WOCA 2Y8EA 3OJFA 4WIAA 1CUVA 3STTA 3MTBA 3IMCA 3ZY5A 1U0OC 4KGDA 4U2DA 3IERA 4F5EA 1Q3HA 1JLMA 2ZIWB 3IUNA 4LGMA 4RW0A 2ZIEA 2WUDA 2HSWA 5A7GA 3FUCA 1Z7GA 5ER9A 4E5NA 1F9EA 1HFKA 3C16C 1QHFA 1SKUA 3Q0IA 3KJNA 5BNTA 3Q5GA 3A7DA 3GPCA 3BA6A 2BZ1A 2DLDA 2GJKA 3ESRA 2OAGA 4ISCA 3A11A 4QYIB 5ICCA 3FSEA 4AJ4A 1PJRA 4Q21A 2OTCA 5HQ3A 1Z0UA 1ZESA 4JNCA 4NNPA 1AF4A 1E32A 1PG5A 3CURA 2VJNA 3LM8A 3UAOA 2XCOA 2Y77A 3TNFA 4ND4A 1MTZA 7REQB 1P1BA 5J1SB 2C7VA 4KAAA 3PQ6A 2EHJA 1EXWA 4YUAA 3LY8A 5HYVA 3FCCA 4D0NA 3TW6A 4DJFC 4QJ3A 5L95A 4YJ2B 4KPGA 3ZDCA 4RXMA 4X7BA 4ZVUA 5AVTA 3EOAI 4RA6B 2FWMX 2YV5A 1TT5A 4BPRA 5ELLA 4LGCA 2AMLA 4OL9A 3AMVA 4I5DA 2MINB 2DHEA 1VL5A 4WD3A 3IT0A 3PR2B 3TX6A 1IDN1 4IIDA 2B94A 2Y76A 2OXTA 2MYUA 1UBJS 2HCBA 3BB4A 2AZXA 4BE4A 3NVAA 1U0NA 2NT4A 2F9MA 2R6ZA 5IKEA 2QYSA 1OFHA 3TVDA 1GL6A 4XCQA 4G1EB 4HH3C 4QGAA 4D6YA 4DIUA 4MXDA 3CRVA 4FLMA 4YR7A 5IVKA 5I7RA 1FXWA 2O05A 4OHRA 4YIHA 3MELA 1E6MA 1Z0JA 1Z5GA 3U4QA 4M9SA 3FWNA 4PSKA 2NTEA 2JCSA 4WBNF 4EDFA 1CXZA 1MB3A 4RIHA 3QRWA 3F7TA 1EB8A 4FONA 4BATA 2Z1MA 1OZFA 4FKMA 3SK0A 5BXYA 5I3ZA 1ILEA 4Y6RA 1UBOS 4ETNA 5HJ5A 3U40A 1T8PA 1U1FA 3LW8A 1YR2A 5E4JA 2GCPA 2G5TA 3IAUA 1PR1A 4C7JA 4Q39A 3VVLA 4LBYA 1EFPA 4PLVA 5ALNA 5AWFC 3Q3HA 3CH6A 3DMFA 2AWNA 1QH1A 3RFVA 5I9TA 1DI0A 4KMMA 2ZCVA 3ZHUA 2AL7A 3BOSA 3O7MA 3RSHA 3BH7A 5A9RA 3GJ8A 2DQKA 2BFDB 3OAAA 3BCUA 2WHPA 2W2MA 3DUFA 2UUOA 1GGVA 2G0TA 4W5WA 5G53C 3RTDA 3HGTA 4PXSA 2Z6UA 4FFOA 1YIDA 3PNQA 3K9QO 5A6SB 2MYTA 4Y2HA 2RH5A 3KB8A 4UOEA 4RKQA 1IAQA 2HJRA 4DG5A 3TSAA 2AV6A 1ZIXA 2JGNA 3KZXA 3FWZA 3LA6A 1JIXA 1R9JA 1QNLA 4KIJA 3OUUA 4HAIA 5ICFA 2ZPUA 1P2UA 4Z9FA 4BFXA 3EAQA 4DWOA 1W25A 3AUYA 1YMQA 2O5VA 1K7XB 2J85A 1L7EA 3KQPA 4IXDA 3B60A 2FRDC 4L8WB 3ZWWA 3I9LA 3I45A 2WWHA 1C9JA 1FX1A 1II9A 1UXIA 3LXUX 4A2WA 2GAFA 4HDSA 1K6MA 4D79A 2VF7A 4MVJP 3NIWA 2J9FB 2JAOA 1PLJA 2EKBA 1CKEA 1PWYE 1G8KA 1XXLA 2P2GA 2AFHB 3BCHA 5G0VA 3TQHA 4E09A 5DWDA 4PSUA 5IFLA 3BWDD 1QHYA 4NFSA 2AGVA 2EEPA 2WQ7A 1TTTA 2QG6A 1Z4NA 3RVQA 1PZFA 3NHPA 1OE0A 1IMJA 1HLGA 5J59A 3L7BA 3HY4A 2AT1A 3QFHA 2OLKA 3QKSA 2IU4A 3ZXSA 4F1JA 2YKGA 3W5VA 4U2CA 5G02A 1DBRA 2I3GA 