2ZJPS

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
175
structure length
175
Chain Sequence
b'MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjpS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjpS02
3J7ZV 4IOCS 2HZ7A 2RD2A 5IZNA 4UY88 4WF9S 5DM6S 4JXXA 5HL7S 1QTQA 3DLLS 1EUQA 5GAGW 1D6KA 4JXZA 4P2BA 1QRTA 5GAEW 1EXDA 4WCES 4WFNS 2ZJPS 2ZJRS 3AIIA 1EUYA 1DFUP 1O0CA 1O0BA 1B75A 4WFAS 5GADW 4JYZA 3CF5S 4H3SA 5JVHS 1GTRA 5JVGS 1GTSA 4U67S 3PIPS 1QRUA 5DM7S 4IOAS 1NYLA 1FEUA 1QRSA 2RE8A 4WFBS 4IO9S 2ZJQS 5GAHW 5BNZA 3PIOS 1ZJWA
chains in the Genus database with same CATH superfamily
3HOYC 3X1LB 4C2MC 3GTOC 4IOCS 3W2WB 2HZ7A 4BBRC 4A3EC 4UY88 4G7ZA 5DM6S 3S1NC 4XSXA 4A3KC 1TWCC 4BXXC 5HL7S 5C4XC 3DLLS 5D4DA 3GTLC 5IP7C 4P2BA 1TWGC 1QRTA 1EXDA 1K83C 3H3VD 4OIQA 2ZJRS 1SFOC 4AYBD 4C3HC 4YFXA 1O0CA 4G7HA 4A3JC 3GTQC 2O5JA 5FLMC 2JA7C 2R93C 5JVHS 2G5DA 3I4MC 4KMUA 3CZBA 2WB1D 4Y7NC 3HOVC 3S2DC 4A3FC 2KPUA 3WODA 1NYLA 2PICA 2CW0A 4YFKA 1QRSA 4V194 2RE8A 3EQLA 4WFBS 4BY7C 4MEXA 2ZJQS 4LK0A 1SMYA 4NOIA 4X6AC 3DXJA 1ZJWA 4JK1A 4A3IC 3PO3C 3J7ZV 2RD2A 4LJZA 3RZDC 2CX8A 5IZNA 1YNJA 2KQ1A 4OIRA 1NXZA 2R92C 4A93C 4J3CA 4LLGA 2E2HC 3S16C 3HOXC 3S15C 5TMCA 2A68A 4C3IC 3S1QC 2JA8C 4Y52C 4WFNS 2ZJPS 3GTJC 3AIIA 1DFUP 4A3DC 1I6HC 4BY1C 2PJJA 5GADW 5JVGS 4OINA 3S2HC 2L3UA 1QRUA 5DM7S 3I4NC 3HOUC 3RZOC 2L5NA 1BDFA 4IO9S 4QJVA 2VUMC 1TWHC 3GTPC 4H4KA 5BNZA 3PIOS 2JA6C 3GTMC 4WF9S 4C3JC 2NVYC 5IYCC 4JXXA 4KN7A 2NVTC 5C4JC 3S1RC 3HKZD 4XLPA 5C3EC 1TWAC 2PI8A 1D6KA 1IW7A 3FKIC 5IP9C 3CQZC 5IYBC 1Y1WC 2NVQC 1I3QC 3GTGC 1V6ZA 1VHYA 4MQ9A 3M4OC 2YU9C 4A3LC 3HOWC 1B75A 2PMZD 2R7ZC 1I50C 2PPBA 4MEYA 4WFAS 2PNWA 4A3CC 4Q4ZA 1Y1VC 1GTRA 3S1MC 2A6EA 3LYWA 2EGWA 2E2JC 3PIPS 3HOZC 4IOAS 4ZH4A 4L69A 5IYDC 4XLNA 4A3GC 2B63C 4LK1A 3S17C 4GZYA 4A3BC 3KW2A 2Z0YA 2NVXC 4Q5SA 5C44C 4KN4A 3M3YC 4BBSC 3W2VB 3K7AC 1HQMA 2JA5C 5TMFA 1QTQA 2Y0SD 1EUQA 4OIOA 5GAGW 4JXZA 4XSZA 3PO2C 2GAEA 4QIWD 1TWFC 2E2IC 4WCES 1UDXA 2G6GA 1EUYA 2A6HA 2A69A 2PA8D 2NWAA 1ZYRA 1O0BA 1R9TC 2O5IA 1YNNA 3GTKC 1I6VA 2EGVA 3S14C 4JYZA 3CF5S 2AE0X 4H3SA 4G7OA 4A3MC 4OIPA 1GTSA 4U67S 1WCMC 1VHKA 3H0GC 1FEUA 4E8BA 5HQHA 4YFNA 2BE5A 2KXYA 4YG2A 1Z85A 5GAHW 5GAEW 2WAQD
