2ZJTA

Crystal structure of dna gyrase b' domain sheds lights on the mechanism for t-segment navigation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
185
Chain Sequence
FTDPRKSELYVVEGDMFQAILPLRGKDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 51
structure length 185
sequence length 206
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2zjtA02
3M4IA 2ZJTA 3IG0A
chains in the Genus database with same CATH superfamily
3R23A 4DL4A 4ED3A 5HV6A 1WR2A 4FS2A 3KAJA 5LOVF 4A3JG 4LF5H 4ED7A 3GIIA 1KJ8A 5KT7A 4A3KG 3MFIA 4I7HA 2PMZE 2PBZA 2ASLA 1T3NA 2UVUA 3GIDA 4QJFA 2J6SA 1WSCA 2ZDQA 4Q43A 3RAXA 4APMA 3RBDA 4O3QA 1GSAA 5KFJA 2JA7G 4FU0A 2I8CA 4QWBA 2V58A 1S0OA 4NXMH 2UUAH 1I7LA 4UCSA 1IOVA 3LP8A 4DL6A 2YS6A 3Q1KA 5FPRA 5KFKA 3L4JA 4GKKH 4B3TH 3JRXA 3PR5B 1JDBB 4F4YA 1UNNC 5D1OA 3N6XA 2XD4A 3Q8QB 5L9XA 2UVRA 3HOWG 1E4FT 2DPJA 2CW7A 2JA6G 5FLMG 1I7NA 3MR2A 2W9BB 1S9FA 4UCTA 3Q8SB 2O03A 3IN5A 1Y1VG 5JH7F 4XZ3B 2JA6A 5BPFA 3QZ7A 3HKZA 4UCRA 4AYBA 3RTXA 3GTGA 5DGBA 1GO3E 4Q0YA 4FS1A 1N33H 2W70A 4UFZA 1Y1VA 4MV7A 1KEEA 4DR1H 1JX4A 4RNNA 3N40P 2R7ZA 4Q45A 5KT2A 5IT9W 3QFFA 2R93G 2F4VH 4EEQA 1WH2A 2JEGA 4O3SA 1OWTA 2W71A 5D8DA 5LXTF 4DR5H 4EFBA 2C28A 3JAMW 2IA6A 4MV9A 5CAEB 4RB2C 1IBMH 4GC7A 3NGDA 1TAEA 3FKIG 1TWAA 5IP7G 4MTEA 1AUVA 4LH7A 3EYYA 2BQUA 3Q8PB 4YAJB 2YRXA 5L1KA 4ECUA 1KJIA 2FP4B 4DV3H 3JRWA 4ED2A 3FKIA 4RUAA 2J6TA 1BNCA 4JV2A 3TQTA 2JEJA 2IMWP 4JI3H 2GPWA 2YU9A 2WYOA 3F8NA 5D1OB 1RJRA 3ORRA 3V6KA 3G6VA 4O3NA 4AQYH 1JLLB 4Q8EA 3H0GG 2RGVA 1ZQ7A 1L2ZA 2VPQA 4A3LG 3N8DA 4CC5A 3JSNA 2XCLA 2C35B 3UQ8A 5KT5A 3T5KA 1B33N 2ZDGA 3RB6A 1RK5A 1RYSA 1MZBA 4J9OA 1HNXH 1FVIA 3H0GA 4RU9A 2PMZA 3VPBA 5T14A 4F4WA 4DR6H 3E5NA 3RAQA 1GSOA 4RB1A 3MJFA 3VPCA 2FK1A 1V51A 4QW8A 5KFSA 4K0KH 2ALZA 3K5IA 4L1KA 4EFEA 5KFWA 3R5FA 3FMAA 4HNUA 4LF9H 2VQFH 3HKZE 1DGSA 1ZHQA 1ZHSA 2QYZA 4WBNF 5KFBA 4JI6H 4MV1A 2OLSA 2CQYA 2FB9A 4C5BA 2V4QA 3MWEA 4A3FG 1M7JA 4RZQA 4O3OA 3PW4A 1VBGA 4XYMB 2DPIA 5DG9A 3OHAA 3KHGA 1XMQH 2AU0A 3RJ0A 3BAAA 2R8GA 2IP4A 3OUZA 3GIJA 5DQGA 2R7LA 4J9NA 4CC6A 2OH2A 4YHHH 3RB4A 2XGQA 1RK6A 2AGQA 4JV5H 4IR1A 3KALA 3J81W 2VA2A 5EZYF 1GSHA 3KXYT 5KFCA 4LF6H 4LSXA 3HOXG 2UUBH 4ECZA 2BR0A 4HQ6A 3KHHA 4UCOA 1CS0A 1X9NA 5GONF 2GLTA 2I87A 4ETSA 4IZOA 3WO0A 2R84A 3RGXA 4J9QA 5IYCG 4J9LA 4DV1H 3UFXB 5DGAA 1I3QA 2VOBA 5LA6F 4J9SA 1JDEA 3WO1A 1IBLH 5EWFA 2C2RA 3GLKA 4GKJH 1V4YA 3TIIA 4RNOA 3QZ8A 3GIQA 2DIKA 4A93G 4A3GG 1O75A 5EOYA 3L2PA 1SCUB 1J5EH 4DV2H 3Q8RB 