2ZJPS

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 15
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 2zjpS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 2zjpS02
5BNZA 5JVGS 2RE8A 4U67S 3J7ZV 4JXZA 5GAHW 4JXXA 1QRSA 4WFNS 4P2BA 1FEUA 2RD2A 5JVHS 5GAGW 5DM6S 1ZJWA 2ZJPS 1EUYA 5IZNA 1QRTA 4WFAS 5GADW 4WFBS 1GTRA 3CF5S 1O0CA 4IO9S 1B75A 3DLLS 1DFUP 4WCES 2ZJQS 1NYLA 1QRUA 5GAEW 1EUQA 4IOAS 1EXDA 1GTSA 4H3SA 3PIPS 5DM7S 5HL7S 3AIIA 1O0BA 2HZ7A 4WF9S 1QTQA 2ZJRS 4IOCS 1D6KA 4UY88 4JYZA 3PIOS
chains in the Genus database with same CATH superfamily
3W2WB 4A3LC 3S2DC 4OIRA 2NVTC 2L5NA 3S15C 4ZH4A 1I6HC 2GAEA 4E8BA 4JXXA 3GTJC 4LK0A 4P2BA 5C4XC 4LK1A 3S2HC 3S1QC 2RD2A 4A3BC 1ZJWA 4A3MC 2NWAA 2JA5C 5TMFA 1R9TC 4Y52C 4XSZA 4XLNA 4IO9S 2ZJQS 3HKZD 1WCMC 4KN4A 1NYLA 5TMCA 2O5IA 1EUQA 4JK1A 1I3QC 4Q5SA 1VHKA 3W2VB 2HZ7A 3H0GC 2WAQD 4C3IC 2KXYA 4Q4ZA 3HOZC 1Z85A 5IYDC 4UY88 4J3CA 4KMUA 4G7OA 4JYZA 3GTLC 2PICA 3M3YC 3CQZC 3WODA 5C4JC 3GTKC 4C2MC 3J7ZV 2EGVA 2O5JA 2A6EA 1QRSA 4WFNS 4A93C 2PJJA 4MQ9A 2CW0A 3GTMC 5JVHS 1I50C 5GAGW 5DM6S 3X1LB 4A3EC 4V194 4WFBS 2A69A 5IYBC 1NXZA 4A3IC 3S1RC 4A3GC 1GTRA 1K83C 4A3FC 3RZOC 3HOUC 4WCES 2PPBA 1SMYA 2VUMC 4BY7C 5FLMC 3S17C 3M4OC 1QRUA 4IOAS 1BDFA 5HQHA 3GTGC 4H3SA 2EGWA 4BY1C 3PO3C 2PA8D 4GZYA 2L3UA 4H4KA 3GTOC 4OINA 2ZJRS 2AE0X 3PIOS 3LYWA 4G7ZA 2A6HA 2NVQC 1VHYA 4BBSC 4OIQA 4U67S 4JXZA 4C3HC 2B63C 4YFXA 1V6ZA 1ZYRA 4BBRC 4A3CC 4YFNA 2BE5A 2KPUA 2PNWA 1EUYA 4QJVA 2KQ1A 2E2JC 1Y1VC 2R92C 3HOVC 4C3JC 4WFAS 3HOYC 2JA6C 5C3EC 4XSXA 2E2IC 1B75A 3CF5S 2R93C 3PO2C 3S16C 1DFUP 2YU9C 5IP9C 4A3JC 5GAEW 1SFOC 4OIOA 4A3KC 1O0BA 4LJZA 4XLPA 3AIIA 2G6GA 4G7HA 3RZDC 1Y1WC 2NVXC 1TWAC 1TWHC 3H3VD 2A68A 3S1MC 1UDXA 2WB1D 1QTQA 4L69A 2CX8A 4KN7A 1D6KA 4LLGA 4MEYA 4AYBD 5BNZA 4MEXA 2JA7C 3S14C 5JVGS 2RE8A 1TWFC 1YNJA 3EQLA 3CZBA 5GAHW 4QIWD 2PMZD 5D4DA 3HOXC 3I4MC 4BXXC 1FEUA 3S1NC 5C44C 1TWGC 1YNNA 4YFKA 5IYCC 2ZJPS 3K7AC 3GTQC 5IZNA 1QRTA 2G5DA 1I6VA 5GADW 3FKIC 2R7ZC 1O0CA 3I4NC 3DLLS 4NOIA 2Y0SD 2PI8A 3DXJA 1EXDA 1GTSA 3PIPS 5DM7S 5HL7S 1TWCC 2Z0YA 4WF9S 4Y7NC 3GTPC 2E2HC 3KW2A 4A3DC 2NVYC 2JA8C 4YG2A 4OIPA 1IW7A 4IOCS 1HQMA 5IP7C 3HOWC 4X6AC
