2ZJTA

Crystal structure of dna gyrase b' domain sheds lights on the mechanism for t-segment navigation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
185
Chain Sequence
FTDPRKSELYVVEGDMFQAILPLRGKDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 51
structure length 185
sequence length 206
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2zjtA02
3M4IA 3IG0A 2ZJTA
chains in the Genus database with same CATH superfamily
4C2MA 1HR0H 4MAMA 4PWQA 2YRXA 4IR1A 5CAEB 5KG0A 3Q2OA 3ORQA 5KT7A 2WE6A 3M9MB 2R8IA 2YZGA 1C3OA 4FBUA 3HOZG 3V4ZA 5FLXW 2OH2A 1Z2OX 3CVZA 3JZIA 4LF7H 3PR4A 4EGQA 2YCHA 2YYAA 3PR5B 4ED1A 3V6JA 4Q45A 3RB0A 4YAKB 3FKIA 4O3RA 5D1OB 1FVIA 2R93G 2F4VH 5KG6A 5KFKA 3OTOH 2YZNA 2V4QA 2C2RA 5DG7A 2C28A 3JSLA 4GC7A 5CA0F 2W9BA 2VOBA 1DV1A 5D1PA 4HYKA 2UVVA 4XZ3B 1TWHA 4L1KA 5KFAA 2XC9A 5KFZA 3BA8A 2CQYA 4FS2A 2JA5G 2JA7A 3WO1A 3NGDA 2NU9B 1Z2NX 4A3JG 4RAYA 3OSPA 4TV8F 5IYDG 4IRDA 3G6YA 5KG2A 1AUVA 5K2MA 2FE3A 5FD5A 4RNOA 2BQUA 3HOYG 4I7HA 3HOUG 1I6UA 5T14A 5H80A 2J6UA 2UVRA 2CZGA 4A3MG 3KAKA 5LA6F 3GIQA 3T5JA 2C2EA 4WBNF 4UCRA 3EPIA 2W71A 4Q8FA 2J9GA 1TAEA 5CA1F 5A2QW 2VUMA 5HV6A 2UU9H 2V4RA 4M7EA 1GO3E 3PZPA 2YL2A 4MTEA 2B63G 5KFCA 2RGRA 2YRWA 4DR5H 4DUZH 3UFXB 5FD6A 4FU0A 4HNTA 1HNZH 4YP3A 2ZJTA 4B3TH 2AGOA 4IRCA 5KFQA 3IN5A 2FKLA 3GTPA 4RNMA 1JDEA 3GIDA 2YZMA 3BJYA 3KTMA 3J7AK 1B04A 2FJZA 4ED2A 2YS7A 4LH7A 4DR6H 5DG8A 5KG1A 3J80W 2GPWA 5KG7A 4U7CA 1S0NA 1A0IA 4DL6A 2XCAA 4QWDA 4ECTA 3F8NA 3SE7A 4DL3A 3RGXA 2RF4A 3KHGA 3L4JA 2QYZA 5C4XG 1EZ1A 2NU6B 4RAZA 3T5HA 4E4TA 3N8DA 1WR2A 2ATLA 2FK3A 4TQSA 3KAJA 1XNRH 2WAQE 3H3VH 3PN1A 2Y0SE 1JIHA 2NUAB 3TINA 2YS6A 1RJQA 1FJGH 5JQWA 4DV7H 1SEIA 4LF5H 2ZDGA 2R82A 2DIKA 1E4FT 2HVQA 2VQDA 4J9RA 1WH2A 2KSWA 2AU0A 3CQZA 4MV6A 5FJ8G 1CE8A 1K83A 4XYMB 1ZHSA 3QZ8A 4JI3H 1UC9A 2FLPA 3R5FA 4O3PA 4ED7A 3FDSA 1EUCB 3R23A 4AQYH 3Q8QB 2R87A 3N41B 2JEFA 5L1KA 3MR6A 1BNCA 4UCUA 4I50F 4MV8A 4NXNH 4J9KA 3BA9A 3MR3A 3KHHA 1RJRA 2IP4A 2XCPA 3OUUA 2W70A 4EYHB 1KJQA 3V6HA 4RB1A 2JA6A 4QIWA 5JUMA 5KFVA 4OX9H 5EWEA 3N43B 4NLGA 3JRWA 5C1OA 2VA2A 4J9SA 4F50A 1XNQH 1ZQ7A 3ETHA 5D8DA 2E5LH 3RAQA 1S0MA 3I12A 2W6PA 4A3LG 1I7NA 1IBKH 1VBGA 4O3OA 4EGJA 2CW7A 1KJ8A 4ECZA 5KFMA 3G8CA 5KFBA 4ED6A 4A3KG 2W6MA 4HNUA 3HKZA 4TUYF 2W9CB 2AQ4A 4DV0H 2UVUA 5KFSA 2XGQA 4I55F 4Q0YA 3PW2A 1M0TA 4JV1A 1S9FA 2W57A 5IYBG 3K3PA 2W7PA 4GC6A 5DLGA 2PN1A 4J9OA 4IRKA 5KT6A 2R8HA 3H0GA 1PK8A 1AN7A 2R8JA 4QIWE 2XIGA 4BBSG 4R8UA 1DGSA 3H4BA 2DZDA 