4HYKA 5C1OA 5JQWA 3RFCA 3KHRA 1R9TA 2VA3A 2FLNA 2YRWA 3L4KA 4B3SH 2NU8B 4ZI7F 3N42B 2VQDA 4F4ZA 2R8HA 3GTLA 5HBRB 1W93A 2PN1A 5KFAA 4QIWA 3M9NB 2IBKA 1WCMG 3GTOA 1S10A 2QK4A 2DLNA 5KFVA 5KFQA 5LP6F 2YYAA 2WTFA 4IWYA 2R8KA 4JV1A 5JVLA 3GTQA 4QWDA 5J2TF 1M0WA 1WCMA 5KFNA 3OTOH 3IG0A 4YR0A 4BXXG 4G3IA 3N44B 3K5HA 4HR7A 1Z2OX 1Y1WA 4DV7H 1DIKA 2R7NA 3ETHA 4M7EA 1XNQH 2YL2A 4TUYF 4DV4H 4LFAH 1GGOA 4I50F 2GPSA 4MA5A 5KFXA 3MR3A 2BQ3A 4OX9H 2BQRA 1UC9A 5DLGA 5C1PA 5CA1F 1EYZA 4ED6A 4DV0H 2AGOA 4EBCA 4DLKA 2R7ZG 5KFPA 5KFRA 1DV1A 4B3MH 4GLXA 3PW2A 4TV9F 4EGQA 4EBEA 2R6FA 1KJQA 2SCUB 2CZGA 5KFGA 3J7AK 3T5JA 4J9KA 4YR3A 4J9MA 3HBLA 4U6PA 1BGWA 5L1JA 1N32H 3K3VA 4KHPH 4HNTA 5A2QW 4GC6A 2B63A 4ECSA 5BPHA 4O3RA 2V59A 1KJJA 3MFHA 4JI8H 2I80A 3CQZA 3U9SA 4ZOLF 3BQ0A 4TQSA 2WE6A 5KT3A 2HHHH 1K1QA 2DZDA 4XYLB 3BA8A 4MTDA 4QWEA 1EHIA 3ORQA 4A3BG 4NXNH 2JA8G 2W6PA 5KG0A 2NVYA 5F9NA 2HVQA 1BJTA 2E2HA 3PO2G 2W6NA 4YJ3F 1TWFA 1N34H 5KFIA 4TQRA 1JXLA 5KX5F 5DG7A 2ASDA 5CA0F 4QWAA 4QIWE 4EBDA 2RDJA 2ZDHA 1E4EA 5BMVF 1TWHA 5KFMA 5IYDG 2V9WA 5H80A 2UVWA 2R8JA 4X62H 4YR2A 1T94A 4DUYH 4UCVA 3R5XA 1EUCB 3G6YA 4IAJA 4RAYA 1KJ9A 1ZETA 4IR9A 2RF4A 4LMYA 4MAMA 3G6XA 4YBZB 1S97A 4MV6A 2FK3A 1CQIB 2C2EA 1TWCA 5L1LA 4DR3H 1CQJB 2R87A 2NVXA 4O4IF 4JI2H 3T5HA 5JVDF 3H20A 3JSLA 5EWGA 2W8LA 2ZJTA 2ASJA 2M05A 1AN7A 3ETJA 3MR5A 1XMOH 3RF2A 4A3MG 2YZGA 3TINA 1RYRA 2E5LH 3BJYA 2FJZA 2V5AA 3M9OB 1N56A 2KSWA 1RJQA 2XIGA 4O2AF 4YQWA 4X65H 2DWCA 4ECQA 3HOYG 1EZ1A 3GIPA 3V4SA 2R8IA 4DL7A 1T36A 2YZMA 1M0TA 2P0AA 3T1YH 3GV5B 3SE7A 2W6MA 3TQ1A 5K2MA 3HOZG 4MA0A 5EDWA 1IBKH 4I55F 3H3VH 4UCUA 3PW0A 2VUMG 4R8UA 3K3PA 5KG7A 1PK8A 1S03G 2HVRA 4LF8H 4RZRA 4RAZA 1B6SA 4BWSC 5LYJF 5KFLA 3I12A 3EPIA 4RB0A 4O2BF 4J9RA 4A3IG 5IYBG 5DQIA 1E4EB 3N43B 5KT6A 3H4DA 2RGRA 3HOVG 2XCAA 4BBSG 2FPPB 2RDIA 2W9CB 2CW8A 1N48A 5KG3A 4Q44A 2WAQA 2FLPA 4IWXA 4ZHQF 5KG2A 1XDNA 1P8LA 3KHLA 2VUMA 5KFZA 4NLGA 2W7PA 5KG4A 3VPDA 1FKAH 3HOUG 3MWMA 4A2BA 3RBEA 1UC8A 5LMUH 1VAJA 2WDTA 4J9PA 2R86A 3EPGA 5LL6b 2C2DA 4RB3C 2FE3A 3G8CA 5C8YF 3H4BA 4R7RA 5C4XG 4O4LF 4C5CA 4ECRA 4JV0A 4ECXA 2FPGB 4YP3A 2NU7B 5KFDA 4BY1G 4PWQA 4RUCA 1N36H 2WB1A 3BG5A 4ECWA 3HXLA 2R82A 4XX0B 3WNZA 4C5AA 1GLVA 1RJPA 5C44G 2C22A 4B3RH 1W96A 3KAKA 3PR4A 1Y1WG 2HJWA 1BXRA 3GTPA 2YZNA 1TWGA 1HNWH 3LWBA 2W57A 4X64H 3BA9A 4RNMA 2X0SA 4A2AA 1M6VA 2W6QA 3RIZA 2ATLA 4YB8B 4MV8A 2V4RA 3RUPA 5BR8H 1JKJB 3R5HA 4ED1A 1VS0A 2PVPA 4YY3H 3KTMA 2Q2TA 4R8UB 2W7OA 4YJ2F 4DUZH 4EGJA 