chains in the Genus database with same CATH topology
3W2WB 5BNZA 5JVGS 2RE8A 4U67S 3J7ZV 4JXZA 5GAHW 4JXXA 1QRSA 4WFNS 4P2BA 1FEUA 2RD2A 5JVHS 5GAGW 5DM6S 1ZJWA 2ZJPS 1EUYA 5IZNA 3X1LB 1QRTA 4WFAS 4V194 5GADW 4WFBS 1GTRA 3CF5S 1O0CA 4IO9S 1B75A 3DLLS 1DFUP 4WCES 2ZJQS 1NYLA 1QRUA 5GAEW 1EUQA 4IOAS 1EXDA 1GTSA 4H3SA 3PIPS 5DM7S 5HL7S 3AIIA 3W2VB 2HZ7A 1O0BA 4WF9S 1UDXA 4H4KA 1QTQA 2ZJRS 4IOCS 1D6KA 4UY88 4JYZA 3PIOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNZ A;  5JVG S;  2RE8 A;  4U67 S;  3J7Z V;  4JXZ A;  5GAH W;  4JXX A;  1QRS A;  4WFN S;  4P2B A;  1FEU A;  2RD2 A;  5JVH S;  5GAG W;  5DM6 S;  1ZJW A;  2ZJP S;  1EUY A;  5IZN A;  1QRT A;  4WFA S;  5GAD W;  4WFB S;  1GTR A;  3CF5 S;  1O0C A;  4IO9 S;  1B75 A;  3DLL S;  1DFU P;  4WCE S;  2ZJQ S;  1NYL A;  1QRU A;  5GAE W;  1EUQ A;  4IOA S;  1EXD A;  1GTS A;  4H3S A;  3PIP S;  5DM7 S;  5HL7 S;  3AII A;  1O0B A;  2HZ7 A;  4WF9 S;  1QTQ A;  2ZJR S;  4IOC S;  1D6K A;  4UY8 8;  4JYZ A;  3PIO S; 
#chains in the Genus database with same CATH topology
 3W2W B;  4A3L C;  3S2D C;  4OIR A;  2NVT C;  2L5N A;  3S15 C;  4ZH4 A;  1I6H C;  2GAE A;  4E8B A;  4JXX A;  3GTJ C;  4LK0 A;  4P2B A;  5C4X C;  4LK1 A;  3S2H C;  3S1Q C;  2RD2 A;  4A3B C;  1ZJW A;  4A3M C;  2NWA A;  2JA5 C;  5TMF A;  1R9T C;  4Y52 C;  4XSZ A;  4XLN A;  4IO9 S;  2ZJQ S;  3HKZ D;  1WCM C;  4KN4 A;  1NYL A;  5TMC A;  2O5I A;  1EUQ A;  4JK1 A;  1I3Q C;  4Q5S A;  1VHK A;  3W2V B;  2HZ7 A;  3H0G C;  2WAQ D;  4C3I C;  2KXY A;  4Q4Z A;  3HOZ C;  1Z85 A;  5IYD C;  4UY8 8;  4J3C A;  4KMU A;  4G7O A;  4JYZ A;  3GTL C;  2PIC A;  3M3Y C;  3CQZ C;  3WOD A;  5C4J C;  3GTK C;  4C2M C;  3J7Z V;  2EGV A;  2O5J A;  2A6E A;  1QRS A;  4WFN S;  4A93 C;  2PJJ A;  4MQ9 A;  2CW0 A;  3GTM C;  5JVH S;  1I50 C;  5GAG W;  5DM6 S;  3X1L B;  4A3E C;  4V19 4;  4WFB S;  2A69 A;  5IYB C;  1NXZ A;  4A3I C;  3S1R C;  4A3G C;  1GTR A;  1K83 C;  4A3F C;  3RZO C;  3HOU C;  4WCE S;  2PPB A;  1SMY A;  2VUM C;  4BY7 C;  5FLM C;  3S17 C;  3M4O C;  