2VPQA 2VR1A 2BQ3A 3U9TA 2P0AA 3IG0A 1RK5A 1N36H 3MFIA 2UUAH 2GLTA 3GLKA 3RUPA 5LMUH 1WSCA 4JI7H 1TWCA 2NU7B 4YJ3F 5LP6F 4A2AA 4M9UA 5C3EG 1Y1VG 4TV9F 2R92A 3BG5A 5KG5A 3G6VA 3JRXA 1SYXB 2DLNA 5IP9G 1M0WA 3R5HA 4LSAA 1SCUB 3VMMA 3N44B 5BPHA 4Q44A 4YHHH 4J9MA 4ECWA 2RGVA 4HR7A 3HOWG 2IA6A 4UCVA 3WO0A 2JEJA 1V9PA 1IOWA 4RNNA 1KC7A 3TQ1A 2FK1A 5EWGA 4O3QA 4QWAA 2JA6G 3RV3A 2FLNA 2FK2A 3M4IA 3HXLA 2QK4A 4ZI7F 1BJTA 4O4IF 3K3VA 3GIIA 3TQTA 1M6VA 2PMZE 3GIJA 1S0OA 2UUBH 1ZHQA 2J6SA 4A2BA 1EHIA 2JA5A 3SI8A 4ED0A 3FMAA 1BGWA 2WDTA 4TQRA 2W9CA 3T5KA 3GTLA 3HBLA 1O75A 5JVDF 3H40A 4ECUA 2ASJA 4IR9A 4K0KH 3BQ2A 4DLKA 4IWXA 1T3NA 4MV3A 2W6QA 3VPCA 2VA3A 3DF7A 4CC6A 1T94A 2XD4A 4ZOLF 4EBEA 3T5LA 1JKJB 3RBEA 3V4SA 3PVXA 1A9XA 3PO2G 2JEGA 2JEIA 4AYBE 2B63A 3LMLA 2CKZB 2NVYA 2C35B 4MA5A 4QW8A 4F4YA 4Q8EA 4RB0A 3BQ0A 5KFIA 4DR3H 2XCLA 5KFXA 5KFNA 4LSXA 4X66H 5DQIA 4B3MH 3G6XA 1X9NA 4YR2A 3KALA 3RBDA 1EYZA 5KFPA 2RDIA 5DGBA 2V59A 3ETJA 3RTXA 4LF9H 3BQ1A 3LP8A 1GSHA 3GIKA 1JXLA 4DL7A 4JI4H 4DR7H 4JYAH 1Y1WA 4ECXA 3JSNA 5KFTA 2Q2UA 3LWBA 4GKJH 1N56A 3Q8PB 1S68A 3OHBA 4FS1A 2HVRA 3KHRA 4QW9A 4MV7A 2FPIB 3HB9A 4DL2A 4JI1H 4DV5H 4ECSA 2FMAA 3QFFA 1Z2PX 5HBRB 5FLMG 1I3QA 3I4NG 1OWTA 2GPSA 3I4MG 4IHJF 1JDBB 3PW5A 1SFOA 5D1OA 4BY1G 2I80A 4Y8VB 2YU9A 2JA8G 1TWAA 5C1PA 2IBKA 3HOVG 1KBLA 3GILA 4DR1H 2UVWA 4RUAA 2RDJA 4HQ6A 2VUMG 1MZBA 5KT2A 4A93G 2V58A 3H4DA 4J9LA 3OUZA 1TWFA 2W6ZA 4JI0H 5KFOA 5DQHA 4ECVA 3U9SA 3J81W 4JV0A 2HJWA 3Q1KA 3HOXG 4EEYA 1XMOH 3GV8B 3N40P 2R7LA 4LFAH 1KJJA 1T36A 5IP7G 2R6FA 2R92G 4ECRA 2ASDA 4BBRG 4I4TF 4JI5H 4CC5A 1JX4A 2V9WA 4O3NA 2WAQA 1IBMH 1BXRA 2WYOA 3KHLA 2NU8B 1KEEA 4DUYH 2BR0A 4WD3A 4JI8H 4ZHQF 4KHPH 1RK6A 2ZDHA 5L1JA 4O4HF 3PW0A 4LF6H 2R7NA 4QWBA 3M9NB 2J6TA 2OLSA 2W7OA 3RF2A 3RV4A 4C5CA 3OSNA 3GV7B 1ULZA 4RZRA 2HVSA 4EBDA 3RB3A 1JLLB 3MWDA 3GTQA 4Q43A 2NVXA 1AUXA 2ALZA 4LF4H 5KFHA 2R93A 3VPDA 2C22A 1RJPA 3JAMW 5JVLA 1GLVA 1K1QA 2R7MA 5LMNH 1VKZA 4EBCA 5DG9A 2V5AA 5LYJF 2SCUB 3PO3G 1IOVA 2R8GA 4EFBA 3PW4A 1CQJB 3RIZA 1W93A 5KKNB 2UXCH 1P8LA 1TWGA 4IWYA 5L1LA 1ZETA 1VAJA 4R7RA 4DR2H 4DV6H 2HGSA 2DPJA 2R7ZG 1WCMA 5LOVF 1EUDB 3GIMA 3RB4A 3GTMA 1L2ZA 2AGQA 1Y1WG 5DQGA 2W6NA 3T1HH 2W8LA 5BMVF 2CW8A 5GONF 1S03G 2VQFH 4AYBA 1VBHA 4O2AF 4A3BG 1PX2A 3ORRA 4X64H 4ED8A 2FB9A 1UNNC 1E4GT 4G3IA 4ZQIA 2WTFA 5DGAA 1N33H 3GQCA 2R7ZA 1KJ9A 4X62H 4UCOA 4RU9A 2Q2TA 4LFCH 1N32H 1VS0A 4IAJA 2R86A 4C5AA 4JI2H 4A3EG 3RFCA 3Q8RB 4J9QA 2I87A 5IWAH 2R7KA 3E5NA 4X65H 1RYRA 4A3IG 