3OSNA 4EYHB 5KG1A 4X66H 4IRKA 3M4IA 2JA7A 2W8KA 5FLXW 2NUAB 3T5LA 4DL2A 1SEIA 4I4TF 3GQCA 5KT4A 4BBRG 2HVSA 2MCTA 4O4HF 1SFOA 4ECTA 3TIGA 2C00A 3RB0A 2VPSA 4F50A 4MV4A 5KG6A 2B63G 1GYFA 3RGZA 2NU6B 1VBHA 4C2MA 2UUCH 5KFUA 3GILA 2Y0SA 3C0FB 3RV4A 2NU9B 3GV8B 4IHJF 4YAKB 2WAQE 1HNZH 2OWOA 4IRCA 3AYHB 1FJGH 2CKZB 5I47A 3PN1A 2R7MA 4DR7H 3PW5A 5C5JA 4JI0H 1AUXA 1EUDB 4ME6A 4ECVA 3GTKA 5KFYA 4A3DG 5IWAH 4F4XA 2FLLA 2ZM6H 3PVXA 3PO3G 3U9TA 1S68A 4DR2H 4DL5A 2FKLA 4E4TA 1I94H 2HGSA 2YCHA 1B6RA 3MR6A 3GIKA 4LF7H 3RV3A 2UU9H 3Q2OA 2WB1E 5FD5A 3OHBA 5LMNH 1A0IA 3I4MG 5KFTA 2R7KA 4TV8F 3I4NG 4A3CG 5EWEA 4JI4H 2UXCH 4LF4H 2R93A 2W9CA 4DV6H 5DG8A 5DLFA 3T1HH 1V9PA 3SI8A 4JYAH 4JUZA 1PX2A 4LFBH 4M9UA 2JA5G 2JEFA 5FPOA 1I6UA 4IRDA 5KG5A 4MV3A 3V4ZA 4FBUA 4A3EG 2FMAA 3V6HA 5IP9G 4DR4H 5KFHA 2JA5A 1Z2NX 5DQHA 2R92G 3H40A 4EYIB 2VUGA 1A9XA 1KC7A 2W6OA 2FK2A 4FBTA 2W6ZA 5L1IA 1Z2PX 4FM9A 4QW9A 2R92A 3JZIA 1ULZA 5IYZF 1VKZA 2W9AA 3GV7B 3OUUA 4O3PA 5KKNB 3OSPA 2J6UA 3RB3A 2JEIA 3HB9A 4EG0A 3PW7A 4J0MA 3CVZA 4U7CA 5FD6A 1E4GT 1TA8A 3BQ2A 1C30A 4JI1H 3DF7A 2Y0SE 1SYXB 1K83A 4LSAA 3GTMA 2E2IA 1CE8A 3PZPA 2YW2A 4LH6A 2AGPA 4JI5H 4JI7H 4DL3A 4AYBE 5D1PA 2FPIB 4HNVA 4QWCA 3BQ1A 5FJ8G 3N41B 1KBLA 1I50A 1DV2A 2XCPA 4ED8A 3V6JA 4EEYA 1Y14B 3LMLA 3GTJA 3GIMA 4ZQIA 4ECYA 4BY7G 2AQ4A 1IOWA 1K1SA 3J80W 2UVVA 2YS7A 2UXBH 3BABA 1JIHA 3FDSA 2J9GA 1C3OA 2VR1A 1XNRH 5CB4F 2XC9A 4LFCH 4PDBA 2UXDH 1B04A 1S0MA 4Q8FA 2W9BA 2R85A 5F9LA 2XGPA 2VQEH 1HR0H 4Y8VB 5JUMA 5J2UF 3VMMA 4WD3A 4ED0A 1S0NA 2Q2UA 3MWDA 5KFFA 5KFOA 5KFEA 3M9MB 5C3EG 4DV5H
chains in the Genus database with same CATH topology
4RZQA 2VPSA 1GYFA 3KAJA 4LF5H 3RGZA 1XMQH 4X62H 2UUCH 3RJ0A 4DUYH 3BAAA 4UCVA 4IAJA 4RAYA 4I7HA 3C0FB 4CC6A 4LMYA 4YHHH 4DV5H 1HNZH 2OWOA 4JV5H 4APMA 1FJGH 3KALA 4DR3H 3J81W 3PN1A 4JI2H 3KXYT 4DR7H 4LF6H 4LSXA 3H20A 3JSLA 4NXMH 2UUAH 4JI0H 2UUBH 2ZJTA 4UCSA 1AN7A 5IWAH 5FPRA 3L4JA 1XMOH 3RF2A 4UCOA 1X9NA 2ZM6H 4B3TH 4GKKH 2E5LH 1S68A 5D1OA 4ETSA 4DR2H 4DV1H 3RGXA 3N6XA 1I94H 2HGSA 2YCHA 2KSWA 2XIGA 2VOBA 4LF7H 4X65H 2UU9H 5FD5A 5LMNH 1IBLH 1A0IA 2UXCH 1E4FT 4JI4H 2CW7A 4LF4H 4GKJH 4DV6H 1M0TA 4UCTA 3T1HH 1V9PA 3T1YH 2O03A 1O75A 4JYAH 5EOYA 4LFBH 3L2PA 1J5EH 1IBKH 5FPOA 4DV2H 1I6UA 4UCRA 3L4KA 4UCUA 3RTXA 4B3SH 4Q0YA 4DR4H 1N33H 4UFZA 1Z2NX 4MV7A 3N42B 4DR1H 2HVRA 4LF8H 1S03G 4RAZA 2VUGA 3N40P 4BWSC 5IT9W 4RB0A 3N43B 2F4VH 2RGRA 1Z2PX 4EEQA 4FM9A 1WH2A 4DR5H 4EFBA 2CW8A 3JAMW 4MV9A 1M0WA 4RB2C 1IBMH 3OTOH 3IG0A 