2ZJTA

Crystal structure of dna gyrase b' domain sheds lights on the mechanism for t-segment navigation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
185
Chain Sequence
FTDPRKSELYVVEGDMFQAILPLRGKDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 51
structure length 185
sequence length 206
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2zjtA02
3IG0A 3M4IA 2ZJTA
chains in the Genus database with same CATH superfamily
5FD5A 2VOBA 4Q43A 4JI6H 2WDTA 4LF7H 5KG3A 4ED3A 4ECYA 2V59A 2PVPA 5FD6A 2XCPA 4E4TA 2FLLA 2WTFA 4ED1A 2JEJA 5K2MA 2R92A 2XIGA 2GPSA 4DL2A 2UUCH 2R8KA 3H4DA 2R93A 4Q44A 2I80A 1RJRA 2B63A 3RGXA 3HOUG 5KT6A 3Q2OA 3GIQA 3M9MB 3V6JA 2BR0A 1FJGH 4DV4H 3U9SA 5C4XG 4GLXA 1E4GT 2FLPA 3E5NA 1TWHA 5GONF 5LYJF 3MWEA 5KFTA 5CB4F 1X9NA 2FPIB 5C3EG 4R8UA 1A9XA 2W9AA 4DL5A 4BXXG 1EUDB 2VQFH 1UNNC 3RV4A 2YZMA 3T5JA 2XC9A 3GIMA 5KFNA 5DG7A 1T3NA 3G8CA 4MA5A 1S0OA 4RAZA 4RB2C 3GV7B 2DWCA 4NLGA 4DR3H 5LA6F 2ASLA 2W71A 5LOVF 5KG6A 4JI3H 2AGQA 5DQIA 3LWBA 4A3KG 1PK8A 2VPSA 1W93A 2Y0SA 3GIPA 3M4IA 5KX5F 2W9CB 4EBCA 2J6TA 4LFBH 3VPCA 5KFOA 4ECXA 2R7LA 4X66H 5F9NA 5D1OB 4DL3A 3H3VH 5BPHA 4U6PA 4YR3A 3H4BA 3I12A 4ED8A 2JEIA 5I47A 4ZHQF 2VUMG 5KT4A 2E2HA 1SYXB 3N42B 4ED7A 1S9FA 1EUCB 3G6XA 3V4SA 3KXYT 1AUVA 3BA9A 5KFZA 3KHRA 4DR6H 4QIWE 2YZNA 4EFEA 3RGZA 5KG2A 4RU9A 1VS0A 1BXRA 2RF4A 1RJQA 4IRCA 3J7AK 1T94A 1BJTA 4EEYA 4Q8FA 4TV9F 3RJ0A 4O3SA 3GILA 3CQZA 1N33H 3TINA 1Z2NX 3GIDA 4JV5H 2WE6A 4X64H 3PW5A 4DR4H 1B6SA 3Q8PB 1RK6A 4IR9A 5IWAH 4GKKH 3SI8A 3MR3A 5KFEA 1E4EB 3TIIA 1XNQH 2W6MA 4J0MA 3Q8SB 1PX2A 2R7ZG 2J6UA 1I94H 4A93G 1ZHQA 3NGDA 5KG4A 3N40P 2HVSA 1EYZA 1DIKA 2XGQA 4ECSA 1BGWA 4C2MA 1K1QA 3C0FB 3L2PA 3IN5A 5EDWA 1W96A 2P0AA 2V4RA 1GYFA 1N36H 3V4ZA 5JUMA 1IBLH 3R5FA 4EGQA 3I4NG 1M0WA 1ZQ7A 2XCLA 3DF7A 4ECUA 2YS7A 4ECTA 4A3GG 5KFYA 3WNZA 3M9OB 3BAAA 4RNOA 1WSCA 1XMQH 4LF9H 1VAJA 1HNWH 4EYIB 2UVWA 3LMLA 4I55F 4YJ3F 1KC7A 1N48A 4NXNH 1KJ9A 5DLFA 2NVXA 4PDBA 2R8HA 3TIGA 1KJIA 3F8NA 2IBKA 4RB0A 2PN1A 5C1PA 4FM9A 1WCMA 4M9UA 3GTMA 3JRXA 2JEGA 1AN7A 4JI2H 4J9NA 2DZDA 2E2IA 3GTOA 4ZOLF 4UFZA 4RUCA 2DPIA 2UXCH 2I8CA 1Y14B 4MTEA 4R7RA 1GSOA 3MWMA 5L9XA 4RB3C 4FBTA 2BQRA 1JLLB 2W9CA 2XD4A 2FPPB 5L1LA 2Q2TA 3T1HH 1I50A 3JSNA 3CVZA 4DL7A 2FLNA 5CAEB 4F4ZA 3RFCA 2HGSA 5D1OA 2NUAB 1S97A 4HNVA 3OUZA 4M7EA 4A3LG 3AYHB 1Y1VA 1KJJA 4XYMB 2GPWA 3R23A 2YRXA 4LF4H 4RZRA 4MTDA 2YW2A 1M0TA 4MV3A 3UFXB 4BWSC 4EYHB 2Y0SE 3N8DA 4TUYF 5H80A 4LSXA 4YP3A 5L1JA 4ECRA 5DGAA 3R5XA 