1S10A 3C0FB 3H0GG 4F4WA 2ASLA 3L2PA 5KFLA 4MV1A 2I8CA 3GIPA 2MCTA 4UFZA 5EWFA 4RUCA 4RB3C 4GLXA 4FBTA 1XMQH 4JI6H 3HKZE 3GTOA 4DV4H 4ECQA 3T1YH 4EG0A 3V6KA 1I7LA 5KFJA 1M7JA 4F4XA 5DLFA 4C5BA 4F4ZA 5J2UF 3R5XA 5KFYA 2BQRA 5KFRA 4JV5H 4YAJB 4GKKH 2VQEH 4J9PA 4DL4A 3Q8SB 1TA8A 3AYHB 3RGZA 5KFWA 3GV5B 4PDBA 5KFDA 4J9NA 5BR8H 2R8KA 1XDNA 3RAXA 1GSOA 5C5JA 4DV1H 1Y1VA 2R85A 1RYSA 3RB6A 4EYIB 1I50A 3UQ8A 2W8KA 4NXMH 2O03A 2WB1E 2X0SA 5KT5A 2AGPA 4FM9A 4LF8H 2WB1A 3EYYA 4ME6A 2W9AA 4A3FG 4MTDA 1S97A 4ETSA 4YR3A 5I47A 2FPPB 4EFEA 1K1SA 1HNWH 4APMA 5KFFA 4R8UB 4DV3H 4A3CG 4MA0A 4YB8B 2UXBH 1UC8A 1J5EH 1B33N 1C30A 3QZ7A 4A3GG 3MR5A 5C44G 4UCTA 3GTKA 4LH6A 2YW2A 2IMWP 1HNXH 3GTJA 1E4EA 5L9XA 5KFGA 4LMYA 2PMZA 5FPOA 2R84A 3MWMA 5BPFA 4RB2C 5JH7F 2ZM6H 5EZYF 2FPGB 2C2DA 4IZOA 2JA7G 3K5HA 4LFBH 5L1IA 5KT4A 5KG4A 4JV2A 2UXDH 4YY3H 4B3RH 2Y0SA 4B3SH 2M05A 3EPGA 4J0MA 1W96A 2FLLA 3MJFA 2E2IA 2XGPA 3TIGA 3FKIG 3KXYT 1Y14B 5LXTF 2FP4B 4RZQA 1FKAH 4JUZA 5EOYA 4BWSC 2ZDQA 4BXXG 4EEQA 2DWCA 5FPRA 1DV2A 4ED3A 2W9BB 4A3DG 5LL6b 4YQWA 3BABA 4XYLB 2W6OA 1CQIB 4HNVA 5C8YF 2VUGA 4QWCA 3PW7A 2DPIA 2UUCH 5IYZF 2E2HA 2PVPA 4BY7G 3K5IA 4MV9A 5KG3A 4YJ2F 3VPBA 5F9NA 4DR4H 4O2BF 1GYFA 1N34H 4DL5A 5KFUA 1DIKA 3N42B 3MR2A 3MFHA 1R9TA 1B6SA 3BAAA 1V51A 5F9LA 5IYCG 4QWEA 3OHAA 3N6XA 4O4LF 3WNZA 4YR0A 4UCSA 1B6RA 4YBZB 1V4YA 4XX0B 4MV4A 2PBZA 4U6PA 1N48A 1E4EB 3TIIA 5KT3A 5CB4F 5J2TF 5EDWA 2C00A 1IBLH 2HHHH 2VPSA 3RJ0A 3M9OB 3H20A 2OWOA 3L4KA 5IT9W 4DV2H 1KJIA 1GGOA 1CS0A 3MWEA 4ECYA 1I94H 4O3SA 1GSAA 5KFEA 5KX5F 4QJFA 1WCMG 3GTGA
chains in the Genus database with same CATH topology
4GLXA 1HR0H 4UCUA 1XMQH 4JI6H 1S68A 4DV4H 2WE6A 2HVRA 3T1YH 4NXNH 3BA9A 4MV7A 4JI1H 4DV5H 5FLXW 1Z2PX 1Z2OX 3CVZA 4LF7H 4JV5H 4GKKH 2VQEH 4RB1A 2YCHA 1TA8A 3RGZA 4OX9H 5D1OA 3N43B 4PDBA 1XNQH 5D1OB 1FVIA 1XDNA 5BR8H 2E5LH 2F4VH 3OTOH 4DV1H 4DR1H 1IBKH 2CW7A 3JSLA 3UQ8A 4NXMH 2VOBA 5D1PA 2O03A 1MZBA 4LF8H 4FM9A 4DV0H 4JI0H 3BA8A 3J81W 3EYYA 4Q0YA 1XMOH 4MTDA 1M0TA 3N40P 4GKJH 4ETSA 4LFAH 1Z2NX 2W57A 4RAYA 4EFEA 1HNWH 4JI5H 4CC5A 4APMA 4UFZA 2FE3A 5FD5A 4DV3H 1AN7A 1IBMH 4I7HA 2WYOA 2XIGA 4DUYH 1DGSA 4JI8H 4KHPH 1I6UA 2UXBH 1J5EH 4LF6H 3IG0A 3KAKA 1N36H 2UUAH 3RF2A 4UCTA 4UCRA 4LH6A 5LMUH 1HNXH 4JI7H 2HVSA 1TAEA 5A2QW 4LMYA 2UU9H 5FPOA 4M7EA 4A2AA 4LF4H 4MTEA 3MWMA 4RB2C 1SYXB 2ZM6H 2RGRA 1M0WA 3JAMW 4LSAA 4DR5H 4DUZH 5FD6A 4LFBH 3N44B 4YHHH 1HNZH 2RGVA 5LMNH 2ZJTA 4B3TH 4UCVA 2UXDH 1V9PA 4YY3H 4B3RH 4EFBA 4B3SH 