2ZJRJ

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
136
structure length
136
Chain Sequence
b'KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 2zjrJ01
4WFBJ 3CC7H 3I56H 1W2BH 3CC4H 1YHQH 4IOAJ 1KD1J 2PA2A 3G4SH 5GADN 1M1KJ 3CCQH 2OTJH 3CMAH 1KQSH 1VQLH 1VQ9H 4IOCJ 1YITH 3CCRH 3OW2H 4UY8M 3CCLH 5JVHJ 1VQKH 3G6EH 3CD6H 5HL7J 1KC8J 1WKIA 3CCEH 3I55H 1VQMH 3G71H 4U67J 3DLLJ 1YJ9H 3CCJH 5MLCO 1N8RJ 2OTLH 3J7ZM 1VQNH 1Q81J 5GAHN 3CCUH 1K73J 1VQ5H 2ZJQJ 3CPWH 2ZJRJ 1Q7YJ 1M90J 4WFAJ 1QVFH 5AN9F 1VQ8H 2QA4H 1NJIJ 2QEXH 1K9MJ 3PIOJ 3CCVH 4WF9J 1VQ7H 1YJWH 1QVGH 2ZJPJ 4WFNJ 4WCEJ 5JVGJ 1S72H 1YJNH 5DM6J 1VQPH 5GAEN 3CC2H 3CCSH 5DM7J 3CCMH 3CF5J 1VQOH 1JJ2H 1Y69K 3CXCH 1YIJH 3PIPJ 3CMEH 1K8AJ 5H1SO 1Q82J 1VQ4H 1YI2H 1Q86J 4IO9J 5GAGN 1VQ6H
chains in the Genus database with same CATH superfamily
2J0FA 4WFBJ 3GNNA 3CC7H 3I56H 1FM0E 1RM6A 1W2BH 1FFVB 4USAA 3CC4H 1YHQH 3TQVA 4IOAJ 1QPOA 4AP8A 1FMAE 3AM9A 1KD1J 2PA2A 3G4SH 1QAPA 1N63B 5GADN 1M1KJ 3CCQH 2B7NA 2I14A 2OTJH 3WO0A 1NVJA 5HUPA 3NVYC 4C7YA 3CMAH 2W54B 1KQSH 4KWVA 1VQLH 1N60B 4GA4A 3NS1C 1VQ9H 2B7QA 4IOCJ 1YITH 3B9JC 3CCRH 4X46A 3WO1A 3OW2H 4UY8M 3CCLH 3ETRC 1FIQC 5JVHJ 1VQKH 3G6EH 3VMMA 1FFUB 3CD6H 5HL7J 1KC8J 1WKIA 3C2RA 4IO9J 2WK5A 3CCEH 3I55H 2WK6A 4YYYA 4XR5A 4C7ZA 1VQMH 3G71H 3SR6C 1O4UA 4U67J 1YJ9H 3CCJH 3DLLJ 1VLBA 3FC4A 3C2EA 3WNZA 1OTPA 5MLCO 1N8RJ 1QPNA 1JROB 2TPTA 3AN1A 4ZOHA 4EADA 2OTLH 2W3RB 3J7ZM 1VQNH 1Q81J 5GAHN 3CCUH 1YTKA 1K73J 1VQ5H 1YTEA 3PAJA 2ZJQJ 3EUB4 3CPWH 2WP4A 1ZXIB 1V97A 3NVWC 2ZJRJ 3C2OA 1JRPB 3FAHA 1Q7YJ 1M90J 4WFAJ 1QVFH 5AN9F 1VQ8H 3RPFA 4US8A 2QA4H 1NJIJ 1VDVA 3C2FA 2QEXH 2DSJA 3C2VA 1K9MJ 1N61B 5HULA 5HUOA 2E3TA 3PIOJ 4EAFA 4YEKA 3BIIE 2W55B 3CCVH 5AYZA 1NVIE 5EY3A 4WF9J 1VQ7H 4LHMA 1YJWH 3L0GA 5EP8A 1YTDA 2ZJPJ 1QVGH 4WFNJ 4WCEJ 4GA5A 5JVGJ 2JBMA 2QIEA 3NVZC 5DM6J 1YJNH 1VQPH 1S72H 2I1OA 5GAEN 1UOUA 3CC2H 3CCSH 1AZYA 5DM7J 3CCMH 1BRWA 3CF5J 1VQOH 2W3SB 1N62B 4C80A 1QPQA 2OMDA 1SB3A 1DGJA 3AMZA 3L4PA 5AYXA 1Y69K 1JJ2H 1SIJA 3CXCH 1X1OA 1N5WB 5MPOC 1YIJH 4KWWA 1FO4A 3PIPJ 3CMEH 2B7PA 4I9AA 1K8AJ 1N5XA 2Q5WE 5H1SO 5AYYA 1Q82J 1VQ4H 1YI2H 1QPRA 3NVVC 3H5QA 3NRZC 1Q86J 4GA6A 5GAGN 4US9A 1VQ6H 1WYGA
chains in the Genus database with same CATH topology