1TAEA 3N44B 1XDNA 4MTEA 1P8LA 1Z2OX 4LH7A 4DV7H 3EYYA 4M7EA 1XNQH 4J0MA 4DV4H 3CVZA 4JI1H 5FD6A 1E4GT 1TA8A 1FKAH 4LFAH 3DF7A 4OX9H 3MWMA 1SYXB 4A2BA 4DV3H 5LMUH 4LSAA 2WDTA 4LH6A 4JI5H 4JI7H 5LL6b 4DV0H 4RB3C 4JI3H 2FE3A 2WYOA 5D1PA 3F8NA 4R7RA 5D1OB 4B3MH 3N41B 4GLXA 4AQYH 3LMLA 2RGVA 1N36H 3J7AK 1L2ZA 3HXLA 4CC5A 3UQ8A 3JSNA 4B3RH 1BGWA 1N32H 3K3VA 3KAKA 3J80W 1MZBA 4KHPH 2UXBH 5A2QW 1HNXH 1FVIA 3BABA 1HNWH 4X64H 2W57A 3BA9A 1XNRH 4LFCH 4A2AA 4PDBA 2UXDH 1B04A 4DR6H 3RIZA 4RB1A 4JI8H 5BR8H 2HHHH 2WE6A 1VS0A 2VQEH 4YY3H 1HR0H 4K0KH 2Q2TA 4EFEA 3BA8A 4MTDA 4DUZH 3FMAA 4X66H 4LF9H 3M4IA 2VQFH 2Q2UA 4NXNH 1DGSA 1ZHQA 1ZHSA 5FLXW 4JI6H 2HVQA 1BJTA 1SEIA 2HVSA 1N34H 2MCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  2ZJT A;  3IG0 A; 
#chains in the Genus database with same CATH topology
 3R23 A;  4DL4 A;  4ED3 A;  5HV6 A;  1WR2 A;  4FS2 A;  3KAJ A;  5LOV F;  4A3J G;  4LF5 H;  4ED7 A;  3GII A;  1KJ8 A;  5KT7 A;  4A3K G;  3MFI A;  4I7H A;  2PMZ E;  2PBZ A;  2ASL A;  1T3N A;  2UVU A;  3GID A;  4QJF A;  2J6S A;  1WSC A;  2ZDQ A;  4Q43 A;  3RAX A;  4APM A;  3RBD A;  4O3Q A;  1GSA A;  5KFJ A;  2JA7 G;  4FU0 A;  2I8C A;  4QWB A;  2V58 A;  1S0O A;  4NXM H;  2UUA H;  1I7L A;  4UCS A;  1IOV A;  3LP8 A;  4DL6 A;  2YS6 A;  3Q1K A;  5FPR A;  5KFK A;  3L4J A;  4GKK H;  4B3T H;  3JRX A;  3PR5 B;  1JDB B;  4F4Y A;  1UNN C;  5D1O A;  3N6X A;  2XD4 A;  3Q8Q B;  5L9X A;  2UVR A;  3HOW G;  1E4F T;  2DPJ A;  2CW7 A;  2JA6 G;  5FLM G;  1I7N A;  3MR2 A;  2W9B B;  1S9F A;  4UCT A;  3Q8S B;  2O03 A;  3IN5 A;  1Y1V G;  5JH7 F;  4XZ3 B;  2JA6 A;  5BPF A;  3QZ7 A;  3HKZ A;  4UCR A;  4AYB A;  3RTX A;  3GTG A;  5DGB A;  1GO3 E;  4Q0Y A;  4FS1 A;  1N33 H;  2W70 A;  4UFZ A;  1Y1V A;  4MV7 A;  1KEE A;  4DR1 H;  1JX4 A;  4RNN A;  3N40 P;  2R7Z A;  4Q45 A;  5KT2 A;  5IT9 W;  3QFF A;  2R93 G;  2F4V H;  4EEQ A;  1WH2 A;  2JEG A;  4O3S A;  1OWT A;  2W71 A;  5D8D A;  5LXT F;  4DR5 H;  4EFB A;  2C28 A;  3JAM W;  2IA6 A;  4MV9 A;  5CAE B;  4RB2 C;  1IBM H;  4GC7 A;  3NGD A;  1TAE A;  3FKI G;  1TWA A;  5IP7 G;  4MTE A;  1AUV A;  4LH7 A;  3EYY A;  2BQU A;  3Q8P B;  4YAJ B;  2YRX A;  5L1K A;  4ECU A;  1KJI A;  2FP4 B;  4DV3 H;  3JRW A;  4ED2 A;  3FKI A;  4RUA A;  2J6T A;  1BNC A;  4JV2 A;  3TQT A;  2JEJ A;  2IMW P;  4JI3 H;  2GPW A;  2YU9 A;  2WYO A;  3F8N A;  5D1O B;  1RJR A;  3ORR A;  3V6K A;  3G6V A;  4O3N A;  4AQY H;  1JLL B;  4Q8E A;  3H0G G;  2RGV A;  1ZQ7 A;  1L2Z A;  2VPQ A;  4A3L