4QW9A 3TQTA 2BQUA 2WAQA 2W70A 3PW0A 5T14A 2R7NA 2VQDA 4TQRA 2RDJA 3RB0A 4XX0B 2ATLA 5LMNH 5C8YF 5A2QW 3KHHA 5KFSA 2ZDHA 2PMZA 2C2DA 2R93G 5DQGA 3Q8QB 3RB3A 4A3BG 1I6UA 3HOZG 2W6ZA 4YAJB 3ORQA 1TWCA 3QFFA 2ZM6H 3FKIA 3JAMW 4IWYA 4L1KA 3PO2G 3G6YA 2RGVA 2DLNA 2C00A 5KG1A 1FKAH 3RBEA 1E4EA 4AYBA 4Y8VB 4I7HA 1CS0A 4HNTA 1I7LA 4O3NA 4IZOA 4DLKA 2R7MA 4J9SA 4JV1A 2CKZB 5KFFA 4O4LF 3SE7A 2R8IA 4DUZH 3OSPA 1TWFA 2VUGA 4DR1H 4PWQA 1GO3E 2W9BB 2HJWA 4HR7A 4GKJH 1P8LA 5KFDA 2XCAA 4J9RA 4GC6A 3KHLA 1E4FT 1IOVA 2I87A 5HBRB 2ZDGA 2C35B 4O3QA 5L1KA 2FMAA 2R92G 4IWXA 2R84A 1S0NA 1SFOA 2O03A 5KFGA 4O4HF 3I4MG 1DV2A 3T5KA 4O3PA 4LSAA 1RJPA 2W57A 2B63G 1XNRH 1HNZH 4DL4A 2VA2A 2VQEH 5FJ8G 1Z2OX 2R82A 2AGOA 3GTQA 2VR1A 3JSLA 3QZ8A 4MV9A 2AU0A 4LMYA 4A3JG 1FVIA 1S10A 4UCUA 1GGOA 2R7KA 1J5EH 1IBKH 5FLXW 4LFCH 4QWBA 3QZ7A 4MV8A 5DGBA 1IBMH 3H0GA 4MV1A 3L4KA 4JUZA 5KFIA 4ME6A 5KG5A 2OLSA 1R9TA 4J9MA 1CQIB 2SCUB 3HOXG 2HVRA 1RK5A 4YHHH 1UC8A 4JI0H 4JI4H 3ORRA 4LFAH 4EBDA 4JI7H 1DGSA 5LL6b 2R6FA 3RUPA 5IYBG 5KFMA 4NXMH 2ASJA 4JI5H 2JA8G 1V4YA 1JX4A 1SEIA 3HKZA 4YB8B 4EG0A 4B3SH 1M7JA 2YL2A 3RBDA 2JA5G 2FK3A 3PO3G 5EZYF 3KAJA 4YY3H 2FP4B 2UUAH 2UXBH 4X65H 5D8DA 1T36A 2RGRA 4DV5H 2YCHA 2FE3A 2AQ4A 4ED0A 5J2UF 3H0GG 4I4TF 4YJ2F 5CA0F 2QK4A 3JRWA 5KKNB 2W7PA 2VPQA 1N34H 1DV1A 5KT2A 4Q8EA 3MJFA 4XYLB 3K5HA 4J9OA 5KFVA 1Z2PX 1JDBB 3KAKA 3GTLA 3N41B 3IG0A 1K83A 2CZGA 4DV1H 2JA5A 2M05A 3HBLA 4LF8H 1L2ZA 3MFIA 3KHGA 1I3QA 4ECQA 2FPGB 2NU6B 2PMZE 5LMUH 5IYZF 3VPBA 2CW8A 4BBRG 3FDSA 2JA6A 4Q45A 5C1OA 3BG5A 5KG7A 1ZETA 1BNCA 1XDNA 1HR0H 2QYZA 2UVUA 4CC6A 5KFBA 2YS6A 4O2AF 4AYBE 2W9BA 1Y1WA 2FK1A 3RV3A 3TQ1A 4LH7A 4UCOA 3RTXA 2CW7A 3BQ0A 3PVXA 4JI8H 4IRDA 2FKLA 3KALA 5EWEA 2IP4A 1GLVA 4FU0A 5KFRA 2WB1A 4J9PA 4A3EG 3OSNA 3BQ1A 2V5AA 3T5HA 2C28A 3RIZA 3G6VA 5L1IA 4FBUA 1WH2A 3FMAA 2V58A 1V9PA 1B04A 1TWAA 4QWCA 3OHAA 5BPFA 3KTMA 4DV6H 2JA7A 1S0MA 4EFBA 3RB4A 4WD3A 3VPDA 3V6KA 3UQ8A 4QWEA 2WYOA 3MR2A 3N44B 4YQWA 4IAJA 4O3OA 2W7OA 3PR5B 2ASDA 4RZQA 4RB1A 3PR4A 1WCMG 5KFXA 4J9LA 4DR5H 5BMVF 4CC5A 4MV6A 4Q0YA 1CQJB 1O75A 3HXLA 4C5BA 4ZQIA 3PW2A 5KFAA 4A3CG 3N6XA 4IR1A 1HNXH 3H20A 4QWAA 3BJYA 2GLTA 5F9LA 4HYKA 2J6SA 3M9NB 4IRKA 5EWGA 4X62H 5KFPA 3GIJA 2IA6A 1TAEA 1GSHA 1Y1VG 1OWTA 4F4WA 4U7CA 2R8JA 4ECWA 3HKZE 5JQWA 3GLKA 4QJFA 5DG9A 4A3MG 1WR2A 4B3RH 5KFHA 4ZI7F 3T1YH 2HHHH 1VKZA 4DR2H 2F4VH 1AUXA 2W6PA 5DLGA 4TQSA 4DV3H 4FS1A 4BBSG 5EWFA 1JIHA 1I7NA 4K0KH 5KFCA 4ED2A 4YAKB 4OX9H 3R5HA 2R85A 3EPGA 