2ZJPS

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 15
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjpS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjpS02
1EUQA 5BNZA 2ZJPS 3J7ZV 2RD2A 5JVHS 1NYLA 4IO9S 4WFNS 1B75A 2ZJQS 4JYZA 4U67S 3PIPS 5DM6S 1EXDA 1DFUP 3DLLS 4IOAS 4JXZA 5JVGS 5IZNA 3CF5S 1EUYA 1QRTA 4UY88 5DM7S 4WFBS 1QRSA 4WF9S 4IOCS 2ZJRS 1GTSA 1FEUA 4WFAS 1ZJWA 4WCES 4P2BA 5GADW 2RE8A 1D6KA 1O0CA 5GAHW 3PIOS 5HL7S 4H3SA 1QRUA 5GAEW 4JXXA 5GAGW 3AIIA 1GTRA 1O0BA 2HZ7A 1QTQA
chains in the Genus database with same CATH superfamily
5C44C 4Q4ZA 4C3JC 4V194 4YFNA 4XSXA 2NWAA 2PMZD 4IO9S 4A3EC 4BXXC 4OINA 4U67S 3DXJA 4NOIA 1DFUP 5C4JC 2PPBA 2O5JA 4H4KA 2WAQD 2R7ZC 3S2HC 4KMUA 5HQHA 1SFOC 3S15C 4A3KC 3GTQC 1Y1VC 2O5IA 1EUYA 2R92C 1QRTA 4UY88 4MQ9A 3HOZC 1VHYA 1ZYRA 3S1RC 1GTSA 1TWCC 3W2WB 1ZJWA 3CQZC 1YNJA 4LK1A 5GAHW 4XLPA 4L69A 1BDFA 3GTJC 4C2MC 4LK0A 2JA6C 5TMFA 3S16C 3GTGC 5GAGW 3EQLA 3HKZD 1GTRA 3H3VD 3I4NC 3HOXC 2ZJPS 3S1MC 2E2IC 4YFKA 4WFNS 5IYCC 3HOWC 4JYZA 4XLNA 4OIPA 4C3IC 3PIPS 1EXDA 4IOAS 1WCMC 2CW0A 2Y0SD 4C3HC 1R9TC 5IZNA 4BBRC 3RZOC 2PNWA 2WB1D 2KXYA 4WFBS 1QRSA 4QJVA 4WF9S 2KPUA 3M3YC 3M4OC 5TMCA 1FEUA 2AE0X 4WCES 4A3FC 1D6KA 4X6AC 4LLGA 2L5NA 2JA8C 3GTMC 2PICA 5HL7S 4H3SA 2A68A 1I50C 4MEYA 2PA8D 4YG2A 4JXXA 2YU9C 2NVQC 3AIIA 1TWHC 2HZ7A 1QTQA 1Z85A 5FLMC 5C4XC 5BNZA 3J7ZV 2CX8A 4QIWD 2G5DA 2NVTC 2ZJQS 4G7OA 3GTLC 1YNNA 3S1NC 2EGVA 5DM6S 2KQ1A 3CZBA 1TWFC 5IP7C 3DLLS 4A3CC 4A3JC 4ZH4A 4MEXA 4JXZA 2GAEA 1TWAC 4YFXA 5C3EC 1Y1WC 2VUMC 3PO2C 2PI8A 3S17C 4G7ZA 3CF5S 4A3MC 2E2HC 4JK1A 4OIQA 1NXZA 4A3BC 3PO3C 2A6EA 3GTPC 1UDXA 2ZJRS 2JA7C 3HOVC 3H0GC 4WFAS 1K83C 5GADW 4A3LC 3W2VB 1O0CA 2A6HA 3GTKC 4GZYA 2A69A 1HQMA 5GAEW 3RZDC 4A93C 1O0BA 3WODA 4Y7NC 4Q5SA 4BBSC 3S14C 3LYWA 1EUQA 2RD2A 2G6GA 3K7AC 4E8BA 5JVHS 1NYLA 1B75A 4LJZA 4Y52C 2E2JC 2NVXC 3HOUC 3I4MC 3HOYC 4OIOA 3GTOC 4BY7C 4XSZA 1VHKA 4KN7A 3X1LB 4AYBD 2PJJA 3S1QC 1I6VA 2JA5C 5JVGS 1IW7A 2L3UA 5D4DA 5DM7S 5IYDC 4A3GC 2B63C 3FKIC 4A3DC 4IOCS 1TWGC 5IYBC 3S2DC 4BY1C 2R93C 4P2BA 2RE8A 1I3QC 4A3IC 1I6HC 5IP9C 4OIRA 3PIOS 2BE5A 1SMYA 2NVYC 1QRUA 4G7HA 3KW2A 4KN4A 4J3CA 2EGWA 2Z0YA 1V6ZA