G;  3N8D A;  4CC5 A;  3JSN A;  2XCL A;  2C35 B;  3UQ8 A;  5KT5 A;  3T5K A;  1B33 N;  2ZDG A;  3RB6 A;  1RK5 A;  1RYS A;  1MZB A;  4J9O A;  1HNX H;  1FVI A;  3H0G A;  4RU9 A;  2PMZ A;  3VPB A;  5T14 A;  4F4W A;  4DR6 H;  3E5N A;  3RAQ A;  1GSO A;  4RB1 A;  3MJF A;  3VPC A;  2FK1 A;  1V51 A;  4QW8 A;  5KFS A;  4K0K H;  2ALZ A;  3K5I A;  4L1K A;  4EFE A;  5KFW A;  3R5F A;  3FMA A;  4HNU A;  4LF9 H;  2VQF H;  3HKZ E;  1DGS A;  1ZHQ A;  1ZHS A;  2QYZ A;  4WBN F;  5KFB A;  4JI6 H;  4MV1 A;  2OLS A;  2CQY A;  2FB9 A;  4C5B A;  2V4Q A;  3MWE A;  4A3F G;  1M7J A;  4RZQ A;  4O3O A;  3PW4 A;  1VBG A;  4XYM B;  2DPI A;  5DG9 A;  3OHA A;  3KHG A;  1XMQ H;  2AU0 A;  3RJ0 A;  3BAA A;  2R8G A;  2IP4 A;  3OUZ A;  3GIJ A;  5DQG A;  2R7L A;  4J9N A;  4CC6 A;  2OH2 A;  4YHH H;  3RB4 A;  2XGQ A;  1RK6 A;  2AGQ A;  4JV5 H;  4IR1 A;  3KAL A;  3J81 W;  2VA2 A;  5EZY F;  1GSH A;  3KXY T;  5KFC A;  4LF6 H;  4LSX A;  3HOX G;  2UUB H;  4ECZ A;  2BR0 A;  4HQ6 A;  3KHH A;  4UCO A;  1CS0 A;  1X9N A;  5GON F;  2GLT A;  2I87 A;  4ETS A;  4IZO A;  3WO0 A;  2R84 A;  3RGX A;  4J9Q A;  5IYC G;  4J9L A;  4DV1 H;  3UFX B;  5DGA A;  1I3Q A;  2VOB A;  5LA6 F;  4J9S A;  1JDE A;  3WO1 A;  1IBL H;  5EWF A;  2C2R A;  3GLK A;  4GKJ H;  1V4Y A;  3TII A;  4RNO A;  3QZ8 A;  3GIQ A;  2DIK A;  4A93 G;  4A3G G;  1O75 A;  5EOY A;  3L2P A;  1SCU B;  1J5E H;  4DV2 H;  3Q8R B;  4HYK A;  5C1O A;  5JQW A;  3RFC A;  3KHR A;  1R9T A;  2VA3 A;  2FLN A;  2YRW A;  3L4K A;  4B3S H;  2NU8 B;  4ZI7 F;  3N42 B;  2VQD A;  4F4Z A;  2R8H A;  3GTL A;  5HBR B;  1W93 A;  2PN1 A;  5KFA A;  4QIW A;  3M9N B;  2IBK A;  1WCM G;  3GTO A;  1S10 A;  2QK4 A;  2DLN A;  5KFV A;  5KFQ A;  5LP6 F;  2YYA A;  2WTF A;  4IWY A;  2R8K A;  4JV1 A;  5JVL A;  3GTQ A;  4QWD A;  5J2T F;  1M0W A;  1WCM A;  5KFN A;  3OTO H;  3IG0 A;  4YR0 A;  4BXX G;  4G3I A;  3N44 B;  3K5H A;  4HR7 A;  1Z2O X;  1Y1W A;  4DV7 H;  1DIK A;  2R7N A;  3ETH A;  4M7E A;  1XNQ H;  2YL2 A;  4TUY F;  4DV4 H;  4LFA H;  1GGO A;  4I50 F;  2GPS A;  4MA5 A;  5KFX A;  3MR3 A;  2BQ3 A;  4OX9 H;  2BQR A;  1UC9 A;  5DLG A;  5C1P A;  5CA1 F;  1EYZ A;  4ED6 A;  4DV0 H;  2AGO A;  4EBC A;  4DLK A;  2R7Z G;  5KFP A;  5KFR A;  1DV1 A;  4B3M H;  4GLX A;  3PW2 A;  4TV9 F;  4EGQ A;  4EBE A;  2R6F A;  1KJQ A;  2SCU B;  2CZG A;  5KFG A;  3J7A K;  3T5J A;  4J9K A;  4YR3 A;  4J9M A;  3HBL A;  4U6P A;  1BGW A;  5L1J A;  1N32 H;  3K3V A;  4KHP H;  4HNT A;  5A2Q W;  4GC6 A;  2B63 A;  4ECS A;  5BPH