4J0MA 3RIZA 3J7AK 1B04A 3M4IA 3HXLA 2UXCH 1P8LA 4LH7A 1BJTA 4DR6H 4R7RA 3J80W 3KXYT 4DR2H 3K3VA 4DV6H 1A0IA 2HGSA 2UUBH 1ZHQA 4RZQA 4A2BA 1FKAH 5EOYA 4BWSC 3F8NA 3FMAA 1BGWA 2WDTA 4EEQA 3RGXA 1L2ZA 3L4JA 5FPRA 1O75A 4K0KH 4RAZA 3T1HH 5LL6b 3BABA 2UUCH 2CW8A 2VUGA 3DF7A 4CC6A 3KAJA 1XNRH 1S03G 2VQFH 3PN1A 4MV9A 1GYFA 4DR4H 3LMLA 1N34H 3N42B 4X64H 3BAAA 4RB0A 1FJGH 1E4GT 4DV7H 1SEIA 4DR3H 4LF5H 3N6XA 1N33H 4LSXA 1E4FT 2HVQA 4UCSA 4X66H 1WH2A 2KSWA 4X62H 1X9NA 4UCOA 2Q2TA 4B3MH 4LFCH 3KALA 1VS0A 1N32H 4IAJA 4JI2H 3RTXA 2HHHH 1IBLH 1ZHSA 4LF9H 4JI3H 2OWOA 2VPSA 3RJ0A 5IWAH 3H20A 5IT9W 3L4KA 4X65H 4DV2H 1I94H 4JI4H 4DR7H 3C0FB 4JYAH 3JSNA 3L2PA 4RB3C 4AQYH 2MCTA 2Q2UA 3N41B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  3IG0 A;  2ZJT A; 
#chains in the Genus database with same CATH topology
 4C2M A;  1HR0 H;  4MAM A;  4PWQ A;  2YRX A;  4IR1 A;  5CAE B;  5KG0 A;  3Q2O A;  3ORQ A;  5KT7 A;  2WE6 A;  3M9M B;  2R8I A;  2YZG A;  1C3O A;  4FBU A;  3HOZ G;  3V4Z A;  5FLX W;  2OH2 A;  1Z2O X;  3CVZ A;  3JZI A;  4LF7 H;  3PR4 A;  4EGQ A;  2YCH A;  2YYA A;  3PR5 B;  4ED1 A;  3V6J A;  4Q45 A;  3RB0 A;  4YAK B;  3FKI A;  4O3R A;  5D1O B;  1FVI A;  2R93 G;  2F4V H;  5KG6 A;  5KFK A;  3OTO H;  2YZN A;  2V4Q A;  2C2R A;  5DG7 A;  2C28 A;  3JSL A;  4GC7 A;  5CA0 F;  2W9B A;  2VOB A;  1DV1 A;  5D1P A;  4HYK A;  2UVV A;  4XZ3 B;  1TWH A;  4L1K A;  5KFA A;  2XC9 A;  5KFZ A;  3BA8 A;  2CQY A;  4FS2 A;  2JA5 G;  2JA7 A;  3WO1 A;  3NGD A;  2NU9 B;  1Z2N X;  4A3J G;  4RAY A;  3OSP A;  4TV8 F;  5IYD G;  4IRD A;  3G6Y A;  5KG2 A;  1AUV A;  5K2M A;  2FE3 A;  5FD5 A;  4RNO A;  2BQU A;  3HOY G;  4I7H A;  3HOU G;  1I6U A;  5T14 A;  5H80 A;  2J6U A;  2UVR A;  2CZG A;  4A3M G;  3KAK A;  5LA6 F;  3GIQ A;  3T5J A;  2C2E A;  4WBN F;  4UCR A;  3EPI A;  2W71 A;  4Q8F A;  2J9G A;  1TAE A;  5CA1 F;  5A2Q W;  2VUM A;  5HV6 A;  2UU9 H;  2V4R A;  4M7E A;  1GO3 E;  3PZP A;  2YL2 A;  4MTE A;  2B63 G;  5KFC A;  2RGR A;  2YRW A;  4DR5 H;  4DUZ H;  3UFX B;  5FD6 A;  4FU0 A;  4HNT A;  1HNZ H;  4YP3 A;  2ZJT A;  4B3T H;  2AGO A;  4IRC A;  5KFQ A;  3IN5 A;  2FKL A;  3GTP A;  4RNM A;  1JDE A;  3GID A;  2YZM A;  3BJY A;  3KTM A;  3J7A K;  1B04 A;  2FJZ A;  4ED2 A;  2YS7 A;  4LH7 A;  4DR6 H;  5DG8 A;  5KG1 A;  3J80 W;  2GPW A;  5KG7 A;  4U7C A;  1S0N A;  1A0I A;  4DL6 A;  2XCA A;  4QWD A;  4ECT A;  3F8N A;  3SE7 A;  4DL3 A;  3RGX A;  2RF4 A;  3KHG A;  3L4J A;  2QYZ A;  5C4X G;  1EZ1 A;  2NU6 B;  4RAZ A;  3T5H A;  4E4T A;  3N8D A;  1WR2 A;  2ATL A;  2FK3 A;  4TQS A;  3KAJ A;  1XNR H;  2WAQ E;  3H3V H;  3PN1 A;  2Y0S E;  1JIH A;  2NUA B;  3TIN A;  2YS6 A;  1RJQ A;  1FJG H;  5JQW A;  4DV7 H;  1SEI A;  4LF5 H;  2ZDG A;  2R82 A;  2DIK A;  1E4F T;  2HVQ A;  2VQD A;  4J9R A;  1WH2 A;  2KSW A;  2AU0 A;  3CQZ A;  4MV6 A;  5FJ8 G;  1CE8 A;  1K83 A;  4XYM B;  1ZHS A;  3QZ8 A;  4JI3 H;  1UC9 A;  2FLP A;  3R5F A;  4O3P A;  4ED7 A;  3FDS A;  1EUC B;  3R23 A;  4AQY H;  3Q8Q B;  2R87 A;  3N41 B;  2JEF A;  5L1K A;  3MR6 A;  1BNC A;  4UCU A;  4I50 F;  4MV8 A;  4NXN H;  4J9K A;  3BA9 A;  3MR3 A;  3KHH A;  1RJR A;  2IP4 A;  2XCP A;  3OUU A;  2W70 A;  4EYH B;  1KJQ A;  3V6H A;  4RB1 A;  2JA6 A;  4QIW A;  5JUM A;  5KFV A;  4OX9 H;  5EWE A;  3N43 B;  4NLG A;  3JRW A;  5C1O A;  2VA2 A;  4J9S A;  4F50 A;  1XNQ H;  1ZQ7 A;  3ETH A;  5D8D A;  2E5L H;  3RAQ A;  1S0M A;  3I12 A;  2W6P A;  4A3L G;  1I7N A;  1IBK H;  1VBG A;  4O3O A;  4EGJ A;  2CW7 A;  1KJ8 A;  4ECZ A;  5KFM A;  3G8C A;  5KFB A;  4ED6 A;  4A3K G;  2W6M A;  4HNU A;  3HKZ A;  4TUY F;  2W9C B;  2AQ4 A;  4DV0 H;  2UVU A;  5KFS A;  2XGQ A;  4I55 F;  4Q0Y A;  3PW2 A;  1M0T A;  4JV1 A;  1S9F A;  2W57 A;  5IYB G;  3K3P A;  2W7P A;  4GC6 A;  5DLG A;  2PN1 A;  4J9O A;  4IRK A;  5KT6 A;  2R8H A;  3H0G A;  1PK8 A;  1AN7 A;  2R8J A;  4QIW E;  2XIG A;  4BBS G;  4R8U A;  1DGS A;  3H4B A;  2DZD A;  2VPQ A;  2VR1 A;  2BQ3 A;  3U9T A;  2P0A A;  3IG0 A;  1RK5 A;  1N36 H;  3MFI A;  2UUA H;  2GLT A;  3GLK A;  3RUP A;  5LMU H;  1WSC A;  4JI7 H;  1TWC A;  2NU7 B;  4YJ3 F;  5LP6 F;  4A2A A;  4M9U A;  5C3E G;  1Y1V G;  4TV9 F;  2R92 A;  3BG5 A;  5KG5 A;  3G6V A;  3JRX A;  1SYX B;  2DLN A;  5IP9 G;  1M0W A;  3R5H A;  4LSA A;  1SCU B;  3VMM A;  3N44 B;  5BPH A;  4Q44 A;  4YHH H;  4J9M A;  4ECW A;  2RGV A;  4HR7 A;  3HOW G;  2IA6 A;  4UCV A;  3WO0 A;  2JEJ A;  1V9P A;  1IOW A;  4RNN A;  1KC7 A;  3TQ1 A;  2FK1 A;  5EWG A;  4O3Q A;  4QWA A;  2JA6 G;  3RV3 A;  2FLN A;  2FK2 A;  3M4I A;  3HXL A;  2QK4 A;  4ZI7 F;  1BJT A;  4O4I F;  3K3V A;  3GII A;  3TQT A;  1M6V A;  2PMZ E;  3GIJ A;  1S0O A;  2UUB H;  1ZHQ A;  2J6S A;  4A2B A;  1EHI A;  2JA5 A;  3SI8 A;  4ED0 A;  3FMA A;  1BGW A;  2WDT A;  4TQR A;  2W9C A;  3T5K A;  3GTL A;  3HBL A;  1O75 A;  5JVD F;  3H40 A;  4ECU A;  2ASJ A;  4IR9 A;  4K0K H;  3BQ2 A;  4DLK A;  4IWX A;  1T3N A;  4MV3 A;  2W6Q A;  3VPC A;  2VA3 A;  3DF7 A;  4CC6 A;  1T94 A;  2XD4 A;  4ZOL F;  4EBE A;  3T5L A;  1JKJ B;  3RBE