2ZJRL

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2zjrL01
1YITN 1ILYA 2ZJPL 1VQ8N 5MLCQ 5JVHL 1NJIO 3CMAN 4U67L 1VQ7N 3CCEN 2OTJN 1KD1O 1VQKN 1K73O 4WFAL 5GADP 3CCLN 1Q81O 3PIOL 3DLLL 3G4SN 3CCJN 1YHQN 3CD6N 4WF9L 3CXCM 4WFBL 1Q86O 1KC8O 1JJ2M 3G6EN 3CPWM 4WFNL 5DM7L 3CF5L 1VQ6N 5GAEP 3I55N 1N8RO 5JVGL 2ZJQL 1VQPN 3CCRN 3CC2N 3CMEN 4IOAL 1YI2N 3CCVN 2QEXN 1KQSM 1W2BM 3CCMN 1K9MO 2OTLN 1S72N 5HL7L 1Q82O 1YJNN 1VQ9N 1QVGM 2QA4N 1VQ5N 4IOCL 3OW2M 2ZJRL 5DM6L 3CCUN 1OVYA 1K8AO 1VQ4N 5H1SQ 1YJ9N 1YIJN 3J7ZO 1VQNN 3G71N 3I56N 1VQMN 1VQLN 3CCSN 4UY8O 5GAHP 1M90O 1M1KO 4WCEL 5GAGP 3CC4N 3CCQN 1VQON 3PIPL 1Q7YO 1QVFM 4IO9L 1YJWN 3CC7N
chains in the Genus database with same CATH superfamily
4GV9A 2YNHA 1EXQA 1RBTA 1RT3A 3J8AA 2P51A 3WXJA 4CBXA 4B1ZA 4JI0K 1HYZA 4BWJA 3AVNA 3L2UA 5E26A 4DQQA 1NJIO 2D0BA 3QB0A 5FPNA 2YHBA 2JLEA 4OGCA 3ZCMA 4DTOA 4KHYA 4M3TA 2O8FB 4DR6K 3C65A 1L3UA 4WFAL 2HHQA 1BU6O 1S1WA 3UKRB 3PIOL 3HPGA 1SKSA 4EP4A 4DTNA 3C6TA 2QKBA 2HW3A 4I2QA 1G15A 3ZSOA 2JWKA 3D0PA 4DV1K 4RW6A 5DK5A 3FR0A 5DM7L 1KFSA 3HM8A 1KRPA 2EWSA 4AHSA 4AHTA 2QKKA 3D2FA 3WXLA 4AM6A 3O08A 1BI4A 3VQPA 1WSGA 4IFYA 3NCIA 3CMEN 4JRQA 1C0TA 4JD2B 3LALA 5JS1A 4CCHA 4FWMA 1GOBA 3JXUA 2A6AA 1TKXA 3SMPA 1VHXA 1NWKA 4X65K 1GOCA 4KHQA 5HL7L 1BOTO 4EIAA 4KB1A 2RN2A 2AJQA 3CJ9A 1W97L 3VTHA 3QEVA 2YNFA 2CGLA 4DR1K 2GX9A 1WSEA 4DUYK 4HTUA 4WYBA 1NG9A 3FZHA 2P9PA 3PSFA 5J1EA 2A42A 4NCAA 3EL2A 3OYKA 3CJAA 3O4QA 3ID8A 1JLAA 2GWKA 4BR2A 1HX1A 2KW4A 1JLGA 3OY9A 2RF2A 2Z1JA 3L2VA 5EVZA 3M1FA 2Q0RA 3OYEA 4BC5A 1M1KO 1EWQA 3T1HK 1RT7A 5GAGP 1NGCA 2YHYA 1SKRA 3ZSRA 4JKGA 3EKUA 4DTSA 1Y64A 2VWBA 3CPEA 2YHXA 2OPQA 4GKJK 1CZ9A 3IAYA 4CEAA 2PFUA 4W5OA 4IZ9A 4CJVA 2YCHA 4FJ9A 5HRSA 3DM2A 5KPZA 5M1KA 1KAYA 3IMXA 1NGFA 3RVCA 3WUHA 1SV5A 3IKMA 3O9RA 1ASVA 3H6EA 5CZ1A 3KLIA 5HRNA 1HKCA 3FZLA 1T8EA 3TSPA 2XY6A 3QFPA 1SQKA 5GADP 3VQ5A 3DXKB 5AQSA 4YFUA 2O8CB 3A0IX 3HRGA 5AQWA 3IG1A 4WFNL 1V4SA 1RBSA 4CIEA 1BCOA 2ETJA 4EP5A 4CFBA 5J2NA 4CW7B 4DR4K 1BGXT 1NKBA 4PL8A 2GEMA 5KPRA 1N5YA 4JKDA 3VGLA 4B9LA 2W6LA 3AGKA 3ZT0A 1RT2A 4QS9A 2BE2A 4F9OA 5C15A 4E0DA 2DPNA 4FL9A 4LF5K 1WAFA 1VSIA 5GINA 1KFDA 3D2EB 4J2EA 3RMCA 3HPHA 4C23A 3SQ1A 4MO5A 2HHHK 1C6VA 2OYQA 1U48A 4CJSA 4CEFA 4GVEA 4RW8A 3OYBA 4DSFA 4Z4EA 3ATVA 3BDPA 4KREA 3OBYA 4FJHA 4M3ZA 2FF6A 3HOSA 2P9KB 4MQ3A 1JXBA 4CJ5A 3HBTA 3OYHA 4E19A 4M7XA 1X1PA 3ZT2A 1YIJN 3AVLA 4Y0WA 1OH5A 3M8PA 3RR7A 1TVRA 1LV5A 2XO7A 4HCCA 5B8HA 3A2FA 1ASWA 3K5OA 3EZWA 4B9TA 3R6MA 4F3OA 4ILGB 5AZJA 4PL7A 5FPEA 1HYVA 3THYA 4IEIA 3CCQN 4W5TA 4BE2A 4OX9K 1RT4A 5J2PA 3QNNA 2YX6A 3K9JA 1WN7A 2YKNA 3NVMA 1J53A 4M3UA 5JMVA 4O8KA 3DLHA 3O9QA 3ZSZA 1VQ8N 3B6OA 4BGBA 4A59A 4PQUA 4FWPA 3BUZB 4ISGA 4U67L 4X64K 4HHTA 1SS6A 3KKSA 4CF9A 1BUPA 4A57A 3HL8A 4CE9A 4FJ8A 4E7IA 3SCXA 2FSJA 3T69A 2FBTA 1YHQN 1DTTA 1ZBUA 5BN8A 3ALYA 4CZEA 3V4IA 1GLBG 3QEXA 4BVPA 2YJFA 3SBTA 3O9SA 1YT3A 2VWJA 4FWSA 2G8IA 5HOOA 4CI6A 3O5BA 3CERA 3BY5A 3RTVA 4RTFD 3IRXA 4IEEA 3UKRA 4DV6K 1VSDA 4KRFA 3E9PA 3E01A 2DTUA 4YORA 4RG8A 4CJ3A 1HQUA 1YXQA 4H5VA 1TKTA 4B9VA 4CD1A 4C8MA 4AH9A 2F9WA 4JLHA 3KIOA 3CCUN 4DTUA 1MU2A 2FBVA 1JCGA 2PYLA 2HF4A 5BREA 1B9DA 4M63C 1A5VA 4JI7K 3V1QA 2WC9A 4DFKA 3HTVA 4XH5A 3OYNA 4UY8O 4LF6K 3SNNA 2UXDK 1NBWA 3THXB 3QFUA 3VQDA 3UKUA 3RR8A 5KQ8A 2HMIA 4WE1A 5C10A 1JCEA 4CJFA 1VQON 4GMJB 3M5RA 1Q7YO 5I42A 2Z1IA 4LF9K 4E1NA 4ICLA 3V9ZA 1S6QA 1LWEA 2V51B 1L3TA 2X6SA 3VEOA 1GLAG 5KGWA 3SPYA 2DY4A 4DTRA 1N6QA 4O0IA 1X9MA 3P5JA 1HNVA 5K14A 1BIUA 4IWVA 3KK7A 3MN7A 3AO5A 4YOTA 1NOZA 5F2RA 3CETA 1K73O 2E6MA 4FM2A 3VN5A 3ULDA 1T3VA 5CYMA 3LANA 1TV6A 4WQ5C 3HSTB 3ZX3A 1L3VA 3JYTA 3HP6A 3H3NO 5AQPA 4BRPA 3LZJA 4JI6K 4H5RA 3G6EN 3VF6A 3SUQA 4J2AA 3KLEA 1N8RO 4DSIA 2ZJQL 1VQPN 2Y1IA 3CYMA 5AQLA 5HLFA 1NGDA 4FO0A 3CC2N 4KHPK 1KVCA 4IDKA 4NB4A 1ATRA 1RGIA 1OKJA 3O4WA 3VGMA 3ZSQA 2QI2A 4HUEA 4A5AA 4KTWA 2QA4N 5M1OA 2EX3A 3TR8A 3OTOK 3LAMA 4LFCK 4NLCA 1VSMA 5EX5A 1NK0A 2WTUA 2O4GA 3ZETB 4FJKA 2VGMA 2HSTA 1K6YA 2YI1A 4Q5VA 1B92A 2OANA 3P1GA 4CF8A 4RW9A 1NMDA 3NE6A 4DR3K 5FRMA 3KK1A 4FLVA 1J5EK 4NXNK 1MWMA 1NGEA 1G99A 3H1VX 4BRIA 1N33K 4NO7A 3ZEUA 3J80O 2EHGA 2GV9A 4CHPA 1RBUA 4LF7K 4DG1A 1RDDA 3K0SA 4JS5A 5AQOA 4ZTJA 1YITN 4B1XB 5AFUH 2FXUA 2E2OA 5BPMA 4QOZB 4H4MA 1U6ZA 3GDQA 2P9SA 4M41A 5M1NA 4H5NA 3V6DA 3U6FA 3TAGA 1XNQK 3MECA 3TABA 4BG9A 4DB3A 5D3GA 1KAXA 3SAGA 3MX5A 5AQKA 4BRNA 3ZSXA 1BCMA 4MO4A 1WNSA 3OYLA 4IG3A 1EETA 3DLLL 4K42A 2YJEA 2CGJA 3HOTA 3S3MA 4B1UB 5JLHA 5BRDA 4WFBL 2O8DA 3OYDA 4BRLA 5CHIA 2P9UB 4I6MA 1C0UA 3PX6A 3M8SA 1VSKA 3VQ6A 2KQ2A 4PA1A 5EXWA 3TWHA 3BEXA 4JYAK 3QIPA 4RW7A 3V9SA 3O3HA 1XWLA 1CZBA 3NGZA 4A5BA 1S3XA 4HTLA 4GVMA 1VQ5N 2UU9K 2QXLA 2IVPA 3LZIA 3ZLJA 3DMJA 1NMNA 3DLGA 5CY4A 4YOWA 4DV7K 5AQGA 2ZJRL 4L3QA 1TK0A 5AQTA 3SQ4A 3F9KA 2G8KA 4DLGA 1NGAA 3PSIA 3ZSWA 5AFUA 1QZ5A 1VQMN 4DF8A 3QBXA 1VQLN 2HF3A 4ID5A 3FFKB 3WQTA 5SWMA 4DTMA 2NRHA 4B3RK 1ZBSA 4CF1A 2HNZA 4YNQA 3CM6A 1Q18A 2IOCA 1WB9A 2OZMA 2YHAA 4FJXA 3AA5X 1UWBA 4EZ6A 4JHDA 1TKZA 3WXKA 4FM1A 2HNDA 2V7ZA 3VQ4A 1E4GT 3A5LC 2P9NA 1VSEA 4AF1A 2VG7A 4CJPA 1K8KA 5JVHL 4GW6A 1W7AA 4DQPA 1IH7A 4BR9A 1U2VB 3RRGA 4M3WA 1VQ7N 2H3GX 4FWOA 4B1VA 1KLNA 2KZMA 1HJRA 2FLOA 4EHTA 3OYJA 1RBVA 3G4SN 4TSXA 2D0AA 1IBMK 4KFBA 4U7BA 4CJWA 4CFCA 3PV8A 3EYZA 1VSJA 3TTCA 1BQMA 1KC8O 5EU7A 1RDWX 1BA1A 2Z1HA 4CJEA 4DFJA 2GUPA 4CJTA 2Q36A 4G9ZA 2UXBK 1HUXA 1JLCA 3CHWA 4YOYA 4ILJA 1P8ZA 4HUFA 3SUPA 2BUPA 3BGRA 3B6PA 2P9PB 5TKYA 4KI6A 2D0CA 4JKAA 4JK8A 2HVHA 4BRCA 1TK8A 4FWNA 1WSJA 4KTZA 4KH6A 3PO4A 1TL1A 2O8CA 1EX4A 2QEXN 1QZ6A 4CEEA 4JK7A 4O8UA 2HHSA 4BGAA 5KTQA 2JWLA 3CG7A 2E20A 2WFBA 2QWLA 3ASMA 3VQ9A 1VQ9N 1QVGM 4BRGA 1KTQA 4KO0A 1IKWA 1GOAA 3PO5A 3NVKA 1BI4B 3BZCA 2E1YA 3G0ZA 3GOIA 1ZBHA 1HNXK 3MWTA 1RDUA 4CHQA 4FWQA 1IO2A 1D4XA 1U04A 4H5TA 4IFEA 4E7JA 2QTDA 2PBDA 4BG8A 2Q3SA 2YNGA 3KJVA 4FYDA 3GBTA 1HPMA 1TL3A 3P39A 4DV5K 3OBWA 3F73A 1YTAA 3OA9A 4CJQA 3RWUA 2D4WA 3VA3A 1CXUA 2B4JA 1ZBLA 2O8FA 2KFNA 3L2WA 4K41A 1RCHA 3ULEA 4PKGA 4DTPA 4OKJA 1YVUA 3VQ8A 4H4OA 5ADXA 4F2SA 4GKKK 1ATNA 1HPZA 4KHUA 3CFPA 2PAVA 3WQUA 2UUBK 2P9NB 1J9AA 4G1QA 2XY7A 3WNGA 3EN9A 3HZ6A 2UYTA 1L3SA 3ZEUB 1BA0A 2BDPA 1Z26A 3AA4A 1Q81O 4MLEA 4DWIA 3U3YA 4FWKA 4CIFA 1WSFA 1DGKN 3DWLA 4CEOA 3TAMA 3DLBA 5EOYA 1N36K 2A1SA 1REVA 2O4IA 4K43A 3WNHA 1MA9B 3I55N 3M3ZA 3MMVA 1Z6RA 2HBKA 3KLGA 1C0GA 3SBGA 5KPTA 4JAXA 3OJSA 2HNYA 3DRPA 4C8NA 3AA3A 4AQYK 4XH1A 3TSQA 2YV0X 3LL3A 3VQ7A 4AHVA 3L6QA 1K9MO 4DLEA 3J7AP 1Q82O 2P9IB 4IJAA 1TGOA 