4WFBJ 3CC7H 3I56H 1W2BH 3CC4H 1YHQH 4IOAJ 1KD1J 2PA2A 3G4SH 5GADN 1M1KJ 3CCQH 2OTJH 3CMAH 1KQSH 1VQLH 1VQ9H 4IOCJ 1YITH 3CCRH 3OW2H 4UY8M 3CCLH 5JVHJ 1VQKH 3G6EH 3CD6H 5HL7J 1KC8J 1WKIA 3CCEH 3I55H 1VQMH 3G71H 4U67J 3DLLJ 1YJ9H 3CCJH 5MLCO 1N8RJ 2OTLH 3J7ZM 1VQNH 1Q81J 5GAHN 3CCUH 1K73J 1VQ5H 2ZJQJ 3CPWH 2ZJRJ 1Q7YJ 1M90J 4WFAJ 1QVFH 5AN9F 1VQ8H 2QA4H 1NJIJ 2QEXH 1K9MJ 3PIOJ 3CCVH 4WF9J 1VQ7H 1YJWH 1QVGH 2ZJPJ 4WFNJ 4WCEJ 5JVGJ 1S72H 1YJNH 5DM6J 1VQPH 5GAEN 3CC2H 3CCSH 5DM7J 3CCMH 3CF5J 1VQOH 1JJ2H 1Y69K 3CXCH 1YIJH 3PIPJ 3CMEH 1K8AJ 5H1SO 1Q82J 1VQ4H 1YI2H 1Q86J 4IO9J 5GAGN 1VQ6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB J;  3CC7 H;  3I56 H;  1W2B H;  3CC4 H;  1YHQ H;  4IOA J;  1KD1 J;  2PA2 A;  3G4S H;  5GAD N;  1M1K J;  3CCQ H;  2OTJ H;  3CMA H;  1KQS H;  1VQL H;  1VQ9 H;  4IOC J;  1YIT H;  3CCR H;  3OW2 H;  4UY8 M;  3CCL H;  5JVH J;  1VQK H;  3G6E H;  3CD6 H;  5HL7 J;  1KC8 J;  1WKI A;  3CCE H;  3I55 H;  1VQM H;  3G71 H;  4U67 J;  3DLL J;  1YJ9 H;  3CCJ H;  5MLC O;  1N8R J;  2OTL H;  3J7Z M;  1VQN H;  1Q81 J;  5GAH N;  3CCU H;  1K73 J;  1VQ5 H;  2ZJQ J;  3CPW H;  2ZJR J;  1Q7Y J;  1M90 J;  4WFA J;  1QVF H;  5AN9 F;  1VQ8 H;  2QA4 H;  1NJI J;  2QEX H;  1K9M J;  3PIO J;  3CCV H;  4WF9 J;  1VQ7 H;  1YJW H;  1QVG H;  2ZJP J;  4WFN J;  4WCE J;  5JVG J;  1S72 H;  1YJN H;  5DM6 J;  1VQP H;  5GAE N;  3CC2 H;  3CCS H;  5DM7 J;  3CCM H;  3CF5 J;  1VQO H;  1JJ2 H;  1Y69 K;  3CXC H;  1YIJ H;  3PIP J;  3CME H;  1K8A J;  5H1S O;  1Q82 J;  1VQ4 H;  1YI2 H;  1Q86 J;  4IO9 J;  5GAG N;  1VQ6 H; 
#chains in the Genus database with same CATH topology
 2J0F A;  4WFB J;  3GNN A;  3CC7 H;  3I56 H;  1FM0 E;  1RM6 A;  1W2B H;  1FFV B;  4USA A;  3CC4 H;  1YHQ H;  3TQV A;  4IOA J;  1QPO A;  4AP8 A;  1FMA E;  3AM9 A;  1KD1 J;  2PA2 A;  3G4S H;  1QAP A;  1N63 B;  5GAD N;  1M1K J;  3CCQ H;  2B7N A;  2I14 A;  2OTJ H;  3WO0 A;  1NVJ A;  5HUP A;  3NVY C;  4C7Y A;  3CMA H;  2W54 B;  1KQS H;  4KWV A;  1VQL H;  1N60 B;  4GA4 A;  3NS1 C;  1VQ9 H;  2B7Q A;  4IOC J;  1YIT H;  3B9J C;  3CCR H;  4X46 A;  3WO1 A;  3OW2 H;  4UY8 M;  3CCL H;  3ETR C;  1FIQ C;  5JVH J;  1VQK H;  3G6E H;  3VMM A;  1FFU B;  3CD6 H;  5HL7 J;  1KC8 J;  1WKI A;  3C2R A;  4IO9 J;  2WK5 A;  3CCE H;  3I55 H;  2WK6 A;  4YYY A;  4XR5 A;  4C7Z A;  1VQM H;  3G71 H;  3SR6 C;  1O4U A;  4U67 J;  1YJ9 H;  3CCJ H;  3DLL