2ZJPS

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjpS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjpS02
3J7ZV 2HZ7A 1ZJWA 4JXZA 3AIIA 1QRTA 1O0CA 4JXXA 4IOAS 5DM6S 5GAGW 4IO9S 1D6KA 1DFUP 1NYLA 4WF9S 4IOCS 1GTSA 4WFNS 1O0BA 1EUYA 2ZJQS 5DM7S 4WFAS 5JVHS 4WFBS 1B75A 4JYZA 5GAEW 3CF5S 1QTQA 1QRSA 5GADW 1EXDA 2RE8A 2RD2A 5IZNA 3DLLS 1EUQA 4WCES 3PIPS 5HL7S 1QRUA 2ZJPS 1GTRA 3PIOS 4U67S 5GAHW 5BNZA 2ZJRS 4P2BA 1FEUA 5JVGS 4H3SA 4UY88
chains in the Genus database with same CATH superfamily
5C4XC 4LK0A 2HZ7A 5C3EC 4Y7NC 1ZJWA 4A3LC 2R7ZC 3M4OC 3AIIA 2PJJA 4L69A 4JXXA 2PICA 4BBRC 4IOAS 3S1MC 4KN4A 1YNNA 2KQ1A 4G7OA 3S14C 5GAGW 1VHKA 3HOUC 2A6EA 3S2DC 4WF9S 2EGVA 1GTSA 3X1LB 4WFNS 3LYWA 2E2JC 3M3YC 1B75A 5DM7S 1UDXA 3HOXC 4XSZA 4C3IC 3I4NC 4A3KC 5IZNA 4MQ9A 1EUQA 1Y1WC 4OINA 1Z85A 2JA7C 3RZOC 4A3BC 3W2WB 2KPUA 5TMFA 2E2IC 1GTRA 5IYCC 3PIOS 1TWCC 4BY7C 5BNZA 3PO2C 3KW2A 4H3SA 4KMUA 3HKZD 4OIOA 4MEYA 4ZH4A 2PPBA 2JA8C 3S1NC 5C4JC 5IYBC 4YFXA 1O0CA 4J3CA 1SMYA 4A3JC 4GZYA 2A68A 4IO9S 4XLPA 5IP7C 1TWHC 2NVQC 3S17C 1HQMA 1VHYA 1NYLA 4V194 5TMCA 3GTOC 3S1RC 1EUYA 2ZJQS 5JVHS 4WFAS 4MEXA 4XLNA 1QTQA 3CF5S 4YFKA 3GTKC 1I50C 1WCMC 2RD2A 1TWFC 4A3DC 4Q5SA 3S2HC 2G5DA 4A3EC 4A3MC 4QIWD 4C3JC 4QJVA 1I6VA 3RZDC 4H4KA 2NVYC 1FEUA 2Y0SD 3GTGC 2PNWA 3W2VB 1SFOC 3GTQC 1I6HC 5IYDC 1TWAC 4OIQA 3HOYC 3GTLC 4BXXC 1NXZA 4E8BA 1QRTA 3H3VD 5C44C 2NWAA 4X6AC 4G7ZA 2AE0X 4KN7A 5DM6S 2GAEA 1YNJA 1I3QC 1D6KA 2B63C 2JA6C 3PO3C 3WODA 4A3GC 4C2MC 1ZYRA 4IOCS 1BDFA 2PMZD 1O0BA 2E2HC 2VUMC 2PI8A 4JYZA 3GTJC 5IP9C 3GTPC 4A93C 2CX8A 1QRSA 3EQLA 3CZBA 3DLLS 4WCES 3PIPS 4Y52C 2JA5C 1QRUA 2YU9C 2ZJPS 5HQHA 2L5NA 4LLGA 4G7HA 4LJZA 3I4MC 4JXZA 2O5IA 5JVGS 4A3IC 4UY88 1DFUP 3HOVC 2EGWA 3J7ZV 3S15C 5D4DA 1Y1VC 4YG2A 1V6ZA 2NVXC 3HOWC 4A3FC 2CW0A 2A69A 4OIRA 4Q4ZA 2WAQD 2G6GA 4A3CC 2Z0YA 1K83C 2PA8D 2WB1D 4LK1A 2BE5A 3H0GC 2O5JA 4BY1C 3DXJA 3CQZC 1R9TC 2A6HA 4WFBS 2NVTC 5GAEW 1TWGC 2R92C 2L3UA 3S1QC 3HOZC 5GADW 1EXDA 1IW7A 2RE8A 4AYBD 5HL7S 3GTMC 4NOIA 4C3HC 4OIPA 2KXYA 2R93C 4XSXA 3S16C 4U67S 4JK1A 5GAHW 4BBSC 2ZJRS 4P2BA 3K7AC 4YFNA 3FKIC 5FLMC