2YU9A 2KSWA 2ZJTA 2AGPA 3VMMA 2ALZA 3FKIG 4LH6A 3PW7A 4KHPH 4DV2H 1S03G 2CQYA 2PBZA 3RF2A 3H40A 1JKJB 4FS2A 3GTKA 4BY7G 3GV5B 1S68A 2VUMA 4A2AA 2MCTA 3PW4A 2V4QA 3V6HA 3RB6A 1JDEA 4A3IG 1K1SA 5LXTF 5KFUA 3U9TA 5KT5A 4APMA 2FB9A 5IP9G 1UC9A 4QWDA 3L4JA 5KFWA 1SCUB 5IYCG 5KFLA 2DIKA 2NU7B 4G3IA 2W6NA 5JVDF 3N43B 4ECVA 4B3TH 3BQ2A 3GQCA 1C3OA 2UU9H 1C30A 4O3RA 2R8GA 3GIKA 2OH2A 5KT3A 4A2BA 2C22A 1GSAA 2R86A 5FPRA 1B6RA 3HB9A 3Q1KA 2WB1E 5C5JA 4YR0A 2R7ZA 3EYYA 3LP8A 2W6QA 4BY1G 4B3MH 5DQHA 4RNNA 5KT7A 5KFJA 5KG0A 3HOWG 3K5IA 5JVLA 5EOYA 4UCSA 3RAXA 2VA3A 4DV7H 4LF5H 3MWDA 4UCVA 2E5LH 1EHIA 4XZ3B 1A0IA 4DV0H 2BQ3A 2NVYA 4MV7A 2UUBH 2OWOA 2C2RA 4F4YA 5D1PA 1V51A 2Q2UA 5DG8A 4DR7H 2WAQE 4I50F 5LP6F 4TV8F 4JV0A 4ETSA 5IT9W 1KBLA 4ECZA 1RYSA 2YZGA 4RAYA 2YRWA 2UXDH 2XGPA 2ZDQA 5JH7F 4QW8A 4C5AA 4AQYH 1N56A 1TWGA 4O4IF 4J9QA 1IOWA 3BABA 3ETJA 2R87A 4R8UB 3Q8RB 4J9KA 3J81W 2C2EA 1XMOH 2FJZA 2FK2A 4HQ6A 4WBNF 2V9WA 3PZPA 5BR8H 5FPOA 1KJ8A 3GTJA 1CE8A 5KFQA 5J2TF 4ED6A 2X0SA 4UCTA 2NU8B 4JI1H 2DPJA 5KFKA 4EBEA 4GC7A 2YYAA 4UCRA 1KEEA 3OUUA 3GTPA 4YBZB 4MA0A 1RYRA 5CA1F 1ZHSA 2NU9B 2IMWP 4LF6H 1N32H 3MR5A 2JEFA 1M6VA 1JXLA 3OHBA 4QIWA 5IP7G 2W8KA 4F50A 1KJQA 2JA6G 3JZIA 4A3FG 4HNUA 3EPIA 3ETHA 5HV6A 5C44G 2UVVA 3MFHA 3GTGA 3MR6A 3K3PA 3WO0A 1Y1WG 3PN1A 2J9GA 3K3VA 4RNMA 4A3DG 3HOYG 4DL6A 1VBGA 3WO1A 1VBHA 2W6OA 3RAQA 4IHJF 4JV2A 4MV4A 1TA8A 4F4XA 4O2BF 3OTOH 3T5LA 1EZ1A 4MAMA 3HOVG 4EGJA 5IYDG 2HVQA 4EEQA 3J80W 5FLMG 2UVRA 3GIIA 3BA8A 1ULZA 4YR2A 1B33N 2W8LA 3GV8B 4C5CA 1MZBA 4DUYH 2JA7G 4RUAA 2RDIA 4JYAH
chains in the Genus database with same CATH topology
5FD5A 1AN7A 2VOBA 4JI2H 1N34H 4APMA 4JI6H 2WDTA 4LF7H 3L4JA 5FD6A 4UFZA 2UXCH 4RB3C 1Z2PX 3KAKA 4R7RA 4MTEA 3IG0A 3MWMA 2XIGA 3N41B 3N43B 4DV1H 4B3TH 2Q2TA 2UUCH 4FM9A 2UU9H 3T1HH 3JSNA 3CVZA 4LF8H 3RGXA 1L2ZA 2HGSA 5D1OA 4A2BA 1FJGH 4M7EA 4DV4H 5FPRA 5LMUH 4GLXA 1E4GT 2CW8A 4LF4H 3EYYA 4MTDA 4B3MH 4BWSC 1M0TA 1X9NA 4LSXA 1XDNA 1HR0H 5EOYA 4UCSA 4CC6A 2VQFH 4DV7H 4LF5H 2E5LH 4UCVA 1A0IA 4DV0H 2UUBH 4LH7A 4MV7A 4UCOA 2OWOA 5LMNH 3RTXA 2CW7A 5A2QW 4RAZA 5D1PA 4JI8H 2Q2UA 3KALA 4RB2C 4DR3H 4DR7H 1I6UA 4JI3H 1J5EH 2VPSA 3M4IA 3JAMW 3RIZA 2ZM6H 4ETSA 4LFBH 5IT9W 2RGVA 4RAYA 4X66H 1WH2A 1FKAH 2UXDH 5D1OB 3FMAA 1V9PA 4I7HA 1B04A 4AQYH 4DV6H 4EFBA 1SYXB 3N42B 3BABA 3UQ8A 3J81W 2WYOA 3KXYT 3BA9A 3N44B 4IAJA 1XMOH 4DR6H 4DUZH 4RZQA 4RB1A 2VUGA 4DR1H 4EFEA 3RGZA 4DR5H 4GKJH 4CC5A 4Q0YA 5BR8H 5FPOA 1P8LA 1O75A 1VS0A 3HXLA 