2ZJRL

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjrL01
1VQMN 2OTLN 2ZJPL 1N8RO 4WFNL 5GAHP 1YJNN 4IOAL 3G71N 1VQ5N 3CCRN 1YJWN 1VQ6N 2QEXN 3G6EN 1KQSM 1OVYA 1VQON 4WFAL 1Q86O 1S72N 1YJ9N 4U67L 3CD6N 1VQ4N 3CXCM 5JVHL 3CCSN 3CMEN 5HL7L 4WF9L 1Q82O 5H1SQ 1ILYA 3PIOL 2OTJN 1KC8O 1K73O 4IO9L 1JJ2M 3PIPL 1Q7YO 5MLCQ 3DLLL 1M90O 3I55N 1VQNN 1VQLN 3CCVN 5DM7L 1VQ7N 2QA4N 2ZJRL 1VQ9N 1QVFM 3CC4N 3CMAN 3CC2N 4UY8O 5DM6L 5GADP 1NJIO 1YHQN 1M1KO 5JVGL 1YIJN 3CCEN 3I56N 3CC7N 1YITN 5GAGP 1YI2N 1VQPN 1QVGM 5GAEP 1Q81O 3CCJN 1K8AO 2ZJQL 1K9MO 4WFBL 3CCQN 3CCLN 3J7ZO 1W2BM 3OW2M 1VQ8N 4WCEL 3CCUN 1VQKN 3CPWM 4IOCL 1KD1O 3CCMN 3G4SN 3CF5L
chains in the Genus database with same CATH superfamily
5KPRA 4IG0A 2ZJPL 1EETA 4HUGA 2P1JA 4CZKA 3MCPA 3M8SA 1JXEA 5J2PA 3SMSA 1WSHA 2XO7A 3AVHA 3SUPA 4IJNA 2O8CB 4O5BA 4IWVA 1MU2A 1LOTB 3O3GA 1N34K 5BN8A 3WNFA 5IWAK 3L0QA 5M1PA 5M1FA 5SWMA 4CIFA 2G8FA 3U3YA 2HHQA 1XMQK 4FJLA 3VQCA 3IUCA 3NBPA 3SQ1A 3H45C 1TGOA 4X65K 4B1VA 5C42A 4B8AB 4GKJK 4JLHA 4Y1CA 5BPLA 1YUWA 5HLFA 3VF6A 3MXIA 4EIAA 2O8DB 2CH6A 3M8PA 4FJXA 4BR4A 4MDBA 4BC5A 2WFBA 3F9MA 3DM2A 3EZWA 4YOWA 1S1UA 3FZHA 3ZETB 3SJHA 5FLXO 4ILGB 3MWPA 3HM9A 3LPUA 4NXMK 4BDYA 3F73A 1D8YA 4O0IA 3VA3A 1XC9A 2NZTA 2YJFA 4CHNA 4CESA 4DR3K 2OPRA 4FLZA 4DR2K 4B1YB 4FZYA 3UE5A 4CI6A 5BRDA 2V7YA 3VEVA 2A1RA 4GNIA 3ZT0A 5CYMA 4CF8A 4DV1K 3QETA 1YVUA 1VRTA 1S9GA 4DTMA 2G8HA 2VCPA 4RW4A 5ADXH 1RT1A 4BQZA 3THXA 4CEDA 2DFEA 5AQLA 5KPTA 2IAJA 4K43A 1ITGA 4A62A 4BROA 3DMJA 4JYAK 1LWFA 4DMNA 5I42A 4CJEA 2OANA 1NGDA 4FWMA 3HPGA 5AQFA 1IBMK 2KW4A 1EO1A 4JKGB 4KB1A 5CYQA 1BI4A 5C25A 4NCBA 1NOZA 4BC4A 4IOAL 1BIUA 4E1MA 3D2FA 3V1QA 4LSNA 3DYAA 3LZJA 4JRPA 4EZ6A 1G15A 1WLJA 4K8ZA 4F8RA 1ATRA 4KI4A 2HHXA 4B3RK 4FM0A 3ZSRA 3M8RA 3K58A 5H1SQ 1U2VA 2NRRA 3A8YA 4DU3A 1IKVA 3NF9A 2G8WA 1U4BA 3NMUA 2P9UB 2KZMA 3AGKA 3OYGA 4IFEA 1CZAN 3DXKB 4IOXA 2I7PA 1NGGA 3NGIA 1C1BA 3ZX0A 4OPHA 1O13A 4B9MA 3VPZA 1BISA 3PO4A 2CGLA 3CJAA 3ZCMA 1YF5L 4G9ZA 3P83D 1ZBIA 3OYIA 4OVLA 1IJJA 1LW2A 1SZ2A 4FJGA 4JD2A 1IG9A 4CGGA 1RTDA 1D4XA 1X9WA 1HR0K 4FVUA 3PY8A 3CC2N 4K42A 1SV5A 1C1AA 3QICA 3ENOA 5HP1A 4DV4K 3D45A 4FWPA 5BR8K 4JI7K 3EY1A 4F4KA 1CLQA 3RRHA 2HHVA 1ZBFA 3JXUA 3PLAA 1KAZA 4FZXC 4PHTX 3CQXA 2NLXA 4DR7K 2CGJA 4KH4A 1BGXT 3QBXA 4Z94A 1HNZK 4ELTA 1U48A 3OVNA 3DLKA 1IO2A 2O8FA 1W2BM 5JICA 4QS7A 4M7YA 3VEZA 3CPWM 2LSNA 4ELVA 2BDPA 1VSIA 4FM2A 2QI2A 3BF3A 3DWLA 1X9MA 5KGWA 3MEGA 4CK2A 1FJGK 1XQSC 2YHAA 2IDOA 4B3TK 3S3NA 2P9NB 3MAQA 1J54A 1VSKA 5EX5A 1YJWN 3O9TA 4EFHA 4IG3A 4KHUA 5KRSA 4X64K 3I8BA 3MK6A 1KLNA 1UA1A 4DUYK 3MEDA 4O5FA 2G8IA 5KTQA 1R59O 3TAPA 4BY9C 4O4GA 2WUSA 3CXCM 2HBKA 3V81A 3IAYA 2O4IA 3K2PA 1C0MA 3TAMA 3ZYYX 5C2DA 2ASPA 2HVIA 1Q7YO 2AJQA 3ZSYA 3V9UA 1UWBA 1QZ6A 2P9PB 3NF6A 3VF2A 2W6LA 1NK6A 4CZGA 3I55N 4FWQA 4CBUA 1J5OA 4B1UB 4CJ7A 1T44A 1TK0A 2DFFA 3O4NA 2GUIA 1RBTA 2W40A 1DGKN 3AO4A 1KSPA 1JXBA 2XRIA 2ZJRL 3AA2A 1X3MA 4Z4CA 3M8QA 3H1QA 3OYDA 3PX4A 2Y1JA 4CHYA 1XNRK 3O1WA 3RWUA 3ZEUB 3KD1E 3FZMA 2P9KA 4OO1J 2O4GA 4DUZK 4JK7A 3AARA 3DXMA 3MN5A 4KTWA 3CCLN 2IVNA 1IV0A 3S9HA 3KK1A 1U47A 3ZSZA 2Q36A 2W6KA 2FC0A 2A41A 4KHYA 1L3VA 2J4RA 4JKBA 1DLOA 1OVQA 3T69A 3ZSWA 4C8KA 2I7NA 1Q9XA 4PKIA 1EKEA 5HOOA 3CM6A 1V4TA 3M5RA 4M3TA 4BR0A 1YJNN 4KTQA 4C23A 3CCRN 3KLHA 4K0KK 4HWIA 1WN7A 2F9WA 1O1WA 4RW6A 2E2QA 3SUQA 3AA4A 3AVBA 4CJQA 1VRUA 4NYFA 3KLEA 4LFBK 1IBLK 5EU7A 4ICLA 3LWLA 2EX3A 1MWMA 4DSIA 3DLRA 1E4GT 4B1XB 4WF9L 1HPZA 4DR1K 4BE2A 4M3XA 1NNEA 3BZCA 3MECA 4BRHA 4DQ8A 1TYQB 4LFAK 3QEVA 1T6DA 3ZT4A 3HZ6A 1U49A 5AQTA 4DTXA 3OJSA 2O8BA 2D1KA 1CZ9A 1HRHA 4NYNA 4KHQA 1UA0A 4CFBA 4CGFA 4KKOA 1XMOK 4CE9A 3RMDA 3CJ1A 2H3GX 5FRMA 1TL3A 2XY5A 4N47A 1HYZA 5AQIA 5ADXA 1ZXOA 1RT4A 3U6FA 1NKBA 1TKDA 4KAZA 4DWIA 3DRRA 4CGDA 3UKRB 1GLAG 2A5XA 3VENA 3HRGA 1KVAA 1YITN 3SBTA 4CD1A 3J8AA 5I3UA 2VGNA 3HM8A 3HO1A 1TK8A 4BRMA 4MLHA 4JHDA 4IBNA 3H3NO 4AHRA 4CBXA 5KI6A 4DG1A 1BWFO 4HUEA 4DS5A 3G0ZA 4FJ7A 3FGUA 4GV3A 1KD1O 3AY9A 2B5JA 4CJVA 4EP4A 4PY5A 1TL1A 5AQZA 4YFUA 3TAFA 4BC2A 4IZ9A 3WQUA 4RW9A 1MWKA 2FXUA 2P9NA 3QDKA 2FBYA 4BDPA 3K9JA 4CGJA 3VEOA 1NGIA 2NRWA 1WSJA 3NH0A 2X74A 1KQSM 4IEEA 4N5SA 2XY8A 3LDPA 2DPNA 4BC3A 4CK3A 3K5LA 1HJOA 1QSSA 3CFRA 4CECA 1VQON 3AV9A 4TSXA 3HBTA 4WQ4C 2R7YA 3SZ2A 1ZBSA 2OPQA 3DRPA 1S72N 4U7BA 4U67L 3SUOA 3VGLA 4Z4IA 1T03A 2B4JA 2G8VA 1NGCA 3NGYA 5KQDA 4XH5A 1GLJO 3V6DA 3IS9A 4IXCA 4DFKA 1L5UA 5HBMA 4IO9L 4CF9A 4JK8A 4FLVA 3Q7BA 3NE6A 1HPMA 1SS6A 4PQUA 3GDQA 3R1XA 4DTOA 3RMBA 4OPKA 2HHHK 3S41A 1RFQA 4DQQA 4CFDA 3J81O 4DV3K 1S9EA 4Z4FA 1GOBA 5AZJB 5I9EB 1BQNA 3RR8A 4DFMA 3RTVA 1JLAA 1V4SA 1IG8A 4M3YA 2ZD1A 4RW7A 2OYQA 1P8ZA 1VSEA 1Z25A 1RT6A 3J7AP 1VQ9N 1Y97A 4IJAA 3L6QA 4CF1A 4IDKA 2P9SA 1S3XA 5DM6L 2O8EB 1C0UA 4CJ4A 2UXCK 4Z4HA 1K8KB 3D6RA 4DR5K 3MX2A 4H4OA 3CCEN 1NK4A 2P5OA 3SYZA 2ITMA 3SAFA 1TKTA 3VEXA 4JNEA 2ZWHA 5AQRA 3SAHA 1Y64A 2ASMA 2KTQA 1K8AO 3FFIA 3NVKA 3PUFA 2Q2RA 5C12A 2RF2A 3EL2A 3ULEA 4E7JA 4H5RA 1LAVA 4K25A 5HRSA 4DFPA 1HX1A 3AA3A 4CHQA 2E4LA 4CJSA 3P5JA 4YHHK 3D0PA 4NXNK 4CZLA 4A2BA 3JS6A 5C15A 2YNGA 3O4QA 1VSDA 2A3ZA 4DR6K 4FLYA 2NUBA 1XUPO 3EEQA 4DLGA 4GVMA 4BGBA 2HSTA 1OH6A 4OKEA 4NO7A 2GUPA 3MN9A 4WFNL 1HNIA 1RBSA 4BGAA 4KI6A 3HK2A 5FPNA 4LD0A 1P90A 1X3NA 2QK9A 2QEXN 2F96A 2WC9A 1WAJA 2OZMA 3KHYA 2W42A 4E0DA 4FJJA 5E26A 2P9LA 4A2AA 1RILA 4B9NA 4ELUA 1L3SA 1ATNA 5K14A 3L2UA 3HTVA 3O1BA 3K0SA 3UKUA 2F7TA 4H03B 1S6QA 2JLEA 4BRIA 4AHSA 1QS4A 3KK7A 4RTFD 3THYA 3CIPA 3D2EB 4O0JA 1QQOA 4LF5K 1SKSA 2HB5A 4DQPA 1I39A 4FSVA 3WQTA 3R8EA 3BY5A 4FYDA 1NK7A 2D0PA 1T3VA 1HKGA 1KAYA 5BN9A 1W9HA 3CQ8A 4JKFA 5GIOA 3U8XA 4HCBA 1FW6A 5AQUA 4M41A 4XIUA 5JVGL 4I2PA 4JK9A 2BUPA 3WNEA 4FWLA 3O9QA 1NWKA 4CFCA 3VQ9A 3EO3A 3P39A 1EXQA 3CJ7A 4EHTA 3GBTA 3AVGA 1QVGM 3K5OA 1HYSA 3VQ5A 3VMFB 3L4QA 3AO3A 4JKEA 2ZJQL 1S1VA 3BZKA 4YY3K 5AQWA 4WFBL 4CEQA 3PSIA 1RNHA 3ZLJA 1KRPA 1NJYA 2E20A 3LDLA 1XHZA 4RG8A 2NNWA 4DV0K 4FXDA 4IOCL 4KV8A 4YDUC 3LALA 4Y0WA 3QO9A 4EP5A 4JAXA 3OYLA 4BRPA 1JL2A 5M1OA 4BG8A 3TAEA 3NH2A 2NRZA 1N8RO 4JI0K 3E9LA 2UUCK 2KZZA 3HT3A 2YNIA 3LP1A 2GWJA 1TKZA 1BO5O 1WSEA 1Q8IA 1C0GA 5F1XA 1QE1A 3VA0A 2IIRA 2HHTA 4QOZB 3LAKA 3CD6N 3VQEA 1KCFA 1ZC6A 4LH5A 5JVHL 3CMEN 2YX6A 3ZT2A 3MDQA 3C0BA 3J80O 4WYBA 2NRXA 4H0PA 4O44A 2Q3SA 3AO1A 1VSMA 4YOUA 3OYNA 1HKBA 2RHKA 4A5BA 2QWOA 3A0IX 3QNNA 2PYJA 1OH5A 3WEEB 3WXJA 1L3UA 2CH5A 3R6MA 3JAMO 1EWQA 4CF2A 3TANA 3MX5A 5AZIB 4C1NI 3TSQA 4CEEA 3CMAN 1TAQA 1SAZA 3NAEA 4FJKA 2E6LA 2P9IB 4BWJA 5AQJA 4DSLA 