2NRZA 4IOXA 3L3VA 3LDPA 3OS1A 2UXCK 1QQNA 4B1YB 4CK3A 3L0QA 4MLHA 3AVIA 2KKZA 3NGIA 5EY4A 3TAPA 2UUAK 3TPQA 2NRVA 4RCHA 3TSUA 1YAGA 2VGNA 3ENOA 3NAEA 3NH0A 3I0SA 1RTIA 4FLWA 4E3SA 2KLAA 3C6AA 4F3TA 2E4LA 4W5NA 1CLQA 3G71N 2ZQBA 2VQFK 5AZJB 3FZFA 4R79A 1SL0A 5GAHP 1M90O 3ZETA 1WUAA 4EAHD 4ZTFA 3M8QA 2VG5A 2QWOA 3VEVA 4MDAA 3MK6A 4BC2A 4JI3K 1XMOK 1HKBA 4IBNA 3G10A 4Z4FA 4F2RA 2P9KA 1NJZA 4H0VB 4YDUA 5AQUA 1LWFA 3M6GA 2QK9A 1LWCA 1FK9A 1NM1A 4FJLA 3IS9A 1WBBA 2NZTA 3M8RA 2GTDA 3K5NA 1IBKK 3LPUA 3KK2A 2Q97A 1XHXA 2BH1A 1TYQA 4LFAK 3V9UA 4DV0K 1T6DA 1TYQB 3F9MA 4CF2A 2HVIA 4PKIA 3G25A 3CF5L 1NGBA 4ISEA 1TKDA 3EEQA 4FVUA 3NGYA 4CJ7A 5KRTA 3J81O 5BN9A 1X9JA 3L2QA 3HP9A 4BQLA 3CI5A 3AVFA 1JL1A 5M1PA 1YF5L 2CGKA 4FJGA 3ENHA 1HQEA 4B9QA 3T19A 4CHOA 1O1WA 1B9FA 4KPYA 1QHAA 1A5WA 2E2NA 4JNEA 4BC3A 4IOCL 3KKRA 3OW2M 3DLRA 4CHZA 3R3LA 4BROA 1K8AO 2I7NA 1P90A 3VQCA 3SMSA 3ATUA 1YJ9N 1WSHA 4A62A 4DR5K 4BRDA 2E1ZA 3OHRA 1DKGD 2RHKA 5FPDA 1DLOA 2WBNA 3SQ0A 3VOVA 3O1BA 1R59O 5C0YA 5AQZA 4KBOA 4BACA 4A61A 3C6HA 1I39A 1C0MA 3C95A 4B9MA 3CC4N 1YVNA 4WQ4A 3AAPA 4CIGA 4CEZA 4YHHK 3QETA 4M42A 4DQSA 1EWRA 1GLLO 3JS6A 5AZIA 2KFZA 3E9OA 2DFEA 4B3SK 1KCFA 5GIOA 5C12A 1A5XA 4LSLA 5HRRA 3A5OC 1L5UA 4FSVA 4C1NK 4CESA 3EKSA 4JHDB 2G8WA 2E2QA 3EE9A 3HVTA 4KB0A 3LDQA 3ISNC 3MXJA 4JKGB 3E9LA 4O55A 4YOXA 1KVBA 1RDCA 3OYIA 3OYMA 3LP1A 1Q86O 2B5JA 5AQRA 1UA1A 4LH4A 4B3TK 1RDBA 3HSCA 3DOKA 1NJXA 1IKYA 1I3AA 1OH7A 3FZMA 3THVA 3GE1A 5AR0A 1XC3A 3I33A 3NFAA 1YI2N 3VGKA 3KLHA 4YOUA 3WXMB 3EY1A 1W2BM 5ELZA 1JKHA 4JV5K 4BRKA 4OKEA 4CJRA 5JS2A 1GLFO 1HNIA 1QS4A 1NGIA 4QS7A 4ZHRA 3FGUA 5HROA 3KD5E 4BRAA 3AGRA 1RT6A 3P38A 5LMNK 1NJWA 3PX4A 3SYZA 4DSEA 1S1VA 4EHUA 4LD0A 1BQNA 4B9UA 4O0JA 5BR9A 4DV3K 2ZGYA 4LC9B 5CR4A 3J7ZO 3BZKA 3UB5A 3O1WA 4FJ7A 1FXXA 4DF4A 3VERA 3LWMA 3O3FA 3LAKA 3QBWA 4M45A 2P9UA 5C2FA 2ITGA 2NRWA 4YY3K 3OJUA 1ZXOA 4JK9A 3BP8A 4C1NI 3GL1A 3ZSYA 1IKXA 3VEXA 4NXMK 1YTUA 1S22A 1Z25A 1NGGA 4FZZA 1HYSA 1NK6A 3SI6A 4BRFA 3S9HA 1MDUB 1XHZA 4DR2K 4DFMA 3AO4A 1GLJO 3AVBA 3HJFA 3QO9A 4JI8K 3N4QA 1ESVA 5HBMA 3AY9A 3H1QA 3VEYA 1OVQA 1VQKN 3MXMA 3W0LA 4HUGA 3U9ZA 3SAHA 1TAQA 2WONA 3MN9A 1RT1A 5CYQA 2PZSA 2NNWA 1F21A 1VSHA 4FK0A 4IO8A 4JRPA 2NRTA 4J8FA 3EZ5A 3QLHA 5ADXH 4ID1A 1X9SA 3DXKA 5BRFA 4Z4GA 3MCPA 1Q8IA 2X6NA 2A5XA 1T03A 4LSNA 3CCRN 2HHWA 4BC4A 4QS8A 1XMQK 1Q9YA 3PX0A 3OVNA 1JLFA 2W40A 2FBYA 2OTLN 1RTDA 3HK2A 4OPAA 4J2DA 3CQYA 3K9KA 1XC9A 4IXCA 3ZSVA 1X3NA 3AVAA 4K25A 1VK0A 3AVGA 3B8AX 3C0BA 4PUOA 4DV2K 3QICA 3VENA 1GLCG 4CJLA 2FF3B 3D7EO 1OVYA 4LH5A 4FLTA 4CJKA 1RT5A 2ATQA 2O8BB 1TK5A 3R9PA 3D45A 1LAVA 1XUPO 3O3GA 4FJ5A 1GLEG 4Z4IA 5F0XA 4DV4K 4A2BA 3MWPA 4I2PA 5KI6A 1BO5O 3WEEA 4CD3A 5DMRA 4KV8A 4CZKA 4WQ4C 4JI2K 3LDNA 3TAFA 1D8YA 4C8LA 2PY5A 4BRHA 2O8EB 3CJ1A 3HPOA 5J2QA 1VSFA 5A2QO 1QQCA 4DQ8A 2ASOA 3MN5A 2X78A 3ZX2A 2Y1JA 3CC7N 4H0PA 1S9GA 4QAGA 4IDHA 4K0KK 3NF6A 1EQYA 5C2DA 4I9QA 2WOMA 4B3MK 1S1XA 5C25A 3KZBA 4A2AA 4FJMA 2OPRA 4FW2A 4CFDA 2D0PA 2A40A 3SK3A 3L2RA 3QNOA 3EO3A 3AVJA 3THWA 4F4KA 4CZIA 1CXQA 5M1FA 1SL1A 1T7PA 3H08A 3FE1A 4DR7K 3O6WA 1QQOA 2J4RA 2NLXA 4Z4HA 4N41A 1NK8A 3K5MA 3DLEA 3TAEA 4UQGA 4XEIA 3CCJN 3BF3A 4BR7A 5LJVA 4WF9L 3CXCM 5LL6Z 4DTXA 4DU1A 2ASMA 4GNIA 5JICA 3THXA 1XQSC 4BDZA 3VF2A 1E4FT 1ATSA 1WOQA 4YOVA 3TI0A 4EFHA 4CF0A 1XNRK 2QWRA 2F9TA 1C1CA 1H1VA 4MDBA 3ID6A 4E1MA 3KK3A 3QERA 1BWFO 1KVAA 3P31A 4ISFA 5CE3A 4I7FA 2O8DB 4BREA 4DS4A 3LDLA 4IOAL 2QXFA 3K2PA 3AA2A 3LPTA 3F5TA 4O4GA 1SZ2A 4BDYA 1KAZA 4CECA 4JKHA 1YJNN 4CHNA 3I8DA 3NHGA 5AQHA 3NF9A 3THYB 4F8RA 2QM1A 2ITMA 4DFPA 4XH4A 5FDLA 3P4IA 3QEPA 1X9WA 4KHNA 2UUCK 2IAJA 4KKOA 4DKWA 3VTIA 4B9NA 3CQ8A 3CCSN 2D0OA 3VESA 2HOEA 1W0HA 1DEJA 4CZHA 4WCEL 3TTFA 4DU3A 5IWAK 3OYAA 1NK9A 2VCPA 2A41A 2W6KA 4E7KA 4JI5K 3F2KA 5BR8K 1U47A 4NLBA 3CFRA 3SV4A 1ZBIA 3DAWA 3KWIA 1ILYA 4NYFA 3ZX0A 1FKOA 4X66K 5J2MA 3N4PA 5MLCQ 1HNZK 4AILC 2I7PA 4CGIA 1BDGA 4ILHA 3MN6A 2VWKA 1OH6A 2OTJN 1U49A 3HT3A 1RILA 1D5AA 1RBRA 3FZKA 4E7LA 2NUBA 4JI1K 3CCLN 4Y1DA 3UKUB 1SAZA 3SUNA 1U45A 1HJOA 2AA4A 1NK7A 2XY8A 3NMUA 2KTQA 4DSKA 4JI4K 4KTQA 4I9LA 2HMPA 5HP1A 3PY8A 1N32K 3HVRA 5FRNA 5GAEP 4FCYA 5I3UA 3LM9A 1WBDA 1RNHA 4OGEA 5KGXA 2VYPA 2HHXA 1S6PA 2HB5A 3SPZA 2JGUA 4H0TB 3AV9A 2FSNA 4B8AB 3K58A 2V52B 2P9IA 4MFBA 4O44A 4M3YA 1NK5A 3WT0A 4PHTX 3S3OA 5I9EB 2BTFA 4FOEA 2W41A 1NNEA 4IJNA 5AQJA 4Y1CA 3ENBA 3VF4A 3V1OA 1WAJA 3P83D 4Z0UA 3I8BA 3TANA 1NLVA 4Z94A 4M3RA 4BR0A 3TARA 1QQMA 2OZSA 1S9EA 3MX2A 1VQNN 2I5JA 4GV3A 2LSNA 3I56N 4FPAA 1FJGK 3H3OB 4GY2B 2RPIA 3RSEB 1V4TA 5C42A 4DCHA 2P9LB 1RTJA 4CJ4A 2CH6A 4K8XA 2OA8A 4AM7A 5AQXA 3HM9A 3L4QA 3T1YK 5KQDA 1C1AA 3A5MC 3KHYA 3CM5A 3DXMA 1YJWN 3R1XA 3FFIA 1W9HA 2R7YA 5LMUK 3KLFA 5AQMA 3SJHA 2IVNA 4E1JA 5AJ3K 4PKHA 1LOTB 3CMAN 3HI0A 2Q0UA 2G8VA 3AVMA 4LF4K 1ZBFA 1HLUA 4BR5A 1UAXA 3I0RA 3SLCA 3V9WA 3ZT4A 2BANA 3QMLA 2DFFA 3QINA 1J54A 3C6UA 5AQFA 4CHYA 5FLXO 4O5FA 3CD6N 3RRHA 2HBJA 3RSEA 5BRHA 3AVCA 3OYGA 2Q31A 3VPZA 1I94K 2IGIA 3HO1A 3SJJA 2HBMA 1J6ZA 4DUZK 1SUQA 1JXEA 4JEPA 3L8BA 3KD1E 1TAUA 4RWTA 2GELA 3ZYYX 4OO1J 4CJUA 4W5QA 1QTMA 4H8KA 1OH8A 3MEEA 2GWJA 2W42A 4IFVA 3SUOA 4FOIA 3A8YA 4OPHA 5GIPA 1RTHA 2GBZA 3CFOA 3H45C 1Z05A 3ULEB 3AVKA 3NBPA 4FWRA 3D2EA 1NGJA 3V81A 1IV0A 3OYCA 5AQVA 1UOCA 4BWMA 4FLZA 5SZTA 4CZFA 5DM6L 1ITGA 4Z4CA 1DT9A 2A1RA 3JAMO 1HR0K 1Y97A 2XRIA 4OPJA 4FZYA 1S5JA 4CGJA 2V7YA 4FM0A 4YDUC 3VQBA 2ZD1A 1NGHA 3IUCA 4OVLA 1BL3A 5IT9O 3R8EA 1IG8A 2QW9A 1TUUA 3WNEA 1JLBA 3VQEA 3D2FB 4CGDA 2FC0A 4M3XA 4I6MB 1QSYA 1C1BA 2D5RA 3LM2A 1N34K 2OCEA 3C94A 1J5OA 3QIOA 4DTJA 1EKEA 1HMVA 1DTQA 2HHTA 2P5OA 2HHUA 1QSLA 4KH5A 1HKGA 2G8FA 4FXDA 2NRXA 2E8AA 5HRPA 3SV3A 4DQRA 4E89A 4DU4A 1EP4A 5F1XA 3E66A 4OPKA 3J7YP 3DI6A 3VQAA 4Q0BA 3IDHA 3UIQA 3WNFA 2ASPA 3AO2A 1HNWK 5AZIB 3A5NC 3CCEN 4NYNA 3BF1A 1C0FA 4NCGA 3V1RA 4CVNE 4KHWA 4CGHA 1JLEA 4KHSA 3DXMB 4H5WA 4FW1A 1JCFA 4CZLA 4OLBA 4DMNA 3LP0A 1JL2A 4AHCA 1XI1A 1QE1A 5E41A 4GV6A 3KTQA 3VETA 3CPWM 3ZT3A 2KHOA 2QWNA 2P9LA 4AHRA 3ZT1A 2VQEK 2XY5A 2PYJA 4FZXC 1IJJA 4CERA 2QWMA 4FJJA 3KVGA 4JN4A 1FKPA 4OLAA 1IBLK 5E84A 2DFHA 1SL2A 1VAZA 3CCVN 3H46O 5C24A 5T7BA 3RMBA 2FBXA 3T3FA 4W5RA 1KQSM 5BPNA 4B9SA 4RW4A 3CCMN 2G8HA 5AQIA 3HYFA 3K59A 3S3NA 1YUWA 3W3DA 4BVOA 1QSSA 1U2VA 3O9UA 4ELUA 3TAQA 4JKFA 1BHLA 1K8KB 2G8UA 2WUSA 1VQ4N 1TUYA 5H1SQ 2CH5A 4BDPA 1ZC6A 4OJRA 4HCBA 5AQNA 2RE2A 1BISA 3UE5A 1KSPA 2B6AA 2AP1A 3NDKA 1D9FA 1HRHA 3U9DA 4E7HA 3VEZA 3SQ2A 2YKMA 4DQIA 4XIUA 1UA0A 2E88A 1NK4A 3RMDA 3FLCO 2IC3A 