J;  1VLB A;  3FC4 A;  3C2E A;  3WNZ A;  1OTP A;  5MLC O;  1N8R J;  1QPN A;  1JRO B;  2TPT A;  3AN1 A;  4ZOH A;  4EAD A;  2OTL H;  2W3R B;  3J7Z M;  1VQN H;  1Q81 J;  5GAH N;  3CCU H;  1YTK A;  1K73 J;  1VQ5 H;  1YTE A;  3PAJ A;  2ZJQ J;  3EUB 4;  3CPW H;  2WP4 A;  1ZXI B;  1V97 A;  3NVW C;  2ZJR J;  3C2O A;  1JRP B;  3FAH A;  1Q7Y J;  1M90 J;  4WFA J;  1QVF H;  5AN9 F;  1VQ8 H;  3RPF A;  4US8 A;  2QA4 H;  1NJI J;  1VDV A;  3C2F A;  2QEX H;  2DSJ A;  3C2V A;  1K9M J;  1N61 B;  5HUL A;  5HUO A;  2E3T A;  3PIO J;  4EAF A;  4YEK A;  3BII E;  2W55 B;  3CCV H;  5AYZ A;  1NVI E;  5EY3 A;  4WF9 J;  1VQ7 H;  4LHM A;  1YJW H;  3L0G A;  5EP8 A;  1YTD A;  2ZJP J;  1QVG H;  4WFN J;  4WCE J;  4GA5 A;  5JVG J;  2JBM A;  2QIE A;  3NVZ C;  5DM6 J;  1YJN H;  1VQP H;  1S72 H;  2I1O A;  5GAE N;  1UOU A;  3CC2 H;  3CCS H;  1AZY A;  5DM7 J;  3CCM H;  1BRW A;  3CF5 J;  1VQO H;  2W3S B;  1N62 B;  4C80 A;  1QPQ A;  2OMD A;  1SB3 A;  1DGJ A;  3AMZ A;  3L4P A;  5AYX A;  1Y69 K;  1JJ2 H;  1SIJ A;  3CXC H;  1X1O A;  1N5W B;  5MPO C;  1YIJ H;  4KWW A;  1FO4 A;  3PIP J;  3CME H;  2B7P A;  4I9A A;  1K8A J;  1N5X A;  2Q5W E;  5H1S O;  5AYY A;  1Q82 J;  1VQ4 H;  1YI2 H;  1QPR A;  3NVV C;  3H5Q A;  3NRZ C;  1Q86 J;  4GA6 A;  5GAG N;  4US9 A;  1VQ6 H;  1WYG A; 
#chains in the Genus database with same CATH homology
 4WFB J;  3CC7 H;  3I56 H;  1W2B H;  3CC4 H;  1YHQ H;  4IOA J;  1KD1 J;  2PA2 A;  3G4S H;  5GAD N;  1M1K J;  3CCQ H;  2OTJ H;  3CMA H;  1KQS H;  1VQL H;  1VQ9 H;  4IOC J;  1YIT H;  3CCR H;  3OW2 H;  4UY8 M;  3CCL H;  5JVH J;  1VQK H;  3G6E H;  3CD6 H;  5HL7 J;  1KC8 J;  1WKI A;  3CCE H;  3I55 H;  1VQM H;  3G71 H;  4U67 J;  3DLL J;  1YJ9 H;  3CCJ H;  5MLC O;  1N8R J;  2OTL H;  3J7Z M;  1VQN H;  1Q81 J;  5GAH N;  3CCU H;  1K73 J;  1VQ5 H;  2ZJQ J;  3CPW H;  2ZJR J;  1Q7Y J;  1M90 J;  4WFA J;  1QVF H;  5AN9 F;  1VQ8 H;  2QA4 H;  1NJI J;  2QEX H;  1K9M J;  3PIO J;  3CCV H;  4WF9 J;  1VQ7 H;  1YJW H;  1QVG H;  2ZJP J;  4WFN J;  4WCE J;  5JVG J;  1S72 H;  1YJN H;  5DM6 J;  1VQP H;  5GAE N;  3CC2 H;  3CCS H;  5DM7 J;  3CCM H;  3CF5 J;  1VQO H;  1JJ2 H;  1Y69 K;  3CXC H;  1YIJ H;  3PIP J;  3CME H;  1K8A J;  5H1S O;  1Q82 J;  1VQ4 H;  1YI2 H;  1Q86 J;  4IO9 J;  5GAG N;  1VQ6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...