3MA0A 3BZUA 2YJGA 2Q6OA 2GYYA 4RD3A 3HFRA 1GYPA 1V9CA 2Q4OA 4OF4A 3TZCA 3F1KA 2OB2A 1QIKA 3VMMA 4Q9AA 4ZO7A 3LHFA 2D8MA 4N9WA 1K4KA 2Z9DA 3NZEA 2ZRAA 1K4YA 3OZ7A 4RD0A 2P9BA 2HBQA 3DMGA 3OMXA 1UC5B 1JIIA 1UZAA 4IVPA 1LUAA 5AYVA 2MR5A 4OHUA 2QI9F 1BYUA 2FK8A 2LKDA 1T0PA 3L0OA 2PWYA 4IH4A 1E8DA 2HRRA 3CF4A 3M6UA 4W4TA 2QS9A 2UZ3A 4C21A 4WK6A 2OBMA 2YIMA 1HNWB 2Q5JA 1YZVA 3T1VA 1SUBA 4WI1A 5DCWA 3RWMB 2R7AA 4C4XA 1ZISA 3FTPA 1VHTA 3HKBA 1FNBA 3VO2A 4P32A 2C57A 1RMTA 2D5BA 3V8PA 1A4IA 2JJMA 5C32A 3NFYA 3WKBA 3O3NB 2HV9A 4EW1A 4X91A 2PMEA 3WHKA 2P7IA 2OV3A 1ZA2A 1FFEA 1YB2A 4JUBA 3RYHB 4EKGA 5KVSA 3W4JA 4MMYB 1X7ZB 3C14C 1X1TA 4FWBA 5DI9A 4JJIA 1RAEA 2PKYX 1X1BA 2E4YA 2OHVA 3ANNA 3BXXA 3K09A 3WA6A 1I33A 5CUQA 2PIDA 5CLIA 1AUXA 2LRHA 3OICA 3UGQA 3F9RA 4JI6B 3JXEA 1I6KA 1NZJA 5BORA 1YOVB 1Q1AA 2QNBA 5A0FA 2JGLA 3K9WA 4ZXPA 2DTXA 3KSRA 4NICA 4AY4A 4B35A 2IE8A 5DT9A 4GZLA 1QHIA 4JY7A 1ECJA 3S8EA 2DT8A 2CLFB 1QCZA 2Q3DA 3QOWA 4W82A 2PV0A 4JL5A 4QU9A 3BMCB 1TZ2A 1VLVA 3AUSA 1L4UA 3PXXA 4ZOCA 1YTLA 2YUTA 3ROEA 1ZR2A 4I50A 4BNDA 4OLBA 4YP9A 4Z4HA 5CDFE 1D0VA 2ZSKA 3B3FA 3PL1A 2B1IA 2XNDA 4Q3LA 3SX0A 1VG8A 1JDJA 3B5EA 4MVJM 2XEDA 1G60A 1BHO1 4KR2A 4MR7B 4IIBA 3KHSA 1Q12A 4PAQA 1JHUA 1GRQA 3P0RA 3QUTA 4M1QA 3ZHSA 1M2OA 1XPJA 2WAMA 5K4HA 3RREA 3NALA 2Y0BA 3JQ7B 4MS4A 2OZLA 3OCJA 8OHMA 1YI8A 4LHXA 4GMFA 4TV8A 1SUIA 3NOQA 3ZNPA 5A9SB 5KOYA 5HUJA 3DS8A 4MRMB 5EUCA 4DR6B 3R77A 4HZGA 4I66A 4OJTA 1K27A 2QJWA 3PFIA 2ZBFA 4AMYA 1IVYA 3FHJA 3I58A 4MRVA 1KKLA 1KYWA 2Q1SA 3TBKA 3OO1A 5G0SA 5KVAA 2PT6A 1BH2A 3DZIA 3NGXA 4IP0A 3C3XA 5G0UA 5SZHB 3ZCPA 5A4DA 2QPOA 3I6QA 4BUCA 1WDTA 5CYOA 4BP3A 3O4RA 2JJ2D 3ERCA 2P2ZA 2ZUUA 3T7JA 2GAAA 1M2HA 1N3YA 1OR8A 2EV9A 2IPLA 3FUXA 2D59A 3GBPA 1HURA 2WIAA 2XB4A 1VBKA 1JQKA 2O1XA 4Z8XA 3PC4A 5I5EA 1C50A 2B20A 2V6BA 4NRDA 3G5UA 2DBZA 3JRNA 2BFAA 2YRXA 5K8IA 2AUMA 1UF9A 2VH1A 3MBIA 1EVQA 1MP0A 1WUHS 2CYBA 3D0KA 4XARA 2XE6A 1Y9AA 2A57A 2YNMD 4R1NA 4EB0A 3IHLA 5HGJA 1R27A 4DNOA 2CDRA 2DPYA 4YBRA 1GUAA 2QLLA 1POWA 3OZDA 1KE2A 1B0AA 2VYVD 1Z82A 2J6HA 3VZPA 2XUOA 4DJAA 1WUIS 4L85A 2AXQA 2OG2A 3DBLA 4OB8A 1TVMA 2WPDD 4QO8A 1O94C 1QG4A 1X1EA 