2OCEA 3OA9A 4KRFA 5GAGP 5HRPA 1YI2N 3DJCA 4WQ5A 4CW7B 4OX9K 4I2QA 2HHSA 4JI1K 2Q0UA 3ATUA 2NRVA 4W5OA 3VQDA 4M3WA 2YKNA 5HROA 3VQ7A 4KO0A 3C6UA 1T05A 3A5LC 5KPZA 5HRNA 3C6HA 3VQ6A 2YJEA 4JKAA 3VETA 5J2MA 1JLQA 2PZSA 3RSEA 2HBMA 1QQCA 2QW9A 5AQXA 3CF5L 1OH7A 5M1NA 5JLHA 3HYFA 4BRQA 5D3GA 2ZM6K 1LWCA 3M6GA 4FPAA 2UXBK 3THWA 4Z0UA 2V7ZA 4OLBA 2VGMA 1B9FA 1S1WA 3C7NB 5IT9O 2E2OA 3HSTB 1S1XA 3AVAA 4ZTJA 4CJ3A 2IVPA 3OYMA 4C1NK 4MFBA 3DLHA 3BUZB 4E7KA 4I9LA 3IDHA 2ZQBA 2QKBA 1T6CA 4OGCA 2KQ2A 2BGGA 1T8EA 3PO5A 1U6ZA 3SK3A 4FLWA 2G8KA 2WOMA 3MN7A 4KB0A 4BRGA 2HHWA 3TAGA 3TSUA 1BG3A 3TU5A 4MLEA 4ID1A 2O8CA 2FBXA 4J2BA 4Y1DA 1GLDG 3O5BA 1NGBA 3TAQA 4QAGA 3WXMB 4DS4A 3KIOA 1YVNA 1M90O 1BA1A 3LL3A 1KVCA 3SMPA 3JYTA 2QWLA 3KJVA 2RN2A 5BPMA 1JL1A 4RWTA 3VQBA 4B9VA 1ZBLA 3SI6A 5M1KA 1TVRA 1NM1A 3CC4N 4DV7K 2YHXA 3KZBA 2O8DA 4H5NA 3LWMA 1HNWK 1WBDA 2I5JA 4NB4A 1S6PA 1EWRA 3K5NA 3IMXA 1WSGA 3LDNA 4BRCA 3DLEA 4BE0A 3AO5A 3B6OA 4FJNA 3AVJA 4JI5K 4YORA 3ZETA 3SLCA 4A61A 2UUBK 3V9XA 4BREA 4I7FA 3J7ZO 4WQ4A 4O8UA 4M3ZA 2FBTA 3MXJA 4BR5A 5EXWA 3VERA 4B1WB 2Z1JA 3FZFA 3CCUN 2UU9K 1F21A 3TSPA 3CQYA 5KGXA 3E1YA 3ZX2A 5FPMA 4DU1A 3LANA 1ASUA 2KLAA 2QM1A 3T7ZA 2YV0X 1JLEA 5AQHA 3QLHA 1KTQA 3EE8A 3G71N 5CE3A 4LFCK 1DTQA 4J2AA 4KHPK 4E3SA 3TTCA 3V9WA 2W41A 3KVGA 1OVYA 3K57A 2FSNA 1YJ9N 1QSYA 3CETA 4M3RA 3CCSN 4JKGA 5HL7L 4E1NA 3F2KA 3CJ9A 4CFAA 3QIPA 1VHXA 3KKSA 5AQPA 3V1RA 2D0BA 4LY7A 1YAGA 2ZE2A 4DR4K 4WQ5C 4FWNA 3HJFA 5FRNA 4B9UA 4YOVA 4J8FA 2YNHA 4DTJA 3WNGA 3EYZA 5CHIA 4CJUA 4GV6A 4DKWA 1BDGA 2QWNA 3N4QA 2CGKA 1EP4A 3T1AA 4EHUA 1NGJA 3OYCA 3BGRA 3O9SA 4BQLA 2P9UA 1JCFA 2Z1GA 3DXKA 5LL6Z 3T1YK 4OPAA 4BWMA 2UYTA 1JLFA 3P38A 4I6MB 3R9PA 3VGKA 1RTHA 2P9IA 4HHTA 1HQEA 2E1YA 3FLCO 4X66K 3B8AX 1GLEG 2QTDA 3OYAA 3QESA 2VQFK 3DOKA 4A59A 3CG7A 1TK5A 1VQPN 1XNQK 1NG9A 3T3FA 4KH6A 3QBWA 3CCJN 4JRQA 4CJTA 2EHGA 2FF6A 3CCQN 3TI0A 2X6NA 2OPSA 2P5GA 4M63C 3KLFA 4W5NA 4DCHA 3CERA 1TUUA 4RCHA 2Q31A 4M45A 2PFUA 3WXKA 4CIEA 1LWEA 4DF4A 4QCLA 2X6SA 1EX4A 4YNQA 4FM1A 3MEEA 5AQGA 4OKKA 1N32K 1BCMA 1U04A 1XHXA 1FK9A 3AVNA 5AQYA 4ISFA 4CVNE 3OYFA 5C0YA 2E88A 1KFSA 1NJXA 1HJRA 5DK5A 3C95A 1YTAA 4CZFA 4DF8A 4FCYA 1Q86O 4CJWA 2JGUA 3ID8A 4BVPA 4LF9K 3KLIA 3L3UA 1JLBA 3U9ZA 2PBDA 4E7IA 2FF3B 3FFKB 4L8RB 2OTJN 1JJ2M 4BR7A 2YHWA 4M42A 5LY3A 3H08A 3M3ZA 3DLLL 3LP3A 1U45A 1SQKA 1WNSA 3C65A 2DTUA 1LAWA 4O8KA 4AF1A 4H5WA 2Q0RA 1NKEA 4N41A 3ALYA 3HVTA 4BR2A 1VQLN 1UAXA 2D4WA 2RKIA 3D7EO 3VQQA 5BRHA 1TKXA 1C6VA 2JWKA 3OBYA 4BE1A 1HKCA 3PX0A 1XI1A 2QWRA 3QFUA 5BRFA 3NH1A 3THXB 3AVLA 2D5RA 3C6AA 2P9PA 4YDUA 3HI0A 3QFPA 1NK0A 3FZKA 2PYLA 3CC7N 1W97L 4KREA 3IFRA 3VTHA 1RDWX 1JKHA 4ISEA 4FLUA 1Q81O 1BI4B 2HBLA 1E4FT 4A5AA 1K9MO 2AA4A 3WNHA 4MDAA 4H5VA 3KD5E 2QWMA 3D2FB 3CFPA 4FVMA 4EAHD 4F2SA 4Q5VA 4Z4EA 3KWIA 3SCXA 1ZBUA 3ZEUA 1ATSA 3RMCA 4ID5A 3T19A 5AQMA 2YKMA 4OGEA 4KFBA 3G4SN 2HBJA 3QINA 4YOYA 3ZT1A 2WTUA 3NVMA 3VQAA 3TR8A 4DTRA 4DV2K 2EWSA 3ASMA 2HMIA 3EZ5A 2DFHA 1U2VB 3HL8A 5GAHP 2F8SA 5KRTA 5GIPA 3HOTA 2QXLA 4AH9A 2HNDA 4CEFA 1VQ6N 4HTUA 3I8DA 4PUOA 4BVOA 4DTNA 1BCOA 4WFAL 3HP9A 3SQ2A 1KAXA 1FKOA 1SL0A 3V4IA 2DY4A 2HNZA 4DSJA 4CD3A 3EN9A 1G99A 3VEYA 3SV3A 1IKWA 4JD2B 1SL2A 1SKWA 3V9SA 2RPIA 1N36K 3QERA 3P31A 2YCHA 1I94K 1JLGA 1H1VA 4CEAA 5J1EA 1J9AA 1N33K 1RDDA 3RVCA 4B9QA 2GEMA 2ZGYA 3SQ0A 3KTQA 3CPEA 1NOYA 3IKMA 4FJ5A 3LDQA 1GLLO 3KKRA 1BA0A 1REVA 3IRXA 4AILC 3WUHA 4JS4A 2OA8A 4B9SA 4JN4A 2ZGZA 2VG7A 4LH4A 3VOVA 1TYQA 3FE1A 3OYKA 3OYJA 1Q9YA 1YTUA 1ASWA 3GOIA 1XC3A 2O8FB 4K8XA 2RE2A 3GE1A 3DI6A 1QZ5A 5KQ8A 4L3QA 4M3UA 2KKZA 4LF4K 1NGFA 5JMVA 1WBBA 3DLGA 4AHCA 4CEOA 3OYBA 4F3OA 1QHAA 4Z4GA 3AVMA 4OKJA 5GAEP 3HPOA 3MN6A 2P51A 3Q7CA 3VEWA 4KH5A 1GLFO 3UKRA 3CJCA 1S5JA 2A1SA 4JKDA 4FK4A 1BHLA 2UXDK 1BQMA 1IH7A 4PL8A 5EOYA 3AVIA 4KHWA 3OY9A 3NHGA 4AHTA 5AFUA 3V9ZA 3EKUA 3VQ8A 2HMPA 3SNNA 4E1JA 2HW3A 5ELZA 1RT5A 2IC3A 3U9DA 2OZSA 4DSKA 4C8OA 3R3LA 3H6EA 2BH1A 1J6ZA 4V19S 4BACA 1VAZA 4B3OA 1SKRA 4HTLA 4B3SK 2KFNA 2VG6A 4DB3A 4DLEA 4CHOA 3EE9A 3ITHA 1T7PA 4DV6K 5B8HA 4B08A 1J53A 5M1QA 5FPDA 3JSMA 3IG1A 1NK5A 1RDBA 4PA1A 4C8MA 3OHRA 1NMNA 3ZX3A 1ILYA 1DKGD 4CHZA 4E7LA 1K73O 5EVZA 2FLOA 3TPQA 1RDUA 2WBNA 3ISNC 1MA9B 1L3TA 3OBWA 1S1TA 4FWKA 4GKKK 1I3AA 3M1FA 1LCUA 2P9KB 4H0YB 3WT0A 2PY5A 3RRGA 2HF4A 1KXPA 4LF7K 3SBGA 4BRDA 3DXMB 3MXMA 4C8LA 4FOEA 1NK8A 4EZ9A 1D9DA 3S3OA 4BDZA 1A5XA 1M1KO 1CXQA 3ENBA 2NRHA 4OLAA 1DT9A 1YXQA 5TKYA 5AZJA 4H0OA 4KHNA 4CJRA 4B8CA 3BP8A 4IFVA 4DHYA 4AM6A 4C8NA 5BREA 4H0XB 5AQSA 4F3TA 4FK0A 3W3DA 1BL3A 3SUNA 3DOLA 3B6PA 2Z1HA 2PAVA 2O8EA 4M7XA 1UOCA 1JCEA 1D5AA 2X78A 1K8KA 4BR9A 4DSFA 2XY7A 3TARA 1GLCG 2D0CA 1EQYA 4BRLA 4NCAA 1X9JA 4FZZA 4JKHA 4FJHA 4J2DA 3QIOA 1C0TA 4PKHA 4CIGA 3TTFA 5CZ1A 2ZF5O 4K41A 3OS0A 3BF1A 2FSKA 4IEIA 2IGIA 2UUAK 1RDAA 1HNXK 2VYPA 1VQ5N 1WSFA 5AJ3K 1B9DA 1HYVA 1QSLA 4H8KA 2D0AA 4H0TB 2O8BB 1WSIA 5E84A 2IS3A 1HMVA 2ASOA 1VQ4N 5BPNA 4IKFA 4R5PA 1WUAA 1LW0A 1A5VA 3O8MA 2BANA 4JI6K 1RCHA 4OJRA 1Q18A 3PX6A 3HPHA 4CJLA 3ATVA 3CHWA 4DQSA 1QQMA 1X1PA 4FLXA 1RBVA 5FDLA 5MLCQ 4Q0BA 1OH8A 3NF8A 1ZBHA 4KPYA 1VQNN 4OPJA 5LJVA 2GX9A 2Q1NA 4AQYK 2VWBA 1RT2A 1KVBA 3CCVN 4YOTA 3ZSXA 3CI5A 1RGIA 5CY4A 3V1OA 4JHDB 5F2RA 3LDOA 4CF0A 1TAUA 2A42A 2BE2A 3A2FA 3AVFA 5C2FA 1NBWA 1WAFA 3D2EA 1NMDA 4FJMA 1DEJA 2GWKA 3I0RA 1MDUB 3A5MC 3S3MA 1Z26A 1KLMA 3I56N 5GINA 2E6MA 1D9FA 2ETJA 3SJJA 2ATQA 3F9KA 1GOCA 3CYMA 4KTZA 4A57A 4JS5A 2NRTA 1JLCA 3U4LA 4YOXA 1W0HA 4W5QA 3DAWA 2KFZA 4GY2B 4LSLA 1ASVA 3AAPA 2HOEA 1IKYA 1VSLA 4FW1A 4H4MA 5LMUK 3H1VX 3A5NC 2F4VK 3CFOA 3HXMA 5BR9A 3FZLA 3CCMN 2V51B 3L2QA 3ZT3A 3VGMA 3O6WA 1VQMN 3NCIA 3A5OC 4BRAA 3C6TA 3QEXA 5JS2A 1NLVA 1Z05A 4AHUA 1TV6A 3P4IA 1HQUA 3ZSVA 2Z1IA 3T1HK 4CK1A 3CJBA 4W5RA 2E2NA 4MO4A 3TTDA 3RMAA 1CZBA 5A2QO 4PWDA 1GLBG 4XEIA 2IVOA 4DQRA 4N76A 3OJUA 1BU6O 2KHOA 3O3FA 2FBVA 3TWHA 5HRRA 4NLBA 3AA5X 4GW6A 3PIPL 4CJPA 5SZTA 2E2PA 2P9SB 4KHSA 5LMNK 1RTIA 4JEPA 1RT7A 2WONA 4FOIA 3SPZA 1IBKK 4BRFA 1VK0A 2A40A 4CZJA 4JI3K 3O08A 2B6AA 4CJ5A 4JI2K 2G8UA 4QS8A 1A5WA 3AVKA 5AFUH 2VQEK 5DM7L 4W5TA 5C10A 1XWLA 1R0AA 2V52B 4CGIA 4CZMA 3KK2A 1C0FA 3KK3A 4G1QA 4FLTA 3ULEB 1E3MA 5GADP 1VSHA 4FW2A 2GV9A 1ESVA 3LM9A 3VQ4A 4DTUA 2E1ZA 2VG5A 3L2RA 3WEEA 4IFYA 1BOTO 3HP6A 3F5TA 4O55A 3L3VA 2QWPA 3QEIA 3E9PA 4CZHA 5AZIA 2BTFA 4FJ9A 1Z6RA 3NDKA 3LP2A 4FL9A 1NGHA 4BRKA 4LF6K 3O4WA 4NCGA 3NGZA 4FK2A 3E66A 3O3HA 1VQKN 1RBRA 2YI1A 1LV5A 1QHTA 4E89A 5AQNA 1QQNA 3FR0A 4FWOA 2P9LB 3GL1A 2OTLN 2IOCA 3L8BA 3UKUB 3L2WA 