2P1JA 3AO1A 4BE1A 3SZ2A 2XHBA 4JKBA 4BR4A 4H03B 4IO9L 4QCLA 3S41A 4M7YA 3DYAA 3JSMA 3EE8A 2QWQA 3DRSA 2F96A 4C8OA 3TU5A 3ITHA 3C7NB 5JLFA 4CK1A 2E5LK 2YNIA 2F4VK 4JD2A 4CFAA 4FK4A 2X74A 3DJCA 3D6RA 5BPLA 3OS2A 4N5SA 3CJBA 2BGGA 4LFBK 4HVJA 4DSJA 3AARA 2RKIA 5FROA 4ELVA 4JKCA 4B8CA 4DS5A 1WSIA 4BY9C 4KH4A 3O9TA 1JJ2M 2OPPA 2VG6A 3HXMA 5KRSA 2ZM6K 1NOYA 1VQ6N 2ZE2A 4BQZA 4CEDA 5JVGL 2HBLA 2KZZA 4KAZA 2YHWA 1JLQA 1VRTA 3VA0A 4K8ZA 3U4LA 4KI4A 3C7NA 2IDOA 2P9SB 3CJCA 3O80A 4N76A 2F8TA 2O8EA 4CEBA 4R5PA 4B08A 4PWDA 4LF8K 3E1YA 2F7TA 1VRUA 5CZ2A 3WXIA 3THWB 1RDAA 3L4IA 1KLMA 4FVMA 3K57A 3PLAA 3T1AA 2A3ZA 1RFQA 4FLUA 2GUIA 2IIRA 3O4NA 1SKWA 1MWKA 1X3MA 1NKCA 4PY5A 4J2BA 1NJYA 3DLKA 3SAFA 3V9XA 1NKEA 2E6LA 5TKWA 2FSKA 1R0AA 1D9DA 4H0XB 3TTDA 3MAQA 3AVHA 3LP2A 2Q2RA 4DHYA 4BE0A 1FW6A 2OPSA 2QWPA 3L3UA 3LWLA 3PIPL 4O5BA 1CZAN 3LDSA 4CGGA 4CBWA 2Q1NA 1T05A 2ZJPL 1S1UA 5FPMA 3LDOA 3QEIA 3MXIA 2IS3A 2P5GA 1Q9XA 4FPBA 2IVOA 1KD1O 1KXPA 3Q7BA 3K5LA 4FJIA 3DRRA 2NRRA 3T7ZA 5AQYA 3CJ7A 1LCUA 4AHUA 3AAQA 3OS0A 4B3OA 2E2PA 3MDQA 5AQQA 1S1TA 1QHTA 4CEQA 3VQQA 3AO3A 4FLXA 2HHVA 3WEEB 1BG3A 3QEWA 4CBUA 5LJWA 3DOLA 4JS4A 3OYFA 4CZGA 1LW2A 4IG0A 1ZYQA 3KWGA 5M1QA 3NF7A 1O13A 2O8BA 3MEDA 4FK2A 1GLDG 4CGFA 4CZMA 1WLJA 1U4BA 3MCAB 3Q7CA 4EZ9A 1BIZA 3GG4A 1VSLA 3CIPA 3O8MA 1S72N 4BRQA 4V19S 2ZWHA 4FWLA 3NH2A 1NU0A 1E3MA 1T44A 4JKEA 1EO1A 4B1WB 3VMFB 4N47A 3U3GA 4DSLA 1IKVA 4FJNA 3LP3A 2D1KA 2ZF5O 4HWIA 3IFRA 2F8SA 4H0YB 1ASUA 3VEWA 1T6CA 1IG9A 4H0OA 4X62K 4WQ5A 4C8KA 4NCBA 1LW0A 4LY7A 4OKKA 3QESA 2Z1GA 3NH1A 3CQXA 3MEGA 4L8RB 4CK2A 4BRMA 3PUFA 3QDKA 4CZJA 4FLYA 5LY3A 2ZGZA 4N56A 4ELTA 3RMAA 1LAWA 4IKFA 1QVFM 3NF8A 3U8XA
chains in the Genus database with same CATH topology
4GV9A 5AQOA 1YITN 4B1XB 5AFUH 1GLLO 3JS6A 2FXUA 2E2OA 5AQMA 3SJHA 5BPMA 3J8AA 3WXJA 2IVNA 1U6ZA 3GDQA 2P9SA 5AZIA 4B1ZA 4H5NA 4CBXA 4E1JA 5M1NA 3E9OA 4BG9A 4DB3A 1KAXA 5E26A 4PKHA 1LOTB 5C12A 3SAGA 5GIOA 3MX5A 3CMAN 1NJIO 3HI0A 3A5OC 3QB0A 5AQKA 5FPNA 2Q0UA 4FSVA 4BRNA 4C1NK 1HLUA 4BR5A 3SLCA 4MO4A 3EKSA 4JHDB 3C65A 3QMLA 2E2QA 3EE9A 4WFAL 1BU6O 3UKRB 3LDQA 3PIOL 5AQFA 3DLLL 4YOXA 4JKGB 3E9LA 4K42A 2YJEA 2CGJA 3HOTA 4O5FA 3CD6N 2HBJA 4B1UB 3RSEA 5BRDA 5BRHA 5JLHA 4WFBL 1Q86O 2Q31A 2JWKA 5AQRA 3VPZA 4BRLA 3FR0A 5CHIA 2P9UB 5DM7L 2HBMA 3HSCA 1J6ZA 4I6MA 3HM8A 2EWSA 4JEPA 3D2FA 3WXLA 3FZMA 3O08A 4AM6A 4RWTA 2GELA 3ZYYX 4OO1J 3GE1A 5AR0A 3CMEN 1XC3A 3I33A 5EXWA 4JD2B 1YI2N 2GWJA 3BEXA 3VGKA 4FWMA 3JXUA 4YOUA 3WXMB 1W2BM 2A6AA 5ELZA 4FOIA 3A8YA 4OPHA 5GIPA 4BRKA 3SMPA 1NWKA 1GLFO 3H45C 1Z05A 4A5BA 3ULEB 5HL7L 1BOTO 4FWRA 3D2EA 4EIAA 1NGIA 1NGJA 3CJ9A 1S3XA 1W97L 3FGUA 4QS7A 3VTHA 4HTLA 1VQ5N 2QXLA 2IVPA 5AQVA 2CGLA 2GX9A 4BRAA 4YOWA 3AGRA 3P38A 5AQGA 4CZFA 5DM6L 4L3QA 2ZJRL 4WYBA 5AQTA 1DT9A 3FZHA 4EHUA 2P9PA 2A42A 2V7YA 5BR9A 3EL2A 4YDUC 1NGHA 2ZGYA 3CJAA 1NGAA 3IUCA 4LC9B 1IG8A 2QW9A 5CR4A 1TUUA 3R8EA 3J7ZO 3ID8A 3UB5A 5AFUA 2GWKA 3D2FB 3O1WA 4BR2A 1QZ5A 1VQMN 1HX1A 3QBXA 3VERA 1VQLN 2HF3A 3QBWA 4I6MB 2P9UA 5C2FA 2NRWA 3FFKB 1ZXOA 5EVZA 3M1FA 4JK9A 2Q0RA 3WQTA 3LM2A 3BP8A 4BC5A 4C1NI 1M1KO 3GL1A 5GAGP 3VEXA 2YHYA 1NGCA 2NRHA 1ZBSA 1S22A 4JKGA 3EKUA 1NGGA 1Q18A 1Y64A 2VWBA 3CPEA 2YHXA 4JHDA 4BRFA 3WXKA 1MDUB 4KH5A 1HKGA 2PFUA 4IZ9A 1GLJO 2V7ZA 2YCHA 1E4GT 2E8AA 2NRXA 2P9NA 3A5LC 3N4QA 5KPZA 4AF1A 1ESVA 1KAYA 5M1KA 5F1XA 3E66A 3IMXA 1NGFA 3RVCA 1K8KA 5JVHL 3AY9A 3H1QA 3WUHA 3IDHA 3IKMA 3O9RA 3H6EA 4BR9A 2ASPA 1U2VB 3VEYA 1HKCA 3FZLA 5AZIB 3A5NC 1VQ7N 3CCEN 3BF1A 1C0FA 2H3GX 4FWOA 3TSPA 4B1VA 1VQKN 3W0LA 2FLOA 4EHTA 3U9ZA 3SAHA 3QFPA 1SQKA 3MN9A 5GADP 3DXMB 3DXKB 4H5WA 5AQSA 1JCFA 3G4SN 4CZLA 3A0IX 4U7BA 3HRGA 4GV6A 2NNWA 3TTCA 1KC8O 5AQWA 4IO8A 3VETA 3CPWM 1RDWX 2NRTA 1BA1A 2KHOA 1V4SA 2P9LA 2GUPA 2QWNA 2Q36A 4J8FA 5ADXH 4WFNL 4G9ZA 3DXKA 5BRFA 1HUXA 3MCPA 1IJJA 3CHWA 4YOYA 4ILJA 2QWMA 1P8ZA 2A5XA 4PL8A 2BUPA 2GEMA 5KPRA 3KVGA 4JN4A 4JKDA 3VGLA 2P9PB 3CCRN 5TKYA 4JKAA 4JK8A 5E84A 3AGKA 4BRCA 4FWNA 4KH6A 4QS9A 4F9OA 4BC4A 5C15A 1VAZA 2DPNA 3CCVN 3H46O 4FL9A 4QS8A 2QEXN 1KQSM 1QZ6A 5GINA 5BPNA 4JK7A 4O8UA 3D2EB 2W40A 3CCMN 4BGAA 5AQIA 4C23A 2OTLN 2JWLA 4MO5A 2E20A 4OPAA 1YUWA 2QWLA 2WFBA 3CQYA 3K9KA 3W3DA 4BVOA 4IXCA 1VQ9N 1U2VA 1QVGM 1X3NA 3O9UA 4K25A 4GVEA 4BRGA 3B8AX 3C0BA 4JKFA 3ATVA 3QICA 1GLCG 1K8KB 3VENA 3OBYA 2FF3B 2WUSA 3D7EO 1VQ4N 1OVYA 2FF6A 1TUYA 5H1SQ 3HOSA 2P9KB 2CH5A 1ZC6A 3R9PA 3NVKA 3HBTA 2E1YA 2RE2A 5AQNA 4M7XA 3GOIA 3UE5A 1YIJN 2AP1A 3MWTA 4Y0WA 1XUPO 1RDUA 1GLEG 3U9DA 4FWQA 5F0XA 4A2BA 3MWPA 3VEZA 1D4XA 1BO5O 4H5TA 4IFEA 3WEEA 2QTDA 2E88A 2PBDA 4BG8A 4CD3A 5B8HA 3FLCO 3GBTA 4CZKA 4WQ4C 3EZWA 1HPMA 3R6MA 3LDNA 3P39A 3OBWA 4ILGB 5AZJA 4PL7A 5FPEA 3OA9A 4BRHA 3CJ1A 2D4WA 4IEIA 3CCQN 4JKBA 4BR4A 4DQ8A 4H03B 4K41A 2ASOA 3MN5A 3ZX2A 4IO9L 3CC7N 3S41A 4H0PA 4M7YA 3ULEA 2YX6A 3K9JA 4IDHA 4PKGA 1EQYA 5C2DA 3NVMA 3EE8A 2QWQA 5ADXA 5JMVA 3KZBA 4O8KA 3TU5A 4A2AA 3O9QA 3C7NB 5JLFA 2D0PA 1VQ8N 1ATNA 2A40A 4BGBA 4JD2A 3SK3A 2PAVA 3EO3A 4A59A 3DJCA 4FWPA 3WQUA 3BUZB 4ISGA 4CZIA 4U67L 5M1FA 3D6RA 2P9NB 5BPLA 1SS6A 3CJBA 3FE1A 1BUPA 4A57A 3O6WA 1QQOA 2J4RA 2NLXA 3EN9A 3HZ6A 2UYTA 3AARA 3ZEUB 1BA0A 1Q81O 4MLEA 4FWKA 2FSJA 3T69A 4XEIA 3CCJN 1DGKN 3BF3A 3DWLA 4JKCA 1YHQN 4BR7A 5LJVA 4WF9L 3CXCM 5BN8A 4BY9C 4CZEA 5EOYA 4KH4A 1GLBG 3O9TA 1JJ2M 2ASMA 4GNIA 5JICA 1XQSC 4BVPA 4K43A 1E4FT 3VF2A 2YJFA 1ATSA 1WOQA 3SBTA 4YOVA 1MA9B 3O9SA 4EFHA 1VQ6N 2QWRA 3I55N 2F9TA 1H1VA 3M3ZA 3MMVA 4MDBA 1Z6RA 4BQZA 5JVGL 2HBLA 3ID6A 2HBKA 4FWSA 1BWFO 1C0GA 2YHWA 3P31A 4ISFA 4JAXA 3SBGA 5CE3A 5KPTA 5HOOA 4CI6A 4BREA 3O5BA 3CERA 4XH1A 3TSQA 3LDLA 4IOAL 3U4LA 3C7NA 4RTFD 3CJCA 2P9SB 3F5TA 3LL3A 3O80A 4IEEA 3UKRA 3L6QA 3E9PA 1K9MO 1SZ2A 4YORA 1KAZA 4JKHA 1Q82O 2P9IB 1YJNN 4IJAA 2NRZA 4IOXA 3E1YA 1YXQA 2F7TA 3LDPA 4H5VA 3WXIA 3L4IA 5AQHA 4CD1A 3PLAA 2QM1A 1QQNA 2A3ZA 1RFQA 2F9WA 3L0QA 2ITMA 4MLHA 4B1YB 3CCUN 2IIRA 4XH4A 2KKZA 1MWKA 5EY4A 1X3MA 3TPQA 2NRVA 1JCGA 3P4IA 4RCHA 3TSUA 2HF4A 3SAFA 1YAGA 5BREA 4M63C 2VGNA 3ENOA 2KLAA 3C6AA 4DKWA 3G71N 3VTIA 2WC9A 3HTVA 4XH5A 5TKWA 2FSKA 3CCSN 5AZJB 2D0OA 3FZFA 3VESA 4R79A 4UY8O 5GAHP 1M90O 2HOEA 4H0XB 1NBWA 3TTDA 3ZETA 1DEJA 1WUAA 3QFUA 3UKUA 4CZHA 4EAHD 4WCEL 5KQ8A 3TTFA 2Q2RA 5C10A 1JCEA 2QWOA 4DHYA 3VEVA 2VCPA 2A41A 2QWPA 1VQON 4MDAA 3MK6A 3PIPL 3M5RA 1Q7YO 3F2KA 4BC2A 1CZAN 1HKBA 4NLBA 2V51B 3VEOA 2Q1NA 4CBWA 3DAWA 3KWIA 1ILYA 1GLAG 2P9KA 3ZX0A 2ZJPL 4H0VB 4YDUA 5AQUA 3M6GA 3N4PA 5FPMA 3LDOA 5MLCQ 4IWVA 2I7PA 3KK7A 3MN7A 1BDGA 4ILHA 3MN6A 