A;  3V4S A;  3PVX A;  1A9X A;  3PO2 G;  2JEG A;  2JEI A;  4AYB E;  2B63 A;  3LML A;  2CKZ B;  2NVY A;  2C35 B;  4MA5 A;  4QW8 A;  4F4Y A;  4Q8E A;  4RB0 A;  3BQ0 A;  5KFI A;  4DR3 H;  2XCL A;  5KFX A;  5KFN A;  4LSX A;  4X66 H;  5DQI A;  4B3M H;  3G6X A;  1X9N A;  4YR2 A;  3KAL A;  3RBD A;  1EYZ A;  5KFP A;  2RDI A;  5DGB A;  2V59 A;  3ETJ A;  3RTX A;  4LF9 H;  3BQ1 A;  3LP8 A;  1GSH A;  3GIK A;  1JXL A;  4DL7 A;  4JI4 H;  4DR7 H;  4JYA H;  1Y1W A;  4ECX A;  3JSN A;  5KFT A;  2Q2U A;  3LWB A;  4GKJ H;  1N56 A;  3Q8P B;  1S68 A;  3OHB A;  4FS1 A;  2HVR A;  3KHR A;  4QW9 A;  4MV7 A;  2FPI B;  3HB9 A;  4DL2 A;  4JI1 H;  4DV5 H;  4ECS A;  2FMA A;  3QFF A;  1Z2P X;  5HBR B;  5FLM G;  1I3Q A;  3I4N G;  1OWT A;  2GPS A;  3I4M G;  4IHJ F;  1JDB B;  3PW5 A;  1SFO A;  5D1O A;  4BY1 G;  2I80 A;  4Y8V B;  2YU9 A;  2JA8 G;  1TWA A;  5C1P A;  2IBK A;  3HOV G;  1KBL A;  3GIL A;  4DR1 H;  2UVW A;  4RUA A;  2RDJ A;  4HQ6 A;  2VUM G;  1MZB A;  5KT2 A;  4A93 G;  2V58 A;  3H4D A;  4J9L A;  3OUZ A;  1TWF A;  2W6Z A;  4JI0 H;  5KFO A;  5DQH A;  4ECV A;  3U9S A;  3J81 W;  4JV0 A;  2HJW A;  3Q1K A;  3HOX G;  4EEY A;  1XMO H;  3GV8 B;  3N40 P;  2R7L A;  4LFA H;  1KJJ A;  1T36 A;  5IP7 G;  2R6F A;  2R92 G;  4ECR A;  2ASD A;  4BBR G;  4I4T F;  4JI5 H;  4CC5 A;  1JX4 A;  2V9W A;  4O3N A;  2WAQ A;  1IBM H;  1BXR A;  2WYO A;  3KHL A;  2NU8 B;  1KEE A;  4DUY H;  2BR0 A;  4WD3 A;  4JI8 H;  4ZHQ F;  4KHP H;  1RK6 A;  2ZDH A;  5L1J A;  4O4H F;  3PW0 A;  4LF6 H;  2R7N A;  4QWB A;  3M9N B;  2J6T A;  2OLS A;  2W7O A;  3RF2 A;  3RV4 A;  4C5C A;  3OSN A;  3GV7 B;  1ULZ A;  4RZR A;  2HVS A;  4EBD A;  3RB3 A;  1JLL B;  3MWD A;  3GTQ A;  4Q43 A;  2NVX A;  1AUX A;  2ALZ A;  4LF4 H;  5KFH A;  2R93 A;  3VPD A;  2C22 A;  1RJP A;  3JAM W;  5JVL A;  1GLV A;  1K1Q A;  2R7M A;  5LMN H;  1VKZ A;  4EBC A;  5DG9 A;  2V5A A;  5LYJ F;  2SCU B;  3PO3 G;  1IOV A;  2R8G A;  4EFB A;  3PW4 A;  1CQJ B;  3RIZ A;  1W93 A;  5KKN B;  2UXC H;  1P8L A;  1TWG A;  4IWY A;  5L1L A;  1ZET A;  1VAJ A;  4R7R A;  4DR2 H;  4DV6 H;  2HGS A;  2DPJ A;  2R7Z G;  1WCM A;  5LOV F;  1EUD B;  3GIM A;  3RB4 A;  3GTM A;  1L2Z A;  2AGQ A;  1Y1W G;  5DQG A;  2W6N A;  3T1H H;  2W8L A;  5BMV F;  2CW8 A;  5GON F;  1S03 G;  2VQF H;  4AYB A;  1VBH A;  4O2A F;  4A3B G;  1PX2 A;  3ORR A;  4X64 H;  4ED8 A;  2FB9 A;  1UNN C;  1E4G T;  4G3I A;  4ZQI A;  2WTF A;  5DGA A;  1N33 H;  3GQC A;  2R7Z A;  1KJ9 A;  4X62 H;  4UCO A;  4RU9 A;  2Q2T A;  4LFC