3CM5A 3UB5A 4CBWA 3LZIA 1TUYA 4UQGA 3G6EN 3THYB 4GVEA 3K59A 3VESA 4JI4K 3OS1A 4HUFA 1WOQA 3KLGA 3SAGA 1X9SA 4LF8K 3KWGA 4F9OA 2F9TA 3ID6A 4FO0A 1BIZA 2JWLA 2HVHA 1IKXA 1Q82O 1NGEA 3DRSA 3PSFA 1C1CA 5AQQA 4MQ3A 3WXIA 1KC8O 3AGRA 4DTSA 1RTJA 2HF3A 4X62K 1SUQA 3C7NA 4DU4A 5T7BA 1NKCA 4JV5K 4FWSA 2XHBA 5JLFA 1RBUA 4DV5K 4DTPA 3NF7A 3BEXA 4BG9A 2D0OA 2VWJA 1OKJA 1VQ7N 5J2QA 3UIQA 2A6AA 3VF4A 1JCGA 1QVFM 3AO2A 1K6YA 2FSJA 3QEWA 3ZSOA 3BDPA 4UY8O 1GOAA 4BRNA 5C24A 5TKWA 1NJIO 1YHQN 2HNYA 4CERA 1N6QA 4FPBA 3LM2A 3SQ4A 4B1ZA 2GBZA 4JKCA 4ILJA 1SL1A 3TABA 4GMJB 1RDCA 2GTDA 4ZHRA 4XH1A 1QTMA 4CJFA 1ZYQA 1NJWA 4QS9A 2HHUA 5CZ2A 5FPEA 5F0XA 3OTOK 4DQIA 3RR7A 3LP0A 4N56A 2QWQA 3H3OB 1NJZA 3THVA 5EY4A 4AHVA 3L2VA 4I9QA 4ISGA 5AQKA 3LPTA 5E41A 1J5EK 4ILHA 4CJKA 3K5MA 3ULDA 3W0LA 1NGAA 2YHYA 3I0SA 2QKKA 3ENHA 4RW8A 4PL7A 5CR4A 2QXFA 4ZTFA 3QEPA 3QMLA 3U3GA 4R79A 2YHBA 4PKGA 4B9LA 3N4PA 4CCHA 4H0VB 1RT3A 2Q97A 4DFJA 3HSCA 5DMRA 4CZEA 2GELA 3ZSQA 3HVRA 3OYHA 3SPYA 5LJWA 5AQOA 4IDHA 4J2EA 3AVCA 1HUXA 3DLBA 3C94A 1CXUA 1KFDA 3QB0A 4FWRA 3GG4A 3P1GA 3O80A 3VN5A 1W7AA 4E7HA 5AR0A 1HNVA 3PIOL 4KBOA 3SV4A 2AP1A 1S22A 2E8AA 3OS2A 3OYEA 3LDSA 1NK9A 3O9RA 1VSFA 4CZIA 2E5LK 4B9TA 4JI8K 3J7YP 3K9KA 3G25A 4AM7A 4IO8A 1FXXA 3MWTA 4MO5A 3E01A 4FJIA 2QA4N 3VQPA 2Y1IA 1B92A 1DTTA 4H5TA 3PV8A 2OPPA 5JS1A 4B3MK 5FROA 1N5YA 4XH4A 3LAMA 2F8TA 4CHPA 1YIJN 4F2RA 2XY6A 3E9OA 1YT3A 1HLUA 4CEZA 3RSEB 3H46O 1BUPA 1FKPA 2YNFA 1NU0A 3HOSA 3AAQA 3QNOA 3L4IA 3O9UA 1VSJA 4CGHA 3VTIA 4LC9B 4GV9A 4WE1A 3THWB 4DSEA 3I33A 4I6MA 3OW2M 5J2NA 1VQ8N 3G10A 3NFAA 5AQVA 4CEBA 4E19A 2VWKA 4WCEL 1WB9A 3MMVA 3MCAB 2ITGA 3EKSA 4FJ8A 4HCCA 3WXLA 4NLCA 4HVJA
chains in the Genus database with same CATH topology
3WQUA 1MWKA 5KPRA 4PKHA 2FXUA 2KLAA 2P9NA 2QM1A 3QDKA 3TTFA 2ZF5O 4K41A 3T7ZA 3BF1A 2FSKA 4IEIA 2ZJPL 4GV6A 5AQHA 3K9JA 3VEOA 1NGIA 4CZKA 3MCPA 2NRWA 2VYPA 3EE8A 3G71N 1VQ5N 5CE3A 3SMSA 4IJNA 1KQSM 4IEEA 3TTCA 3LDPA 4IWVA 2DPNA 4BC3A 1LOTB 2W41A 3KVGA 4H0TB 1HJOA 5BN8A 1OVYA 1VQON 5E84A 3L0QA 5M1PA 4WQ4C 3HBTA 1S72N 2FSNA 1ZBSA 5M1FA 1YJ9N 4U7BA 4U67L 3VGLA 3CETA 1VQ4N 2ASOA 3IUCA 5BPNA 3CCSN 1NGCA 3H45C 4JKGA 1WUAA 5HL7L 5KQDA 3F2KA 3CJ9A 3O8MA 1GLJO 4XH5A 4B1VA 1Q18A 4IXCA 5AQPA 1YAGA 3ATVA 3CHWA 4IO9L 1QQMA 4JK8A 5BPLA 1YUWA 3Q7BA 4WQ5C 4FWNA 3VF6A 4EIAA 1HPMA 1SS6A 5MLCQ 2CH6A 4YOVA 3GDQA 3R1XA 4BR4A 4J8FA 4MDBA 3S41A 1RFQA 4BC5A 2WFBA 1VQNN 5CHIA 5LJVA 4DKWA 2GX9A 1BDGA 2QWNA 3F9MA 2CGKA 2Q1NA 3EZWA 2VWBA 3N4QA 5AZJB 5I9EB 4EHUA 4YOWA 1NGJA 3FZHA 1V4SA 3ZETB 1IG8A 3SJHA 3CCVN 3O9SA 1P8ZA 4YOTA 4BQLA 4ILGB 3MWPA 3CI5A 1RGIA 1VQ9N 4JHDB 5F2RA 3LDOA 4IJAA 2P9UA 3L6QA 1JCFA 2A42A 5C2FA 2P9SA 3DXKA 1S3XA 4OPAA 5DM6L 1NBWA 2NZTA 2UYTA 2YJFA 3P38A 3D2EA 4I6MB 3R9PA 1NMDA 3VGKA 1DEJA 2GWKA 2P9IA 1MDUB 3A5MC 1K8KB 3D6RA 2E1YA 3FLCO 4B1YB 3B8AX 3MX2A 3UE5A 4CI6A 3CCEN 1GLEG 2QTDA 2V7YA 5BRDA 3VEVA 5GINA 3I56N 2ITMA 3SAFA 4GNIA 3VEXA 4JNEA 4A59A 2ZWHA 5AQRA 1VQPN 4A57A 3SAHA 1Y64A 2ASMA 2NRTA 2VCPA 4KH6A 3U4LA 3QBWA 4YOXA 3DAWA 5ADXH 3CCJN 1K8AO 4GY2B 4BQZA 3NVKA 2Q2RA 5C12A 3EL2A 3AAPA 2HOEA 3ULEA 2FF6A 3CCQN 5AQLA 4H5RA 4K25A 5KPTA 1HX1A 3H1VX 3A5NC 4K43A 4M63C 4CZLA 4A2BA 4A62A 3JS6A 4BROA 5C15A 4DCHA 3CERA 5BR9A 1TUUA 3FZLA 4RCHA 2A3ZA 2OANA 2Q31A 2PFUA 3WXKA 3CCMN 2V51B 1NGDA 4FWMA 3VGMA 3O6WA 1XUPO 1VQMN 5AQFA 1EO1A 3A5OC 4JKGB 4BRAA 4BGBA 2HSTA 4NO7A 4BC4A 2GUPA 3MN9A 1NLVA 5AQGA 1Z05A 4WFNL 4IOAL 4BGAA 3P4IA 5FPNA 1P90A 1X3NA 4ISFA 5AQYA 3D2FA 2QEXN 5C0YA 3CJBA 2WC9A 2E88A 2E2NA 4MO4A 3TTDA 3KHYA 1GLBG 4CZFA 1Q86O 4XEIA 2IVOA 1BU6O 1ATRA 2KHOA 5E26A 2P9LA 4A2AA 3ID8A 1ATNA 4NLBA 4BVPA 3HTVA 3O1BA 5H1SQ 2F7TA 4H03B 1U2VA 2NRRA 3A8YA 3UKUA 3U9ZA 2PBDA 4BRIA 2FF3B 3FFKB 2OTJN 3NMUA 2P9UB 3AGKA 4IFEA 1JJ2M 3PIPL 1CZAN 2P9SB 2E2PA 3DXKB 3KK7A 4BR7A 4RTFD 4IOXA 2I7PA 4JEPA 2YHWA 4FOIA 3CIPA 3D2EB 3M3ZA 1NGGA 4BRFA 5LY3A 2A40A 3DLLL 4CZJA 1QQOA 1SQKA 3C65A 3O08A 3ZX0A 4O8KA 4OPHA 4AF1A 4H5WA 1O13A 2Q0RA 3VPZA 2CGLA 3CJAA 4G9ZA 1YF5L 4QS8A 5AFUH 4BR2A 1VQLN 4FSVA 5DM7L 3WQTA 5C10A 2D4WA 1IJJA 3R8EA 3D7EO 1SZ2A 5BRHA 2V52B 2JWKA 3OBYA 2D0PA 4JD2A 1T3VA 1HKGA 1KAYA 1C0FA 1HKCA 5BN9A 4CZMA 1D4XA 2QWRA 3QFUA 5BRFA 4JKFA 3ULEB 5GIOA 3CC2N 4FVUA 3U8XA 4K42A 3C6AA 2P9PA 4YDUA 3HI0A 5AQUA 3QICA 5GADP 3QFPA 3ENOA 5JVGL 4JK9A 3FZKA 4FWPA 2BUPA 1ESVA 3LM9A 1W97L 3ZX2A 3CC7N 2E1ZA 4FWLA 3IFRA 3WEEA 3O9QA 1NWKA 3JXUA 1BOTO 3PLAA 1KAZA 3F5TA 3EO3A 3P39A 3VTHA 1RDWX 3CJ7A 4EHTA 2QWPA 3GBTA 3E9PA 4PHTX 1QVGM 3CQXA 4ISEA 3VMFB 2NLXA 3L4QA 4CZHA 1Q81O 2CGJA 2HBLA 1E4FT 4JKEA 5AZIA 2ZJQL 2BTFA 4KH4A 4A5AA 2AA4A 1K9MO 5AQWA 4WFBL 1Z6RA 4MDAA 4H5VA 3QBXA 4Z94A 2QWMA 4FL9A 1NGHA 3D2FB 1W2BM 4BRKA 2E20A 3LDLA 3O4WA 4EAHD 5JICA 4QS7A 4M7YA 2NNWA 3VEZA 3KWIA 3E66A 3ZEUA 2YI1A 1ATSA 4CJ7A 3CPWM 1VQKN 5AQNA 4IOCL 5AQMA 4YDUC 4Y0WA 2QI2A 3BF3A 3G4SN 1QQNA 2HBJA 4YOYA 3FR0A 4FWOA 3DWLA 3NVMA 4JAXA 4BRPA 2P9LB 5M1OA 2EWSA 1XQSC 3GL1A 4BG8A 2OTLN 2NRZA 1N8RO 2P9NB 3E9LA 3UKUB 1U2VB 5GAHP 4BC2A 5EX5A 5GIPA 3HOTA 2QXLA 3UB5A 4CBWA 1YJWN 1VQ6N 2GWJA 3O9TA 4EFHA 1TUYA 1BO5O 3G6EN 4BVOA 1C0GA 5F1XA 4GVEA 3I8BA 3MK6A 3VESA 2IIRA 4WFAL 4O5FA 1WOQA 3SAGA 1R59O 3CD6N 1ZC6A 3KWGA 1KAXA 4F9OA 4BY9C 2F9TA 2WUSA 3ID6A 3CXCM 2HBKA 4FO0A 5JVHL 3CMEN 2YX6A 2JWLA 4CD3A 3MDQA 3EN9A 1Q82O 1G99A 3VEYA 1NGEA 3C0BA 4JD2B 5AQQA 3WXIA 4WYBA 1KC8O 3AGRA 5C2DA 3P31A 2NRXA 4H0PA 2ASPA 3ZYYX 2HF3A 2YCHA 1Q7YO 1QZ6A 2P9PB 4YOUA 1HKBA 1H1VA 3C7NA 3VF2A 4FWSA 2RHKA 3RVCA 4A5BA 2GEMA 4B9QA 2ZGYA 5JLFA 4CZGA 3I55N 4FWQA 2QWOA 3A0IX 4CBUA 3CPEA 3BEXA 4B1UB 3IKMA 1T44A 3WEEB 4BG9A 3LDQA 1GLLO 2D0OA 2CH5A 3WXJA 1BA0A 1OKJA 3R6MA 2W40A 1DGKN 3WUHA 1VQ7N 4JN4A 2ZGZA 2A6AA 3VF4A 1JCGA 2ZJRL 3VOVA 1QVFM 3MX5A 5AZIB 1TYQA 2FSJA 3FE1A 3TSQA 4C1NI 1X3MA 3CMAN 3H1QA 4UY8O 4BRNA 1SAZA 3GOIA 1XC3A 5TKWA 2RE2A 3GE1A 1NJIO 1YHQN 3O1WA 1QZ5A 2P9IB 5KQ8A 4FPBA 3ZEUB 4L3QA 5AQJA 2KKZA 3FZMA 3LM2A 2P9KA 3OA9A 4B1ZA 4OO1J 1NGFA 4JKCA 4ILJA 5GAGP 5JMVA 1YI2N 2GTDA 4XH1A 1QHAA 3DJCA 4WQ5A 4JK7A 3AARA 5GAEP 4QS9A 2Q0UA 3MN6A 3ATUA 2NRVA 3DXMA 3MN5A 5F0XA 5FPEA 2QWQA 3CCLN 3Q7CA 3H3OB 3VEWA 4KH5A 5EY4A 1GLFO 2IVNA 3A5LC 3UKRA 3CJCA 5KPZA 4ISGA 4JKDA 5AQKA 3C6HA 4ILHA 2YJEA 4JKAA 3VETA 2Q36A 3W0LA 1NGAA 2A41A 2YHYA 4PL8A 3ENHA 5EOYA 3RSEA 2J4RA 2HBMA 2QW9A 4JKBA 5AQXA 3CF5L 3T69A 5AFUA 3EKUA 4PL7A 5CR4A 5M1NA 2HMPA 2I7NA 5JLHA 4PKIA 3QMLA 4R79A 5HOOA 4E1JA 4PKGA 4BRQA 1V4TA 3M5RA 5ELZA 4BR0A 3U9DA 1YJNN 3N4PA 3M6GA 3R3LA 4FPAA 3H6EA 4H0VB 2Q97A 4C23A 2BH1A 3CCRN 4HWIA 2F9WA 2V7ZA 3HSCA 4CZEA 1J6ZA 2E2QA 2VGMA 1VAZA 2GELA 3C7NB 2E2OA 5LJWA 5AQOA 4IDHA 4HTLA 2IVPA 4C1NK 4DB3A 1HUXA 3EE9A 1MWMA 3BUZB 5B8HA 3QB0A 3IDHA 3GG4A 4FWRA 5M1QA 5FPDA 3O80A 1T6CA 1E4GT 4B1XB 1U6ZA 4WF9L 3SK3A 3OHRA 5AR0A 3ZX3A 4BRHA 1DKGD 3PIOL 1ILYA 3MN7A 4BRGA 4DQ8A 1TYQB 4KBOA 2AP1A 1S22A 3TSUA 1K73O 5EVZA 2E8AA 1BG3A 2FLOA 3TPQA 1RDUA 2WBNA 1T6DA 3TU5A 1MA9B 4MLEA 3O9RA 3OBWA 3HZ6A 1GLDG 5AQTA 4CZIA 3O5BA 1NGBA 4FWKA 3WXMB 1YVNA 2D1KA 1M90O 1BA1A 3K9KA 3M1FA 1LCUA 3LL3A 3G25A 4AM7A 2P9KB 4IO8A 3SMPA 4H0YB 3WT0A 3MWTA 2QWLA 4MO5A 3CJ1A 2H3GX 5BPMA 4RWTA 2HF4A 1KXPA 3SBGA 4BRDA 2QA4N 5AQIA 5ADXA 1ZXOA 3DXMB 5M1KA 1NM1A 4H5TA 3CC4N 2YHXA 3KZBA 4FOEA 4H5NA 3UKRB 4XH4A 1GLAG 2A5XA 1M1KO 4NB4A 3ENBA 3VENA 2NRHA 1YIJN 1DT9A 3HRGA 3IMXA 3LDNA 4BRCA 3E9OA 1YXQA 5TKYA 1HLUA 5AZJA 4H0OA 1YITN 3RSEB 3SBTA 4CD1A 3H46O 3J8AA 1BUPA 3BP8A 4YORA 3ZETA 2VGNA 3SLCA 4A61A 3HM8A 4AM6A 4DHYA 3AAQA 3HOSA 5BREA 3L4IA 4H0XB 3O9UA 4MLHA 5AQSA 4BRMA 4JHDA 3W3DA 4BREA 3H3NO 3VTIA 4LC9B 4GV9A 4CBXA 3J7ZO 4WQ4A 4O8UA 2PAVA 3I33A 4M7XA 4BR5A 4I6MA 1BWFO 5EXWA 3OW2M 3VERA 4B1WB 1VQ8N 5AQVA 1JCEA 3FGUA 4WCEL 3FZFA 3CCUN 1K8KA 4BR9A 1GLCG 3MMVA 3TSPA 4GV3A 3CQYA 1KD1O 3MCAB 4BRLA 1EQYA 3EKSA 3AY9A 1X9JA 5AQZA 3WXLA 4JKHA 3E1YA 4NLCA 5FPMA 4IZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM N;  2OTL N;  2ZJP L;  1N8R O;  4WFN L;  5GAH P;  1YJN N;  4IOA L;  3G71 N;  1VQ5 N;  3CCR N;  1YJW N;  1VQ6 N;  2QEX N;  3G6E N;  1KQS M;  1OVY A;  1VQO N;  4WFA L;  1Q86 O;  1S72 N;  1YJ9 N;  4U67 L;  3CD6 N;  1VQ4 N;  3CXC M;  5JVH L;  3CCS N;  3CME N;  5HL7 L;  4WF9 L;  1Q82 O;  5H1S Q;  1ILY A;  3PIO L;  2OTJ N;  1KC8 O;  1K73 O;  4IO9 L;  1JJ2 M;  3PIP L;  1Q7Y O;  5MLC Q;  3DLL L;  1M90 O;  3I55 N;  1VQN N;  1VQL N;  3CCV N;  5DM7 L;  1VQ7 N;  2QA4 N;  2ZJR L;  1VQ9 N;  1QVF M;  3CC4 N;  3CMA N;  3CC2 N;  4UY8 O;  5DM6 L;  5GAD P;  1NJI O;  1YHQ N;  1M1K O;  5JVG L;  1YIJ N;  3CCE N;  3I56 N;  3CC7 N;  1YIT N;  5GAG P;  1YI2 N;  1VQP N;  1QVG M;  5GAE P;  1Q81 O;  3CCJ N;  1K8A O;  2ZJQ L;  1K9M O;  4WFB L;  3CCQ N;  3CCL N;  3J7Z O;  1W2B M;  3OW2 M;  1VQ8 N;  4WCE L;  3CCU N;  1VQK N;  3CPW M;  4IOC L;  1KD1 O;  3CCM N;  3G4S N;  3CF5 L; 
#chains in the Genus database with same CATH topology
 5KPR A;  4IG0 A;  2ZJP L;  1EET A;  4HUG A;  2P1J A;  4CZK A;  3MCP A;  3M8S A;  1JXE A;  5J2P A;  3SMS A;  1WSH A;  2XO7 A;  3AVH A;  3SUP A;  4IJN A;  2O8C B;  4O5B A;  4IWV A;  1MU2 A;  1LOT B;  3O3G A;  1N34 K;  5BN8 A;  3WNF A;  5IWA K;  3L0Q A;  5M1P A;  5M1F A;  5SWM A;  4CIF A;  2G8F A;  3U3Y A;  2HHQ A;  1XMQ K;  4FJL A;  3VQC A;  3IUC A;  3NBP A;  3SQ1 A;  3H45 C;  1TGO A;  4X65 K;  4B1V A;  5C42 A;  4B8A B;  4GKJ K;  4JLH A;  4Y1C A;  5BPL A;  1YUW A;  5HLF A;  3VF6 A;  3MXI A;  4EIA A;  2O8D B;  2CH6 A;  3M8P A;  4FJX A;  4BR4 A;  4MDB A;  4BC5 A;  2WFB A;  3F9M A;  3DM2 A;  3EZW A;  4YOW A;  1S1U A;  3FZH A;  3ZET B;  3SJH A;  5FLX O;  4ILG B;  3MWP A;  3HM9 A;  3LPU A;  4NXM K;  4BDY A;  3F73 A;  1D8Y A;  4O0I A;  3VA3 A;  1XC9 A;  2NZT A;  2YJF A;  4CHN A;  4CES A;  4DR3 K;  2OPR A;  4FLZ A;  4DR2 K;  4B1Y B;  4FZY A;  3UE5 A;  4CI6 A;  5BRD A;  2V7Y A;  3VEV A;  2A1R A;  4GNI A;  3ZT0 A;  5CYM A;  4CF8 A;  4DV1 K;  3QET A;  1YVU A;  1VRT A;  1S9G A;  4DTM A;  2G8H A;  2VCP A;  4RW4 A;  5ADX H;  1RT1 A;  4BQZ A;  3THX A;  4CED A;  2DFE A;  5AQL A;  5KPT A;  2IAJ A;  4K43 A;  1ITG A;  4A62 A;  4BRO A;  3DMJ A;  4JYA K;  1LWF A;  4DMN A;  5I42 A;  4CJE A;  2OAN A;  1NGD A;  4FWM A;  3HPG A;  5AQF A;  1IBM K;  2KW4 A;  1EO1 A;  4JKG B;  4KB1 A;  5CYQ A;  1BI4 A;  5C25 A;  4NCB A;  1NOZ A;  4BC4 A;  4IOA L;  1BIU A;  4E1M A;  3D2F A;  3V1Q A;  4LSN A;  3DYA A;  3LZJ A;  4JRP A;  4EZ6 A;  1G15 A;  1WLJ A;  4K8Z A;  4F8R A;  1ATR A;  4KI4 A;  2HHX A;  4B3R K;  4FM0 A;  3ZSR A;  3M8R A;  3K58 A;  5H1S Q;  1U2V A;  2NRR A;  3A8Y A;  4DU3 A;  1IKV A;  3NF9 A;  2G8W A;  1U4B A;  3NMU A;  2P9U B;  2KZM A;  3AGK A;  3OYG A;  4IFE A;  1CZA N;  3DXK B;  4IOX A;  2I7P A;  1NGG A;  3NGI A;  1C1B A;  3ZX0 A;  4OPH A;  1O13 A;  4B9M A;  3VPZ A;  1BIS A;  3PO4 A;  2CGL A;  3CJA A;  3ZCM A;  1YF5 L;  4G9Z A;  3P83 D;  1ZBI A;  3OYI A;  4OVL A;  1IJJ A;  1LW2 A;  1SZ2 A;  4FJG A;  4JD2 A;  1IG9 A;  4CGG A;  1RTD A;  1D4X A;  1X9W A;  1HR0 K;  4FVU A;  3PY8 A;  3CC2 N;  4K42 A;  1SV5 A;  1C1A A;  3QIC A;  3ENO A;  5HP1 A;  4DV4 K;  3D45 A;  4FWP A;  5BR8 K;  4JI7 K;  3EY1 A;  4F4K A;  1CLQ A;  3RRH A;  2HHV A;  1ZBF A;  3JXU A;  3PLA A;  1KAZ A;  4FZX C;  4PHT X;  3CQX A;  2NLX A;  4DR7 K;  2CGJ A;  4KH4 A;  1BGX T;  3QBX A;  4Z94 A;  1HNZ K;  4ELT A;  1U48 A;  3OVN A;  3DLK A;  1IO2 A;  2O8F A;  1W2B M;  5JIC A;  4QS7 A;  4M7Y A;  3VEZ A;  3CPW M;  2LSN A;  4ELV A;  2BDP A;  1VSI A;  4FM2 A;  2QI2 A;  3BF3 A;  3DWL A;  1X9M A;  5KGW A;  3MEG A;  4CK2 A;  1FJG K;  1XQS C;  2YHA A;  2IDO A;  4B3T K;  3S3N A;  2P9N B;  3MAQ A;  1J54 A;  1VSK A;  5EX5 A;  1YJW N;  3O9T A;  4EFH A;  4IG3 A;  4KHU A;  5KRS A;  4X64 K;  3I8B A;  3MK6 A;  1KLN A;  1UA1 A;  4DUY K;  3MED A;  4O5F A;  2G8I A;  5KTQ A;  1R59 O;  3TAP A;  4BY9 C;  4O4G A;  2WUS A;  3CXC M;  2HBK A;  3V81 A;  3IAY A;  2O4I A;  3K2P A;  1C0M A;  3TAM A;  3ZYY X;  5C2D A;  2ASP A;  2HVI A;  1Q7Y O;  2AJQ A;  3ZSY A;  3V9U A;  1UWB A;  1QZ6 A;  2P9P B;  3NF6 A;  3VF2 A;  2W6L A;  1NK6 A;  4CZG A;  3I55 N;  4FWQ A;  4CBU A;  1J5O A;  4B1U B;  4CJ7 A;  1T44 A;  1TK0 A;  2DFF A;  3O4N A;  2GUI A;  1RBT A;  2W40 A;  1DGK N;  3AO4 A;  1KSP A;  1JXB A;  2XRI A;  2ZJR L;  3AA2 A;  1X3M A;  4Z4C A;  3M8Q A;  3H1Q A;  3OYD A;  3PX4 A;  2Y1J A;  4CHY A;  1XNR K;  3O1W A;  3RWU A;  3ZEU B;  3KD1 E;  3FZM A;  2P9K A;  4OO1 J;  2O4G A;  4DUZ K;  4JK7 A;  3AAR A;  3DXM A;  3MN5 A;  4KTW A;  3CCL N;  2IVN A;  1IV0 A;  3S9H A;  3KK1 A;  1U47 A;  3ZSZ A;  2Q36 A;  2W6K A;  2FC0 A;  2A41 A;  4KHY A;  1L3V A;  2J4R A;  4JKB A;  1DLO A;  1OVQ A;  3T69 A;  3ZSW A;  4C8K A;  2I7N A;  1Q9X A;  4PKI A;  1EKE A;  5HOO A;  3CM6 A;  1V4T A;  3M5R A;  4M3T A;  4BR0 A;  1YJN N;  4KTQ A;  4C23 A;  3CCR N;  3KLH A;  4K0K K;  4HWI A;  1WN7 A;  2F9W A;  1O1W A;  4RW6 A;  2E2Q A;  3SUQ A;  3AA4 A;  3AVB A;  4CJQ A;  1VRU A;  4NYF A;  3KLE A;  4LFB K;  1IBL K;  5EU7 A;  4ICL A;  3LWL A;  2EX3 A;  1MWM A;  4DSI A;  3DLR A;  1E4G T;  4B1X B;  4WF9 L;  1HPZ A;  4DR1 K;  4BE2 A;  4M3X A;  1NNE A;  