4YOTA 1NM1A 4FPBA 2OTJN 2IVOA 1KD1O 1KXPA 3Q7BA 5F2RA 3CETA 1K73O 2NZTA 3FZKA 2GTDA 2NRRA 3T7ZA 3CCLN 5AQYA 1T3VA 2Q97A 1SAZA 3CJ7A 4WQ5C 3UKUB 1HJOA 1LCUA 2AA4A 3AAQA 3ZX3A 3NMUA 2BH1A 1TYQA 3H3NO 5AQPA 4BRPA 2E2PA 3MDQA 1T6DA 4H5RA 1TYQB 5AQQA 3G6EN 2HMPA 3F9MA 3VF6A 4PKIA 3G25A 3CF5L 1NGBA 3WEEB 1BG3A 4ISEA 5GAEP 4CBUA 1N8RO 5LJWA 4FVUA 2ZJQL 1VQPN 3LM9A 5AQLA 4CJ7A 1NGDA 4CZGA 2VYPA 4FO0A 3CC2N 5BN9A 1X9JA 3KWGA 5M1QA 4H0TB 1O13A 4BQLA 4NB4A 1GLDG 4CZMA 2FSNA 1ATRA 3CI5A 3MCAB 2V52B 3Q7CA 2P9IA 1RGIA 5M1PA 1YF5L 2CGKA 1OKJA 3O4WA 3GG4A 3ENHA 4B9QA 3WT0A 3CIPA 3O8MA 3VGMA 4PHTX 1S72N 2QI2A 4BRQA 5I9EB 4A5AA 2BTFA 4FOEA 2W41A 1QHAA 2ZWHA 2QA4N 4FWLA 2E2NA 5M1OA 4JNEA 4BC3A 4IJNA 4NLCA 1T44A 4IOCL 3OW2M 4JKEA 5EX5A 3R3LA 5AQJA 4B1WB 3ENBA 3VF4A 4BROA 2I7NA 1P90A 1K8AO 1EO1A 3SMSA 3ZETB 3ATUA 3VMFB 1YJ9N 2VGMA 4A62A 3I8BA 2E1ZA 2HSTA 1NLVA 2D1KA 2ZF5O 2YI1A 3IFRA 3OHRA 4HWIA 4BRDA 4Z94A 2OANA 1DKGD 4H0YB 2RHKA 4BR0A 5FPDA 3VEWA 1NMDA 1QQMA 1T6CA 2WBNA 3MX2A 4H0OA 1VQNN 4WQ5A 3VOVA 3O1BA 4GV3A 3I56N 1R59O 4FPAA 5C0YA 5AQZA 4KBOA 3CQXA 3H3OB 1MWMA 4GY2B 3RSEB 1NGEA 1V4TA 4A61A 4DCHA 1G99A 2P9LB 3C6HA 4BRMA 3H1VX 4BRIA 3QDKA 2CH6A 4CZJA 4NO7A 3ZEUA 4AM7A 5AQXA 5LY3A 3CC4N 1YVNA 2ZGZA 4WQ4A 3L4QA 3AAPA 5KQDA 3A5MC 3DXMA 3KHYA 1YJWN 1QVFM 3R1XA 3U8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT N;  1ILY A;  2ZJP L;  1VQ8 N;  5MLC Q;  5JVH L;  1NJI O;  3CMA N;  4U67 L;  1VQ7 N;  3CCE N;  2OTJ N;  1KD1 O;  1VQK N;  1K73 O;  4WFA L;  5GAD P;  3CCL N;  1Q81 O;  3PIO L;  3DLL L;  3G4S N;  3CCJ N;  1YHQ N;  3CD6 N;  4WF9 L;  3CXC M;  4WFB L;  1Q86 O;  1KC8 O;  1JJ2 M;  3G6E N;  3CPW M;  4WFN L;  5DM7 L;  3CF5 L;  1VQ6 N;  5GAE P;  3I55 N;  1N8R O;  5JVG L;  2ZJQ L;  1VQP N;  3CCR N;  3CC2 N;  3CME N;  4IOA L;  1YI2 N;  3CCV N;  2QEX N;  1KQS M;  1W2B M;  3CCM N;  1K9M O;  2OTL N;  1S72 N;  5HL7 L;  1Q82 O;  1YJN N;  1VQ9 N;  1QVG M;  2QA4 N;  1VQ5 N;  4IOC L;  3OW2 M;  2ZJR L;  5DM6 L;  3CCU N;  1OVY A;  1K8A O;  1VQ4 N;  5H1S Q;  1YJ9 N;  1YIJ N;  3J7Z O;  1VQN N;  3G71 N;  3I56 N;  1VQM N;  1VQL N;  3CCS N;  4UY8 O;  5GAH P;  1M90 O;  1M1K O;  4WCE L;  5GAG P;  3CC4 N;  3CCQ N;  1VQO N;  3PIP L;  1Q7Y O;  1QVF M;  4IO9 L;  1YJW N;  3CC7 N; 
#chains in the Genus database with same CATH topology
 4GV9 A;  2YNH A;  1EXQ A;  1RBT A;  1RT3 A;  3J8A A;  2P51 A;  3WXJ A;  4CBX A;  4B1Z A;  4JI0 K;  1HYZ A;  4BWJ A;  3AVN A;  3L2U A;  5E26 A;  4DQQ A;  1NJI O;  2D0B A;  3QB0 A;  5FPN A;  2YHB A;  2JLE A;  4OGC A;  3ZCM A;  4DTO A;  4KHY A;  4M3T A;  2O8F B;  4DR6 K;  3C65 A;  1L3U A;  4WFA L;  2HHQ A;  1BU6 O;  1S1W A;  3UKR B;  3PIO L;  3HPG A;  1SKS A;  4EP4 A;  4DTN A;  3C6T A;  2QKB A;  2HW3 A;  4I2Q A;  1G15 A;  3ZSO A;  2JWK A;  3D0P A;  4DV1 K;  4RW6 A;  5DK5 A;  3FR0 A;  5DM7 L;  1KFS A;  3HM8 A;  1KRP A;  2EWS A;  4AHS A;  4AHT A;  2QKK A;  3D2F A;  3WXL A;  4AM6 A;  3O08 A;  1BI4 A;  3VQP A;  1WSG A;  4IFY A;  3NCI A;  3CME N;  4JRQ A;  1C0T A;  4JD2 B;  3LAL A;  5JS1 A;  4CCH A;  4FWM A;  1GOB A;  3JXU A;  2A6A A;  1TKX A;  3SMP A;  1VHX A;  1NWK A;  4X65 K;  1GOC A;  4KHQ A;  5HL7 L;  1BOT O;  4EIA A;  4KB1 A;  2RN2 A;  2AJQ A;  3CJ9 A;  1W97 L;  3VTH A;  3QEV A;  2YNF A;  2CGL A;  4DR1 K;  2GX9 A;  1WSE A;  4DUY K;  4HTU A;  4WYB A;  1NG9 A;  3FZH A;  2P9P A;  3PSF A;  5J1E A;  2A42 A;  4NCA A;  3EL2 A;  3OYK A;  3CJA A;  3O4Q A;  3ID8 A;  1JLA A;  2GWK A;  4BR2 A;  1HX1 A;  2KW4 A;  1JLG A;  3OY9 A;  2RF2 A;  2Z1J A;  3L2V A;  5EVZ A;  3M1F A;  2Q0R A;  3OYE A;  4BC5 A;  1M1K O;  1EWQ A;  3T1H K;  1RT7 A;  5GAG P;  1NGC A;  2YHY A;  1SKR A;  3ZSR A;  4JKG A;  3EKU A;  4DTS A;  1Y64 A;  2VWB A;  3CPE A;  2YHX A;  2OPQ A;  4GKJ K;  1CZ9 A;  3IAY A;  4CEA A;  2PFU A;  4W5O A;  4IZ9 A;  4CJV A;  2YCH A;  4FJ9 A;  5HRS A;  3DM2 A;  5KPZ A;  5M1K A;  1KAY A;  3IMX A;  1NGF A;  3RVC A;  3WUH A;  1SV5 A;  3IKM A;  3O9R A;  1ASV A;  3H6E A;  5CZ1 A;  3KLI A;  5HRN A;  1HKC A;  3FZL A;  1T8E A;  3TSP A;  2XY6 A;  3QFP A;  1SQK A;  5GAD P;  3VQ5 A;  3DXK B;  5AQS A;  4YFU A;  2O8C B;  3A0I X;  3HRG A;  5AQW A;  3IG1 A;  4WFN L;  1V4S A;  1RBS A;  4CIE A;  1BCO A;  2ETJ A;  4EP5 A;  4CFB A;  5J2N A;  4CW7 B;  4DR4 K;  1BGX T;  1NKB A;  4PL8 A;  2GEM A;  5KPR A;  1N5Y A;  4JKD A;  3VGL A;  4B9L A;  2W6L A;  3AGK A;  3ZT0 A;  1RT2 A;  4QS9 A;  2BE2 A;  4F9O A;  5C15 A;  4E0D A;  2DPN A;  4FL9 A;  4LF5 K;  1WAF A;  1VSI A;  5GIN A;  1KFD A;  3D2E B;  4J2E A;  3RMC A;  3HPH A;  4C23 A;  3SQ1 A;  4MO5 A;  2HHH K;  1C6V A;  2OYQ A;  1U48 A;  4CJS A;  4CEF A;  4GVE A;  4RW8 A;  3OYB A;  4DSF A;  4Z4E A;  3ATV A;  3BDP A;  4KRE A;  3OBY A;  4FJH A;  4M3Z A;  2FF6 A;  3HOS A;  2P9K B;  4MQ3 A;  1JXB A;  4CJ5 A;  3HBT A;  3OYH A;  4E19 A;  4M7X A;  1X1P A;  3ZT2 A;  1YIJ N;  3AVL A;  4Y0W A;  1OH5 A;  3M8P A;  3RR7 A;  1TVR A;  1LV5 A;  2XO7 A;  4HCC A;  5B8H A;  3A2F A;  1ASW A;  3K5O A;  3EZW A;  4B9T A;  3R6M A;  4F3O A;  4ILG B;  5AZJ A;  4PL7 A;  5FPE A;  1HYV A;  3THY A;  4IEI A;  3CCQ N;  4W5T A;  4BE2 A;  4OX9 K;  1RT4 A;  5J2P A;  3QNN A;  2YX6 A;  3K9J A;  1WN7 A;  2YKN A;  3NVM A;  1J53 A;  4M3U A;  5JMV A;  4O8K A;  3DLH A;  3O9Q A;  3ZSZ A;  1VQ8 N;  3B6O A;  4BGB A;  4A59 A;  4PQU A;  4FWP A;  3BUZ B;  4ISG A;  4U67 L;  4X64 K;  4HHT A;  1SS6 A;  3KKS A;  4CF9 A;  1BUP A;  4A57 A;  3HL8 A;  4CE9 A;  4FJ8 A;  4E7I A;  3SCX A;  2FSJ A;  3T69 A;  2FBT A;  1YHQ N;  1DTT A;  1ZBU A;  5BN8 A;  3ALY A;  4CZE A;  3V4I A;  1GLB G;  3QEX A;  4BVP A;  2YJF A;  3SBT A;  3O9S A;  1YT3 A;  2VWJ A;  4FWS A;  2G8I A;  5HOO A;  4CI6 A;  3O5B A;  3CER A;  3BY5 A;  3RTV A;  4RTF D;  3IRX A;  4IEE A;  3UKR A;  4DV6 K;  1VSD A;  4KRF A;  3E9P A;  3E01 A;  2DTU A;  4YOR A;  4RG8 A;  4CJ3 A;  1HQU A;  1YXQ A;  4H5V A;  1TKT A;  4B9V A;  4CD1 A;  4C8M A;  4AH9 A;  2F9W A;  4JLH A;  3KIO A;  3CCU N;  4DTU A;  1MU2 A;  2FBV A;  1JCG A;  2PYL A;  2HF4 A;  5BRE A;  1B9D A;  4M63 C;  1A5V A;  4JI7 K;  3V1Q A;  2WC9 A;  4DFK A;  3HTV A;  4XH5 A;  3OYN A;  4UY8 O;  4LF6 K;  3SNN A;  2UXD K;  1NBW A;  3THX B;  3QFU A;  3VQD A;  3UKU A;  3RR8 A;  5KQ8 A;  2HMI A;  4WE1 A;  5C10 A;  1JCE A;  4CJF A;  1VQO N;  4GMJ B;  3M5R A;  1Q7Y O;  5I42 A;  2Z1I A;  4LF9 K;  4E1N A;  4ICL A;  3V9Z A;  1S6Q A;  1LWE A;  2V51 B;  1L3T A;  2X6S A;  3VEO A;  1GLA G;  5KGW A;  3SPY A;  2DY4 A;  4DTR A;  1N6Q A;  4O0I A;  1X9M A;  3P5J A;  1HNV A;  