chains in the Genus database with same CATH topology
1EUQA 5BNZA 2ZJPS 3J7ZV 2RD2A 4V194 5JVHS 1NYLA 4IO9S 4WFNS 1B75A 2ZJQS 4JYZA 4U67S 3PIPS 5DM6S 1EXDA 1DFUP 3DLLS 4IOAS 4H4KA 3X1LB 4JXZA 5JVGS 5IZNA 3CF5S 1EUYA 1QRTA 4UY88 5DM7S 4WFBS 1QRSA 4WF9S 1UDXA 2ZJRS 4IOCS 1GTSA 3W2WB 1FEUA 4WFAS 1ZJWA 4WCES 4P2BA 5GADW 2RE8A 3W2VB 1D6KA 1O0CA 5GAHW 3PIOS 5HL7S 4H3SA 1QRUA 5GAEW 4JXXA 5GAGW 3AIIA 1GTRA 1O0BA 2HZ7A 1QTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUQ A;  5BNZ A;  2ZJP S;  3J7Z V;  2RD2 A;  5JVH S;  1NYL A;  4IO9 S;  4WFN S;  1B75 A;  2ZJQ S;  4JYZ A;  4U67 S;  3PIP S;  5DM6 S;  1EXD A;  1DFU P;  3DLL S;  4IOA S;  4JXZ A;  5JVG S;  5IZN A;  3CF5 S;  1EUY A;  1QRT A;  4UY8 8;  5DM7 S;  4WFB S;  1QRS A;  4WF9 S;  4IOC S;  2ZJR S;  1GTS A;  1FEU A;  4WFA S;  1ZJW A;  4WCE S;  4P2B A;  5GAD W;  2RE8 A;  1D6K A;  1O0C A;  5GAH W;  3PIO S;  5HL7 S;  4H3S A;  1QRU A;  5GAE W;  4JXX A;  5GAG W;  3AII A;  1GTR A;  1O0B A;  2HZ7 A;  1QTQ A; 
#chains in the Genus database with same CATH topology
 5C44 C;  4Q4Z A;  4C3J C;  4V19 4;  4YFN A;  4XSX A;  2NWA A;  2PMZ D;  4IO9 S;  4A3E C;  4BXX C;  4OIN A;  4U67 S;  3DXJ A;  4NOI A;  1DFU P;  5C4J C;  2PPB A;  2O5J A;  4H4K A;  2WAQ D;  2R7Z C;  3S2H C;  4KMU A;  5HQH A;  1SFO C;  3S15 C;  4A3K C;  3GTQ C;  1Y1V C;  2O5I A;  1EUY A;  2R92 C;  1QRT A;  4UY8 8;  4MQ9 A;  3HOZ C;  1VHY A;  1ZYR A;  3S1R C;  1GTS A;  1TWC C;  3W2W B;  1ZJW A;  3CQZ C;  1YNJ A;  4LK1 A;  5GAH W;  4XLP A;  4L69 A;  1BDF A;  3GTJ C;  4C2M C;  4LK0 A;  2JA6 C;  5TMF A;  3S16 C;  3GTG C;  5GAG W;  3EQL A;  3HKZ D;  1GTR A;  3H3V D;  3I4N C;  3HOX C;  2ZJP S;  3S1M C;  2E2I C;  4YFK A;  4WFN S;  5IYC C;  3HOW C;  4JYZ A;  4XLN A;  4OIP A;  4C3I C;  3PIP S;  1EXD A;  4IOA S;  1WCM C;  2CW0 A;  2Y0S D;  4C3H C;  1R9T C;  5IZN A;  4BBR C;  3RZO C;  2PNW A;  2WB1 D;  2KXY A;  4WFB S;  1QRS A;  4QJV A;  4WF9 S;  2KPU A;  3M3Y C;  3M4O C;  5TMC A;  1FEU A;  2AE0 X;  4WCE S;  4A3F C;  1D6K A;  4X6A C;  