2FWRA 2XDAA 4M53A 1JDTA 4S1PA 2HUPA 3VBCA 3WYBA 2XTNA 4TVKA 4YCLA 1SBHA 4NP6A 3LIIA 5HA5A 5GMOA 2TMGA 4MWZA 4ZOEA 3K8YA 4Q9NA 3G68A 3Q0TA 1O96B 2ZM5A 1DEHA 4QTZA 3MFQA 2ZVQX 4MLZA 1PW5A 1R1DA 1W5EA 3V4LA 4WOBA 1HGXA 2H7XA 4PZPA 3EZYA 2V7QA 4KOEC 3FSGD 4JL8A 3AFHA 1FVFA 1XHFA 3CO5A 1UUFA 1IK6A 4ZU1X 1TAHA 2FN7A 4YCNA 1J1ZA 1N2SA 5B7PA 4B75A 3LYLA 2QGFA 2WHEA 4H9GA 3GDGA 5H4HA 1E3DA 1L5RA 1P29A 4LBZA 3ZZMA 4MV7A 4IV5A 2Q4TA 3WS7A 1L5OA 4X60A 3RS5A 4RORA 3IURA 2XWQA 2P9GA 3JZIA 3INGA 5DBHX 5LYJF 1S1CA 4RABA 3HM9A 4MQMA 2DWQA 3G6WA 5KYWA 1QJ4A 2IIBA 4CUJA 3LXRA 5IKMA 3LQRA 2CMHA 2EARA 2QRUA 4HNAB 1T2VA 4RF4A 3KCQA 5AD1A 5BMVB 1C3LA 3NMUF 4FHCA 4C89A 1WCIA 1MEOA 2O8FB 4QUHA 3HEMA 1I7DA 4E70A 3K70C 5FDFA 1CQJA 3ZV6A 4MWGA 4YRGA 3E8SA 3B51X 3H5WA 4H17A 5DOZA 5A0TA 1G21B 4M8SA 4N3BA 4A9AA 1EVLA 1C4OA 2FZLA 3GP5A 3E3MA 1DB3A 2QSYA 4URYR 4WJZA 3OQ1A 3FPLA 2HA4A 2Z0MA 1Z47A 4L50A 3OX1A 3TCKA 3GLFA 1TPZA 2Q3CA 2QY9A 1W0JD 4DMUB 1LS1A 1YB5A 5AM5A 4EOGA 1RZRD 3W1VA 4LSZA 2QTRA 1US8A 5C5CA 1MAHA 3I2IA 3EVTA 4EQ6A 3AUUA 2Q5EA 4FXOA 4DCNA 4INZA 1OC4A 3B1WA 1EJ0A 3G2HA 4LRSB 4IOKA 4M1ZA 4DRZA 3GEIA 3GF4A 3PHLA 4PRKA 3WK8A 5DGXA 2FMFA 4ZGBA 3OE4A 4N6OA 1XEXA 2C0PA 4IXMA 5D5QA 4YRNA 3F6RA 3V7NA 3FROA 3PA8A 4GKAA 1KGDA 1NZDA 4KLRA 3MM4A 2C3MA 1Z08A 1I8TA 1NNLA 2AQKA 1SU4A 4BB5A 1HYBA 5DN6A 4HATA 4D4JA 2YJTD 3G6KA 3M5CA 5JZMA 2IYUA 2WLSA 2AOUB 4K6CA 5H7XA 3TIXB 3M49A 1TAQA 3OZIA 3AY6A 4PPQA 2JAUA 3U81A 3ABQB 5IMSA 5D1HA 4FQ7A 3ORRA 4GR9A 3RG8A 4ZHQA 2HMYB 1EWYA 4LVOA 3TIGA 3V32A 4LRXA 1QORA 1YOBA 4QYMA 4OKNA 4QDJA 4X20B 5EWMA 2QUBA 2MSLA 4JVSB 1NPDA 4D41A 4FEAA 2NXJA 4DC0A 2VR1A 2GCGA 1Q1BA 4CU2A 1MG5A 4OMUA 5EIAA 1L7VC 2EP5A 1OBOA 1X87A 1VSUA 2Q7XA 3AUKA 3BEDA 1EVEA 3B78A 3CONA 3HUFA 4KFSA 5C52B 1QRTA 3UANA 4WZAE 4FNMA 5F5NA 1SCQA 1LSSA 1Y89A 2COUA 4NPAA 4YB8A 2VH5R 3L9WA 1VFPA 1B93A 3NHUA 5KOIA 1Z2CA 4B83A 3I9MA 5DK6A 4XGIA 1R4NA 3LWDA 1YA4A 1NYTA 4TV9A 4DJDC 4BS9A 5BPHA 4XIIA 2C03A 4V0ME 1B7GO 1A5TA 3F6PA 5H02A 1MJGA 1EE2A 1MABB 3FW1A 3B20A 3ESQA 3P4XA 1TYDE 1JALA 1V47A 4OTZA 5DKFA 5HJEA 3RODA 3KETA 1SIWA 1ORHA 3BMNA 4DSUA 5PGMA 2OYRA 1X7YA 2HADA 3FMPB 