5K14 A;  1BIU A;  4IWV A;  3KK7 A;  3MN7 A;  3AO5 A;  4YOT A;  1NOZ A;  5F2R A;  3CET A;  1K73 O;  2E6M A;  4FM2 A;  3VN5 A;  3ULD A;  1T3V A;  5CYM A;  3LAN A;  1TV6 A;  4WQ5 C;  3HST B;  3ZX3 A;  1L3V A;  3JYT A;  3HP6 A;  3H3N O;  5AQP A;  4BRP A;  3LZJ A;  4JI6 K;  4H5R A;  3G6E N;  3VF6 A;  3SUQ A;  4J2A A;  3KLE A;  1N8R O;  4DSI A;  2ZJQ L;  1VQP N;  2Y1I A;  3CYM A;  5AQL A;  5HLF A;  1NGD A;  4FO0 A;  3CC2 N;  4KHP K;  1KVC A;  4IDK A;  4NB4 A;  1ATR A;  1RGI A;  1OKJ A;  3O4W A;  3VGM A;  3ZSQ A;  2QI2 A;  4HUE A;  4A5A A;  4KTW A;  2QA4 N;  5M1O A;  2EX3 A;  3TR8 A;  3OTO K;  3LAM A;  4LFC K;  4NLC A;  1VSM A;  5EX5 A;  1NK0 A;  2WTU A;  2O4G A;  3ZET B;  4FJK A;  2VGM A;  2HST A;  1K6Y A;  2YI1 A;  4Q5V A;  1B92 A;  2OAN A;  3P1G A;  4CF8 A;  4RW9 A;  1NMD A;  3NE6 A;  4DR3 K;  5FRM A;  3KK1 A;  4FLV A;  1J5E K;  4NXN K;  1MWM A;  1NGE A;  1G99 A;  3H1V X;  4BRI A;  1N33 K;  4NO7 A;  3ZEU A;  3J80 O;  2EHG A;  2GV9 A;  4CHP A;  1RBU A;  4LF7 K;  4DG1 A;  1RDD A;  3K0S A;  4JS5 A;  5AQO A;  4ZTJ A;  1YIT N;  4B1X B;  5AFU H;  2FXU A;  2E2O A;  5BPM A;  4QOZ B;  4H4M A;  1U6Z A;  3GDQ A;  2P9S A;  4M41 A;  5M1N A;  4H5N A;  3V6D A;  3U6F A;  3TAG A;  1XNQ K;  3MEC A;  3TAB A;  4BG9 A;  4DB3 A;  5D3G A;  1KAX A;  3SAG A;  3MX5 A;  5AQK A;  4BRN A;  3ZSX A;  1BCM A;  4MO4 A;  1WNS A;  3OYL A;  4IG3 A;  1EET A;  3DLL L;  4K42 A;  2YJE A;  2CGJ A;  3HOT A;  3S3M A;  4B1U B;  5JLH A;  5BRD A;  4WFB L;  2O8D A;  3OYD A;  4BRL A;  5CHI A;  2P9U B;  4I6M A;  1C0U A;  3PX6 A;  3M8S A;  1VSK A;  3VQ6 A;  2KQ2 A;  4PA1 A;  5EXW A;  3TWH A;  3BEX A;  4JYA K;  3QIP A;  4RW7 A;  3V9S A;  3O3H A;  1XWL A;  1CZB A;  3NGZ A;  4A5B A;  1S3X A;  4HTL A;  4GVM A;  1VQ5 N;  2UU9 K;  2QXL A;  2IVP A;  3LZI A;  3ZLJ A;  3DMJ A;  1NMN A;  3DLG A;  5CY4 A;  4YOW A;  4DV7 K;  5AQG A;  2ZJR L;  4L3Q A;  1TK0 A;  5AQT A;  3SQ4 A;  3F9K A;  2G8K A;  4DLG A;  1NGA A;  3PSI A;  3ZSW A;  5AFU A;  1QZ5 A;  1VQM N;  4DF8 A;  3QBX A;  1VQL N;  2HF3 A;  4ID5 A;  3FFK B;  3WQT A;  5SWM A;  4DTM A;  2NRH A;  4B3R K;  1ZBS A;  4CF1 A;  2HNZ A;  4YNQ A;  3CM6 A;  1Q18 A;  2IOC A;  1WB9 A;  2OZM A;  2YHA A;  4FJX A;  3AA5 X;  1UWB A;  4EZ6 A;  4JHD A;  1TKZ A;  3WXK A;  4FM1 A;  2HND A;  2V7Z A;  3VQ4 A;  1E4G T;  3A5L C;  2P9N A;  1VSE A;  4AF1 A;  2VG7 A;  4CJP A;  1K8K A;  5JVH L;  4GW6 A;  1W7A A;  4DQP A;  1IH7 A;  4BR9 A;  1U2V B;  3RRG A;  4M3W A;  1VQ7 N;  2H3G X;  4FWO A;  4B1V A;  1KLN A;  2KZM A;  1HJR A;  2FLO A;  4EHT A;  3OYJ A;  1RBV A;  3G4S N;  4TSX A;  2D0A A;  1IBM K;  4KFB A;  4U7B A;  4CJW A;  4CFC A;  3PV8 A;  3EYZ A;  1VSJ A;  3TTC A;  1BQM A;  1KC8 O;  5EU7 A;  1RDW X;  1BA1 A;  2Z1H A;  4CJE A;  4DFJ A;  2GUP A;  4CJT A;  2Q36 A;  4G9Z A;  2UXB K;  1HUX A;  1JLC A;  3CHW A;  4YOY A;  4ILJ A;  1P8Z A;  4HUF A;  3SUP A;  2BUP A;  3BGR A;  3B6P A;  2P9P B;  5TKY A;  4KI6 A;  2D0C A;  4JKA A;  4JK8 A;  2HVH A;  4BRC A;  1TK8 A;  4FWN A;  1WSJ A;  4KTZ A;  4KH6 A;  3PO4 A;  1TL1 A;  2O8C A;  1EX4 A;  2QEX N;  1QZ6 A;  4CEE A;  4JK7 A;  4O8U A;  2HHS A;  4BGA A;  5KTQ A;  2JWL A;  3CG7 A;  2E20 A;  2WFB A;  2QWL A;  3ASM A;  3VQ9 A;  1VQ9 N;  1QVG M;  4BRG A;  1KTQ A;  4KO0 A;  1IKW A;  1GOA A;  3PO5 A;  3NVK A;  1BI4 B;  3BZC A;  2E1Y A;  3G0Z A;  3GOI A;  1ZBH A;  1HNX K;  3MWT A;  1RDU A;  4CHQ A;  4FWQ A;  1IO2 A;  1D4X A;  1U04 A;  4H5T A;  4IFE A;  4E7J A;  2QTD A;  2PBD A;  4BG8 A;  2Q3S A;  2YNG A;  3KJV A;  4FYD A;  3GBT A;  1HPM A;  1TL3 A;  3P39 A;  4DV5 K;  3OBW A;  3F73 A;  1YTA A;  3OA9 A;  4CJQ A;  3RWU A;  2D4W A;  3VA3 A;  1CXU A;  2B4J A;  1ZBL A;  2O8F A;  2KFN A;  3L2W A;  4K41 A;  1RCH A;  3ULE A;  4PKG A;  4DTP A;  4OKJ A;  1YVU A;  3VQ8 A;  4H4O A;  5ADX A;  4F2S A;  4GKK K;  1ATN A;  1HPZ A;  4KHU A;  3CFP A;  2PAV A;  3WQU A;  2UUB K;  2P9N B;  1J9A A;  4G1Q A;  2XY7 A;  3WNG A;  3EN9 A;  3HZ6 A;  2UYT A;  1L3S A;  3ZEU B;  1BA0 A;  2BDP A;  1Z26 A;  3AA4 A;  1Q81 O;  4MLE A;  4DWI A;  3U3Y A;  4FWK A;  4CIF A;  1WSF A;  1DGK N;  3DWL A;  4CEO A;  3TAM A;  3DLB A;  5EOY A;  1N36 K;  2A1S A;  1REV A;  2O4I A;  4K43 A;  3WNH A;  1MA9 B;  3I55 N;  3M3Z A;  3MMV A;  1Z6R A;  2HBK A;  3KLG A;  1C0G A;  3SBG A;  5KPT A;  4JAX A;  3OJS A;  2HNY A;  3DRP A;  4C8N A;  3AA3 A;  4AQY K;  4XH1 A;  3TSQ A;  2YV0 X;  3LL3 A;  3VQ7 A;  4AHV A;  3L6Q A;  1K9M O;  4DLE A;  3J7A P;  1Q82 O;  2P9I B;  4IJA A;  1TGO A;  2NRZ A;  4IOX A;  3L3V A;  3LDP A;  3OS1 A;  2UXC K;  1QQN A;  4B1Y B;  4CK3 A;  3L0Q A;  4MLH A;  3AVI A;  2KKZ A;  3NGI A;  5EY4 A;  3TAP A;  2UUA K;  3TPQ A;  2NRV A;  4RCH A;  3TSU A;  1YAG A;  2VGN A;  3ENO A;  3NAE A;  3NH0 A;  3I0S A;  1RTI A;  4FLW A;  4E3S A;  2KLA A;  3C6A A;  4F3T A;  2E4L A;  4W5N A;  1CLQ A;  3G71 N;  2ZQB A;  2VQF K;  5AZJ B;  3FZF A;  4R79 A;  1SL0 A;  5GAH P;  1M90 O;  3ZET A;  1WUA A;  4EAH D;  4ZTF A;  3M8Q A;  2VG5 A;  2QWO A;  3VEV A;  4MDA A;  3MK6 A;  4BC2 A;  4JI3 K;  1XMO K;  1HKB A;  4IBN A;  3G10 A;  4Z4F A;  4F2R A;  2P9K A;  1NJZ A;  4H0V B;  4YDU A;  5AQU A;  1LWF A;  3M6G A;  2QK9 A;  1LWC A;  1FK9 A;  1NM1 A;  4FJL A;  3IS9 A;  1WBB A;  2NZT A;  3M8R A;  2GTD A;  3K5N A;  1IBK K;  3LPU A;  3KK2 A;  2Q97 A;  1XHX A;  2BH1 A;  1TYQ A;  4LFA K;  3V9U A;  4DV0 K;  1T6D A;  1TYQ B;  3F9M A;  4CF2 A;  2HVI A;  4PKI A;  3G25 A;  3CF5 L;  1NGB A;  4ISE A;  1TKD A;  3EEQ A;  4FVU A;  3NGY A;  4CJ7 A;  5KRT A;  3J81 O;  5BN9 A;  1X9J A;  3L2Q A;  3HP9 A;  4BQL A;  3CI5 A;  3AVF A;  1JL1 A;  5M1P A;  1YF5 L;  2CGK A;  4FJG A;  3ENH A;  1HQE A;  4B9Q A;  3T19 A;  4CHO A;  1O1W A;  1B9F A;  4KPY A;  1QHA A;  1A5W A;  2E2N A;  4JNE A;  4BC3 A;  4IOC L;  3KKR A;  3OW2 M;  3DLR A;  4CHZ A;  3R3L A;  4BRO A;  1K8A O;  2I7N A;  1P90 A;  3VQC A;  3SMS A;  3ATU A;  1YJ9 N;  1WSH A;  4A62 A;  4DR5 K;  4BRD A;  2E1Z A;  3OHR A;  1DKG D;  2RHK A;  5FPD A;  1DLO A;  2WBN A;  3SQ0 A;  3VOV A;  3O1B A;  1R59 O;  5C0Y A;  5AQZ A;  4KBO A;  4BAC A;  4A61 A;  3C6H A;  1I39 A;  1C0M A;  3C95 A;  4B9M A;  3CC4 N;  1YVN A;  4WQ4 A;  3AAP A;  4CIG A;  4CEZ A;  4YHH K;  3QET A;  4M42 A;  4DQS A;  1EWR A;  1GLL O;  3JS6 A;  5AZI A;  2KFZ A;  3E9O A;  2DFE A;  4B3S K;  1KCF A;  5GIO A;  5C12 A;  1A5X A;  4LSL A;  5HRR A;  3A5O C;  1L5U A;  4FSV A;  4C1N K;  4CES A;  3EKS A;  4JHD B;  2G8W A;  2E2Q A;  3EE9 A;  3HVT A;  4KB0 A;  3LDQ A;  3ISN C;  3MXJ A;  4JKG B;  3E9L A;  4O55 