4UCTA 3J7AK 4JI1H 3N6XA 1BJTA 3RJ0A 1HNXH 3H20A 1N33H 2O03A 4UCRA 1Z2NX 4JV5H 2WE6A 1ZHSA 4X64H 4LSAA 4LF6H 2W57A 4DR4H 1N32H 4X62H 1XNRH 4GKKH 5IWAH 2VQEH 1TAEA 1Z2OX 3JSLA 1XNQH 4MV9A 4LMYA 4J0MA 1FVIA 1IBKH 4UCUA 1HNZH 4LFCH 5FLXW 1I94H 1ZHQA 2HVSA 3N40P 4B3RH 3T1YH 1IBMH 2HHHH 1BGWA 3L4KA 4DR2H 3C0FB 2F4VH 3L2PA 4DV3H 3PN1A 3K3VA 1GYFA 1N36H 1IBLH 2HVRA 4YHHH 1M0WA 4JI0H 4JI4H 4K0KH 4LFAH 4JI7H 3DF7A 4OX9H 1DGSA 5LL6b 4NXMH 4JI5H 1TA8A 3BAAA 2KSWA 1XMQH 2ZJTA 1SEIA 3OTOH 4B3SH 4LF9H 4LH6A 1HNWH 4KHPH 4DV2H 1S03G 3RF2A 3LMLA 3KAJA 2HVQA 4EEQA 4YY3H 3J80W 1S68A 3BA8A 4A2AA 2UUAH 2MCTA 4X65H 4NXNH 2UXBH 1MZBA 2RGRA 4DUYH 4PDBA 4DV5H 3F8NA 2YCHA 2FE3A 4RB0A 1E4FT 4JYAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG0 A;  3M4I A;  2ZJT A; 
#chains in the Genus database with same CATH topology
 5FD5 A;  2VOB A;  4Q43 A;  4JI6 H;  2WDT A;  4LF7 H;  5KG3 A;  4ED3 A;  4ECY A;  2V59 A;  2PVP A;  5FD6 A;  2XCP A;  4E4T A;  2FLL A;  2WTF A;  4ED1 A;  2JEJ A;  5K2M A;  2R92 A;  2XIG A;  2GPS A;  4DL2 A;  2UUC H;  2R8K A;  3H4D A;  2R93 A;  4Q44 A;  2I80 A;  1RJR A;  2B63 A;  3RGX A;  3HOU G;  5KT6 A;  3Q2O A;  3GIQ A;  3M9M B;  3V6J A;  2BR0 A;  1FJG H;  4DV4 H;  3U9S A;  5C4X G;  4GLX A;  1E4G T;  2FLP A;  3E5N A;  1TWH A;  5GON F;  5LYJ F;  3MWE A;  5KFT A;  5CB4 F;  1X9N A;  2FPI B;  5C3E G;  4R8U A;  1A9X A;  2W9A A;  4DL5 A;  4BXX G;  1EUD B;  2VQF H;  1UNN C;  3RV4 A;  2YZM A;  3T5J A;  2XC9 A;  3GIM A;  5KFN A;  5DG7 A;  1T3N A;  3G8C A;  4MA5 A;  1S0O A;  4RAZ A;  4RB2 C;  3GV7 B;  2DWC A;  4NLG A;  4DR3 H;  5LA6 F;  2ASL A;  2W71 A;  5LOV F;  5KG6 A;  4JI3 H;  2AGQ A;  5DQI A;  3LWB A;  4A3K G;  1PK8 A;  2VPS A;  1W93 A;  2Y0S A;  3GIP A;  3M4I A;  5KX5 F;  2W9C B;  4EBC A;  2J6T A;  4LFB H;  3VPC A;  5KFO A;  4ECX A;  2R7L A;  4X66 H;  5F9N A;  5D1O B;  4DL3 A;  3H3V H;  5BPH A;  4U6P A;  4YR3 A;  3H4B A;  3I12 A;  4ED8 A;  2JEI A;  5I47 A;  4ZHQ F;  2VUM G;  5KT4 A;  2E2H A;  1SYX B;  3N42 B;  4ED7 A;  1S9F A;  1EUC B;  3G6X A;  3V4S A;  3KXY T;  1AUV A;  3BA9 A;  5KFZ A;  3KHR A;  4DR6 H;  4QIW E;  2YZN A;  4EFE A;  3RGZ A;  5KG2 A;  4RU9 A;  1VS0 A;  1BXR A;  2RF4 A;  1RJQ A;  4IRC A;  3J7A K;  1T94 A;  1BJT A;  4EEY A;  4Q8F A;  4TV9 F;  3RJ0 A;  4O3S A;  3GIL A;  3CQZ A;  1N33 H;  3TIN A;  1Z2N X;  3GID A;  4JV5 H;  2WE6 A;  4X64 H;  3PW5 A;  4DR4 H;  1B6S A;  3Q8P B;  1RK6 A;  4IR9 A;  5IWA H;  4GKK H;  3SI8 A;  3MR3 A;  5KFE A;  1E4E B;  