1F4PA 1U9IC 5BRJA 5JNRA 3OLWA 4WOKA 1NL3A 2FUKA 3MCUA 5IAEA 4MW7A 1DAPA 3PLRA 5HM8A 1FU4A 2H1VA 5DYTA 3VDNB 2D2EA 3GPLA 2D13A 3DW1X 2XRFA 4POAA 4BNHA 4N1AA 2PLRA 2VBFA 4QREA 1KZ6A 3U4IA 4DV6B 4B6SA 3V5NA 2EKQA 4FFVA 3K5IA 4K7JA 1N0HA 4N01A 4OFZA 1XZJA 4G5YA 3MD0A 5FWYB 1VHLA 3MCTA 3G2PA 2H4FA 1E1QD 1GPKA 1HE3A 1YSCA 1E18A 4PN7A 2V45A 4PZYA 1RI5A 1ESMA 3RKSA 3KXIA 4JKYA 1NBIA 2X0FA 3A32A 1E0JA 2PMFA 1W5TA 5L4NA 4IXTA 3UHAA 4HAWA 1XNHA 5D3ZA 4F60A 4O4HB 4GPAA 3K9LA 2OB1A 4LXQA 1NQTA 1VZ3A 1X9HA 3WGUA 1WVIA 3G5LA 5L7YA 4Y9TA 1B3RA 1EXDA 3C7KA 4K9NA 3RR2A 3ANYB 2LTAA 5EUBA 3IIIA 1XRQA 5FADA 3SX4A 2AC7A 1KOLA 4JUAA 4HDKA 1DQNA 3GG2A 1FFAA 3G5TA 1HYQA 2P9JA 2XADA 2R5FA 4CPDA 1FTWA 4I4TA 3VSDA 4X5OA 3E9RA 3AONB 3KR0A 3P9ZA 4G2NA 3MWDA 4WXMA 3EBOA 2WNIA 3ZK8A 5AR1A 1CR6A 1G98A 1ZOLA 2A9OA 2JHCA 4H18A 4MJ3A 4XVHA 1ZSYA 1IB6A 3EUEA 2YYSA 3L82B 3L7MA 1YR3A 2MIIA 4N39A 4YJGB 5JC8A 4ZFNA 2EBFX 2G0NA 3AEUA 1SZJG 1Z4PX 3IVXA 4NJOA 3GLGA 4MQLA 2VDPB 3GBVA 1JEYA 2GN0A 4WE3A 5M34A 5DCUA 2GJSA 3ICQB 5KCMA 1XCPA 5LDHA 1O3YA 2FEPA 4KWTA 3CTMA 4JQZA 1TGYA 4V24A 2Q21A 2OM2A 2WSBA 4BC0A 4YXWD 5KOJB 1D9XA 2XYHA 3GR6A 4W5NA 1ISSA 2R5WA 4QE3A 1CJBA 1J8MF 2RGDA 2VCYA 2X4IA 3N53A 4P36A 4XM1A 5DRYA 4BP8A 3WGNA 1IOWA 3L1JA 3LGSA 4Z54A 5JJKA 2ZS9A 1WX1A 3M82A 3NEAA 3QW4B 2TS1A 2GEFA 4OI2A 1VL2A 3DEIA 1SBYA 2QBYB 1KEWA 5JBNA 4E5VA 3BD9A 5DBFA 1NSFA 1WVMA 2AYXA 2ZU0C 3CEHA 1RBZA 2O4UX 3FZEA 3KJEA 2NU7B 2ZTSA 3NS7A 1XLWA 3GJ5A 4O25A 3ULKA 3ZKWB 4UQPA 4POOA 3L0YA 4FNAA 4PRYA 1JHZA 3DHWC 2XYGA 1PIWA 4ZICA 3LFHA 2B82A 4WY2A 1UOQA 2Q8NA 3TTSA 1EGQA 1BWSA 2CXPA 4Q4JB 3MLEA 2IODA 3D6NB 1I2BA 3HCDA 4RE6A 5AJZA 3RUCA 4CIDA 1UDBA 4CTKA 4QLBA 3DDWA 1LI4A 1TYCA 3I0NA 4DN6A 2PUEA 2PKQO 1JEEA 5HDBB 4Y9RA 1WB9A 5EVCA 3RLIA 5EIOA 3F5DA 3HXKA 5LXTF 1BXZA 4GNKA 2XMGA 3QXJA 4G5FA 3FTCA 4C01A 3MXTA 3EXHA 4AS3A 3EC1A 3OF2A 2O2EA 2Y1KA 3UN1A 4JXZA 2HFKA 4YMTA 4CWAA 5JR3A 4JVMA 3WTBA 2JIBA 1CT9A 1DIRA 1T5OA 5A3JA 4FYKA 2H1IA 2WWTA 3I05A 1KY5A 4J4TA 1TMOA 1R0SA 2O7SA 2RHDA 3ZDAA 4M0MA 2HU8A 2QZPA 2I4NA 3MERA 4OIMA 3A6HA 4R7GA 5FLEX 3DNFA 1G41A 4LVCA 5LQMA 3B9QA 4QPDA 3E3NA 4Q24A 3SZMA 5IG2A 