2ZJRE

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
b'GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 2zjrE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 2zjrE01
5H1SI 3CC7E 1Q7YG 1VQ8E 5GAHG 1W2BE 5GADG 5DM6E 1K9MG 3CCUE 4IOCE 1YI2E 1VQPE 1M90G 3OW2E 1NJIG 1YJWE 5GAGG 1VQKE 2QA4E 1YIJE 1S72E 5HL7E 5GAEG 1VQ9E 1N8RG 1VQ4E 5DM7E 4U67E 1K8AG 2ZJRE 4WF9E 5MLCH 1YHQE 3CF5E 4WFNE 3CC4E 2OTJE 2ZJPE 3CMAE 1M1KG 4IO9E 1JJ2E 3CXCE 1Q82G 3CPWE 1KD1G 1KC8G 1Q86G 2ZJQE 4WFBE 5AN9B 4UY8G 4WFAE 3PIOE 3CD6E 3G71E 4IOAE 1KQSE 3CCLE 5JVHE 3CCQE 3CCEE 1K73G 1QVGE 1QVFE 1VQME 1YITE 1YJNE 3G4SE 1YJ9E 1Q81G 5JVGE 2OTLE 2CQLA 3CCJE 3G6EE 3I55E 3CMEE 3CC2E 1VQNE 1RL6A 1VQ6E 1VQOE 3CCSE 1VQLE 4WCEE 3CCRE 3PIPE 1VQ5E 3DLLE 3CCME 3J7ZG 3I56E 2QEXE 3CCVE 1VQ7E
chains in the Genus database with same CATH superfamily
5H1SI 3CC7E 1Q7YG 1VQ8E 5GAHG 1W2BE 5GADG 5DM6E 1K9MG 3CCUE 4IOCE 1YI2E 1P4PA 1VQPE 1M90G 3OW2E 1NJIG 1YJWE 5GAGG 3IGEA 1VQKE 3CKFA 2QA4E 1YIJE 2FKGA 1S72E 5HL7E 5GAEG 1VQ9E 1N8RG 1VQ4E 2OL6O 5DM7E 4U67E 1K8AG 5B2AO 2ZJRE 2G8CO 4WF9E 5MLCH 5B11O 1YHQE 5B10O 3CF5E 4WFNE 3CC4E 1FJ1E 2OY1O 2OTJE 2ZJPE 3CMAE 1M1KG 4IO9E 1JJ2E 3CXCE 1Q82G 3CPWE 1KD1G 1KC8G 1Q86G 2ZJQE 4WFBE 5AN9B 2PI3O 2OL8O 4UY8G 4WFAE 1OSPO 3PIOE 3CD6E 3G71E 4IOAE 2FKJA 1KQSE 2HKDA 3CKGA 3AUMO 3CCLE 5JVHE 3CCQE 3CCEE 1K73G 1QVGE 1RJLC 1QVFE 1VQME 1YITE 1YJNE 3G4SE 1YJ9E 2AF5A 1Q81G 5JVGE 2OY8A 2OTLE 2OY7A 2CQLA 3CCJE 3G6EE 3IG9A 3I55E 2I5VO 2OY5O 3CMEE 3CC2E 1VQNE 1RL6A 1VQ6E 1VQOE 3CCSE 1VQLE 4WCEE 3CCRE 2I5ZO 3PIPE 1VQ5E 2OYBO 5B3MO 3EC5A 2OL7A 3DLLE 3CCME 3J7ZG 3I56E 2QEXE 3CCVE 1VQ7E
chains in the Genus database with same CATH topology
5H1SI 3CC7E 1Q7YG 1VQ8E 5GAHG 1W2BE 5GADG 5DM6E 1K9MG 3CCUE 4IOCE 1YI2E 1VQPE 1M90G 3OW2E 1NJIG 1YJWE 5GAGG 1VQKE 2QA4E 1YIJE 1S72E 5HL7E 5GAEG 1VQ9E 1N8RG 1VQ4E 5DM7E 4U67E 1K8AG 2ZJRE 4WF9E 5MLCH 1YHQE 3CF5E 4WFNE 3CC4E 2OTJE 2ZJPE 3CMAE 1M1KG 4IO9E 1JJ2E 3CXCE 1Q82G 3CPWE 1KD1G 1KC8G 1Q86G 2ZJQE 4WFBE 5AN9B 4UY8G 4WFAE 3PIOE 3CD6E 3G71E 4IOAE 1KQSE 3CCLE 5JVHE 3CCQE 3CCEE 1K73G 1QVGE 1QVFE 1VQME 1YITE 1YJNE 3G4SE 1YJ9E 1Q81G 5JVGE 2OTLE 2CQLA 3CCJE 3G6EE 3I55E 3CMEE 3CC2E 1VQNE 1RL6A 1VQ6E 1VQOE 3CCSE 1VQLE 4WCEE 3CCRE 3PIPE 1VQ5E 3DLLE 3CCME 3J7ZG 3I56E 2QEXE 3CCVE 1VQ7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1S I;  3CC7 E;  1Q7Y G;  1VQ8 E;  5GAH G;  1W2B E;  5GAD G;  5DM6 E;  1K9M G;  3CCU E;  4IOC E;  1YI2 E;  1VQP E;  1M90 G;  3OW2 E;  1NJI G;  1YJW E;  5GAG G;  1VQK E;  2QA4 E;  1YIJ E;  1S72 E;  5HL7 E;  5GAE G;  1VQ9 E;  1N8R G;  1VQ4 E;  5DM7 E;  4U67 E;  1K8A G;  2ZJR E;  4WF9 E;  5MLC H;  1YHQ E;  3CF5 E;  4WFN E;  3CC4 E;  2OTJ E;  2ZJP E;  3CMA E;  1M1K G;  4IO9 E;  1JJ2 E;  3CXC