4LLG A;  2L5N A;  2JA8 C;  3GTM C;  2PIC A;  5HL7 S;  4H3S A;  2A68 A;  1I50 C;  4MEY A;  2PA8 D;  4YG2 A;  4JXX A;  2YU9 C;  2NVQ C;  3AII A;  1TWH C;  2HZ7 A;  1QTQ A;  1Z85 A;  5FLM C;  5C4X C;  5BNZ A;  3J7Z V;  2CX8 A;  4QIW D;  2G5D A;  2NVT C;  2ZJQ S;  4G7O A;  3GTL C;  1YNN A;  3S1N C;  2EGV A;  5DM6 S;  2KQ1 A;  3CZB A;  1TWF C;  5IP7 C;  3DLL S;  4A3C C;  4A3J C;  4ZH4 A;  4MEX A;  4JXZ A;  2GAE A;  1TWA C;  4YFX A;  5C3E C;  1Y1W C;  2VUM C;  3PO2 C;  2PI8 A;  3S17 C;  4G7Z A;  3CF5 S;  4A3M C;  2E2H C;  4JK1 A;  4OIQ A;  1NXZ A;  4A3B C;  3PO3 C;  2A6E A;  3GTP C;  1UDX A;  2ZJR S;  2JA7 C;  3HOV C;  3H0G C;  4WFA S;  1K83 C;  5GAD W;  4A3L C;  3W2V B;  1O0C A;  2A6H A;  3GTK C;  4GZY A;  2A69 A;  1HQM A;  5GAE W;  3RZD C;  4A93 C;  1O0B A;  3WOD A;  4Y7N C;  4Q5S A;  4BBS C;  3S14 C;  3LYW A;  1EUQ A;  2RD2 A;  2G6G A;  3K7A C;  4E8B A;  5JVH S;  1NYL A;  1B75 A;  4LJZ A;  4Y52 C;  2E2J C;  2NVX C;  3HOU C;  3I4M C;  3HOY C;  4OIO A;  3GTO C;  4BY7 C;  4XSZ A;  1VHK A;  4KN7 A;  3X1L B;  4AYB D;  2PJJ A;  3S1Q C;  1I6V A;  2JA5 C;  5JVG S;  1IW7 A;  2L3U A;  5D4D A;  5DM7 S;  5IYD C;  4A3G C;  2B63 C;  3FKI C;  4A3D C;  4IOC S;  1TWG C;  5IYB C;  3S2D C;  4BY1 C;  2R93 C;  4P2B A;  2RE8 A;  1I3Q C;  4A3I C;  1I6H C;  5IP9 C;  4OIR A;  3PIO S;  2BE5 A;  1SMY A;  2NVY C;  1QRU A;  4G7H A;  3KW2 A;  4KN4 A;  4J3C A;  2EGW A;  2Z0Y A;  1V6Z A; 
#chains in the Genus database with same CATH homology
 1EUQ A;  5BNZ A;  2ZJP S;  3J7Z V;  2RD2 A;  4V19 4;  5JVH S;  1NYL A;  4IO9 S;  4WFN S;  1B75 A;  2ZJQ S;  4JYZ A;  4U67 S;  3PIP S;  5DM6 S;  1EXD A;  1DFU P;  3DLL S;  4IOA S;  4H4K A;  3X1L B;  4JXZ A;  5JVG S;  5IZN A;  3CF5 S;  1EUY A;  1QRT A;  4UY8 8;  5DM7 S;  4WFB S;  1QRS A;  4WF9 S;  1UDX A;  2ZJR S;  4IOC S;  1GTS A;  3W2W B;  1FEU A;  4WFA S;  1ZJW A;  4WCE S;  4P2B A;  5GAD W;  2RE8 A;  3W2V B;  1D6K A;  1O0C A;  5GAH W;  3PIO S;  5HL7 S;  4H3S A;  1QRU A;  5GAE W;  4JXX A;  5GAG W;  3AII A;  1GTR A;  1O0B A;  2HZ7 A;  1QTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...