3TII A;  1XNQ H;  2W6M A;  4J0M A;  3Q8S B;  1PX2 A;  2R7Z G;  2J6U A;  1I94 H;  4A93 G;  1ZHQ A;  3NGD A;  5KG4 A;  3N40 P;  2HVS A;  1EYZ A;  1DIK A;  2XGQ A;  4ECS A;  1BGW A;  4C2M A;  1K1Q A;  3C0F B;  3L2P A;  3IN5 A;  5EDW A;  1W96 A;  2P0A A;  2V4R A;  1GYF A;  1N36 H;  3V4Z A;  5JUM A;  1IBL H;  3R5F A;  4EGQ A;  3I4N G;  1M0W A;  1ZQ7 A;  2XCL A;  3DF7 A;  4ECU A;  2YS7 A;  4ECT A;  4A3G G;  5KFY A;  3WNZ A;  3M9O B;  3BAA A;  4RNO A;  1WSC A;  1XMQ H;  4LF9 H;  1VAJ A;  1HNW H;  4EYI B;  2UVW A;  3LML A;  4I55 F;  4YJ3 F;  1KC7 A;  1N48 A;  4NXN H;  1KJ9 A;  5DLF A;  2NVX A;  4PDB A;  2R8H A;  3TIG A;  1KJI A;  3F8N A;  2IBK A;  4RB0 A;  2PN1 A;  5C1P A;  4FM9 A;  1WCM A;  4M9U A;  3GTM A;  3JRX A;  2JEG A;  1AN7 A;  4JI2 H;  4J9N A;  2DZD A;  2E2I A;  3GTO A;  4ZOL F;  4UFZ A;  4RUC A;  2DPI A;  2UXC H;  2I8C A;  1Y14 B;  4MTE A;  4R7R A;  1GSO A;  3MWM A;  5L9X A;  4RB3 C;  4FBT A;  2BQR A;  1JLL B;  2W9C A;  2XD4 A;  2FPP B;  5L1L A;  2Q2T A;  3T1H H;  1I50 A;  3JSN A;  3CVZ A;  4DL7 A;  2FLN A;  5CAE B;  4F4Z A;  3RFC A;  2HGS A;  5D1O A;  2NUA B;  1S97 A;  4HNV A;  3OUZ A;  4M7E A;  4A3L G;  3AYH B;  1Y1V A;  1KJJ A;  4XYM B;  2GPW A;  3R23 A;  2YRX A;  4LF4 H;  4RZR A;  4MTD A;  2YW2 A;  1M0T A;  4MV3 A;  3UFX B;  4BWS C;  4EYH B;  2Y0S E;  3N8D A;  4TUY F;  5H80 A;  4LSX A;  4YP3 A;  5L1J A;  4ECR A;  5DGA A;  3R5X A;  4QW9 A;  3TQT A;  2BQU A;  2WAQ A;  2W70 A;  3PW0 A;  5T14 A;  2R7N A;  2VQD A;  4TQR A;  2RDJ A;  3RB0 A;  4XX0 B;  2ATL A;  5LMN H;  5C8Y F;  5A2Q W;  3KHH A;  5KFS A;  2ZDH A;  2PMZ A;  2C2D A;  2R93 G;  5DQG A;  3Q8Q B;  3RB3 A;  4A3B G;  1I6U A;  3HOZ G;  2W6Z A;  4YAJ B;  3ORQ A;  1TWC A;  3QFF A;  2ZM6 H;  3FKI A;  3JAM W;  4IWY A;  4L1K A;  3PO2 G;  3G6Y A;  2RGV A;  2DLN A;  2C00 A;  5KG1 A;  1FKA H;  3RBE A;  1E4E A;  4AYB A;  4Y8V B;  4I7H A;  1CS0 A;  4HNT A;  1I7L A;  4O3N A;  4IZO A;  4DLK A;  2R7M A;  4J9S A;  4JV1 A;  2CKZ B;  5KFF A;  4O4L F;  3SE7 A;  2R8I A;  4DUZ H;  3OSP A;  1TWF A;  2VUG A;  4DR1 H;  4PWQ A;  1GO3 E;  2W9B B;  2HJW A;  4HR7 A;  4GKJ H;  1P8L A;  5KFD A;  2XCA A;  4J9R A;  4GC6 A;  3KHL A;  1E4F T;  1IOV A;  2I87 A;  5HBR B;  2ZDG A;  2C35 B;  4O3Q A;  5L1K A;  2FMA A;  2R92 G;  4IWX A;  2R84 A;  1S0N A;  1SFO A;  2O03 A;  5KFG A;  4O4H F;  3I4M G;  1DV2 A;  3T5K A;  4O3P A;  4LSA A;  1RJP A;  2W57 A;  2B63 G;  1XNR H;  1HNZ H;  4DL4 A;  2VA2 A;  2VQE H;  5FJ8 G;  1Z2O X;  2R82 A;  2AGO