A;  4O3R A;  2V59 A;  1KJJ A;  3MFH A;  4JI8 H;  2I80 A;  3CQZ A;  3U9S A;  4ZOL F;  3BQ0 A;  4TQS A;  2WE6 A;  5KT3 A;  2HHH H;  1K1Q A;  2DZD A;  4XYL B;  3BA8 A;  4MTD A;  4QWE A;  1EHI A;  3ORQ A;  4A3B G;  4NXN H;  2JA8 G;  2W6P A;  5KG0 A;  2NVY A;  5F9N A;  2HVQ A;  1BJT A;  2E2H A;  3PO2 G;  2W6N A;  4YJ3 F;  1TWF A;  1N34 H;  5KFI A;  4TQR A;  1JXL A;  5KX5 F;  5DG7 A;  2ASD A;  5CA0 F;  4QWA A;  4QIW E;  4EBD A;  2RDJ A;  2ZDH A;  1E4E A;  5BMV F;  1TWH A;  5KFM A;  5IYD G;  2V9W A;  5H80 A;  2UVW A;  2R8J A;  4X62 H;  4YR2 A;  1T94 A;  4DUY H;  4UCV A;  3R5X A;  1EUC B;  3G6Y A;  4IAJ A;  4RAY A;  1KJ9 A;  1ZET A;  4IR9 A;  2RF4 A;  4LMY A;  4MAM A;  3G6X A;  4YBZ B;  1S97 A;  4MV6 A;  2FK3 A;  1CQI B;  2C2E A;  1TWC A;  5L1L A;  4DR3 H;  1CQJ B;  2R87 A;  2NVX A;  4O4I F;  4JI2 H;  3T5H A;  5JVD F;  3H20 A;  3JSL A;  5EWG A;  2W8L A;  2ZJT A;  2ASJ A;  2M05 A;  1AN7 A;  3ETJ A;  3MR5 A;  1XMO H;  3RF2 A;  4A3M G;  2YZG A;  3TIN A;  1RYR A;  2E5L H;  3BJY A;  2FJZ A;  2V5A A;  3M9O B;  1N56 A;  2KSW A;  1RJQ A;  2XIG A;  4O2A F;  4YQW A;  4X65 H;  2DWC A;  4ECQ A;  3HOY G;  1EZ1 A;  3GIP A;  3V4S A;  2R8I A;  4DL7 A;  1T36 A;  2YZM A;  1M0T A;  2P0A A;  3T1Y H;  3GV5 B;  3SE7 A;  2W6M A;  3TQ1 A;  5K2M A;  3HOZ G;  4MA0 A;  5EDW A;  1IBK H;  4I55 F;  3H3V H;  4UCU A;  3PW0 A;  2VUM G;  4R8U A;  3K3P A;  5KG7 A;  1PK8 A;  1S03 G;  2HVR A;  4LF8 H;  4RZR A;  4RAZ A;  1B6S A;  4BWS C;  5LYJ F;  5KFL A;  3I12 A;  3EPI A;  4RB0 A;  4O2B F;  4J9R A;  4A3I G;  5IYB G;  5DQI A;  1E4E B;  3N43 B;  5KT6 A;  3H4D A;  2RGR A;  3HOV G;  2XCA A;  4BBS G;  2FPP B;  2RDI A;  2W9C B;  2CW8 A;  1N48 A;  5KG3 A;  4Q44 A;  2WAQ A;  2FLP A;  4IWX A;  4ZHQ F;  5KG2 A;  1XDN A;  1P8L A;  3KHL A;  2VUM A;  5KFZ A;  4NLG A;  2W7P A;  5KG4 A;  3VPD A;  1FKA H;  3HOU G;  3MWM A;  4A2B A;  3RBE A;  1UC8 A;  5LMU H;  1VAJ A;  2WDT A;  4J9P A;  2R86 A;  3EPG A;  5LL6 b;  2C2D A;  4RB3 C;  2FE3 A;  3G8C A;  5C8Y F;  3H4B A;  4R7R A;  5C4X G;  4O4L F;  4C5C A;  4ECR A;  4JV0 A;  4ECX A;  2FPG B;  4YP3 A;  2NU7 B;  5KFD A;  4BY1 G;  4PWQ A;  4RUC A;  1N36 H;  2WB1 A;  3BG5 A;  4ECW A;  3HXL A;  2R82 A;  4XX0 B;  3WNZ A;  4C5A A;  1GLV A;  1RJP A;  5C44 G;  2C22 A;  4B3R H;  1W96 A;  3KAK A;  3PR4 A;  1Y1W G;  2HJW A;  1BXR A;  3GTP A;  2YZN A;  1TWG A;  1HNW H;  3LWB A;  2W57 A;  4X64 H;  3BA9 A;  4RNM A;  2X0S A;  4A2A A;  1M6V A;  2W6Q A;  3RIZ A;  2ATL A;  4YB8 B;  4MV8 