3BZC A;  3MEC A;  4BRH A;  4DQ8 A;  1TYQ B;  4LFA K;  3QEV A;  1T6D A;  3ZT4 A;  3HZ6 A;  1U49 A;  5AQT A;  4DTX A;  3OJS A;  2O8B A;  2D1K A;  1CZ9 A;  1HRH A;  4NYN A;  4KHQ A;  1UA0 A;  4CFB A;  4CGF A;  4KKO A;  1XMO K;  4CE9 A;  3RMD A;  3CJ1 A;  2H3G X;  5FRM A;  1TL3 A;  2XY5 A;  4N47 A;  1HYZ A;  5AQI A;  5ADX A;  1ZXO A;  1RT4 A;  3U6F A;  1NKB A;  1TKD A;  4KAZ A;  4DWI A;  3DRR A;  4CGD A;  3UKR B;  1GLA G;  2A5X A;  3VEN A;  3HRG A;  1KVA A;  1YIT N;  3SBT A;  4CD1 A;  3J8A A;  5I3U A;  2VGN A;  3HM8 A;  3HO1 A;  1TK8 A;  4BRM A;  4MLH A;  4JHD A;  4IBN A;  3H3N O;  4AHR A;  4CBX A;  5KI6 A;  4DG1 A;  1BWF O;  4HUE A;  4DS5 A;  3G0Z A;  4FJ7 A;  3FGU A;  4GV3 A;  1KD1 O;  3AY9 A;  2B5J A;  4CJV A;  4EP4 A;  4PY5 A;  1TL1 A;  5AQZ A;  4YFU A;  3TAF A;  4BC2 A;  4IZ9 A;  3WQU A;  4RW9 A;  1MWK A;  2FXU A;  2P9N A;  3QDK A;  2FBY A;  4BDP A;  3K9J A;  4CGJ A;  3VEO A;  1NGI A;  2NRW A;  1WSJ A;  3NH0 A;  2X74 A;  1KQS M;  4IEE A;  4N5S A;  2XY8 A;  3LDP A;  2DPN A;  4BC3 A;  4CK3 A;  3K5L A;  1HJO A;  1QSS A;  3CFR A;  4CEC A;  1VQO N;  3AV9 A;  4TSX A;  3HBT A;  4WQ4 C;  2R7Y A;  3SZ2 A;  1ZBS A;  2OPQ A;  3DRP A;  1S72 N;  4U7B A;  4U67 L;  3SUO A;  3VGL A;  4Z4I A;  1T03 A;  2B4J A;  2G8V A;  1NGC A;  3NGY A;  5KQD A;  4XH5 A;  1GLJ O;  3V6D A;  3IS9 A;  4IXC A;  4DFK A;  1L5U A;  5HBM A;  4IO9 L;  4CF9 A;  4JK8 A;  4FLV A;  3Q7B A;  3NE6 A;  1HPM A;  1SS6 A;  4PQU A;  3GDQ A;  3R1X A;  4DTO A;  3RMB A;  4OPK A;  2HHH K;  3S41 A;  1RFQ A;  4DQQ A;  4CFD A;  3J81 O;  4DV3 K;  1S9E A;  4Z4F A;  1GOB A;  5AZJ B;  5I9E B;  1BQN A;  3RR8 A;  4DFM A;  3RTV A;  1JLA A;  1V4S A;  1IG8 A;  4M3Y A;  2ZD1 A;  4RW7 A;  2OYQ A;  1P8Z A;  1VSE A;  1Z25 A;  1RT6 A;  3J7A P;  1VQ9 N;  1Y97 A;  4IJA A;  3L6Q A;  4CF1 A;  4IDK A;  2P9S A;  1S3X A;  5DM6 L;  2O8E B;  1C0U A;  4CJ4 A;  2UXC K;  4Z4H A;  1K8K B;  3D6R A;  4DR5 K;  3MX2 A;  4H4O A;  3CCE N;  1NK4 A;  2P5O A;  3SYZ A;  2ITM A;  3SAF A;  1TKT A;  3VEX A;  4JNE A;  2ZWH A;  5AQR A;  3SAH A;  1Y64 A;  2ASM A;  2KTQ A;  1K8A O;  3FFI A;  3NVK A;  3PUF A;  2Q2R A;  5C12 A;  2RF2 A;  3EL2 A;  3ULE A;  4E7J A;  4H5R A;  1LAV A;  4K25 A;  5HRS A;  4DFP A;  1HX1 A;  3AA3 A;  4CHQ A;  2E4L A;  4CJS A;  3P5J A;  4YHH K;  3D0P A;  4NXN K;  4CZL A;  4A2B A;  3JS6 A;  5C15 A;  2YNG A;  3O4Q A;  1VSD A;  2A3Z A;  4DR6 K;  4FLY A;  2NUB A;  1XUP O;  3EEQ A;  4DLG A;  4GVM A;  4BGB A;  2HST A;  1OH6 A;  4OKE A;  4NO7 A;  2GUP A;  3MN9 A;  4WFN L;  1HNI A;  1RBS A;  4BGA A;  4KI6 A;  3HK2 A;  5FPN A;  4LD0 A;  1P90 A;  1X3N A;  2QK9 A;  2QEX N;  2F96 A;  2WC9 A;  1WAJ A;  2OZM A;  3KHY A;  2W42 A;  4E0D A;  4FJJ A;  5E26 A;  2P9L A;  4A2A A;  1RIL A;  4B9N A;  4ELU A;  1L3S A;  1ATN A;  5K14 A;  3L2U A;  3HTV A;  3O1B A;  3K0S A;  3UKU A;  2F7T A;  4H03 B;  1S6Q A;  2JLE A;  4BRI A;  4AHS A;  1QS4 A;  3KK7 A;  4RTF D;  3THY A;  3CIP A;  3D2E B;  4O0J A;  1QQO A;  4LF5 K;  1SKS A;  2HB5 A;  4DQP A;  1I39 A;  4FSV A;  3WQT A;  3R8E A;  3BY5 A;  4FYD A;  1NK7 A;  2D0P A;  1T3V A;  1HKG A;  1KAY A;  5BN9 A;  1W9H A;  3CQ8 A;  4JKF A;  5GIO A;  3U8X A;  4HCB A;  1FW6 A;  5AQU A;  4M41 A;  4XIU A;  5JVG L;  4I2P A;  4JK9 A;  2BUP A;  3WNE A;  4FWL A;  3O9Q A;  1NWK A;  4CFC A;  3VQ9 A;  3EO3 A;  3P39 A;  1EXQ A;  3CJ7 A;  4EHT A;  3GBT A;  3AVG A;  1QVG M;  3K5O A;  1HYS A;  3VQ5 A;  3VMF B;  3L4Q A;  3AO3 A;  4JKE A;  2ZJQ L;  1S1V A;  3BZK A;  4YY3 K;  5AQW A;  4WFB L;  4CEQ A;  3PSI A;  1RNH A;  3ZLJ A;  1KRP A;  1NJY A;  2E20 A;  3LDL A;  1XHZ A;  4RG8 A;  2NNW A;  4DV0 K;  4FXD A;  4IOC L;  4KV8 A;  4YDU C;  3LAL A;  4Y0W A;  3QO9 A;  4EP5 A;  4JAX A;  3OYL A;  4BRP A;  1JL2 A;  5M1O A;  4BG8 A;  3TAE A;  3NH2 A;  2NRZ A;  1N8R O;  4JI0 K;  3E9L A;  2UUC K;  2KZZ A;  3HT3 A;  2YNI A;  3LP1 A;  2GWJ A;  1TKZ A;  1BO5 O;  1WSE A;  1Q8I A;  1C0G A;  5F1X A;  1QE1 A;  3VA0 A;  2IIR A;  2HHT A;  4QOZ B;  3LAK A;  3CD6 N;  3VQE A;  1KCF A;  1ZC6 A;  4LH5 A;  5JVH L;  3CME N;  2YX6 A;  3ZT2 A;  3MDQ A;  3C0B A;  3J80 O;  4WYB A;  2NRX A;  4H0P A;  4O44 A;  2Q3S A;  3AO1 A;  1VSM A;  4YOU A;  3OYN A;  1HKB A;  2RHK A;  4A5B A;  2QWO A;  3A0I X;  3QNN A;  2PYJ A;  1OH5 A;  3WEE B;  3WXJ A;  1L3U A;  2CH5 A;  3R6M A;  3JAM O;  1EWQ A;  4CF2 A;  3TAN A;  3MX5 A;  5AZI B;  4C1N I;  3TSQ A;  4CEE A;  3CMA N;  1TAQ A;  1SAZ A;  3NAE A;  4FJK A;  2E6L A;  2P9I B;  4BWJ A;  5AQJ A;  4DSL A;  2OCE A;  3OA9 A;  4KRF A;  5GAG P;  5HRP A;  1YI2 N;  3DJC A;  4WQ5 A;  4CW7 B;  4OX9 K;  4I2Q A;  2HHS A;  4JI1 K;  2Q0U A;  3ATU A;  2NRV A;  4W5O A;  3VQD A;  4M3W A;  2YKN A;  5HRO A;  3VQ7 A;  4KO0 A;  3C6U A;  1T05 A;  3A5L C;  5KPZ A;  5HRN A;  3C6H A;  3VQ6 A;  2YJE A;  4JKA A;  3VET A;  5J2M A;  1JLQ A;  2PZS A;  3RSE A;  2HBM A;  1QQC A;  2QW9 A;  5AQX A;  3CF5 L;  1OH7 A;  5M1N A;  5JLH A;  3HYF A;  4BRQ A;  5D3G A;  2ZM6 K;  1LWC A;  3M6G A;  4FPA A;  2UXB K;  3THW A;  4Z0U A;  2V7Z A;  4OLB A;  2VGM A;  1B9F A;  1S1W A;  3C7N B;  5IT9 O;  2E2O A;  3HST B;  1S1X A;  3AVA A;  4ZTJ A;  4CJ3 A;  2IVP A;  3OYM A;  4C1N K;  4MFB A;  3DLH A;  3BUZ B;  4E7K A;  4I9L A;  3IDH A;  2ZQB A;  2QKB A;  1T6C A;  4OGC A;  2KQ2 A;  2BGG A;  1T8E A;  3PO5 A;  1U6Z A;  3SK3 A;  4FLW A;  2G8K A;  2WOM A;  3MN7 A;  4KB0 A;  4BRG A;  2HHW A;  3TAG A;  3TSU A;  1BG3 A;  3TU5 A;  4MLE A;  4ID1 A;  2O8C A;  2FBX A;  4J2B A;  4Y1D A;  1GLD G;  3O5B A;  1NGB A;  3TAQ A;  4QAG A;  3WXM B;  4DS4 A;  3KIO A;  1YVN A;  1M90 O;  1BA1 A;  3LL3 A;  1KVC A;  3SMP A;  3JYT A;  2QWL A;  3KJV A;  2RN2 A;  5BPM A;  1JL1 A;  4RWT A;  3VQB A;  4B9V A;  1ZBL A;  3SI6 A;  5M1K A;  1TVR A;  1NM1 A;  3CC4 N;  4DV7 K;  2YHX A;  3KZB A;  2O8D A;  4H5N A;  3LWM A;  1HNW K;  1WBD A;  2I5J A;  4NB4 A;  1S6P A;  1EWR A;  3K5N A;  3IMX A;  1WSG A;  3LDN A;  4BRC A;  3DLE A;  4BE0 A;  3AO5 A;  3B6O A;  4FJN A;  3AVJ A;  4JI5 K;  4YOR A;  3ZET A;  3SLC A;  4A61 A;  2UUB K;  3V9X A;  4BRE A;  4I7F A;  3J7Z O;  4WQ4 A;  4O8U A;  4M3Z A;  2FBT A;  3MXJ A;  4BR5 A;  5EXW A;  3VER A;  4B1W B;  2Z1J A;  3FZF A;  3CCU N;  2UU9 K;  1F21 A;  3TSP A;  3CQY A;  5KGX A;  3E1Y A;  3ZX2 A;  5FPM A;  4DU1 A;  3LAN A;  1ASU A;  2KLA A;  2QM1 A;  3T7Z A;  2YV0 X;  1JLE A;  5AQH A;  3QLH A;  1KTQ A;  3EE8 A;  3G71 N;  5CE3 A;  4LFC K;  1DTQ A;  4J2A A;  4KHP K;  4E3S A;  3TTC A;  3V9W A;  2W41 A;  3KVG A;  1OVY A;  3K57 A;  2FSN A;  1YJ9 N;  1QSY