1QRU A;  4IOA S;  1BDF A;  5HQH A;  3GTG C;  4H3S A;  2EGW A;  4BY1 C;  3PO3 C;  2PA8 D;  4GZY A;  2L3U A;  4H4K A;  3GTO C;  4OIN A;  2ZJR S;  2AE0 X;  3PIO S;  3LYW A;  4G7Z A;  2A6H A;  2NVQ C;  1VHY A;  4BBS C;  4OIQ A;  4U67 S;  4JXZ A;  4C3H C;  2B63 C;  4YFX A;  1V6Z A;  1ZYR A;  4BBR C;  4A3C C;  4YFN A;  2BE5 A;  2KPU A;  2PNW A;  1EUY A;  4QJV A;  2KQ1 A;  2E2J C;  1Y1V C;  2R92 C;  3HOV C;  4C3J C;  4WFA S;  3HOY C;  2JA6 C;  5C3E C;  4XSX A;  2E2I C;  1B75 A;  3CF5 S;  2R93 C;  3PO2 C;  3S16 C;  1DFU P;  2YU9 C;  5IP9 C;  4A3J C;  5GAE W;  1SFO C;  4OIO A;  4A3K C;  1O0B A;  4LJZ A;  4XLP A;  3AII A;  2G6G A;  4G7H A;  3RZD C;  1Y1W C;  2NVX C;  1TWA C;  1TWH C;  3H3V D;  2A68 A;  3S1M C;  1UDX A;  2WB1 D;  1QTQ A;  4L69 A;  2CX8 A;  4KN7 A;  1D6K A;  4LLG A;  4MEY A;  4AYB D;  5BNZ A;  4MEX A;  2JA7 C;  3S14 C;  5JVG S;  2RE8 A;  1TWF C;  1YNJ A;  3EQL A;  3CZB A;  5GAH W;  4QIW D;  2PMZ D;  5D4D A;  3HOX C;  3I4M C;  4BXX C;  1FEU A;  3S1N C;  5C44 C;  1TWG C;  1YNN A;  4YFK A;  5IYC C;  2ZJP S;  3K7A C;  3GTQ C;  5IZN A;  1QRT A;  2G5D A;  1I6V A;  5GAD W;  3FKI C;  2R7Z C;  1O0C A;  3I4N C;  3DLL S;  4NOI A;  2Y0S D;  2PI8 A;  3DXJ A;  1EXD A;  1GTS A;  3PIP S;  5DM7 S;  5HL7 S;  1TWC C;  2Z0Y A;  4WF9 S;  4Y7N C;  3GTP C;  2E2H C;  3KW2 A;  4A3D C;  2NVY C;  2JA8 C;  4YG2 A;  4OIP A;  1IW7 A;  4IOC S;  1HQM A;  5IP7 C;  3HOW C;  4X6A C; 
#chains in the Genus database with same CATH homology
 3W2W B;  5BNZ A;  5JVG S;  2RE8 A;  4U67 S;  3J7Z V;  4JXZ A;  5GAH W;  4JXX A;  1QRS A;  4WFN S;  4P2B A;  1FEU A;  2RD2 A;  5JVH S;  5GAG W;  5DM6 S;  1ZJW A;  2ZJP S;  1EUY A;  5IZN A;  3X1L B;  1QRT A;  4WFA S;  4V19 4;  5GAD W;  4WFB S;  1GTR A;  3CF5 S;  1O0C A;  4IO9 S;  1B75 A;  3DLL S;  1DFU P;  4WCE S;  2ZJQ S;  1NYL A;  1QRU A;  5GAE W;  1EUQ A;  4IOA S;  1EXD A;  1GTS A;  4H3S A;  3PIP S;  5DM7 S;  5HL7 S;  3AII A;  3W2V B;  2HZ7 A;  1O0B A;  4WF9 S;  1UDX A;  4H4K A;  1QTQ A;  2ZJR S;  4IOC S;  1D6K A;  4UY8 8;  4JYZ A;  3PIO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...