1MENA 4ILEA 2X2FA 1UPTA 4Z6KA 4AN4A 3FRIA 3CNEA 4BE7B 2GT1A 3LCCA 2Z1NA 3GCGA 3T3MB 2FGJA 4LECA 4E3ZA 3I8SA 3UV6A 4DQDA 4CEJA 1PKXA 3OM1A 1Y1PA 3TTTA 4EHLA 1IPHA 2FWAA 3QKUA 4JEUA 4R6WA 5EIBC 3R9KA 5JSZB 1L3BA 4H7DA 3LKVA 1DBQA 3OE5A 2V6IA 1G20A 4KACA 4TYMA 2WLTA 4BMXA 5C37A 1CR0A 2A92A 4DLKA 4MDEA 1GCIA 2ZI7A 1R5BA 1FFXA 4D42A 8AT1A 1JDNA 2G09A 4NS4A 5BOSA 4EMUA 4ARVA 5IWCA 1CY2A 2J41A 3NUZA 3T1TA 5ER6A 3TXYA 5J4HA 2C1XA 3EEIA 4CTOA 4URVR 3HDGA 3QY9A 3I2FA 4I6JA 4JA0A 1XDUA 1Z4OA 4KIFA 2RE8A 4OM7A 3MLAA 3KQUA 4LE0A 2OPHA 3A1VA 4UM9B 1IZYA 1PS8A 1JR3D 4LJ6A 1YR8A 1J5XA 5C8YB 4HRVA 2PKWA 3HI6A 2V7VA 1O6GA 5JAQA 4OAQA 4C06A 2WTBA 1E1KA 2Q2NA 3HU1A 1EP2B 4YMWA 4J7CA 5U4XA 4Z7QB 3Q7RA 3L7LA 4RD6A 3ONNA 4WJLA 1HI9A 3M2TA 4IX9A 3TZQA 3WMRA 1EFRA 5D6OA 1BQ4A 1ZPDA 1UT6A 5A2QA 1BE6A 1T8RA 2QN3A 4RMJA 3BREA 1Z06A 5D8DA 1GSIA 5JE8A 3RM3A 2BKLA 4MVJI 5HVNA 1RWQA 2JLCA 4JUIA 1IC6A 3S99A 4K0RA 1EB9A 5HMMA 2ZJZA 2WTEA 3WBJA 4D57A 2GN4A 3CLUC 4ZZ3A 2JBAA 2IGTA 4IDAA 2Q8PA 3PK0A 5HS4A 1DC6A 2ZRMA 2Z83A 4OHOA 3RF6A 6YASA 2PX0A 3DVRX 3FFAA 4PYNA 3WICA 2XQFA 3GLSA 5HTKA 4PYMA 4RTNA 1NPTO 4NV1A 2IEDA 1IN6A 1HFJA 4NABA 4LYDA 1WPXA 1DLIA 1KDPA 2ECQA 1CRQA 1BW9A 3FVTA 3S70A 1PJ8A 3DVQX 3WRXC 5B7QA 3T0IA 3FKSD 4US2R 5IZ4A 1AMNA 1Y8CA 2X0KA 1ZICA 4HEQA 5HZKA 2QX4A 3C3YA 3IHTA 4LYFA 4QYXA 2Q3HA 4IMRA 5K8LA 3UOWA 5K6RA 2PUJA 4OK3A 5F9HA 3W9BA 4CBVA 2W2TA 4NCNA 4XI9A 4DF3A 1NXQA 1SZCA 1UBFA 3QLVA 4N65A 1XIVA 5BSEA 2BTQB 4J16A 4YRSA 5DTRA 3S3TA 4ZDKA 5AW1A 5FBQB 3UHOA 1IBKB 1QU2A 2QT0A 4EYSA 3H4MA 1MX1A 2NTVA 3LIPA 4C1BA 1WXFA 1EX6A 3J80A 3SR4A 4I9HA 2XWBF 1Y1LA 4LN1A 4P4TA 1KIMA 3W8DA 1GDTA 4M8KA 4NLLA 3BF8A 3NOXA 1UBUS 4P82A 1XD8A 4C7OA 3UC9A 3K4PA 3BSWA 3ZIUA 4QJ4A 3HB4X 4HQNA 3DM9B 4PZDA 2SNIE 1QDEA 1TLTA 2ZQYA 5K3BA 2WC1A 1HDZA 4AKEA 4CKCA 4EVIA 1E6WA 4ND6A 4P7BA 4XGQA 4NZPA 2DQSA 2BR4A 1XKQA 1AGNA 1N9KA 3CG4A 2QT1A 1UJMA 1H2BA 2ZBUA 3EJ6A 3G8BA 3WL8A 5A4KA 1A77A 3IP8A 4IJMA 1ZBQA 4K81B 1Z6PA 3SR3A 3GLHE 4GWLA 1NVUQ 5JWHA 5C7YA 2WKQA 4LYYA 2J5XA 3ADPA 4US1R 5AVYA 2BJHA 1R5OA 3R5KA 4X54A 4CMGA 1WR8A 4XAQA 4OSPA 1MORA 1KI4A 1Q1EA 2JJ8A 1GGKA 2Y1XA 3R0JA 4OM8A 