A;  3CET A;  4M3R A;  3CCS N;  4JKG A;  5HL7 L;  4E1N A;  3F2K A;  3CJ9 A;  4CFA A;  3QIP A;  1VHX A;  3KKS A;  5AQP A;  3V1R A;  2D0B A;  4LY7 A;  1YAG A;  2ZE2 A;  4DR4 K;  4WQ5 C;  4FWN A;  3HJF A;  5FRN A;  4B9U A;  4YOV A;  4J8F A;  2YNH A;  4DTJ A;  3WNG A;  3EYZ A;  5CHI A;  4CJU A;  4GV6 A;  4DKW A;  1BDG A;  2QWN A;  3N4Q A;  2CGK A;  1EP4 A;  3T1A A;  4EHU A;  1NGJ A;  3OYC A;  3BGR A;  3O9S A;  4BQL A;  2P9U A;  1JCF A;  2Z1G A;  3DXK A;  5LL6 Z;  3T1Y K;  4OPA A;  4BWM A;  2UYT A;  1JLF A;  3P38 A;  4I6M B;  3R9P A;  3VGK A;  1RTH A;  2P9I A;  4HHT A;  1HQE A;  2E1Y A;  3FLC O;  4X66 K;  3B8A X;  1GLE G;  2QTD A;  3OYA A;  3QES A;  2VQF K;  3DOK A;  4A59 A;  3CG7 A;  1TK5 A;  1VQP N;  1XNQ K;  1NG9 A;  3T3F A;  4KH6 A;  3QBW A;  3CCJ N;  4JRQ A;  4CJT A;  2EHG A;  2FF6 A;  3CCQ N;  3TI0 A;  2X6N A;  2OPS A;  2P5G A;  4M63 C;  3KLF A;  4W5N A;  4DCH A;  3CER A;  1TUU A;  4RCH A;  2Q31 A;  4M45 A;  2PFU A;  3WXK A;  4CIE A;  1LWE A;  4DF4 A;  4QCL A;  2X6S A;  1EX4 A;  4YNQ A;  4FM1 A;  3MEE A;  5AQG A;  4OKK A;  1N32 K;  1BCM A;  1U04 A;  1XHX A;  1FK9 A;  3AVN A;  5AQY A;  4ISF A;  4CVN E;  3OYF A;  5C0Y A;  2E88 A;  1KFS A;  1NJX A;  1HJR A;  5DK5 A;  3C95 A;  1YTA A;  4CZF A;  4DF8 A;  4FCY A;  1Q86 O;  4CJW A;  2JGU A;  3ID8 A;  4BVP A;  4LF9 K;  3KLI A;  3L3U A;  1JLB A;  3U9Z A;  2PBD A;  4E7I A;  2FF3 B;  3FFK B;  4L8R B;  2OTJ N;  1JJ2 M;  4BR7 A;  2YHW A;  4M42 A;  5LY3 A;  3H08 A;  3M3Z A;  3DLL L;  3LP3 A;  1U45 A;  1SQK A;  1WNS A;  3C65 A;  2DTU A;  1LAW A;  4O8K A;  4AF1 A;  4H5W A;  2Q0R A;  1NKE A;  4N41 A;  3ALY A;  3HVT A;  4BR2 A;  1VQL N;  1UAX A;  2D4W A;  2RKI A;  3D7E O;  3VQQ A;  5BRH A;  1TKX A;  1C6V A;  2JWK A;  3OBY A;  4BE1 A;  1HKC A;  3PX0 A;  1XI1 A;  2QWR A;  3QFU A;  5BRF A;  3NH1 A;  3THX B;  3AVL A;  2D5R A;  3C6A A;  2P9P A;  4YDU A;  3HI0 A;  3QFP A;  1NK0 A;  3FZK A;  2PYL A;  3CC7 N;  1W97 L;  4KRE A;  3IFR A;  3VTH A;  1RDW X;  1JKH A;  4ISE A;  4FLU A;  1Q81 O;  1BI4 B;  2HBL A;  1E4F T;  4A5A A;  1K9M O;  2AA4 A;  3WNH A;  4MDA A;  4H5V A;  3KD5 E;  2QWM A;  3D2F B;  3CFP A;  4FVM A;  4EAH D;  4F2S A;  4Q5V A;  4Z4E A;  3KWI A;  3SCX A;  1ZBU A;  3ZEU A;  1ATS A;  3RMC A;  4ID5 A;  3T19 A;  5AQM A;  2YKM A;  4OGE A;  4KFB A;  3G4S N;  2HBJ A;  3QIN A;  4YOY A;  3ZT1 A;  2WTU A;  3NVM A;  3VQA A;  3TR8 A;  4DTR A;  4DV2 K;  2EWS A;  3ASM A;  2HMI A;  3EZ5 A;  2DFH A;  1U2V B;  3HL8 A;  5GAH P;  2F8S A;  5KRT A;  5GIP A;  3HOT A;  2QXL A;  4AH9 A;  2HND A;  4CEF A;  1VQ6 N;  4HTU A;  3I8D A;  4PUO A;  4BVO A;  4DTN A;  1BCO A;  4WFA L;  3HP9 A;  3SQ2 A;  1KAX A;  1FKO A;  1SL0 A;  3V4I A;  2DY4 A;  2HNZ A;  4DSJ A;  4CD3 A;  3EN9 A;  1G99 A;  3VEY A;  3SV3 A;  1IKW A;  4JD2 B;  1SL2 A;  1SKW A;  3V9S A;  2RPI A;  1N36 K;  3QER A;  3P31 A;  2YCH A;  1I94 K;  1JLG A;  1H1V A;  4CEA A;  5J1E A;  1J9A A;  1N33 K;  1RDD A;  3RVC A;  4B9Q A;  2GEM A;  2ZGY A;  3SQ0 A;  3KTQ A;  3CPE A;  1NOY A;  3IKM A;  4FJ5 A;  3LDQ A;  1GLL O;  3KKR A;  1BA0 A;  1REV A;  3IRX A;  4AIL C;  3WUH A;  4JS4 A;  2OA8 A;  4B9S A;  4JN4 A;  2ZGZ A;  2VG7 A;  4LH4 A;  3VOV A;  1TYQ A;  3FE1 A;  3OYK A;  3OYJ A;  1Q9Y A;  1YTU A;  1ASW A;  3GOI A;  1XC3 A;  2O8F B;  4K8X A;  2RE2 A;  3GE1 A;  3DI6 A;  1QZ5 A;  5KQ8 A;  4L3Q A;  4M3U A;  2KKZ A;  4LF4 K;  1NGF A;  5JMV A;  1WBB A;  3DLG A;  4AHC A;  4CEO A;  3OYB A;  4F3O A;  1QHA A;  4Z4G A;  3AVM A;  4OKJ A;  5GAE P;  3HPO A;  3MN6 A;  2P51 A;  3Q7C A;  3VEW A;  4KH5 A;  1GLF O;  3UKR A;  3CJC A;  1S5J A;  2A1S A;  4JKD A;  4FK4 A;  1BHL A;  2UXD K;  1BQM A;  1IH7 A;  4PL8 A;  5EOY A;  3AVI A;  4KHW A;  3OY9 A;  3NHG A;  4AHT A;  5AFU A;  3V9Z A;  3EKU A;  3VQ8 A;  2HMP A;  3SNN A;  4E1J A;  2HW3 A;  5ELZ A;  1RT5 A;  2IC3 A;  3U9D A;  2OZS A;  4DSK A;  4C8O A;  3R3L A;  3H6E A;  2BH1 A;  1J6Z A;  4V19 S;  4BAC A;  1VAZ A;  4B3O A;  1SKR A;  4HTL A;  4B3S K;  2KFN A;  2VG6 A;  4DB3 A;  4DLE A;  4CHO A;  3EE9 A;  3ITH A;  1T7P A;  4DV6 K;  5B8H A;  4B08 A;  1J53 A;  5M1Q A;  5FPD A;  3JSM A;  3IG1 A;  1NK5 A;  1RDB A;  4PA1 A;  4C8M A;  3OHR A;  1NMN A;  3ZX3 A;  1ILY A;  1DKG D;  4CHZ A;  4E7L A;  1K73 O;  5EVZ A;  2FLO A;  3TPQ A;  1RDU A;  2WBN A;  3ISN C;  1MA9 B;  1L3T A;  3OBW A;  1S1T A;  4FWK A;  4GKK K;  1I3A A;  3M1F A;  1LCU A;  2P9K B;  4H0Y B;  3WT0 A;  2PY5 A;  3RRG A;  2HF4 A;  1KXP A;  4LF7 K;  3SBG A;  4BRD A;  3DXM B;  3MXM A;  4C8L A;  4FOE A;  1NK8 A;  4EZ9 A;  1D9D A;  3S3O A;  4BDZ A;  1A5X A;  1M1K O;  1CXQ A;  3ENB A;  2NRH A;  4OLA A;  1DT9 A;  1YXQ A;  5TKY A;  5AZJ A;  4H0O A;  4KHN A;  4CJR A;  4B8C A;  3BP8 A;  4IFV A;  4DHY A;  4AM6 A;  4C8N A;  5BRE A;  4H0X B;  5AQS A;  4F3T A;  4FK0 A;  3W3D A;  1BL3 A;  3SUN A;  3DOL A;  3B6P A;  2Z1H A;  2PAV A;  2O8E A;  4M7X A;  1UOC A;  1JCE A;  1D5A A;  2X78 A;  1K8K A;  4BR9 A;  4DSF A;  2XY7 A;  3TAR A;  1GLC G;  2D0C A;  1EQY A;  4BRL A;  4NCA A;  1X9J A;  4FZZ A;  4JKH A;  4FJH A;  4J2D A;  3QIO A;  1C0T A;  4PKH A;  4CIG A;  3TTF A;  5CZ1 A;  2ZF5 O;  4K41 A;  3OS0 A;  3BF1 A;  2FSK A;  4IEI A;  2IGI A;  2UUA K;  1RDA A;  1HNX K;  2VYP A;  1VQ5 N;  1WSF A;  5AJ3 K;  1B9D A;  1HYV A;  1QSL A;  4H8K A;  2D0A A;  4H0T B;  2O8B B;  1WSI A;  5E84 A;  2IS3 A;  1HMV A;  2ASO A;  1VQ4 N;  5BPN A;  4IKF A;  4R5P A;  1WUA A;  1LW0 A;  1A5V A;  3O8M A;  2BAN A;  4JI6 K;  1RCH A;  4OJR A;  1Q18 A;  3PX6 A;  3HPH A;  4CJL A;  3ATV A;  3CHW A;  4DQS A;  1QQM A;  1X1P A;  4FLX A;  1RBV A;  5FDL A;  5MLC Q;  4Q0B A;  1OH8 A;  3NF8 A;  1ZBH A;  4KPY A;  1VQN N;  4OPJ A;  5LJV A;  2GX9 A;  2Q1N A;  4AQY K;  2VWB A;  1RT2 A;  1KVB A;  3CCV N;  4YOT A;  3ZSX A;  3CI5 A;  1RGI A;  5CY4 A;  3V1O A;  4JHD B;  5F2R A;  3LDO A;  4CF0 A;  1TAU A;  2A42 A;  2BE2 A;  3A2F A;  3AVF A;  5C2F A;  1NBW A;  1WAF A;  3D2E A;  1NMD A;  4FJM A;  1DEJ A;  2GWK A;  3I0R A;  1MDU B;  3A5M C;  3S3M A;  1Z26 A;  1KLM A;  3I56 N;  5GIN A;  2E6M A;  1D9F A;  2ETJ A;  3SJJ A;  2ATQ A;  3F9K A;  1GOC A;  3CYM A;  4KTZ A;  4A57 A;  4JS5 A;  2NRT A;  1JLC A;  3U4L A;  4YOX A;  1W0H A;  4W5Q A;  3DAW A;  2KFZ A;  4GY2 B;  4LSL A;  1ASV A;  3AAP A;  2HOE A;  1IKY A;  1VSL A;  4FW1 A;  4H4M A;  5LMU K;  3H1V X;  3A5N C;  2F4V K;  3CFO A;  3HXM A;  5BR9 A;  3FZL A;  3CCM N;  2V51 B;  3L2Q A;  3ZT3 A;  3VGM A;  3O6W A;  1VQM N;  3NCI A;  3A5O C;  4BRA A;  3C6T A;  3QEX A;  5JS2 A;  1NLV A;  1Z05 