chains in the Genus database with same CATH topology
3J7ZV 2HZ7A 1ZJWA 4JXZA 3AIIA 1QRTA 1O0CA 4JXXA 4IOAS 5DM6S 5GAGW 4IO9S 1D6KA 1DFUP 1NYLA 4V194 4WF9S 4IOCS 1GTSA 3X1LB 4WFNS 1O0BA 1EUYA 2ZJQS 5DM7S 4WFAS 5JVHS 4WFBS 1B75A 4JYZA 1UDXA 5GAEW 3CF5S 1QTQA 1QRSA 5GADW 1EXDA 2RE8A 2RD2A 5IZNA 3DLLS 1EUQA 4WCES 3PIPS 5HL7S 1QRUA 3W2WB 2ZJPS 1GTRA 3PIOS 4U67S 5GAHW 4H4KA 5BNZA 2ZJRS 4P2BA 1FEUA 5JVGS 3W2VB 4H3SA 4UY88
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z V;  2HZ7 A;  1ZJW A;  4JXZ A;  3AII A;  1QRT A;  1O0C A;  4JXX A;  4IOA S;  5DM6 S;  5GAG W;  4IO9 S;  1D6K A;  1DFU P;  1NYL A;  4WF9 S;  4IOC S;  1GTS A;  4WFN S;  1O0B A;  1EUY A;  2ZJQ S;  5DM7 S;  4WFA S;  5JVH S;  4WFB S;  1B75 A;  4JYZ A;  5GAE W;  3CF5 S;  1QTQ A;  1QRS A;  5GAD W;  1EXD A;  2RE8 A;  2RD2 A;  5IZN A;  3DLL S;  1EUQ A;  4WCE S;  3PIP S;  5HL7 S;  1QRU A;  2ZJP S;  1GTR A;  3PIO S;  4U67 S;  5GAH W;  5BNZ A;  2ZJR S;  4P2B A;  1FEU A;  5JVG S;  4H3S A;  4UY8 8; 
#chains in the Genus database with same CATH topology
 5C4X C;  4LK0 A;  2HZ7 A;  5C3E C;  4Y7N C;  1ZJW A;  4A3L C;  2R7Z C;  3M4O C;  3AII A;  2PJJ A;  4L69 A;  4JXX A;  2PIC A;  4BBR C;  4IOA S;  3S1M C;  4KN4 A;  1YNN A;  2KQ1 A;  4G7O A;  3S14 C;  5GAG W;  1VHK A;  3HOU C;  2A6E A;  3S2D C;  4WF9 S;  2EGV A;  1GTS A;  3X1L B;  4WFN S;  3LYW A;  2E2J C;  3M3Y C;  1B75 A;  5DM7 S;  1UDX A;  3HOX C;  4XSZ A;  4C3I C;  3I4N C;  4A3K C;  5IZN A;  4MQ9 A;  1EUQ A;  1Y1W C;  4OIN A;  1Z85 A;  2JA7 C;  3RZO C;  4A3B C;  3W2W B;  2KPU A;  5TMF A;  2E2I C;  1GTR A;  5IYC C;  3PIO S;  1TWC C;  4BY7 C;  5BNZ A;  3PO2 C;  3KW2 A;  4H3S A;  4KMU A;  3HKZ D;  4OIO A;  4MEY A;  4ZH4 A;  2PPB A;  2JA8 C;  3S1N C;  5C4J C;  5IYB C;  4YFX A;  1O0C A;  4J3C A;  1SMY A;  4A3J C;  4GZY A;  2A68 A;  4IO9 S;  4XLP A;  5IP7 C;  1TWH C;  2NVQ C;  3S17 C;  1HQM A;  1VHY A;  1NYL A;  4V19 4;  5TMC A;  3GTO C;  3S1R C;  1EUY A;  2ZJQ S;  5JVH S;  4WFA S;  4MEX A;  4XLN A;  1QTQ A;  3CF5 S;  4YFK A;  3GTK C;  1I50 C;  1WCM