3VTKA 4EH1A 3WQBA 2F62A 4YP7A 1EXNA 1EDZA 3N8DA 4NYMR 2HQRA 1P2BA 1ZM7A 1MO3A 4N0EA 5MGNA 1E7YA 3VKVA 1HMYA 2PZAA 2FW1A 4W8GA 3WA7A 1DTWA 3NUGA 2J09A 4QOIA 3N28A 3H0EA 1Z28A 4EGSA 3D8NA 1BDHA 3PVZA 3VZDA 1GTRA 4KKXB 1K3FA 4U2BA 1GQRA 1PSDA 4OQLA 5K2MA 3KB6A 4YRAA 4YV1A 2G1AA 1HE5A 2WWWA 1H0KA 2FDRA 2XX3A 2W00A 3HB1A 4RDIA 5CH3A 3I2KA 3K05A 1ZD2P 3PUHA 5AIAA 3NC0C 4ZQEA 1PEAA 2KS6A 4ZT5A 5H83A 5CLJA 4II7A 2EGHA 2P4SA 4EHFA 3EGOA 2YVLA 3H8JA 4QODA 3AETB 3HBLA 3OJWA 4Y2UA 2UZ1A 2GHQA 1R6XA 1TD1A 5DXJA 2HJHA 3SHFA 1B16A 4GR5A 3ZE7A 2JJ2A 3WVNA 2IUFA 3FMVA 2OPBA 2NTNA 4PQEA 1AH2A 4WUTA 4L0CA 3H8SA 3U7HB 4DMFA 3SEZA 1EDOA 3Q87B 4CMIA 5DGTA 3QF7A 3QKSB 4XEUA 4RCVA 4TRNA 2HMAA 2IQ5A 2ZR0A 2V6MA 3HMQA 1GUBA 1N6OA 1WXIA 1KK3A 5CXQA 4P81A 2JKZA 2RIRA 2YNMA 3O31A 1RQXA 4XWWA 4V0KA 3BIXA 1RPJA 2D5CA 2YQZA 3DULA 3H5AA 3IEVA 2AWOA 4N0QA 2VYVA 1Y4AE 4RANA 4OX9B 2VAVA 3OE1A 4IH9A 2WDPA 3UKDA 4W6ZA 3UAXA 2CNDA 2QL7A 3DM5A 2WPDA 4QU0A 3NPMA 2Y0CA 4XYGA 1GFIA 1T3HA 3EDRA 1TCCA 2CVZA 2CYAA 2VJYA 3U3ZA 2W70A 4KI7A 1AIPA 4ZTZB 3C0KA 1RZVA 4TLCA 5FPQA 1ZUHA 3A1NA 5HJ7A 5KOHA 3OI7A 4LZAA 1YR1A 2WR8A 2BMJA 3EDQA 4MRSA 4EB3A 5JWOA 1ZRNA 1KVRA 2W6PA 2VAPA 4UNQA 3BTVA 4ZI7B 4UTPA 1M0WA 1HOXA 3HKBB 4HH4A 2I7DA 2K2WA 3D31A 1LLQA 1DKLA 1J5PA 2A14A 3BRWD 4RHCA 4WT7A 4MJLA 4Y1RB 3M6XA 1Y7HA 1GOTA 1EQ2A 3NP9A 4NV3A 4TMWA 5KU7A 4ZCTA 5KSZA 2ERXA 1EUDA 1E3SA 1GZDA 1QHNA 3FSGA 3LCUA 3NR2A 1OT5A 1ZK2A 1GHTA 2IZZA 1VPVA 3LVRE 4P3KA 5C8VA 3IKJA 1F4VA 4J7AA 4ZV9A 4FDTA 2Z6AA 1GTVA 4WLFA 4EG6A 3DZHA 1BU5A 1VTKA 5CCXA 2WD8A 4QU5A 5IKOA 4DLRA 5F7XA 4S2EA 2WU1A 1Q0UA 1AQLA 4UEQA 4XQ0A 1U63A 1K9VF 4CFYA 2PZFA 1ZOOA 4EHDA 2HGZA 5TRTA 3DF7A 3OCXA 4UHFA 2YVAA 3RIGA 3SMVA 4YPVA 3GNTA 3RS0A 1G8MA 1ORWA 1FMLA 2L69A 2ZB2A 1LLUA 5CIYA 3ZH9B 1OB2A 4KW7A 1N36B 5L3QB 2QQ5A 2OXFA 4Y3UA 3A1WA 4GLLA 4QQ8A 2REXB 1MJFA 3PQ4A 3A6DA 3BTUA 4FSHA 4UAVA 4Y9SA 5GJWC 2I4TA 5HF8A 4EI9A 2REOA 3DEZA 3DAHA 1N2BA 3GA7A 3WWZA 5KVCA 5LU9A 1KI7A 1X19A 4FNOA 1LLDA 3EFHA 2IXEA 2N1BA 1W0JA 3HFJA 3OPXA 4M37A 1QAOA 1M2OB 3DPUA 2CLLB 2XCQA 4FT2A 1I7SB 1RZRA 5NULA 5J3JA 2OZLB 2XNCA 4KSCA 4FGJA 4XXHA 4BECA 3HXQA 1IAVA 