A;  4AHU A;  1TV6 A;  3P4I A;  1HQU A;  3ZSV A;  2Z1I A;  3T1H K;  4CK1 A;  3CJB A;  4W5R A;  2E2N A;  4MO4 A;  3TTD A;  3RMA A;  1CZB A;  5A2Q O;  4PWD A;  1GLB G;  4XEI A;  2IVO A;  4DQR A;  4N76 A;  3OJU A;  1BU6 O;  2KHO A;  3O3F A;  2FBV A;  3TWH A;  5HRR A;  4NLB A;  3AA5 X;  4GW6 A;  3PIP L;  4CJP A;  5SZT A;  2E2P A;  2P9S B;  4KHS A;  5LMN K;  1RTI A;  4JEP A;  1RT7 A;  2WON A;  4FOI A;  3SPZ A;  1IBK K;  4BRF A;  1VK0 A;  2A40 A;  4CZJ A;  4JI3 K;  3O08 A;  2B6A A;  4CJ5 A;  4JI2 K;  2G8U A;  4QS8 A;  1A5W A;  3AVK A;  5AFU H;  2VQE K;  5DM7 L;  4W5T A;  5C10 A;  1XWL A;  1R0A A;  2V52 B;  4CGI A;  4CZM A;  3KK2 A;  1C0F A;  3KK3 A;  4G1Q A;  4FLT A;  3ULE B;  1E3M A;  5GAD P;  1VSH A;  4FW2 A;  2GV9 A;  1ESV A;  3LM9 A;  3VQ4 A;  4DTU A;  2E1Z A;  2VG5 A;  3L2R A;  3WEE A;  4IFY A;  1BOT O;  3HP6 A;  3F5T A;  4O55 A;  3L3V A;  2QWP A;  3QEI A;  3E9P A;  4CZH A;  5AZI A;  2BTF A;  4FJ9 A;  1Z6R A;  3NDK A;  3LP2 A;  4FL9 A;  1NGH A;  4BRK A;  4LF6 K;  3O4W A;  4NCG A;  3NGZ A;  4FK2 A;  3E66 A;  3O3H A;  1VQK N;  1RBR A;  2YI1 A;  1LV5 A;  1QHT A;  4E89 A;  5AQN A;  1QQN A;  3FR0 A;  4FWO A;  2P9L B;  3GL1 A;  2OTL N;  2IOC A;  3L8B A;  3UKU B;  3L2W A;  3CM5 A;  3UB5 A;  4CBW A;  3LZI A;  1TUY A;  4UQG A;  3G6E N;  3THY B;  4GVE A;  3K59 A;  3VES A;  4JI4 K;  3OS1 A;  4HUF A;  1WOQ A;  3KLG A;  3SAG A;  1X9S A;  4LF8 K;  3KWG A;  4F9O A;  2F9T A;  3ID6 A;  4FO0 A;  1BIZ A;  2JWL A;  2HVH A;  1IKX A;  1Q82 O;  1NGE A;  3DRS A;  3PSF A;  1C1C A;  5AQQ A;  4MQ3 A;  3WXI A;  1KC8 O;  3AGR A;  4DTS A;  1RTJ A;  2HF3 A;  4X62 K;  1SUQ A;  3C7N A;  4DU4 A;  5T7B A;  1NKC A;  4JV5 K;  4FWS A;  2XHB A;  5JLF A;  1RBU A;  4DV5 K;  4DTP A;  3NF7 A;  3BEX A;  4BG9 A;  2D0O A;  2VWJ A;  1OKJ A;  1VQ7 N;  5J2Q A;  3UIQ A;  2A6A A;  3VF4 A;  1JCG A;  1QVF M;  3AO2 A;  1K6Y A;  2FSJ A;  3QEW A;  3ZSO A;  3BDP A;  4UY8 O;  1GOA A;  4BRN A;  5C24 A;  5TKW A;  1NJI O;  1YHQ N;  2HNY A;  4CER A;  1N6Q A;  4FPB A;  3LM2 A;  3SQ4 A;  4B1Z A;  2GBZ A;  4JKC A;  4ILJ A;  1SL1 A;  3TAB A;  4GMJ B;  1RDC A;  2GTD A;  4ZHR A;  4XH1 A;  1QTM A;  4CJF A;  1ZYQ A;  1NJW A;  4QS9 A;  2HHU A;  5CZ2 A;  5FPE A;  5F0X A;  3OTO K;  4DQI A;  3RR7 A;  3LP0 A;  4N56 A;  2QWQ A;  3H3O B;  1NJZ A;  3THV A;  5EY4 A;  4AHV A;  3L2V A;  4I9Q A;  4ISG A;  5AQK A;  3LPT A;  5E41 A;  1J5E K;  4ILH A;  4CJK A;  3K5M A;  3ULD A;  3W0L A;  1NGA A;  2YHY A;  3I0S A;  2QKK A;  3ENH A;  4RW8 A;  4PL7 A;  5CR4 A;  2QXF A;  4ZTF A;  3QEP A;  3QML A;  3U3G A;  4R79 A;  2YHB A;  4PKG A;  4B9L A;  3N4P A;  4CCH A;  4H0V B;  1RT3 A;  2Q97 A;  4DFJ A;  3HSC A;  5DMR A;  4CZE A;  2GEL A;  3ZSQ A;  3HVR A;  3OYH A;  3SPY A;  5LJW A;  5AQO A;  4IDH A;  4J2E A;  3AVC A;  1HUX A;  3DLB A;  3C94 A;  1CXU A;  1KFD A;  3QB0 A;  4FWR A;  3GG4 A;  3P1G A;  3O80 A;  3VN5 A;  1W7A A;  4E7H A;  5AR0 A;  1HNV A;  3PIO L;  4KBO A;  3SV4 A;  2AP1 A;  1S22 A;  2E8A A;  3OS2 A;  3OYE A;  3LDS A;  1NK9 A;  3O9R A;  1VSF A;  4CZI A;  2E5L K;  4B9T A;  4JI8 K;  3J7Y P;  3K9K A;  3G25 A;  4AM7 A;  4IO8 A;  1FXX A;  3MWT A;  4MO5 A;  3E01 A;  4FJI A;  2QA4 N;  3VQP A;  2Y1I A;  1B92 A;  1DTT A;  4H5T A;  3PV8 A;  2OPP A;  5JS1 A;  4B3M K;  5FRO A;  1N5Y A;  4XH4 A;  3LAM A;  2F8T A;  4CHP A;  1YIJ N;  4F2R A;  2XY6 A;  3E9O A;  1YT3 A;  1HLU A;  4CEZ A;  3RSE B;  3H46 O;  1BUP A;  1FKP A;  2YNF A;  1NU0 A;  3HOS A;  3AAQ A;  3QNO A;  3L4I A;  3O9U A;  1VSJ A;  4CGH A;  3VTI A;  4LC9 B;  4GV9 A;  4WE1 A;  3THW B;  4DSE A;  3I33 A;  4I6M A;  3OW2 M;  5J2N A;  1VQ8 N;  3G10 A;  3NFA A;  5AQV A;  4CEB A;  4E19 A;  2VWK A;  4WCE L;  1WB9 A;  3MMV A;  3MCA B;  2ITG A;  3EKS A;  4FJ8 A;  4HCC A;  3WXL A;  4NLC A;  4HVJ A; 
#chains in the Genus database with same CATH homology
 3WQU A;  1MWK A;  5KPR A;  4PKH A;  2FXU A;  2KLA A;  2P9N A;  2QM1 A;  3QDK A;  3TTF A;  2ZF5 O;  4K41 A;  3T7Z A;  3BF1 A;  2FSK A;  4IEI A;  2ZJP L;  4GV6 A;  5AQH A;  3K9J A;  3VEO A;  1NGI A;  4CZK A;  3MCP A;  2NRW A;  2VYP A;  3EE8 A;  3G71 N;  1VQ5 N;  5CE3 A;  3SMS A;  4IJN A;  1KQS M;  4IEE A;  3TTC A;  3LDP A;  4IWV A;  2DPN A;  4BC3 A;  1LOT B;  2W41 A;  3KVG A;  4H0T B;  1HJO A;  5BN8 A;  1OVY A;  1VQO N;  5E84 A;  3L0Q A;  5M1P A;  4WQ4 C;  3HBT A;  1S72 N;  2FSN A;  1ZBS A;  5M1F A;  1YJ9 N;  4U7B A;  4U67 L;  3VGL A;  3CET A;  1VQ4 N;  2ASO A;  3IUC A;  5BPN A;  3CCS N;  1NGC A;  3H45 C;  4JKG A;  1WUA A;  5HL7 L;  5KQD A;  3F2K A;  3CJ9 A;  3O8M A;  1GLJ O;  4XH5 A;  4B1V A;  1Q18 A;  4IXC A;  5AQP A;  1YAG A;  3ATV A;  3CHW A;  4IO9 L;  1QQM A;  4JK8 A;  5BPL A;  1YUW A;  3Q7B A;  4WQ5 C;  4FWN A;  3VF6 A;  4EIA A;  1HPM A;  1SS6 A;  5MLC Q;  2CH6 A;  4YOV A;  3GDQ A;  3R1X A;  4BR4 A;  4J8F A;  4MDB A;  3S41 A;  1RFQ A;  4BC5 A;  2WFB A;  1VQN N;  5CHI A;  5LJV A;  4DKW A;  2GX9 A;  1BDG A;  2QWN A;  3F9M A;  2CGK A;  2Q1N A;  3EZW A;  2VWB A;  3N4Q A;  5AZJ B;  5I9E B;  4EHU A;  4YOW A;  1NGJ A;  3FZH A;  1V4S A;  3ZET B;  1IG8 A;  3SJH A;  3CCV N;  3O9S A;  1P8Z A;  4YOT A;  4BQL A;  4ILG B;  3MWP A;  3CI5 A;  1RGI A;  1VQ9 N;  4JHD B;  5F2R A;  3LDO A;  4IJA A;  2P9U A;  3L6Q A;  1JCF A;  2A42 A;  5C2F A;  2P9S A;  3DXK A;  1S3X A;  4OPA A;  5DM6 L;  1NBW A;  2NZT A;  2UYT A;  2YJF A;  3P38 A;  3D2E A;  4I6M B;  3R9P A;  1NMD A;  3VGK A;  1DEJ A;  2GWK A;  2P9I A;  1MDU B;  3A5M C;  1K8K B;  3D6R A;  2E1Y A;  3FLC O;  4B1Y B;  3B8A X;  3MX2 A;  3UE5 A;  4CI6 A;  3CCE N;  1GLE G;  2QTD A;  2V7Y A;  5BRD A;  3VEV A;  5GIN A;  3I56 N;  2ITM A;  3SAF A;  4GNI A;  3VEX A;  4JNE A;  4A59 A;  2ZWH A;  5AQR A;  1VQP N;  4A57 A;  3SAH A;  1Y64 A;  2ASM A;  2NRT A;  2VCP A;  4KH6 A;  3U4L A;  3QBW A;  4YOX A;  3DAW A;  5ADX H;  3CCJ N;  1K8A O;  4GY2 B;  4BQZ A;  3NVK A;  2Q2R A;  5C12 A;  3EL2 A;  3AAP A;  2HOE A;  3ULE A;  2FF6 A;  3CCQ N;  5AQL A;  4H5R A;  4K25 A;  5KPT A;  1HX1 A;  3H1V X;  3A5N C;  4K43 A;  4M63 C;  4CZL A;  4A2B A;  4A62 A;  3JS6 A;  4BRO A;  5C15 A;  4DCH A;  3CER A;  5BR9 A;  1TUU A;  3FZL A;  4RCH A;  2A3Z A;  2OAN A;  2Q31 A;  2PFU A;  3WXK A;  3CCM N;  2V51 B;  1NGD A;  4FWM A;  3VGM A;  3O6W A;  1XUP O;  1VQM N;  5AQF A;  1EO1 A;  3A5O C;  4JKG B;  4BRA A;  4BGB A;  2HST A;  4NO7 A;  4BC4 A;  2GUP A;  3MN9 A;  1NLV A;  5AQG A;  1Z05 A;  4WFN L;  4IOA L;  4BGA A;  3P4I A;  5FPN A;  1P90 A;  1X3N A;  4ISF A;  5AQY A;  3D2F A;  2QEX N;  5C0Y A;  3CJB A;  2WC9 