C;  2RD2 A;  1TWF C;  4A3D C;  4Q5S A;  3S2H C;  2G5D A;  4A3E C;  4A3M C;  4QIW D;  4C3J C;  4QJV A;  1I6V A;  3RZD C;  4H4K A;  2NVY C;  1FEU A;  2Y0S D;  3GTG C;  2PNW A;  3W2V B;  1SFO C;  3GTQ C;  1I6H C;  5IYD C;  1TWA C;  4OIQ A;  3HOY C;  3GTL C;  4BXX C;  1NXZ A;  4E8B A;  1QRT A;  3H3V D;  5C44 C;  2NWA A;  4X6A C;  4G7Z A;  2AE0 X;  4KN7 A;  5DM6 S;  2GAE A;  1YNJ A;  1I3Q C;  1D6K A;  2B63 C;  2JA6 C;  3PO3 C;  3WOD A;  4A3G C;  4C2M C;  1ZYR A;  4IOC S;  1BDF A;  2PMZ D;  1O0B A;  2E2H C;  2VUM C;  2PI8 A;  4JYZ A;  3GTJ C;  5IP9 C;  3GTP C;  4A93 C;  2CX8 A;  1QRS A;  3EQL A;  3CZB A;  3DLL S;  4WCE S;  3PIP S;  4Y52 C;  2JA5 C;  1QRU A;  2YU9 C;  2ZJP S;  5HQH A;  2L5N A;  4LLG A;  4G7H A;  4LJZ A;  3I4M C;  4JXZ A;  2O5I A;  5JVG S;  4A3I C;  4UY8 8;  1DFU P;  3HOV C;  2EGW A;  3J7Z V;  3S15 C;  5D4D A;  1Y1V C;  4YG2 A;  1V6Z A;  2NVX C;  3HOW C;  4A3F C;  2CW0 A;  2A69 A;  4OIR A;  4Q4Z A;  2WAQ D;  2G6G A;  4A3C C;  2Z0Y A;  1K83 C;  2PA8 D;  2WB1 D;  4LK1 A;  2BE5 A;  3H0G C;  2O5J A;  4BY1 C;  3DXJ A;  3CQZ C;  1R9T C;  2A6H A;  4WFB S;  2NVT C;  5GAE W;  1TWG C;  2R92 C;  2L3U A;  3S1Q C;  3HOZ C;  5GAD W;  1EXD A;  1IW7 A;  2RE8 A;  4AYB D;  5HL7 S;  3GTM C;  4NOI A;  4C3H C;  4OIP A;  2KXY A;  2R93 C;  4XSX A;  3S16 C;  4U67 S;  4JK1 A;  5GAH W;  4BBS C;  2ZJR S;  4P2B A;  3K7A C;  4YFN A;  3FKI C;  5FLM C; 
#chains in the Genus database with same CATH homology
 3J7Z V;  2HZ7 A;  1ZJW A;  4JXZ A;  3AII A;  1QRT A;  1O0C A;  4JXX A;  4IOA S;  5DM6 S;  5GAG W;  4IO9 S;  1D6K A;  1DFU P;  1NYL A;  4V19 4;  4WF9 S;  4IOC S;  1GTS A;  3X1L B;  4WFN S;  1O0B A;  1EUY A;  2ZJQ S;  5DM7 S;  4WFA S;  5JVH S;  4WFB S;  1B75 A;  4JYZ A;  1UDX A;  5GAE W;  3CF5 S;  1QTQ A;  1QRS A;  5GAD W;  1EXD A;  2RE8 A;  2RD2 A;  5IZN A;  3DLL S;  1EUQ A;  4WCE S;  3PIP S;  5HL7 S;  1QRU A;  3W2W B;  2ZJP S;  1GTR A;  3PIO S;  4U67 S;  5GAH W;  4H4K A;  5BNZ A;  2ZJR S;  4P2B A;  1FEU A;  5JVG S;  3W2V B;  4H3S A;  4UY8 8; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...