A;  2V4R A;  3RUP A;  5BR8 H;  1JKJ B;  3R5H A;  4ED1 A;  1VS0 A;  2PVP A;  4YY3 H;  3KTM A;  2Q2T A;  4R8U B;  2W7O A;  4YJ2 F;  4DUZ H;  4EGJ A;  3OSN A;  4EYH B;  5KG1 A;  4X66 H;  4IRK A;  3M4I A;  2JA7 A;  2W8K A;  5FLX W;  2NUA B;  3T5L A;  4DL2 A;  1SEI A;  4I4T F;  3GQC A;  5KT4 A;  4BBR G;  2HVS A;  2MCT A;  4O4H F;  1SFO A;  4ECT A;  3TIG A;  2C00 A;  3RB0 A;  2VPS A;  4F50 A;  4MV4 A;  5KG6 A;  2B63 G;  1GYF A;  3RGZ A;  2NU6 B;  1VBH A;  4C2M A;  2UUC H;  5KFU A;  3GIL A;  2Y0S A;  3C0F B;  3RV4 A;  2NU9 B;  3GV8 B;  4IHJ F;  4YAK B;  2WAQ E;  1HNZ H;  2OWO A;  4IRC A;  3AYH B;  1FJG H;  2CKZ B;  5I47 A;  3PN1 A;  2R7M A;  4DR7 H;  3PW5 A;  5C5J A;  4JI0 H;  1AUX A;  1EUD B;  4ME6 A;  4ECV A;  3GTK A;  5KFY A;  4A3D G;  5IWA H;  4F4X A;  2FLL A;  2ZM6 H;  3PVX A;  3PO3 G;  3U9T A;  1S68 A;  4DR2 H;  4DL5 A;  2FKL A;  4E4T A;  1I94 H;  2HGS A;  2YCH A;  1B6R A;  3MR6 A;  3GIK A;  4LF7 H;  3RV3 A;  2UU9 H;  3Q2O A;  2WB1 E;  5FD5 A;  3OHB A;  5LMN H;  1A0I A;  3I4M G;  5KFT A;  2R7K A;  4TV8 F;  3I4N G;  4A3C G;  5EWE A;  4JI4 H;  2UXC H;  4LF4 H;  2R93 A;  2W9C A;  4DV6 H;  5DG8 A;  5DLF A;  3T1H H;  1V9P A;  3SI8 A;  4JYA H;  4JUZ A;  1PX2 A;  4LFB H;  4M9U A;  2JA5 G;  2JEF A;  5FPO A;  1I6U A;  4IRD A;  5KG5 A;  4MV3 A;  3V4Z A;  4FBU A;  4A3E G;  2FMA A;  3V6H A;  5IP9 G;  4DR4 H;  5KFH A;  2JA5 A;  1Z2N X;  5DQH A;  2R92 G;  3H40 A;  4EYI B;  2VUG A;  1A9X A;  1KC7 A;  2W6O A;  2FK2 A;  4FBT A;  2W6Z A;  5L1I A;  1Z2P X;  4FM9 A;  4QW9 A;  2R92 A;  3JZI A;  1ULZ A;  5IYZ F;  1VKZ A;  2W9A A;  3GV7 B;  3OUU A;  4O3P A;  5KKN B;  3OSP A;  2J6U A;  3RB3 A;  2JEI A;  3HB9 A;  4EG0 A;  3PW7 A;  4J0M A;  3CVZ A;  4U7C A;  5FD6 A;  1E4G T;  1TA8 A;  3BQ2 A;  1C30 A;  4JI1 H;  3DF7 A;  2Y0S E;  1SYX B;  1K83 A;  4LSA A;  3GTM A;  2E2I A;  1CE8 A;  3PZP A;  2YW2 A;  4LH6 A;  2AGP A;  4JI5 H;  4JI7 H;  4DL3 A;  4AYB E;  5D1P A;  2FPI B;  4HNV A;  4QWC A;  3BQ1 A;  5FJ8 G;  3N41 B;  1KBL A;  1I50 A;  1DV2 A;  2XCP A;  4ED8 A;  3V6J A;  4EEY A;  1Y14 B;  3LML A;  3GTJ A;  3GIM A;  4ZQI A;  4ECY A;  4BY7 G;  2AQ4 A;  1IOW A;  1K1S A;  3J80 W;  2UVV A;  2YS7 A;  2UXB H;  3BAB A;  1JIH A;  3FDS A;  2J9G A;  1C3O A;  2VR1 A;  1XNR H;  5CB4 F;  2XC9 A;  4LFC H;  4PDB A;  2UXD H;  1B04 A;  1S0M A;  4Q8F A;  2W9B A;  2R85 A;  5F9L A;  2XGP A;  2VQE H;  1HR0 H;  4Y8V B;  5JUM A;  5J2U F;  3VMM A;  4WD3 A;  4ED0 A;  1S0N A;  2Q2U A;  3MWD A;  5KFF A;  5KFO A;  5KFE A;  3M9M B;  5C3E G;  4DV5 H; 