H;  1N32 H;  1VS0 A;  4IAJ A;  2R86 A;  4C5A A;  4JI2 H;  4A3E G;  3RFC A;  3Q8R B;  4J9Q A;  2I87 A;  5IWA H;  2R7K A;  3E5N A;  4X65 H;  1RYR A;  4A3I G;  1S10 A;  3C0F B;  3H0G G;  4F4W A;  2ASL A;  3L2P A;  5KFL A;  4MV1 A;  2I8C A;  3GIP A;  2MCT A;  4UFZ A;  5EWF A;  4RUC A;  4RB3 C;  4GLX A;  4FBT A;  1XMQ H;  4JI6 H;  3HKZ E;  3GTO A;  4DV4 H;  4ECQ A;  3T1Y H;  4EG0 A;  3V6K A;  1I7L A;  5KFJ A;  1M7J A;  4F4X A;  5DLF A;  4C5B A;  4F4Z A;  5J2U F;  3R5X A;  5KFY A;  2BQR A;  5KFR A;  4JV5 H;  4YAJ B;  4GKK H;  2VQE H;  4J9P A;  4DL4 A;  3Q8S B;  1TA8 A;  3AYH B;  3RGZ A;  5KFW A;  3GV5 B;  4PDB A;  5KFD A;  4J9N A;  5BR8 H;  2R8K A;  1XDN A;  3RAX A;  1GSO A;  5C5J A;  4DV1 H;  1Y1V A;  2R85 A;  1RYS A;  3RB6 A;  4EYI B;  1I50 A;  3UQ8 A;  2W8K A;  4NXM H;  2O03 A;  2WB1 E;  2X0S A;  5KT5 A;  2AGP A;  4FM9 A;  4LF8 H;  2WB1 A;  3EYY A;  4ME6 A;  2W9A A;  4A3F G;  4MTD A;  1S97 A;  4ETS A;  4YR3 A;  5I47 A;  2FPP B;  4EFE A;  1K1S A;  1HNW H;  4APM A;  5KFF A;  4R8U B;  4DV3 H;  4A3C G;  4MA0 A;  4YB8 B;  2UXB H;  1UC8 A;  1J5E H;  1B33 N;  1C30 A;  3QZ7 A;  4A3G G;  3MR5 A;  5C44 G;  4UCT A;  3GTK A;  4LH6 A;  2YW2 A;  2IMW P;  1HNX H;  3GTJ A;  1E4E A;  5L9X A;  5KFG A;  4LMY A;  2PMZ A;  5FPO A;  2R84 A;  3MWM A;  5BPF A;  4RB2 C;  5JH7 F;  2ZM6 H;  5EZY F;  2FPG B;  2C2D A;  4IZO A;  2JA7 G;  3K5H A;  4LFB H;  5L1I A;  5KT4 A;  5KG4 A;  4JV2 A;  2UXD H;  4YY3 H;  4B3R H;  2Y0S A;  4B3S H;  2M05 A;  3EPG A;  4J0M A;  1W96 A;  2FLL A;  3MJF A;  2E2I A;  2XGP A;  3TIG A;  3FKI G;  3KXY T;  1Y14 B;  5LXT F;  2FP4 B;  4RZQ A;  1FKA H;  4JUZ A;  5EOY A;  4BWS C;  2ZDQ A;  4BXX G;  4EEQ A;  2DWC A;  5FPR A;  1DV2 A;  4ED3 A;  2W9B B;  4A3D G;  5LL6 b;  4YQW A;  3BAB A;  4XYL B;  2W6O A;  1CQI B;  4HNV A;  5C8Y F;  2VUG A;  4QWC A;  3PW7 A;  2DPI A;  2UUC H;  5IYZ F;  2E2H A;  2PVP A;  4BY7 G;  3K5I A;  4MV9 A;  5KG3 A;  4YJ2 F;  3VPB A;  5F9N A;  4DR4 H;  4O2B F;  1GYF A;  1N34 H;  4DL5 A;  5KFU A;  1DIK A;  3N42 B;  3MR2 A;  3MFH A;  1R9T A;  1B6S A;  3BAA A;  1V51 A;  5F9L A;  5IYC G;  4QWE A;  3OHA A;  3N6X A;  4O4L F;  3WNZ A;  4YR0 A;  4UCS A;  1B6R A;  4YBZ B;  1V4Y A;  4XX0 B;  4MV4 A;  2PBZ A;  4U6P A;  1N48 A;  1E4E B;  3TII A;  5KT3 A;  5CB4 F;  5J2T F;  5EDW A;  2C00 A;  1IBL H;  2HHH H;  2VPS A;  3RJ0 A;  3M9O B;  3H20 A;  2OWO A;  3L4K A;  5IT9 W;  4DV2 H;  1KJI A;  1GGO A;  1CS0 A;  3MWE A;  4ECY A;  1I94 H;  4O3S A;  1GSA A;  5KFE A;  5KX5 F;  4QJF A;  1WCM G;  3GTG A; 