A;  3GTQ A;  2VR1 A;  3JSL A;  3QZ8 A;  4MV9 A;  2AU0 A;  4LMY A;  4A3J G;  1FVI A;  1S10 A;  4UCU A;  1GGO A;  2R7K A;  1J5E H;  1IBK H;  5FLX W;  4LFC H;  4QWB A;  3QZ7 A;  4MV8 A;  5DGB A;  1IBM H;  3H0G A;  4MV1 A;  3L4K A;  4JUZ A;  5KFI A;  4ME6 A;  5KG5 A;  2OLS A;  1R9T A;  4J9M A;  1CQI B;  2SCU B;  3HOX G;  2HVR A;  1RK5 A;  4YHH H;  1UC8 A;  4JI0 H;  4JI4 H;  3ORR A;  4LFA H;  4EBD A;  4JI7 H;  1DGS A;  5LL6 b;  2R6F A;  3RUP A;  5IYB G;  5KFM A;  4NXM H;  2ASJ A;  4JI5 H;  2JA8 G;  1V4Y A;  1JX4 A;  1SEI A;  3HKZ A;  4YB8 B;  4EG0 A;  4B3S H;  1M7J A;  2YL2 A;  3RBD A;  2JA5 G;  2FK3 A;  3PO3 G;  5EZY F;  3KAJ A;  4YY3 H;  2FP4 B;  2UUA H;  2UXB H;  4X65 H;  5D8D A;  1T36 A;  2RGR A;  4DV5 H;  2YCH A;  2FE3 A;  2AQ4 A;  4ED0 A;  5J2U F;  3H0G G;  4I4T F;  4YJ2 F;  5CA0 F;  2QK4 A;  3JRW A;  5KKN B;  2W7P A;  2VPQ A;  1N34 H;  1DV1 A;  5KT2 A;  4Q8E A;  3MJF A;  4XYL B;  3K5H A;  4J9O A;  5KFV A;  1Z2P X;  1JDB B;  3KAK A;  3GTL A;  3N41 B;  3IG0 A;  1K83 A;  2CZG A;  4DV1 H;  2JA5 A;  2M05 A;  3HBL A;  4LF8 H;  1L2Z A;  3MFI A;  3KHG A;  1I3Q A;  4ECQ A;  2FPG B;  2NU6 B;  2PMZ E;  5LMU H;  5IYZ F;  3VPB A;  2CW8 A;  4BBR G;  3FDS A;  2JA6 A;  4Q45 A;  5C1O A;  3BG5 A;  5KG7 A;  1ZET A;  1BNC A;  1XDN A;  1HR0 H;  2QYZ A;  2UVU A;  4CC6 A;  5KFB A;  2YS6 A;  4O2A F;  4AYB E;  2W9B A;  1Y1W A;  2FK1 A;  3RV3 A;  3TQ1 A;  4LH7 A;  4UCO A;  3RTX A;  2CW7 A;  3BQ0 A;  3PVX A;  4JI8 H;  4IRD A;  2FKL A;  3KAL A;  5EWE A;  2IP4 A;  1GLV A;  4FU0 A;  5KFR A;  2WB1 A;  4J9P A;  4A3E G;  3OSN A;  3BQ1 A;  2V5A A;  3T5H A;  2C28 A;  3RIZ A;  3G6V A;  5L1I A;  4FBU A;  1WH2 A;  3FMA A;  2V58 A;  1V9P A;  1B04 A;  1TWA A;  4QWC A;  3OHA A;  5BPF A;  3KTM A;  4DV6 H;  2JA7 A;  1S0M A;  4EFB A;  3RB4 A;  4WD3 A;  3VPD A;  3V6K A;  3UQ8 A;  4QWE A;  2WYO A;  3MR2 A;  3N44 B;  4YQW A;  4IAJ A;  4O3O A;  2W7O A;  3PR5 B;  2ASD A;  4RZQ A;  4RB1 A;  3PR4 A;  1WCM G;  5KFX A;  4J9L A;  4DR5 H;  5BMV F;  4CC5 A;  4MV6 A;  4Q0Y A;  1CQJ B;  1O75 A;  3HXL A;  4C5B A;  4ZQI A;  3PW2 A;  5KFA A;  4A3C G;  3N6X A;  4IR1 A;  1HNX H;  3H20 A;  4QWA A;  3BJY A;  2GLT A;  5F9L A;  4HYK A;  2J6S A;  3M9N B;  4IRK A;  5EWG A;  4X62 H;  5KFP A;  3GIJ A;  2IA6 A;  1TAE A;  1GSH A;  1Y1V G;  1OWT A;  4F4W A;  4U7C A;  2R8J A;  4ECW A;  3HKZ E;  5JQW A;  3GLK A;  4QJF A;  5DG9 A;  4A3M G;  1WR2 A;  4B3R H;  5KFH A;  4ZI7 F;  3T1Y H;  2HHH H;  1VKZ A;  4DR2 H;  2F4V H;  1AUX