1Z2DA 5DO9A 5GQSA 4D9FA 4CJXA 4FK8A 5KNBH 3ROGA 1IVSA 4EJ6A 1JS1X 3DVAB 3OE7D 4HTFB 4DREA 1DCKA 1U9YA 4Z4GA 4ZT4A 4R0MA 2O2YA 2VQFB 4N3CA 3CE9A 1GNRA 1Y1QA 2O3RA 2QTMA 4YV2A 3NJ4A 2N3ZA 2PSDA 4MUJA 3QELB 3ROPA 3ZD8A 1R3UA 3V1NA 4BNXA 4A2CA 1AKMA 4F5ZA 2BI4A 1IHPA 3ZWDA 1C7IA 3BWMA 3DQQA 1Z63A 4AJ1A 2ZAYA 3EBPA 5E0KB 5AMXA 1L4GA 2GYWA 2YWDA 3HBJA 3B13B 4L75A 4KR0A 3OPYA 4NECA 3D3EA 3LYAA 2EFHB 4L2IA 3U7QA 4AJKA 1ZJ5A 3L7YA 3ABSB 1IRIA 5JDIC 3PEFA 3DMNA 4NAHA 1NT2A 5BQPA 1KBQA 1GY8A 2IPMA 1DPFA 3AC0A 3BH6A 1DWUA 3B9RA 5E9AA 1FTSA 3L41A 1GAWA 3H3XA 1ZI6A 2FXVA 1QZUA 2O54A 5J9FA 4NBTA 3DEYX 5LZ4A 4RYLA 2GYUA 1WXQA 2F1IA 2NVWA 3TJRA 1WXDA 1EVYA 3H4IA 4C2UA 3A58B 4YRFA 4K6FA 4MSUA 3PWZA 4Q4LA 5AW4A 3BVPA 3CF4G 4FU0A 2TECE 1IN7A 4FOTA 4TVBA 3NKVA 4W99A 2C4MA 2WIFA 1ECPA 5BSHA 5AM3A 5H80A 1OV6A 3N2KA 5HRAA 3FYCA 5JCXA 3AZOA 2VXCA 2OZKA 1QP0A 1WKCA 3GH3A 2I4RA 3MIIA 5ECWA 2O3UA 2WYVA 4URWR 1E61A 5J4KA 4MWTA 2J6IA 4HJRA 1R9MA 2XDQA 3BMOB 3R3XA 2P1DA 4LXIA 5AKKA 2Z58A 4QGFA 3O1IC 5B30A 3R0ZA 1BWQA 1IJEA 3BTOA 4Z99A 3F5FA 3HRKA 5E8JA 4DR1B 2Z95A 1P5JA 3HYRA 1OX4A 2C5FA 2XEXA 4JI7B 3EIOA 1I5RA 4IQGA 1Y5LA 4IO1A 4U6SA 3NHAA 1L7PA 4BKOA 1O0SA 3GROA 1NYQA 3P96A 4DPMA 4TTPA 5GGYA 4L5YA 2E2WA 3RFXA 4J1TA 4BFUA 3TRFA 4BLUA 1N5OX 3HCRA 3LX6A 4OLFA 3QE2A 1NU6A 1MB9A 3CRZA 2B3DA 2H52A 1L1QA 3ABZA 1JVNA 1XD2B 3JARB 5C0OE 4ZIRA 4S35A 1YQQA 4TXMA 1WBBA 2QPAA 4PS0A 3TXXA 1ODKA 1E1QA 3M3DA 1B74A 4IJVA 3WYGA 5F52A 4U0JA 4PWZA 1IK4A 3ED1A 5JNLA 3OH8A 4GSYA 5LUAA 1N2XA 4JMPA 3NRJA 2JARA 3R5FA 4TYQA 5TNXA 3SHVA 2AEEA 1WCIB 2JH9A 2GRUA 2O8BA 3D4PA 5B6JA 5IF3A 1SC1A 4WERA 3QFFA 3ZDEA 1CQJB 1HQYE 2B5VA 1V6AA 3LUBA 4NJMA 3TINA 2H85A 4RVSA 3R7WB 3WYAA 3RRZA 1N6RA 4KUGA 4R2KA 4B3RB 3GCZA 2QG9A 1RLUA 2NM0A 3I04A 2CJYA 3K6JA 4O5AA 4B6JA 3L0DA 5KQGA 3ESXA 4XWOA 4YLEA 1QUFA 3K9CA 1SVUA 2B92A 1QO9A 4J0FA 2YHBA 4FZ3A 3EZ2A 4G1UC 1T3ZA 1M6WA 3RSGA 5TIIA 2VJBA 3AOEA 5JAMA 4DIBA 2B6HA 5FX2A 4EQ6B 5BYKA 3ABIA 3ZG6A 4B3GA 1RQLA 3LOQA 3U4GA 3ZWXA 1G8HA 3TFOA 3RGWS 4OQFA 3GT4A 5BV7A 1SC3A 1J07A 2X8BA 2ZUWA 1H1LB 3HVKA 2QDKA 3F5QA 3NGMA 4G0PA 2QLTA 2G9NA 2IU6A 1QM5A 3N58A 4L6CA 1XEXB 1TU0A 