A;  4YOX A;  1KVB A;  1RDC A;  3OYI A;  3OYM A;  3LP1 A;  1Q86 O;  2B5J A;  5AQR A;  1UA1 A;  4LH4 A;  4B3T K;  1RDB A;  3HSC A;  3DOK A;  1NJX A;  1IKY A;  1I3A A;  1OH7 A;  3FZM A;  3THV A;  3GE1 A;  5AR0 A;  1XC3 A;  3I33 A;  3NFA A;  1YI2 N;  3VGK A;  3KLH A;  4YOU A;  3WXM B;  3EY1 A;  1W2B M;  5ELZ A;  1JKH A;  4JV5 K;  4BRK A;  4OKE A;  4CJR A;  5JS2 A;  1GLF O;  1HNI A;  1QS4 A;  1NGI A;  4QS7 A;  4ZHR A;  3FGU A;  5HRO A;  3KD5 E;  4BRA A;  3AGR A;  1RT6 A;  3P38 A;  5LMN K;  1NJW A;  3PX4 A;  3SYZ A;  4DSE A;  1S1V A;  4EHU A;  4LD0 A;  1BQN A;  4B9U A;  4O0J A;  5BR9 A;  4DV3 K;  2ZGY A;  4LC9 B;  5CR4 A;  3J7Z O;  3BZK A;  3UB5 A;  3O1W A;  4FJ7 A;  1FXX A;  4DF4 A;  3VER A;  3LWM A;  3O3F A;  3LAK A;  3QBW A;  4M45 A;  2P9U A;  5C2F A;  2ITG A;  2NRW A;  4YY3 K;  3OJU A;  1ZXO A;  4JK9 A;  3BP8 A;  4C1N I;  3GL1 A;  3ZSY A;  1IKX A;  3VEX A;  4NXM K;  1YTU A;  1S22 A;  1Z25 A;  1NGG A;  4FZZ A;  1HYS A;  1NK6 A;  3SI6 A;  4BRF A;  3S9H A;  1MDU B;  1XHZ A;  4DR2 K;  4DFM A;  3AO4 A;  1GLJ O;  3AVB A;  3HJF A;  3QO9 A;  4JI8 K;  3N4Q A;  1ESV A;  5HBM A;  3AY9 A;  3H1Q A;  3VEY A;  1OVQ A;  1VQK N;  3MXM A;  3W0L A;  4HUG A;  3U9Z A;  3SAH A;  1TAQ A;  2WON A;  3MN9 A;  1RT1 A;  5CYQ A;  2PZS A;  2NNW A;  1F21 A;  1VSH A;  4FK0 A;  4IO8 A;  4JRP A;  2NRT A;  4J8F A;  3EZ5 A;  3QLH A;  5ADX H;  4ID1 A;  1X9S A;  3DXK A;  5BRF A;  4Z4G A;  3MCP A;  1Q8I A;  2X6N A;  2A5X A;  1T03 A;  4LSN A;  3CCR N;  2HHW A;  4BC4 A;  4QS8 A;  1XMQ K;  1Q9Y A;  3PX0 A;  3OVN A;  1JLF A;  2W40 A;  2FBY A;  2OTL N;  1RTD A;  3HK2 A;  4OPA A;  4J2D A;  3CQY A;  3K9K A;  1XC9 A;  4IXC A;  3ZSV A;  1X3N A;  3AVA A;  4K25 A;  1VK0 A;  3AVG A;  3B8A X;  3C0B A;  4PUO A;  4DV2 K;  3QIC A;  3VEN A;  1GLC G;  4CJL A;  2FF3 B;  3D7E O;  1OVY A;  4LH5 A;  4FLT A;  4CJK A;  1RT5 A;  2ATQ A;  2O8B B;  1TK5 A;  3R9P A;  3D45 A;  1LAV A;  1XUP O;  3O3G A;  4FJ5 A;  1GLE G;  4Z4I A;  5F0X A;  4DV4 K;  4A2B A;  3MWP A;  4I2P A;  5KI6 A;  1BO5 O;  3WEE A;  4CD3 A;  5DMR A;  4KV8 A;  4CZK A;  4WQ4 C;  4JI2 K;  3LDN A;  3TAF A;  1D8Y A;  4C8L A;  2PY5 A;  4BRH A;  2O8E B;  3CJ1 A;  3HPO A;  5J2Q A;  1VSF A;  5A2Q O;  1QQC A;  4DQ8 A;  2ASO A;  3MN5 A;  2X78 A;  3ZX2 A;  2Y1J A;  3CC7 N;  4H0P A;  1S9G A;  4QAG A;  4IDH A;  4K0K K;  3NF6 A;  1EQY A;  5C2D A;  4I9Q A;  2WOM A;  4B3M K;  1S1X A;  5C25 A;  3KZB A;  4A2A A;  4FJM A;  2OPR A;  4FW2 A;  4CFD A;  2D0P A;  2A40 A;  3SK3 A;  3L2R A;  3QNO A;  3EO3 A;  3AVJ A;  3THW A;  4F4K A;  4CZI A;  1CXQ A;  5M1F A;  1SL1 A;  1T7P A;  3H08 A;  3FE1 A;  4DR7 K;  3O6W A;  1QQO A;  2J4R A;  2NLX A;  4Z4H A;  4N41 A;  1NK8 A;  3K5M A;  3DLE A;  3TAE A;  4UQG A;  4XEI A;  3CCJ N;  3BF3 A;  4BR7 A;  5LJV A;  4WF9 L;  3CXC M;  5LL6 Z;  4DTX A;  4DU1 A;  2ASM A;  4GNI A;  5JIC A;  3THX A;  1XQS C;  4BDZ A;  3VF2 A;  1E4F T;  1ATS A;  1WOQ A;  4YOV A;  3TI0 A;  4EFH A;  4CF0 A;  1XNR K;  2QWR A;  2F9T A;  1C1C A;  1H1V A;  4MDB A;  3ID6 A;  4E1M A;  3KK3 A;  3QER A;  1BWF O;  1KVA A;  3P31 A;  4ISF A;  5CE3 A;  4I7F A;  2O8D B;  4BRE A;  4DS4 A;  3LDL A;  4IOA L;  2QXF A;  3K2P A;  3AA2 A;  3LPT A;  3F5T A;  4O4G A;  1SZ2 A;  4BDY A;  1KAZ A;  4CEC A;  4JKH A;  1YJN N;  4CHN A;  3I8D A;  3NHG A;  5AQH A;  3NF9 A;  3THY B;  4F8R A;  2QM1 A;  2ITM A;  4DFP A;  4XH4 A;  5FDL A;  3P4I A;  3QEP A;  1X9W A;  4KHN A;  2UUC K;  2IAJ A;  4KKO A;  4DKW A;  3VTI A;  4B9N A;  3CQ8 A;  3CCS N;  2D0O A;  3VES A;  2HOE A;  1W0H A;  1DEJ A;  4CZH A;  4WCE L;  3TTF A;  4DU3 A;  5IWA K;  3OYA A;  1NK9 A;  2VCP A;  2A41 A;  2W6K A;  4E7K A;  4JI5 K;  3F2K A;  5BR8 K;  1U47 A;  4NLB A;  3CFR A;  3SV4 A;  1ZBI A;  3DAW A;  3KWI A;  1ILY A;  4NYF A;  3ZX0 A;  1FKO A;  4X66 K;  5J2M A;  3N4P A;  5MLC Q;  1HNZ K;  4AIL C;  2I7P A;  4CGI A;  1BDG A;  4ILH A;  3MN6 A;  2VWK A;  1OH6 A;  2OTJ N;  1U49 A;  3HT3 A;  1RIL A;  1D5A A;  1RBR A;  3FZK A;  4E7L A;  2NUB A;  4JI1 K;  3CCL N;  4Y1D A;  3UKU B;  1SAZ A;  3SUN A;  1U45 A;  1HJO A;  2AA4 A;  1NK7 A;  2XY8 A;  3NMU A;  2KTQ A;  4DSK A;  4JI4 K;  4KTQ A;  4I9L A;  2HMP A;  5HP1 A;  3PY8 A;  1N32 K;  3HVR A;  5FRN A;  5GAE P;  4FCY A;  5I3U A;  3LM9 A;  1WBD A;  1RNH A;  4OGE A;  5KGX A;  2VYP A;  2HHX A;  1S6P A;  2HB5 A;  3SPZ A;  2JGU A;  4H0T B;  3AV9 A;  2FSN A;  4B8A B;  3K58 A;  2V52 B;  2P9I A;  4MFB A;  4O44 A;  4M3Y A;  1NK5 A;  3WT0 A;  4PHT X;  3S3O A;  5I9E B;  2BTF A;  4FOE A;  2W41 A;  1NNE A;  4IJN A;  5AQJ A;  4Y1C A;  3ENB A;  3VF4 A;  3V1O A;  1WAJ A;  3P83 D;  4Z0U A;  3I8B A;  3TAN A;  1NLV A;  4Z94 A;  4M3R A;  4BR0 A;  3TAR A;  1QQM A;  2OZS A;  1S9E A;  3MX2 A;  1VQN N;  2I5J A;  4GV3 A;  2LSN A;  3I56 N;  4FPA A;  1FJG K;  3H3O B;  4GY2 B;  2RPI A;  3RSE B;  1V4T A;  5C42 A;  4DCH A;  2P9L B;  1RTJ A;  4CJ4 A;  2CH6 A;  4K8X A;  2OA8 A;  4AM7 A;  5AQX A;  3HM9 A;  3L4Q A;  3T1Y K;  5KQD A;  1C1A A;  3A5M C;  3KHY A;  3CM5 A;  3DXM A;  1YJW N;  3R1X A;  3FFI A;  1W9H A;  2R7Y A;  5LMU K;  3KLF A;  5AQM A;  3SJH A;  2IVN A;  4E1J A;  5AJ3 K;  4PKH A;  1LOT B;  3CMA N;  3HI0 A;  2Q0U A;  2G8V A;  3AVM A;  4LF4 K;  1ZBF A;  1HLU A;  4BR5 A;  1UAX A;  3I0R A;  3SLC A;  3V9W A;  3ZT4 A;  2BAN A;  3QML A;  2DFF A;  3QIN A;  1J54 A;  3C6U A;  5AQF A;  4CHY A;  5FLX O;  4O5F A;  3CD6 N;  3RRH A;  2HBJ A;  3RSE A;  5BRH A;  3AVC A;  3OYG A;  2Q31 A;  3VPZ A;  1I94 K;  2IGI A;  3HO1 A;  3SJJ A;  2HBM A;  1J6Z A;  4DUZ K;  1SUQ A;  1JXE A;  4JEP A;  3L8B A;  3KD1 E;  1TAU A;  4RWT A;  2GEL A;  3ZYY X;  4OO1 J;  4CJU A;  4W5Q A;  1QTM A;  4H8K A;  1OH8 A;  3MEE A;  2GWJ A;  2W42 A;  4IFV A;  3SUO A;  4FOI A;  3A8Y A;  4OPH A;  5GIP A;  1RTH A;  2GBZ A;  3CFO A;  3H45 C;  1Z05 A;  3ULE B;  3AVK A;  3NBP A;  4FWR A;  3D2E A;  1NGJ A;  3V81 A;  1IV0 A;  3OYC A;  5AQV A;  1UOC A;  4BWM A;  4FLZ A;  5SZT A;  4CZF A;  5DM6 L;  1ITG A;  4Z4C A;  1DT9 A;  2A1R A;  3JAM O;  1HR0 K;  1Y97 A;  2XRI A;  4OPJ A;  4FZY A;  1S5J A;  4CGJ A;  2V7Y A;  4FM0 A;  4YDU C;  3VQB A;  2ZD1 A;  1NGH A;  3IUC A;  4OVL A;  1BL3 A;  5IT9 O;  3R8E A;  1IG8 A;  2QW9 A;  1TUU A;  3WNE A;  1JLB A;  3VQE A;  3D2F B;  4CGD A;  2FC0 A;  4M3X A;  4I6M B;  1QSY A;  1C1B A;  2D5R A;  3LM2 A;  1N34 K;  2OCE A;  3C94 A;  1J5O A;  3QIO A;  4DTJ A;  1EKE A;  1HMV A;  1DTQ A;  2HHT A;  2P5O A;  2HHU A;  1QSL A;  4KH5 A;  1HKG A;  2G8F A;  4FXD A;  2NRX A;  2E8A A;  5HRP A;  3SV3 A;  4DQR