A;  2W6P A;  5DLG A;  4TQS A;  4DV3 H;  4FS1 A;  4BBS G;  5EWF A;  1JIH A;  1I7N A;  4K0K H;  5KFC A;  4ED2 A;  4YAK B;  4OX9 H;  3R5H A;  2R85 A;  3EPG A;  2YU9 A;  2KSW A;  2ZJT A;  2AGP A;  3VMM A;  2ALZ A;  3FKI G;  4LH6 A;  3PW7 A;  4KHP H;  4DV2 H;  1S03 G;  2CQY A;  2PBZ A;  3RF2 A;  3H40 A;  1JKJ B;  4FS2 A;  3GTK A;  4BY7 G;  3GV5 B;  1S68 A;  2VUM A;  4A2A A;  2MCT A;  3PW4 A;  2V4Q A;  3V6H A;  3RB6 A;  1JDE A;  4A3I G;  1K1S A;  5LXT F;  5KFU A;  3U9T A;  5KT5 A;  4APM A;  2FB9 A;  5IP9 G;  1UC9 A;  4QWD A;  3L4J A;  5KFW A;  1SCU B;  5IYC G;  5KFL A;  2DIK A;  2NU7 B;  4G3I A;  2W6N A;  5JVD F;  3N43 B;  4ECV A;  4B3T H;  3BQ2 A;  3GQC A;  1C3O A;  2UU9 H;  1C30 A;  4O3R A;  2R8G A;  3GIK A;  2OH2 A;  5KT3 A;  4A2B A;  2C22 A;  1GSA A;  2R86 A;  5FPR A;  1B6R A;  3HB9 A;  3Q1K A;  2WB1 E;  5C5J A;  4YR0 A;  2R7Z A;  3EYY A;  3LP8 A;  2W6Q A;  4BY1 G;  4B3M H;  5DQH A;  4RNN A;  5KT7 A;  5KFJ A;  5KG0 A;  3HOW G;  3K5I A;  5JVL A;  5EOY A;  4UCS A;  3RAX A;  2VA3 A;  4DV7 H;  4LF5 H;  3MWD A;  4UCV A;  2E5L H;  1EHI A;  4XZ3 B;  1A0I A;  4DV0 H;  2BQ3 A;  2NVY A;  4MV7 A;  2UUB H;  2OWO A;  2C2R A;  4F4Y A;  5D1P A;  1V51 A;  2Q2U A;  5DG8 A;  4DR7 H;  2WAQ E;  4I50 F;  5LP6 F;  4TV8 F;  4JV0 A;  4ETS A;  5IT9 W;  1KBL A;  4ECZ A;  1RYS A;  2YZG A;  4RAY A;  2YRW A;  2UXD H;  2XGP A;  2ZDQ A;  5JH7 F;  4QW8 A;  4C5A A;  4AQY H;  1N56 A;  1TWG A;  4O4I F;  4J9Q A;  1IOW A;  3BAB A;  3ETJ A;  2R87 A;  4R8U B;  3Q8R B;  4J9K A;  3J81 W;  2C2E A;  1XMO H;  2FJZ A;  2FK2 A;  4HQ6 A;  4WBN F;  2V9W A;  3PZP A;  5BR8 H;  5FPO A;  1KJ8 A;  3GTJ A;  1CE8 A;  5KFQ A;  5J2T F;  4ED6 A;  2X0S A;  4UCT A;  2NU8 B;  4JI1 H;  2DPJ A;  5KFK A;  4EBE A;  4GC7 A;  2YYA A;  4UCR A;  1KEE A;  3OUU A;  3GTP A;  4YBZ B;  4MA0 A;  1RYR A;  5CA1 F;  1ZHS A;  2NU9 B;  2IMW P;  4LF6 H;  1N32 H;  3MR5 A;  2JEF A;  1M6V A;  1JXL A;  3OHB A;  4QIW A;  5IP7 G;  2W8K A;  4F50 A;  1KJQ A;  2JA6 G;  3JZI A;  4A3F G;  4HNU A;  3EPI A;  3ETH A;  5HV6 A;  5C44 G;  2UVV A;  3MFH A;  3GTG A;  3MR6 A;  3K3P A;  3WO0 A;  1Y1W G;  3PN1 A;  2J9G A;  3K3V A;  4RNM A;  4A3D G;  3HOY G;  4DL6 A;  1VBG A;  3WO1 A;  1VBH A;  2W6O A;  3RAQ A;  4IHJ F;  4JV2 A;  4MV4 A;  1TA8 A;  4F4X A;  4O2B F;  3OTO H;  3T5L A;  1EZ1 A;  4MAM A;  3HOV G;  4EGJ A;  5IYD G;  2HVQ A;  4EEQ A;  3J80 W;  5FLM G;  2UVR A;  3GII A;  3BA8 A;  1ULZ A;  4YR2 A;  1B33 N;  2W8L A;  3GV8 B;  4C5C A;  1MZB A;  4DUY H;  2JA7 G;  4RUA A;  2RDI A;  4JYA H; 