4MGYR 1CUAA 4EQZA 1NT4A 4HQLA 8GPBA 5GONF 1AOXA 5JOQA 3K6SA 1ZUNB 2OO5C 2W2QA 1FUKA 3MJFA 3ORHA 4KJXA 2IP4A 3BK7A 3O4IA 1SO8A 4LDAA 3REFA 3DTTA 2DFKB 5KMGA 2WD9A 4YXWA 1J0CA 1KPGA 4IDFA 4RF3A 3DZJA 4CMEC 4GPEA 5KBYA 4EJSA 3LUKA 4H1UA 3IBTA 5E7QA 4J07A 2BSQA 1FFDA 3OO0A 1M74A 1GT91 1T35A 3G89A 3BE6A 5EJAA 1TXGA 3U3MA 4ZHQB 3WP1B 2G1PA 2FKAA 1Z73A 4S1NA 1WOYA 3UB2A 1K8ZB 1NP3A 1SUFA 5AKZA 5HK8A 3WYFA 1W52X 2B7BA 1F8XA 5LQNA 2H1OA 4LZLA 2PWAA 3OQ6A 3GFSA 4Q1AA 2VHCA 3FSRA 3IIKA 2D74A 1NE2A 4M9QA 1Y7IA 3D7LA 1UMDB 3DMRA 3WJAA 2PZEA 4BMDA 2XVXA 4B3BA 3R3WA 1QVAA 3QXCA 1P5ZB 4BO7A 5LU8A 3JQAD 1YZUA 4O2AF 3LVQE 3MIZA 3UVEA 1V9SA 4BLRA 2CV0A 3IP3A 3QVKA 5L4SA 1M67A 1OXBB 2E3JA 4D3SA 3OFKA 1WW2A 1Z74A 3D1VA 1HE8B 2BIFA 5LA6F 2B4AA 4JLDA 4ZYZA 2GRJA 3DO8A 4KE6A 2C8VA 1GTG1 4TV9B 4UEKA 2IZ0A 4MIYA 5T4FA 1PDOA 1UJ2A 1QGOA 1U8TA 3DXXA 2O1SA 4ZGGA 3BIWA 3BMNB 1UOPA 1KR5A 3CGWA 1DAIA 3LHSA 3WRYA 4JJZA 1DEOA 1V37A 2QXUA 5CDTA 2PPLA 5LP6A 2Q9BA 3OF3A 4F7DA 4P31A 3DV2A 4HAOA 4UFNA 1FJHA 3NHZA 5H9VA 4ZOLF 3MXOA 5T7BA 2C42A 3VKWA 4GL2A 1C1DB 1ZCZA 4IIXA 4RF5A 2LCIA 3RRBA 3DZ8A 4BRSA 5ADWA 1P7PA 2GZAA 2WJGA 3PUZA 4TL8A 4MWBA 5FQOA 4CKBB 3GNSA 5ES4B 1Q7GA 1A9YA 4AX8A 4OK6A 1EM6A 1IY2A 1ZD9A 1B6RA 4DA9A 1I7QB 4Q16A 2GR9A 2FQYA 2YW9A 4HFMA 4J3FA 5JALA 3INYA 4W9NC 2J30A 4M76B 3CW8X 4PCUA 4PV7A 1HA3A 3BXHA 4DTIA 3W3AH 3IQFA 4TKLA 1TTQB 1Z6ZA 1Q14A 1I5EA 1SXGA 1L2TA 3QITA 4J75A 3LNTA 3HYNA 3RYIA 3ZI0A 3ZY3A 1BFDA 3HR4A 4K1LA 4LE2A 2GOYA 2TMYA 1YJAA 3VU8A 1YZLA 2J0VA 3HA7A 2ONZA 3GRUA 4GX1A 2AK2A 2Z2IA 3LXMA 2J7PD 4JP3A 3W8EA 4E31A 2WB2A 2WNSA 1K0UA 4TLAA 5DHFA 1KS2A 3UG7A 4BP1A 1XU9A 3TGWA 2CF5A 4AMBA 2PTGA 1A76A 4I4TB 3FYSA 4RHTA 4WFIA 3OX2A 4U5XA 3OFND 1CBUA 1UINA 1B1AA 3WYDA 2IZOA 1DIAA 3PWSA 1NW7A 4NOLA 1JR3A 4L57A 3OLCX 2JRCA 3SIRA 4BWVA 5GPBA 4CM3A 2FPWA 2UUPA 1XRNA 3RSLA 2H2WA 2INGX 3LRXA 3HXPA 3EIWA 4AUKA 3AEUB 4OUKX 4OYLA 1UDAA 3E7DA 4A8JB 1WUYA 5HCNA 1DCTA 5DGIA 1V6CA 2GZHA 5FTKA 3GLGB 1JEYB 4N8DA 2HYIC 2PMWB 4FILA 3V4PB 1Z5NA 4R84A 1KJ8A 2OHIA 2P9ZA 3EEOA 4HDNB 4YO8A 1NDHA 4KTVE 3HP7A 1B8PA 2VEOA 2WZDA 3W9UA 2I5PO 2XUIA 2GARA 3AHFA 4P5EA 3CSUA 1DWQA