chains in the Genus database with same CATH topology
3X1LB 3J7ZV 4IOCS 3W2WB 2HZ7A 2RD2A 3W2VB 5IZNA 4UY88 4WF9S 5DM6S 4JXXA 5HL7S 1QTQA 3DLLS 1EUQA 5GAGW 1D6KA 4JXZA 4P2BA 1QRTA 5GAEW 1EXDA 4WCES 4WFNS 1UDXA 2ZJPS 3AIIA 2ZJRS 1EUYA 1DFUP 1O0CA 1O0BA 1B75A 4WFAS 5GADW 4JYZA 3CF5S 4H3SA 5JVHS 1GTRA 5JVGS 1GTSA 4U67S 3PIPS 1QRUA 5DM7S 4IOAS 1NYLA 1FEUA 1QRSA 4V194 2RE8A 4WFBS 4IO9S 2ZJQS 5GAHW 4H4KA 5BNZA 3PIOS 1ZJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z V;  4IOC S;  2HZ7 A;  2RD2 A;  5IZN A;  4UY8 8;  4WF9 S;  5DM6 S;  4JXX A;  5HL7 S;  1QTQ A;  3DLL S;  1EUQ A;  5GAG W;  1D6K A;  4JXZ A;  4P2B A;  1QRT A;  5GAE W;  1EXD A;  4WCE S;  4WFN S;  2ZJP S;  2ZJR S;  3AII A;  1EUY A;  1DFU P;  1O0C A;  1O0B A;  1B75 A;  4WFA S;  5GAD W;  4JYZ A;  3CF5 S;  4H3S A;  5JVH S;  1GTR A;  5JVG S;  1GTS A;  4U67 S;  3PIP S;  1QRU A;  5DM7 S;  4IOA S;  1NYL A;  1FEU A;  1QRS A;  2RE8 A;  4WFB S;  4IO9 S;  2ZJQ S;  5GAH W;  5BNZ A;  3PIO S;  1ZJW A; 
#chains in the Genus database with same CATH topology
 3HOY C;  3X1L B;  4C2M C;  3GTO C;  4IOC S;  3W2W B;  2HZ7 A;  4BBR C;  4A3E C;  4UY8 8;  4G7Z A;  5DM6 S;  3S1N C;  4XSX A;  4A3K C;  1TWC C;  4BXX C;  5HL7 S;  5C4X C;  3DLL S;  5D4D A;  3GTL C;  5IP7 C;  4P2B A;  1TWG C;  1QRT A;  1EXD A;  1K83 C;  3H3V D;  4OIQ A;  2ZJR S;  1SFO C;  4AYB D;  4C3H C;  4YFX A;  1O0C A;  4G7H A;  4A3J C;  3GTQ C;  2O5J A;  5FLM C;  2JA7 C;  2R93 C;  5JVH S;  2G5D A;  3I4M C;  4KMU A;  3CZB A;  2WB1 D;  4Y7N C;  3HOV C;  3S2D C;  4A3F C;  2KPU A;  3WOD A;  1NYL A;  2PIC A;  2CW0 A;  4YFK A;  1QRS A;  4V19 4;  2RE8 A;  3EQL A;  4WFB S;  4BY7 C;  4MEX A;  2ZJQ S;  4LK0 A;  1SMY A;  4NOI A;  4X6A C;  3DXJ A;  1ZJW A;  4JK1 A;  4A3I C;  3PO3 C;  3J7Z V;  2RD2 A;  4LJZ A;  3RZD C;  2CX8 A;  5IZN A;  1YNJ A;  2KQ1 A;  4OIR A;  1NXZ A;  2R92 C;  4A93 C;  4J3C A;  4LLG A;  2E2H C;  3S16 C;  3HOX C;  3S15 C;  5TMC A;  2A68 A;  4C3I C;  3S1Q C;  2JA8 C;  4Y52 C;  4WFN S;  2ZJP S;  3GTJ C;  3AII A;  1DFU P;  4A3D C;  1I6H C;  4BY1 C;  2PJJ A;  5GAD W;  5JVG S;  4OIN A;  3S2H C;  2L3U A;  1QRU A;  5DM7 S;  3I4N C;  3HOU C;  3RZO C;  2L5N A;  1BDF A;  4IO9 S;  4QJV A;  2VUM C;  1TWH C;  3GTP C;  4H4K A;  5BNZ A;  3PIO S;  2JA6 C;  3GTM C;  4WF9 S;  4C3J C;  2NVY C;  5IYC C;  4JXX A;  4KN7 A;  2NVT C;  5C4J C;  3S1R C;  3HKZ D;  4XLP A;  5C3E C;  1TWA C;  2PI8 A;  1D6K A;  1IW7 A;  3FKI C;  5IP9 C;  3CQZ C;  5IYB C;  1Y1W C;  2NVQ C;  1I3Q C;  3GTG C;  1V6Z A;  1VHY A;  4MQ9 A;  3M4O C;  2YU9 C;  4A3L C;  3HOW C;  1B75 A;  2PMZ D;  2R7Z C;  1I50 C;  2PPB A;  4MEY A;  4WFA S;  2PNW A;  4A3C C;  4Q4Z A;  1Y1V C;  1GTR A;  3S1M C;  2A6E A;  3LYW A;  2EGW A;  2E2J C;  3PIP S;  3HOZ C;  4IOA S;  4ZH4 A;  4L69 A;  5IYD C;  4XLN A;  4A3G C;  2B63 C;  4LK1 A;  3S17 C;  4GZY A;  4A3B C;  3KW2 A;  2Z0Y A;  2NVX C;  4Q5S A;  5C44 C;  4KN4 A;  3M3Y C;  4BBS C;  3W2V B;  3K7A C;  1HQM A;  2JA5 C;  5TMF A;  1QTQ A;  2Y0S D;  1EUQ A;  4OIO A;  5GAG W;  4JXZ A;  4XSZ A;  3PO2 C;  2GAE A;  4QIW D;  1TWF C;  2E2I C;  4WCE S;  1UDX A;  2G6G A;  1EUY A;  2A6H A;  2A69 A;  2PA8 D;  2NWA A;  1ZYR A;  1O0B A;  1R9T C;  2O5I A;  1YNN A;  3GTK C;  1I6V A;  2EGV A;  3S14 C;  4JYZ A;  3CF5 S;  2AE0 X;  4H3S A;  4G7O A;  4A3M C;  4OIP A;  1GTS A;  4U67 S;  1WCM C;  1VHK A;  3H0G C;  1FEU A;  4E8B A;  5HQH A;  4YFN A;  2BE5 A;  2KXY A;  4YG2 A;  1Z85 A;  5GAH W;  5GAE W;  2WAQ D; 
#chains in the Genus database with same CATH homology
 3X1L B;  3J7Z V;  4IOC S;  3W2W B;  2HZ7 A;  2RD2 A;  3W2V B;  5IZN A;  4UY8 8;  4WF9 S;  5DM6 S;  4JXX A;  5HL7 S;  1QTQ A;  3DLL S;  1EUQ A;  5GAG W;  1D6K A;  4JXZ A;  4P2B A;  1QRT A;  5GAE W;  1EXD A;  4WCE S;  4WFN S;  1UDX A;  2ZJP S;  3AII A;  2ZJR S;  1EUY A;  1DFU P;  1O0C A;  1O0B A;  1B75 A;  4WFA S;  5GAD W;  4JYZ A;  3CF5 S;  4H3S A;  5JVH S;  1GTR A;  5JVG S;  1GTS A;  4U67 S;  3PIP S;  1QRU A;  5DM7 S;  4IOA S;  1NYL A;  1FEU A;  1QRS A;  4V19 4;  2RE8 A;  4WFB S;  4IO9 S;  2ZJQ S;  5GAH W;  4H4K A;  5BNZ A;  3PIO S;  1ZJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...