E;  1Q82 G;  3CPW E;  1KD1 G;  1KC8 G;  1Q86 G;  2ZJQ E;  4WFB E;  5AN9 B;  4UY8 G;  4WFA E;  3PIO E;  3CD6 E;  3G71 E;  4IOA E;  1KQS E;  3CCL E;  5JVH E;  3CCQ E;  3CCE E;  1K73 G;  1QVG E;  1QVF E;  1VQM E;  1YIT E;  1YJN E;  3G4S E;  1YJ9 E;  1Q81 G;  5JVG E;  2OTL E;  2CQL A;  3CCJ E;  3G6E E;  3I55 E;  3CME E;  3CC2 E;  1VQN E;  1RL6 A;  1VQ6 E;  1VQO E;  3CCS E;  1VQL E;  4WCE E;  3CCR E;  3PIP E;  1VQ5 E;  3DLL E;  3CCM E;  3J7Z G;  3I56 E;  2QEX E;  3CCV E;  1VQ7 E; 
#chains in the Genus database with same CATH topology
 5H1S I;  3CC7 E;  1Q7Y G;  1VQ8 E;  5GAH G;  1W2B E;  5GAD G;  5DM6 E;  1K9M G;  3CCU E;  4IOC E;  1YI2 E;  1P4P A;  1VQP E;  1M90 G;  3OW2 E;  1NJI G;  1YJW E;  5GAG G;  3IGE A;  1VQK E;  3CKF A;  2QA4 E;  1YIJ E;  2FKG A;  1S72 E;  5HL7 E;  5GAE G;  1VQ9 E;  1N8R G;  1VQ4 E;  2OL6 O;  5DM7 E;  4U67 E;  1K8A G;  5B2A O;  2ZJR E;  2G8C O;  4WF9 E;  5MLC H;  5B11 O;  1YHQ E;  5B10 O;  3CF5 E;  4WFN E;  3CC4 E;  1FJ1 E;  2OY1 O;  2OTJ E;  2ZJP E;  3CMA E;  1M1K G;  4IO9 E;  1JJ2 E;  3CXC E;  1Q82 G;  3CPW E;  1KD1 G;  1KC8 G;  1Q86 G;  2ZJQ E;  4WFB E;  5AN9 B;  2PI3 O;  2OL8 O;  4UY8 G;  4WFA E;  1OSP O;  3PIO E;  3CD6 E;  3G71 E;  4IOA E;  2FKJ A;  1KQS E;  2HKD A;  3CKG A;  3AUM O;  3CCL E;  5JVH E;  3CCQ E;  3CCE E;  1K73 G;  1QVG E;  1RJL C;  1QVF E;  1VQM E;  1YIT E;  1YJN E;  3G4S E;  1YJ9 E;  2AF5 A;  1Q81 G;  5JVG E;  2OY8 A;  2OTL E;  2OY7 A;  2CQL A;  3CCJ E;  3G6E E;  3IG9 A;  3I55 E;  2I5V O;  2OY5 O;  3CME E;  3CC2 E;  1VQN E;  1RL6 A;  1VQ6 E;  1VQO E;  3CCS E;  1VQL E;  4WCE E;  3CCR E;  2I5Z O;  3PIP E;  1VQ5 E;  2OYB O;  5B3M O;  3EC5 A;  2OL7 A;  3DLL E;  3CCM E;  3J7Z G;  3I56 E;  2QEX E;  3CCV E;  1VQ7 E; 
#chains in the Genus database with same CATH homology
 5H1S I;  3CC7 E;  1Q7Y G;  1VQ8 E;  5GAH G;  1W2B E;  5GAD G;  5DM6 E;  1K9M G;  3CCU E;  4IOC E;  1YI2 E;  1VQP E;  1M90 G;  3OW2 E;  1NJI G;  1YJW E;  5GAG G;  1VQK E;  2QA4 E;  1YIJ E;  1S72 E;  5HL7 E;  5GAE G;  1VQ9 E;  1N8R G;  1VQ4 E;  5DM7 E;  4U67 E;  1K8A G;  2ZJR E;  4WF9 E;  5MLC H;  1YHQ E;  3CF5 E;  4WFN E;  3CC4 E;  2OTJ E;  2ZJP E;  3CMA E;  1M1K G;  4IO9 E;  1JJ2 E;  3CXC E;  1Q82 G;  3CPW E;  1KD1 G;  1KC8 G;  1Q86 G;  2ZJQ E;  4WFB E;  5AN9 B;  4UY8 G;  4WFA E;  3PIO E;  3CD6 E;  3G71 E;  4IOA E;  1KQS E;  3CCL E;  5JVH E;  3CCQ E;  3CCE E;  1K73 G;  1QVG E;  1QVF E;  1VQM E;  1YIT E;  1YJN E;  3G4S E;  1YJ9 E;  1Q81 G;  5JVG E;  2OTL E;  2CQL A;  3CCJ E;  3G6E E;  3I55 E;  3CME E;  3CC2 E;  1VQN E;  1RL6 A;  1VQ6 E;  1VQO E;  3CCS E;  1VQL E;  4WCE E;  3CCR E;  3PIP E;  1VQ5 E;  3DLL E;  3CCM E;  3J7Z G;  3I56 E;  2QEX E;  3CCV E;  1VQ7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...