#chains in the Genus database with same CATH homology
 4GLX A;  1HR0 H;  4UCU A;  1XMQ H;  4JI6 H;  1S68 A;  4DV4 H;  2WE6 A;  2HVR A;  3T1Y H;  4NXN H;  3BA9 A;  4MV7 A;  4JI1 H;  4DV5 H;  5FLX W;  1Z2P X;  1Z2O X;  3CVZ A;  4LF7 H;  4JV5 H;  4GKK H;  2VQE H;  4RB1 A;  2YCH A;  1TA8 A;  3RGZ A;  4OX9 H;  5D1O A;  3N43 B;  4PDB A;  1XNQ H;  5D1O B;  1FVI A;  1XDN A;  5BR8 H;  2E5L H;  2F4V H;  3OTO H;  4DV1 H;  4DR1 H;  1IBK H;  2CW7 A;  3JSL A;  3UQ8 A;  4NXM H;  2VOB A;  5D1P A;  2O03 A;  1MZB A;  4LF8 H;  4FM9 A;  4DV0 H;  4JI0 H;  3BA8 A;  3J81 W;  3EYY A;  4Q0Y A;  1XMO H;  4MTD A;  1M0T A;  3N40 P;  4GKJ H;  4ETS A;  4LFA H;  1Z2N X;  2W57 A;  4RAY A;  4EFE A;  1HNW H;  4JI5 H;  4CC5 A;  4APM A;  4UFZ A;  2FE3 A;  5FD5 A;  4DV3 H;  1AN7 A;  1IBM H;  4I7H A;  2WYO A;  2XIG A;  4DUY H;  1DGS A;  4JI8 H;  4KHP H;  1I6U A;  2UXB H;  1J5E H;  4LF6 H;  3IG0 A;  3KAK A;  1N36 H;  2UUA H;  3RF2 A;  4UCT A;  4UCR A;  4LH6 A;  5LMU H;  1HNX H;  4JI7 H;  2HVS A;  1TAE A;  5A2Q W;  4LMY A;  2UU9 H;  5FPO A;  4M7E A;  4A2A A;  4LF4 H;  4MTE A;  3MWM A;  4RB2 C;  1SYX B;  2ZM6 H;  2RGR A;  1M0W A;  3JAM W;  4LSA A;  4DR5 H;  4DUZ H;  5FD6 A;  4LFB H;  3N44 B;  4YHH H;  1HNZ H;  2RGV A;  5LMN H;  2ZJT A;  4B3T H;  4UCV A;  2UXD H;  1V9P A;  4YY3 H;  4B3R H;  4EFB A;  4B3S H;  4J0M A;  3RIZ A;  3J7A K;  1B04 A;  3M4I A;  3HXL A;  2UXC H;  1P8L A;  4LH7 A;  1BJT A;  4DR6 H;  4R7R A;  3J80 W;  3KXY T;  4DR2 H;  3K3V A;  4DV6 H;  1A0I A;  2HGS A;  2UUB H;  1ZHQ A;  4RZQ A;  4A2B A;  1FKA H;  5EOY A;  4BWS C;  3F8N A;  3FMA A;  1BGW A;  2WDT A;  4EEQ A;  3RGX A;  1L2Z A;  3L4J A;  5FPR A;  1O75 A;  4K0K H;  4RAZ A;  3T1H H;  5LL6 b;  3BAB A;  2UUC H;  2CW8 A;  2VUG A;  3DF7 A;  4CC6 A;  3KAJ A;  1XNR H;  1S03 G;  2VQF H;  3PN1 A;  4MV9 A;  1GYF A;  4DR4 H;  3LML A;  1N34 H;  3N42 B;  4X64 H;  3BAA A;  4RB0 A;  1FJG H;  1E4G T;  4DV7 H;  1SEI A;  4DR3 H;  4LF5 H;  3N6X A;  1N33 H;  4LSX A;  1E4F T;  2HVQ A;  4UCS A;  4X66 H;  1WH2 A;  2KSW A;  4X62 H;  1X9N A;  4UCO A;  2Q2T A;  4B3M H;  4LFC H;  3KAL A;  1VS0 A;  1N32 H;  4IAJ A;  4JI2 H;  3RTX A;  2HHH H;  1IBL H;  1ZHS A;  4LF9 H;  4JI3 H;  2OWO A;  2VPS A;  3RJ0 A;  5IWA H;  3H20 A;  5IT9 W;  3L4K A;  4X65 H;  4DV2 H;  1I94 H;  4JI4 H;  4DR7 H;  3C0F B;  4JYA H;  3JSN A;  3L2P A;  4RB3 C;  4AQY H;  2MCT A;  2Q2U A;  3N41 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...