A;  2E88 A;  2E2N A;  4MO4 A;  3TTD A;  3KHY A;  1GLB G;  4CZF A;  1Q86 O;  4XEI A;  2IVO A;  1BU6 O;  1ATR A;  2KHO A;  5E26 A;  2P9L A;  4A2A A;  3ID8 A;  1ATN A;  4NLB A;  4BVP A;  3HTV A;  3O1B A;  5H1S Q;  2F7T A;  4H03 B;  1U2V A;  2NRR A;  3A8Y A;  3UKU A;  3U9Z A;  2PBD A;  4BRI A;  2FF3 B;  3FFK B;  2OTJ N;  3NMU A;  2P9U B;  3AGK A;  4IFE A;  1JJ2 M;  3PIP L;  1CZA N;  2P9S B;  2E2P A;  3DXK B;  3KK7 A;  4BR7 A;  4RTF D;  4IOX A;  2I7P A;  4JEP A;  2YHW A;  4FOI A;  3CIP A;  3D2E B;  3M3Z A;  1NGG A;  4BRF A;  5LY3 A;  2A40 A;  3DLL L;  4CZJ A;  1QQO A;  1SQK A;  3C65 A;  3O08 A;  3ZX0 A;  4O8K A;  4OPH A;  4AF1 A;  4H5W A;  1O13 A;  2Q0R A;  3VPZ A;  2CGL A;  3CJA A;  4G9Z A;  1YF5 L;  4QS8 A;  5AFU H;  4BR2 A;  1VQL N;  4FSV A;  5DM7 L;  3WQT A;  5C10 A;  2D4W A;  1IJJ A;  3R8E A;  3D7E O;  1SZ2 A;  5BRH A;  2V52 B;  2JWK A;  3OBY A;  2D0P A;  4JD2 A;  1T3V A;  1HKG A;  1KAY A;  1C0F A;  1HKC A;  5BN9 A;  4CZM A;  1D4X A;  2QWR A;  3QFU A;  5BRF A;  4JKF A;  3ULE B;  5GIO A;  3CC2 N;  4FVU A;  3U8X A;  4K42 A;  3C6A A;  2P9P A;  4YDU A;  3HI0 A;  5AQU A;  3QIC A;  5GAD P;  3QFP A;  3ENO A;  5JVG L;  4JK9 A;  3FZK A;  4FWP A;  2BUP A;  1ESV A;  3LM9 A;  1W97 L;  3ZX2 A;  3CC7 N;  2E1Z A;  4FWL A;  3IFR A;  3WEE A;  3O9Q A;  1NWK A;  3JXU A;  1BOT O;  3PLA A;  1KAZ A;  3F5T A;  3EO3 A;  3P39 A;  3VTH A;  1RDW X;  3CJ7 A;  4EHT A;  2QWP A;  3GBT A;  3E9P A;  4PHT X;  1QVG M;  3CQX A;  4ISE A;  3VMF B;  2NLX A;  3L4Q A;  4CZH A;  1Q81 O;  2CGJ A;  2HBL A;  1E4F T;  4JKE A;  5AZI A;  2ZJQ L;  2BTF A;  4KH4 A;  4A5A A;  2AA4 A;  1K9M O;  5AQW A;  4WFB L;  1Z6R A;  4MDA A;  4H5V A;  3QBX A;  4Z94 A;  2QWM A;  4FL9 A;  1NGH A;  3D2F B;  1W2B M;  4BRK A;  2E20 A;  3LDL A;  3O4W A;  4EAH D;  5JIC A;  4QS7 A;  4M7Y A;  2NNW A;  3VEZ A;  3KWI A;  3E66 A;  3ZEU A;  2YI1 A;  1ATS A;  4CJ7 A;  3CPW M;  1VQK N;  5AQN A;  4IOC L;  5AQM A;  4YDU C;  4Y0W A;  2QI2 A;  3BF3 A;  3G4S N;  1QQN A;  2HBJ A;  4YOY A;  3FR0 A;  4FWO A;  3DWL A;  3NVM A;  4JAX A;  4BRP A;  2P9L B;  5M1O A;  2EWS A;  1XQS C;  3GL1 A;  4BG8 A;  2OTL N;  2NRZ A;  1N8R O;  2P9N B;  3E9L A;  3UKU B;  1U2V B;  5GAH P;  4BC2 A;  5EX5 A;  5GIP A;  3HOT A;  2QXL A;  3UB5 A;  4CBW A;  1YJW N;  1VQ6 N;  2GWJ A;  3O9T A;  4EFH A;  1TUY A;  1BO5 O;  3G6E N;  4BVO A;  1C0G A;  5F1X A;  4GVE A;  3I8B A;  3MK6 A;  3VES A;  2IIR A;  4WFA L;  4O5F A;  1WOQ A;  3SAG A;  1R59 O;  3CD6 N;  1ZC6 A;  3KWG A;  1KAX A;  4F9O A;  4BY9 C;  2F9T A;  2WUS A;  3ID6 A;  3CXC M;  2HBK A;  4FO0 A;  5JVH L;  3CME N;  2YX6 A;  2JWL A;  4CD3 A;  3MDQ A;  3EN9 A;  1Q82 O;  1G99 A;  3VEY A;  1NGE A;  3C0B A;  4JD2 B;  5AQQ A;  3WXI A;  4WYB A;  1KC8 O;  3AGR A;  5C2D A;  3P31 A;  2NRX A;  4H0P A;  2ASP A;  3ZYY X;  2HF3 A;  2YCH A;  1Q7Y O;  1QZ6 A;  2P9P B;  4YOU A;  1HKB A;  1H1V A;  3C7N A;  3VF2 A;  4FWS A;  2RHK A;  3RVC A;  4A5B A;  2GEM A;  4B9Q A;  2ZGY A;  5JLF A;  4CZG A;  3I55 N;  4FWQ A;  2QWO A;  3A0I X;  4CBU A;  3CPE A;  3BEX A;  4B1U B;  3IKM A;  1T44 A;  3WEE B;  4BG9 A;  3LDQ A;  1GLL O;  2D0O A;  2CH5 A;  3WXJ A;  1BA0 A;  1OKJ A;  3R6M A;  2W40 A;  1DGK N;  3WUH A;  1VQ7 N;  4JN4 A;  2ZGZ A;  2A6A A;  3VF4 A;  1JCG A;  2ZJR L;  3VOV A;  1QVF M;  3MX5 A;  5AZI B;  1TYQ A;  2FSJ A;  3FE1 A;  3TSQ A;  4C1N I;  1X3M A;  3CMA N;  3H1Q A;  4UY8 O;  4BRN A;  1SAZ A;  3GOI A;  1XC3 A;  5TKW A;  2RE2 A;  3GE1 A;  1NJI O;  1YHQ N;  3O1W A;  1QZ5 A;  2P9I B;  5KQ8 A;  4FPB A;  3ZEU B;  4L3Q A;  5AQJ A;  2KKZ A;  3FZM A;  3LM2 A;  2P9K A;  3OA9 A;  4B1Z A;  4OO1 J;  1NGF A;  4JKC A;  4ILJ A;  5GAG P;  5JMV A;  1YI2 N;  2GTD A;  4XH1 A;  1QHA A;  3DJC A;  4WQ5 A;  4JK7 A;  3AAR A;  5GAE P;  4QS9 A;  2Q0U A;  3MN6 A;  3ATU A;  2NRV A;  3DXM A;  3MN5 A;  5F0X A;  5FPE A;  2QWQ A;  3CCL N;  3Q7C A;  3H3O B;  3VEW A;  4KH5 A;  5EY4 A;  1GLF O;  2IVN A;  3A5L C;  3UKR A;  3CJC A;  5KPZ A;  4ISG A;  4JKD A;  5AQK A;  3C6H A;  4ILH A;  2YJE A;  4JKA A;  3VET A;  2Q36 A;  3W0L A;  1NGA A;  2A41 A;  2YHY A;  4PL8 A;  3ENH A;  5EOY A;  3RSE A;  2J4R A;  2HBM A;  2QW9 A;  4JKB A;  5AQX A;  3CF5 L;  3T69 A;  5AFU A;  3EKU A;  4PL7 A;  5CR4 A;  5M1N A;  2HMP A;  2I7N A;  5JLH A;  4PKI A;  3QML A;  4R79 A;  5HOO A;  4E1J A;  4PKG A;  4BRQ A;  1V4T A;  3M5R A;  5ELZ A;  4BR0 A;  3U9D A;  1YJN N;  3N4P A;  3M6G A;  3R3L A;  4FPA A;  3H6E A;  4H0V B;  2Q97 A;  4C23 A;  2BH1 A;  3CCR N;  4HWI A;  2F9W A;  2V7Z A;  3HSC A;  4CZE A;  1J6Z A;  2E2Q A;  2VGM A;  1VAZ A;  2GEL A;  3C7N B;  2E2O A;  5LJW A;  5AQO A;  4IDH A;  4HTL A;  2IVP A;  4C1N K;  4DB3 A;  1HUX A;  3EE9 A;  1MWM A;  3BUZ B;  5B8H A;  3QB0 A;  3IDH A;  3GG4 A;  4FWR A;  5M1Q A;  5FPD A;  3O80 A;  1T6C A;  1E4G T;  4B1X B;  1U6Z A;  4WF9 L;  3SK3 A;  3OHR A;  5AR0 A;  3ZX3 A;  4BRH A;  1DKG D;  3PIO L;  1ILY A;  3MN7 A;  4BRG A;  4DQ8 A;  1TYQ B;  4KBO A;  2AP1 A;  1S22 A;  3TSU A;  1K73 O;  5EVZ A;  2E8A A;  1BG3 A;  2FLO A;  3TPQ A;  1RDU A;  2WBN A;  1T6D A;  3TU5 A;  1MA9 B;  4MLE A;  3O9R A;  3OBW A;  3HZ6 A;  1GLD G;  5AQT A;  4CZI A;  3O5B A;  1NGB A;  4FWK A;  3WXM B;  1YVN A;  2D1K A;  1M90 O;  1BA1 A;  3K9K A;  3M1F A;  1LCU A;  3LL3 A;  3G25 A;  4AM7 A;  2P9K B;  4IO8 A;  3SMP A;  4H0Y B;  3WT0 A;  3MWT A;  2QWL A;  4MO5 A;  3CJ1 A;  2H3G X;  5BPM A;  4RWT A;  2HF4 A;  1KXP A;  3SBG A;  4BRD A;  2QA4 N;  5AQI A;  5ADX A;  1ZXO A;  3DXM B;  5M1K A;  1NM1 A;  4H5T A;  3CC4 N;  2YHX A;  3KZB A;  4FOE A;  4H5N A;  3UKR B;  4XH4 A;  1GLA G;  2A5X A;  1M1K O;  4NB4 A;  3ENB A;  3VEN A;  2NRH A;  1YIJ N;  1DT9 A;  3HRG A;  3IMX A;  3LDN A;  4BRC A;  3E9O A;  1YXQ A;  5TKY A;  1HLU A;  5AZJ A;  4H0O A;  1YIT N;  3RSE B;  3SBT A;  4CD1 A;  3H46 O;  3J8A A;  1BUP A;  3BP8 A;  4YOR A;  3ZET A;  2VGN A;  3SLC A;  4A61 A;  3HM8 A;  4AM6 A;  4DHY A;  3AAQ A;  3HOS A;  5BRE A;  3L4I A;  4H0X B;  3O9U A;  4MLH A;  5AQS A;  4BRM A;  4JHD A;  3W3D A;  4BRE A;  3H3N O;  3VTI A;  4LC9 B;  4GV9 A;  4CBX A;  3J7Z O;  4WQ4 A;  4O8U A;  2PAV A;  3I33 A;  4M7X A;  4BR5 A;  4I6M A;  1BWF O;  5EXW A;  3OW2 M;  3VER A;  4B1W B;  1VQ8 N;  5AQV A;  1JCE A;  3FGU A;  4WCE L;  3FZF A;  3CCU N;  1K8K A;  4BR9 A;  1GLC G;  3MMV A;  3TSP A;  4GV3 A;  3CQY A;  1KD1 O;  3MCA B;  4BRL A;  1EQY A;  3EKS A;  3AY9 A;  1X9J A;  5AQZ A;  3WXL A;  4JKH A;  3E1Y A;  4NLC A;  5FPM A;  4IZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...