A;  4E89 A;  4DU4 A;  1EP4 A;  5F1X A;  3E66 A;  4OPK A;  3J7Y P;  3DI6 A;  3VQA A;  4Q0B A;  3IDH A;  3UIQ A;  3WNF A;  2ASP A;  3AO2 A;  1HNW K;  5AZI B;  3A5N C;  3CCE N;  4NYN A;  3BF1 A;  1C0F A;  4NCG A;  3V1R A;  4CVN E;  4KHW A;  4CGH A;  1JLE A;  4KHS A;  3DXM B;  4H5W A;  4FW1 A;  1JCF A;  4CZL A;  4OLB A;  4DMN A;  3LP0 A;  1JL2 A;  4AHC A;  1XI1 A;  1QE1 A;  5E41 A;  4GV6 A;  3KTQ A;  3VET A;  3CPW M;  3ZT3 A;  2KHO A;  2QWN A;  2P9L A;  4AHR A;  3ZT1 A;  2VQE K;  2XY5 A;  2PYJ A;  4FZX C;  1IJJ A;  4CER A;  2QWM A;  4FJJ A;  3KVG A;  4JN4 A;  1FKP A;  4OLA A;  1IBL K;  5E84 A;  2DFH A;  1SL2 A;  1VAZ A;  3CCV N;  3H46 O;  5C24 A;  5T7B A;  3RMB A;  2FBX A;  3T3F A;  4W5R A;  1KQS M;  5BPN A;  4B9S A;  4RW4 A;  3CCM N;  2G8H A;  5AQI A;  3HYF A;  3K59 A;  3S3N A;  1YUW A;  3W3D A;  4BVO A;  1QSS A;  1U2V A;  3O9U A;  4ELU A;  3TAQ A;  4JKF A;  1BHL A;  1K8K B;  2G8U A;  2WUS A;  1VQ4 N;  1TUY A;  5H1S Q;  2CH5 A;  4BDP A;  1ZC6 A;  4OJR A;  4HCB A;  5AQN A;  2RE2 A;  1BIS A;  3UE5 A;  1KSP A;  2B6A A;  2AP1 A;  3NDK A;  1D9F A;  1HRH A;  3U9D A;  4E7H A;  3VEZ A;  3SQ2 A;  2YKM A;  4DQI A;  4XIU A;  1UA0 A;  2E88 A;  1NK4 A;  3RMD A;  3FLC O;  2IC3 A;  2P1J A;  3AO1 A;  4BE1 A;  3SZ2 A;  2XHB A;  4JKB A;  4BR4 A;  4H03 B;  4IO9 L;  4QCL A;  3S41 A;  4M7Y A;  3DYA A;  3JSM A;  3EE8 A;  2QWQ A;  3DRS A;  2F96 A;  4C8O A;  3TU5 A;  3ITH A;  3C7N B;  5JLF A;  4CK1 A;  2E5L K;  2YNI A;  2F4V K;  4JD2 A;  4CFA A;  4FK4 A;  2X74 A;  3DJC A;  3D6R A;  5BPL A;  3OS2 A;  4N5S A;  3CJB A;  2BGG A;  4LFB K;  4HVJ A;  4DSJ A;  3AAR A;  2RKI A;  5FRO A;  4ELV A;  4JKC A;  4B8C A;  4DS5 A;  1WSI A;  4BY9 C;  4KH4 A;  3O9T A;  1JJ2 M;  2OPP A;  2VG6 A;  3HXM A;  5KRS A;  2ZM6 K;  1NOY A;  1VQ6 N;  2ZE2 A;  4BQZ A;  4CED A;  5JVG L;  2HBL A;  2KZZ A;  4KAZ A;  2YHW A;  1JLQ A;  1VRT A;  3VA0 A;  4K8Z A;  3U4L A;  4KI4 A;  3C7N A;  2IDO A;  2P9S B;  3CJC A;  3O80 A;  4N76 A;  2F8T A;  2O8E A;  4CEB A;  4R5P A;  4B08 A;  4PWD A;  4LF8 K;  3E1Y A;  2F7T A;  1VRU A;  5CZ2 A;  3WXI A;  3THW B;  1RDA A;  3L4I A;  1KLM A;  4FVM A;  3K57 A;  3PLA A;  3T1A A;  2A3Z A;  1RFQ A;  4FLU A;  2GUI A;  2IIR A;  3O4N A;  1SKW A;  1MWK A;  1X3M A;  1NKC A;  4PY5 A;  4J2B A;  1NJY A;  3DLK A;  3SAF A;  3V9X A;  1NKE A;  2E6L A;  5TKW A;  2FSK A;  1R0A A;  1D9D A;  4H0X B;  3TTD A;  3MAQ A;  3AVH A;  3LP2 A;  2Q2R A;  4DHY A;  4BE0 A;  1FW6 A;  2OPS A;  2QWP A;  3L3U A;  3LWL A;  3PIP L;  4O5B A;  1CZA N;  3LDS A;  4CGG A;  4CBW A;  2Q1N A;  1T05 A;  2ZJP L;  1S1U A;  5FPM A;  3LDO A;  3QEI A;  3MXI A;  2IS3 A;  2P5G A;  1Q9X A;  4FPB A;  2IVO A;  1KD1 O;  1KXP A;  3Q7B A;  3K5L A;  4FJI A;  3DRR A;  2NRR A;  3T7Z A;  5AQY A;  3CJ7 A;  1LCU A;  4AHU A;  3AAQ A;  3OS0 A;  4B3O A;  2E2P A;  3MDQ A;  5AQQ A;  1S1T A;  1QHT A;  4CEQ A;  3VQQ A;  3AO3 A;  4FLX A;  2HHV A;  3WEE B;  1BG3 A;  3QEW A;  4CBU A;  5LJW A;  3DOL A;  4JS4 A;  3OYF A;  4CZG A;  1LW2 A;  4IG0 A;  1ZYQ A;  3KWG A;  5M1Q A;  3NF7 A;  1O13 A;  2O8B A;  3MED A;  4FK2 A;  1GLD G;  4CGF A;  4CZM A;  1WLJ A;  1U4B A;  3MCA B;  3Q7C A;  4EZ9 A;  1BIZ A;  3GG4 A;  1VSL A;  3CIP A;  3O8M A;  1S72 N;  4BRQ A;  4V19 S;  2ZWH A;  4FWL A;  3NH2 A;  1NU0 A;  1E3M A;  1T44 A;  4JKE A;  1EO1 A;  4B1W B;  3VMF B;  4N47 A;  3U3G A;  4DSL A;  1IKV A;  4FJN A;  3LP3 A;  2D1K A;  2ZF5 O;  4HWI A;  3IFR A;  2F8S A;  4H0Y B;  1ASU A;  3VEW A;  1T6C A;  1IG9 A;  4H0O A;  4X62 K;  4WQ5 A;  4C8K A;  4NCB A;  1LW0 A;  4LY7 A;  4OKK A;  3QES A;  2Z1G A;  3NH1 A;  3CQX A;  3MEG A;  4L8R B;  4CK2 A;  4BRM A;  3PUF A;  3QDK A;  4CZJ A;  4FLY A;  5LY3 A;  2ZGZ A;  4N56 A;  4ELT A;  3RMA A;  1LAW A;  4IKF A;  1QVF M;  3NF8 A;  3U8X A; 
#chains in the Genus database with same CATH homology
 4GV9 A;  5AQO A;  1YIT N;  4B1X B;  5AFU H;  1GLL O;  3JS6 A;  2FXU A;  2E2O A;  5AQM A;  3SJH A;  5BPM A;  3J8A A;  3WXJ A;  2IVN A;  1U6Z A;  3GDQ A;  2P9S A;  5AZI A;  4B1Z A;  4H5N A;  4CBX A;  4E1J A;  5M1N A;  3E9O A;  4BG9 A;  4DB3 A;  1KAX A;  5E26 A;  4PKH A;  1LOT B;  5C12 A;  3SAG A;  5GIO A;  3MX5 A;  3CMA N;  1NJI O;  3HI0 A;  3A5O C;  3QB0 A;  5AQK A;  5FPN A;  2Q0U A;  4FSV A;  4BRN A;  4C1N K;  1HLU A;  4BR5 A;  3SLC A;  4MO4 A;  3EKS A;  4JHD B;  3C65 A;  3QML A;  2E2Q A;  3EE9 A;  4WFA L;  1BU6 O;  3UKR B;  3LDQ A;  3PIO L;  5AQF A;  3DLL L;  4YOX A;  4JKG B;  3E9L A;  4K42 A;  2YJE A;  2CGJ A;  3HOT A;  4O5F A;  3CD6 N;  2HBJ A;  4B1U B;  3RSE A;  5BRD A;  5BRH A;  5JLH A;  4WFB L;  1Q86 O;  2Q31 A;  2JWK A;  5AQR A;  3VPZ A;  4BRL A;  3FR0 A;  5CHI A;  2P9U B;  5DM7 L;  2HBM A;  3HSC A;  1J6Z A;  4I6M A;  3HM8 A;  2EWS A;  4JEP A;  3D2F A;  3WXL A;  3FZM A;  3O08 A;  4AM6 A;  4RWT A;  2GEL A;  3ZYY X;  4OO1 J;  3GE1 A;  5AR0 A;  3CME N;  1XC3 A;  3I33 A;  5EXW A;  4JD2 B;  1YI2 N;  2GWJ A;  3BEX A;  3VGK A;  4FWM A;  3JXU A;  4YOU A;  3WXM B;  1W2B M;  2A6A A;  5ELZ A;  4FOI A;  3A8Y A;  4OPH A;  5GIP A;  4BRK A;  3SMP A;  1NWK A;  1GLF O;  3H45 C;  1Z05 A;  4A5B A;  3ULE B;  5HL7 L;  1BOT O;  4FWR A;  3D2E A;  4EIA A;  1NGI A;  1NGJ A;  3CJ9 A;  1S3X A;  1W97 L;  3FGU A;  4QS7 A;  3VTH A;  4HTL A;  1VQ5 N;  2QXL A;  2IVP A;  5AQV A;  2CGL A;  2GX9 A;  4BRA A;  4YOW A;  3AGR A;  3P38 A;  5AQG A;  4CZF A;  5DM6 L;  4L3Q A;  2ZJR L;  4WYB A;  5AQT A;  1DT9 A;  3FZH A;  4EHU A;  2P9P A;  2A42 A;  2V7Y A;  5BR9 A;  3EL2 A;  4YDU C;  1NGH A;  2ZGY A;  3CJA A;  1NGA A;  3IUC A;  4LC9 B;  1IG8 A;  2QW9 A;  5CR4 A;  1TUU A;  3R8E A;  3J7Z O;  3ID8 A;  3UB5 A;  5AFU A;  2GWK A;  3D2F B;  3O1W A;  4BR2 A;  1QZ5 A;  1VQM N;  1HX1 A;  3QBX A;  3VER A;  1VQL N;  2HF3 A;  3QBW A;  4I6M B;  2P9U A;  5C2F A;  2NRW A;  3FFK B;  1ZXO A;  5EVZ A;  3M1F A;  4JK9 A;  2Q0R A;  3WQT A;  3LM2 A;  3BP8 A;  4BC5 A;  4C1N I;  1M1K O;  3GL1 A;  5GAG P;  3VEX A;  2YHY A;  1NGC A;  2NRH A;  1ZBS A;  1S22 A;  4JKG A;  3EKU A;  1NGG A;  1Q18 A;  1Y64 A;  2VWB A;  3CPE A;  2YHX A;  4JHD A;  4BRF A;  3WXK A;  1MDU B;  4KH5 A;  1HKG A;  2PFU A;  4IZ9 A;  1GLJ O;  2V7Z A;  2YCH A;  1E4G T;  2E8A A;  2NRX A;  2P9N A;  3A5L C;  3N4Q A;  5KPZ A;  4AF1 A;  1ESV A;  1KAY A;  5M1K A;  5F1X A;  3E66 A;  3IMX A;  1NGF A;  3RVC A;  1K8K A;  5JVH L;  3AY9 A;  3H1Q A;  3WUH A;  3IDH A;  3IKM A;  3O9R A;  3H6E A;  4BR9 A;  2ASP A;  1U2V B;  3VEY A;  1HKC A;  3FZL A;  5AZI B;  3A5N C;  1VQ7 N;  3CCE N;  3BF1 A;  1C0F A;  2H3G