#chains in the Genus database with same CATH homology
 4RZQ A;  2VPS A;  1GYF A;  3KAJ A;  4LF5 H;  3RGZ A;  1XMQ H;  4X62 H;  2UUC H;  3RJ0 A;  4DUY H;  3BAA A;  4UCV A;  4IAJ A;  4RAY A;  4I7H A;  3C0F B;  4CC6 A;  4LMY A;  4YHH H;  4DV5 H;  1HNZ H;  2OWO A;  4JV5 H;  4APM A;  1FJG H;  3KAL A;  4DR3 H;  3J81 W;  3PN1 A;  4JI2 H;  3KXY T;  4DR7 H;  4LF6 H;  4LSX A;  3H20 A;  3JSL A;  4NXM H;  2UUA H;  4JI0 H;  2UUB H;  2ZJT A;  4UCS A;  1AN7 A;  5IWA H;  5FPR A;  3L4J A;  1XMO H;  3RF2 A;  4UCO A;  1X9N A;  2ZM6 H;  4B3T H;  4GKK H;  2E5L H;  1S68 A;  5D1O A;  4ETS A;  4DR2 H;  4DV1 H;  3RGX A;  3N6X A;  1I94 H;  2HGS A;  2YCH A;  2KSW A;  2XIG A;  2VOB A;  4LF7 H;  4X65 H;  2UU9 H;  5FD5 A;  5LMN H;  1IBL H;  1A0I A;  2UXC H;  1E4F T;  4JI4 H;  2CW7 A;  4LF4 H;  4GKJ H;  4DV6 H;  1M0T A;  4UCT A;  3T1H H;  1V9P A;  3T1Y H;  2O03 A;  1O75 A;  4JYA H;  5EOY A;  4LFB H;  3L2P A;  1J5E H;  1IBK H;  5FPO A;  4DV2 H;  1I6U A;  4UCR A;  3L4K A;  4UCU A;  3RTX A;  4B3S H;  4Q0Y A;  4DR4 H;  1N33 H;  4UFZ A;  1Z2N X;  4MV7 A;  3N42 B;  4DR1 H;  2HVR A;  4LF8 H;  1S03 G;  4RAZ A;  2VUG A;  3N40 P;  4BWS C;  5IT9 W;  4RB0 A;  3N43 B;  2F4V H;  2RGR A;  1Z2P X;  4EEQ A;  4FM9 A;  1WH2 A;  4DR5 H;  4EFB A;  2CW8 A;  3JAM W;  4MV9 A;  1M0W A;  4RB2 C;  1IBM H;  3OTO H;  3IG0 A;  1TAE A;  3N44 B;  1XDN A;  4MTE A;  1P8L A;  1Z2O X;  4LH7 A;  4DV7 H;  3EYY A;  4M7E A;  1XNQ H;  4J0M A;  4DV4 H;  3CVZ A;  4JI1 H;  5FD6 A;  1E4G T;  1TA8 A;  1FKA H;  4LFA H;  3DF7 A;  4OX9 H;  3MWM A;  1SYX B;  4A2B A;  4DV3 H;  5LMU H;  4LSA A;  2WDT A;  4LH6 A;  4JI5 H;  4JI7 H;  5LL6 b;  4DV0 H;  4RB3 C;  4JI3 H;  2FE3 A;  2WYO A;  5D1P A;  3F8N A;  4R7R A;  5D1O B;  4B3M H;  3N41 B;  4GLX A;  4AQY H;  3LML A;  2RGV A;  1N36 H;  3J7A K;  1L2Z A;  3HXL A;  4CC5 A;  3UQ8 A;  3JSN A;  4B3R H;  1BGW A;  1N32 H;  3K3V A;  3KAK A;  3J80 W;  1MZB A;  4KHP H;  2UXB H;  5A2Q W;  1HNX H;  1FVI A;  3BAB A;  1HNW H;  4X64 H;  2W57 A;  3BA9 A;  1XNR H;  4LFC H;  4A2A A;  4PDB A;  2UXD H;  1B04 A;  4DR6 H;  3RIZ A;  4RB1 A;  4JI8 H;  5BR8 H;  2HHH H;  2WE6 A;  1VS0 A;  2VQE H;  4YY3 H;  1HR0 H;  4K0K H;  2Q2T A;  4EFE A;  3BA8 A;  4MTD A;  4DUZ H;  3FMA A;  4X66 H;  4LF9 H;  3M4I A;  2VQF H;  2Q2U A;  4NXN H;  1DGS A;  1ZHQ A;  1ZHS A;  5FLX W;  4JI6 H;  2HVQ A;  1BJT A;  1SEI A;  2HVS A;  1N34 H;  2MCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...