#chains in the Genus database with same CATH homology
 5FD5 A;  1AN7 A;  2VOB A;  4JI2 H;  1N34 H;  4APM A;  4JI6 H;  2WDT A;  4LF7 H;  3L4J A;  5FD6 A;  4UFZ A;  2UXC H;  4RB3 C;  1Z2P X;  3KAK A;  4R7R A;  4MTE A;  3IG0 A;  3MWM A;  2XIG A;  3N41 B;  3N43 B;  4DV1 H;  4B3T H;  2Q2T A;  2UUC H;  4FM9 A;  2UU9 H;  3T1H H;  3JSN A;  3CVZ A;  4LF8 H;  3RGX A;  1L2Z A;  2HGS A;  5D1O A;  4A2B A;  1FJG H;  4M7E A;  4DV4 H;  5FPR A;  5LMU H;  4GLX A;  1E4G T;  2CW8 A;  4LF4 H;  3EYY A;  4MTD A;  4B3M H;  4BWS C;  1M0T A;  1X9N A;  4LSX A;  1XDN A;  1HR0 H;  5EOY A;  4UCS A;  4CC6 A;  2VQF H;  4DV7 H;  4LF5 H;  2E5L H;  4UCV A;  1A0I A;  4DV0 H;  2UUB H;  4LH7 A;  4MV7 A;  4UCO A;  2OWO A;  5LMN H;  3RTX A;  2CW7 A;  5A2Q W;  4RAZ A;  5D1P A;  4JI8 H;  2Q2U A;  3KAL A;  4RB2 C;  4DR3 H;  4DR7 H;  1I6U A;  4JI3 H;  1J5E H;  2VPS A;  3M4I A;  3JAM W;  3RIZ A;  2ZM6 H;  4ETS A;  4LFB H;  5IT9 W;  2RGV A;  4RAY A;  4X66 H;  1WH2 A;  1FKA H;  2UXD H;  5D1O B;  3FMA A;  1V9P A;  4I7H A;  1B04 A;  4AQY H;  4DV6 H;  4EFB A;  1SYX B;  3N42 B;  3BAB A;  3UQ8 A;  3J81 W;  2WYO A;  3KXY T;  3BA9 A;  3N44 B;  4IAJ A;  1XMO H;  4DR6 H;  4DUZ H;  4RZQ A;  4RB1 A;  2VUG A;  4DR1 H;  4EFE A;  3RGZ A;  4DR5 H;  4GKJ H;  4CC5 A;  4Q0Y A;  5BR8 H;  5FPO A;  1P8L A;  1O75 A;  1VS0 A;  3HXL A;  4UCT A;  3J7A K;  4JI1 H;  3N6X A;  1BJT A;  3RJ0 A;  1HNX H;  3H20 A;  1N33 H;  2O03 A;  4UCR A;  1Z2N X;  4JV5 H;  2WE6 A;  1ZHS A;  4X64 H;  4LSA A;  4LF6 H;  2W57 A;  4DR4 H;  1N32 H;  4X62 H;  1XNR H;  4GKK H;  5IWA H;  2VQE H;  1TAE A;  1Z2O X;  3JSL A;  1XNQ H;  4MV9 A;  4LMY A;  4J0M A;  1FVI A;  1IBK H;  4UCU A;  1HNZ H;  4LFC H;  5FLX W;  1I94 H;  1ZHQ A;  2HVS A;  3N40 P;  4B3R H;  3T1Y H;  1IBM H;  2HHH H;  1BGW A;  3L4K A;  4DR2 H;  3C0F B;  2F4V H;  3L2P A;  4DV3 H;  3PN1 A;  3K3V A;  1GYF A;  1N36 H;  1IBL H;  2HVR A;  4YHH H;  1M0W A;  4JI0 H;  4JI4 H;  4K0K H;  4LFA H;  4JI7 H;  3DF7 A;  4OX9 H;  1DGS A;  5LL6 b;  4NXM H;  4JI5 H;  1TA8 A;  3BAA A;  2KSW A;  1XMQ H;  2ZJT A;  1SEI A;  3OTO H;  4B3S H;  4LF9 H;  4LH6 A;  1HNW H;  4KHP H;  4DV2 H;  1S03 G;  3RF2 A;  3LML A;  3KAJ A;  2HVQ A;  4EEQ A;  4YY3 H;  3J80 W;  1S68 A;  3BA8 A;  4A2A A;  2UUA H;  2MCT A;  4X65 H;  4NXN H;  2UXB H;  1MZB A;  2RGR A;  4DUY H;  4PDB A;  4DV5 H;  3F8N A;  2YCH A;  2FE3 A;  4RB0 A;  1E4F T;  4JYA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...