X;  4FWO A;  3TSP A;  4B1V A;  1VQK N;  3W0L A;  2FLO A;  4EHT A;  3U9Z A;  3SAH A;  3QFP A;  1SQK A;  3MN9 A;  5GAD P;  3DXM B;  3DXK B;  4H5W A;  5AQS A;  1JCF A;  3G4S N;  4CZL A;  3A0I X;  4U7B A;  3HRG A;  4GV6 A;  2NNW A;  3TTC A;  1KC8 O;  5AQW A;  4IO8 A;  3VET A;  3CPW M;  1RDW X;  2NRT A;  1BA1 A;  2KHO A;  1V4S A;  2P9L A;  2GUP A;  2QWN A;  2Q36 A;  4J8F A;  5ADX H;  4WFN L;  4G9Z A;  3DXK A;  5BRF A;  1HUX A;  3MCP A;  1IJJ A;  3CHW A;  4YOY A;  4ILJ A;  2QWM A;  1P8Z A;  2A5X A;  4PL8 A;  2BUP A;  2GEM A;  5KPR A;  3KVG A;  4JN4 A;  4JKD A;  3VGL A;  2P9P B;  3CCR N;  5TKY A;  4JKA A;  4JK8 A;  5E84 A;  3AGK A;  4BRC A;  4FWN A;  4KH6 A;  4QS9 A;  4F9O A;  4BC4 A;  5C15 A;  1VAZ A;  2DPN A;  3CCV N;  3H46 O;  4FL9 A;  4QS8 A;  2QEX N;  1KQS M;  1QZ6 A;  5GIN A;  5BPN A;  4JK7 A;  4O8U A;  3D2E B;  2W40 A;  3CCM N;  4BGA A;  5AQI A;  4C23 A;  2OTL N;  2JWL A;  4MO5 A;  2E20 A;  4OPA A;  1YUW A;  2QWL A;  2WFB A;  3CQY A;  3K9K A;  3W3D A;  4BVO A;  4IXC A;  1VQ9 N;  1U2V A;  1QVG M;  1X3N A;  3O9U A;  4K25 A;  4GVE A;  4BRG A;  3B8A X;  3C0B A;  4JKF A;  3ATV A;  3QIC A;  1GLC G;  1K8K B;  3VEN A;  3OBY A;  2FF3 B;  2WUS A;  3D7E O;  1VQ4 N;  1OVY A;  2FF6 A;  1TUY A;  5H1S Q;  3HOS A;  2P9K B;  2CH5 A;  1ZC6 A;  3R9P A;  3NVK A;  3HBT A;  2E1Y A;  2RE2 A;  5AQN A;  4M7X A;  3GOI A;  3UE5 A;  1YIJ N;  2AP1 A;  3MWT A;  4Y0W A;  1XUP O;  1RDU A;  1GLE G;  3U9D A;  4FWQ A;  5F0X A;  4A2B A;  3MWP A;  3VEZ A;  1D4X A;  1BO5 O;  4H5T A;  4IFE A;  3WEE A;  2QTD A;  2E88 A;  2PBD A;  4BG8 A;  4CD3 A;  5B8H A;  3FLC O;  3GBT A;  4CZK A;  4WQ4 C;  3EZW A;  1HPM A;  3R6M A;  3LDN A;  3P39 A;  3OBW A;  4ILG B;  5AZJ A;  4PL7 A;  5FPE A;  3OA9 A;  4BRH A;  3CJ1 A;  2D4W A;  4IEI A;  3CCQ N;  4JKB A;  4BR4 A;  4DQ8 A;  4H03 B;  4K41 A;  2ASO A;  3MN5 A;  3ZX2 A;  4IO9 L;  3CC7 N;  3S41 A;  4H0P A;  4M7Y A;  3ULE A;  2YX6 A;  3K9J A;  4IDH A;  4PKG A;  1EQY A;  5C2D A;  3NVM A;  3EE8 A;  2QWQ A;  5ADX A;  5JMV A;  3KZB A;  4O8K A;  3TU5 A;  4A2A A;  3O9Q A;  3C7N B;  5JLF A;  2D0P A;  1VQ8 N;  1ATN A;  2A40 A;  4BGB A;  4JD2 A;  3SK3 A;  2PAV A;  3EO3 A;  4A59 A;  3DJC A;  4FWP A;  3WQU A;  3BUZ B;  4ISG A;  4CZI A;  4U67 L;  5M1F A;  3D6R A;  2P9N B;  5BPL A;  1SS6 A;  3CJB A;  3FE1 A;  1BUP A;  4A57 A;  3O6W A;  1QQO A;  2J4R A;  2NLX A;  3EN9 A;  3HZ6 A;  2UYT A;  3AAR A;  3ZEU B;  1BA0 A;  1Q81 O;  4MLE A;  4FWK A;  2FSJ A;  3T69 A;  4XEI A;  3CCJ N;  1DGK N;  3BF3 A;  3DWL A;  4JKC A;  1YHQ N;  4BR7 A;  5LJV A;  4WF9 L;  3CXC M;  5BN8 A;  4BY9 C;  4CZE A;  5EOY A;  4KH4 A;  1GLB G;  3O9T A;  1JJ2 M;  2ASM A;  4GNI A;  5JIC A;  1XQS C;  4BVP A;  4K43 A;  1E4F T;  3VF2 A;  2YJF A;  1ATS A;  1WOQ A;  3SBT A;  4YOV A;  1MA9 B;  3O9S A;  4EFH A;  1VQ6 N;  2QWR A;  3I55 N;  2F9T A;  1H1V A;  3M3Z A;  3MMV A;  4MDB A;  1Z6R A;  4BQZ A;  5JVG L;  2HBL A;  3ID6 A;  2HBK A;  4FWS A;  1BWF O;  1C0G A;  2YHW A;  3P31 A;  4ISF A;  4JAX A;  3SBG A;  5CE3 A;  5KPT A;  5HOO A;  4CI6 A;  4BRE A;  3O5B A;  3CER A;  4XH1 A;  3TSQ A;  3LDL A;  4IOA L;  3U4L A;  3C7N A;  4RTF D;  3CJC A;  2P9S B;  3F5T A;  3LL3 A;  3O80 A;  4IEE A;  3UKR A;  3L6Q A;  3E9P A;  1K9M O;  1SZ2 A;  4YOR A;  1KAZ A;  4JKH A;  1Q82 O;  2P9I B;  1YJN N;  4IJA A;  2NRZ A;  4IOX A;  3E1Y A;  1YXQ A;  2F7T A;  3LDP A;  4H5V A;  3WXI A;  3L4I A;  5AQH A;  4CD1 A;  3PLA A;  2QM1 A;  1QQN A;  2A3Z A;  1RFQ A;  2F9W A;  3L0Q A;  2ITM A;  4MLH A;  4B1Y B;  3CCU N;  2IIR A;  4XH4 A;  2KKZ A;  1MWK A;  5EY4 A;  1X3M A;  3TPQ A;  2NRV A;  1JCG A;  3P4I A;  4RCH A;  3TSU A;  2HF4 A;  3SAF A;  1YAG A;  5BRE A;  4M63 C;  2VGN A;  3ENO A;  2KLA A;  3C6A A;  4DKW A;  3G71 N;  3VTI A;  2WC9 A;  3HTV A;  4XH5 A;  5TKW A;  2FSK A;  3CCS N;  5AZJ B;  2D0O A;  3FZF A;  3VES A;  4R79 A;  4UY8 O;  5GAH P;  1M90 O;  2HOE A;  4H0X B;  1NBW A;  3TTD A;  3ZET A;  1DEJ A;  1WUA A;  3QFU A;  3UKU A;  4CZH A;  4EAH D;  4WCE L;  5KQ8 A;  3TTF A;  2Q2R A;  5C10 A;  1JCE A;  2QWO A;  4DHY A;  3VEV A;  2VCP A;  2A41 A;  2QWP A;  1VQO N;  4MDA A;  3MK6 A;  3PIP L;  3M5R A;  1Q7Y O;  3F2K A;  4BC2 A;  1CZA N;  1HKB A;  4NLB A;  2V51 B;  3VEO A;  2Q1N A;  4CBW A;  3DAW A;  3KWI A;  1ILY A;  1GLA G;  2P9K A;  3ZX0 A;  2ZJP L;  4H0V B;  4YDU A;  5AQU A;  3M6G A;  3N4P A;  5FPM A;  3LDO A;  5MLC Q;  4IWV A;  2I7P A;  3KK7 A;  3MN7 A;  1BDG A;  4ILH A;  3MN6 A;  4YOT A;  1NM1 A;  4FPB A;  2OTJ N;  2IVO A;  1KD1 O;  1KXP A;  3Q7B A;  5F2R A;  3CET A;  1K73 O;  2NZT A;  3FZK A;  2GTD A;  2NRR A;  3T7Z A;  3CCL N;  5AQY A;  1T3V A;  2Q97 A;  1SAZ A;  3CJ7 A;  4WQ5 C;  3UKU B;  1HJO A;  1LCU A;  2AA4 A;  3AAQ A;  3ZX3 A;  3NMU A;  2BH1 A;  1TYQ A;  3H3N O;  5AQP A;  4BRP A;  2E2P A;  3MDQ A;  1T6D A;  4H5R A;  1TYQ B;  5AQQ A;  3G6E N;  2HMP A;  3F9M A;  3VF6 A;  4PKI A;  3G25 A;  3CF5 L;  1NGB A;  3WEE B;  1BG3 A;  4ISE A;  5GAE P;  4CBU A;  1N8R O;  5LJW A;  4FVU A;  2ZJQ L;  1VQP N;  3LM9 A;  5AQL A;  4CJ7 A;  1NGD A;  4CZG A;  2VYP A;  4FO0 A;  3CC2 N;  5BN9 A;  1X9J A;  3KWG A;  5M1Q A;  4H0T B;  1O13 A;  4BQL A;  4NB4 A;  1GLD G;  4CZM A;  2FSN A;  1ATR A;  3CI5 A;  3MCA B;  2V52 B;  3Q7C A;  2P9I A;  1RGI A;  5M1P A;  1YF5 L;  2CGK A;  1OKJ A;  3O4W A;  3GG4 A;  3ENH A;  4B9Q A;  3WT0 A;  3CIP A;  3O8M A;  3VGM A;  4PHT X;  1S72 N;  2QI2 A;  4BRQ A;  5I9E B;  4A5A A;  2BTF A;  4FOE A;  2W41 A;  1QHA A;  2ZWH A;  2QA4 N;  4FWL A;  2E2N A;  5M1O A;  4JNE A;  4BC3 A;  4IJN A;  4NLC A;  1T44 A;  4IOC L;  3OW2 M;  4JKE A;  5EX5 A;  3R3L A;  5AQJ A;  4B1W B;  3ENB A;  3VF4 A;  4BRO A;  2I7N A;  1P90 A;  1K8A O;  1EO1 A;  3SMS A;  3ZET B;  3ATU A;  3VMF B;  1YJ9 N;  2VGM A;  4A62 A;  3I8B A;  2E1Z A;  2HST A;  1NLV A;  2D1K A;  2ZF5 O;  2YI1 A;  3IFR A;  3OHR A;  4HWI A;  4BRD A;  4Z94 A;  2OAN A;  1DKG D;  4H0Y B;  2RHK A;  4BR0 A;  5FPD A;  3VEW A;  1NMD A;  1QQM A;  1T6C A;  2WBN A;  3MX2 A;  4H0O A;  1VQN N;  4WQ5 A;  3VOV A;  3O1B A;  4GV3 A;  3I56 N;  1R59 O;  4FPA A;  5C0Y A;  5AQZ A;  4KBO A;  3CQX A;  3H3O B;  1MWM A;  4GY2 B;  3RSE B;  1NGE A;  1V4T A;  4A61 A;  4DCH A;  1G99 A;  2P9L B;  3C6H A;  4BRM A;  3H1V X;  4BRI A;  3QDK A;  2CH6 A;  4CZJ A;  4NO7 A;  3ZEU A;  4AM7 A;  5AQX A;  5LY3 A;  3CC4 N;  1YVN A;  2ZGZ A;  4WQ4 A;  3L4Q A;  3AAP A;  5KQD A;  3A5M C;  3DXM A;  3KHY A;  1YJW N;  1QVF M;  3R1X A;  3U8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...