2ZJTA

Crystal structure of dna gyrase b' domain sheds lights on the mechanism for t-segment navigation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
185
Chain Sequence
b'FTDPRKSELYVVEGDMFQAILPLRGKDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 51
structure length 185
sequence length 206
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2zjtA02
3IG0A 2ZJTA 3M4IA
chains in the Genus database with same CATH superfamily
4UCUA 4FBUA 2VQFH 2NU9B 2J6UA 3HBLA 4RAYA 3GIMA 1B04A 1TWAA 4HQ6A 5IYDG 2XGQA 4JI5H 4RU9A 3OHBA 3N41B 4DV5H 3GIPA 4M9UA 1XDNA 2W9BA 3J81W 3M4IA 4X64H 2FB9A 3GIKA 3R5XA 4WD3A 2FLPA 1ZHSA 1WSCA 2FK1A 2B63G 2RDJA 3OUUA 4IRCA 3U9TA 5JH7F 3EPIA 3BQ0A 2R7KA 3PZPA 1WCMG 5F9LA 1KJJA 2J9GA 1Z2NX 1GSHA 5KG1A 5LMNH 3LWBA 4RB1A 2JA6G 2XGPA 1Y1VG 3GIQA 4IR9A 4IRDA 4MV8A 4B3RH 4FS2A 4RNMA 2E5LH 4LF4H 1GGOA 4QIWE 3H0GG 2W70A 5KT7A 4AYBA 2AGPA 5H80A 4APMA 4I50F 2I8CA 4J9QA 1T94A 2R86A 2FKLA 2R7LA 3PN1A 3MR5A 4QWDA 2GPSA 4EGQA 3FMAA 5DQHA 2QYZA 3RV3A 4B3SH 4RUAA 5BPHA 4MV6A 2BQRA 4YR2A 5CB4F 3G6VA 2NU8B 2AGQA 1B6RA 5L1LA 3I4NG 3GTQA 3F8NA 4IZOA 2WB1E 4MV9A 5KFNA 2YS6A 1Y14B 1E4GT 3KAJA 2WTFA 1I7NA 4L1KA 2AQ4A 1SFOA 4JI8H 4MV1A 5C8YF 4A3DG 4RNNA 2FLLA 4MTDA 2R8GA 2VA2A 3GTOA 4RUCA 4ECRA 2YCHA 1DIKA 1KJ9A 2PMZE 1TWFA 3QZ7A 2W7OA 2YW2A 2R8HA 4DR3H 2V58A 2W6NA 2WE6A 4OX9H 5KFLA 3Q8SB 2FPPB 1O75A 4A2BA 3T5JA 4DL2A 4A3LG 5KFMA 3GTJA 2JA5G 2W7PA 1K1QA 1ZHQA 4YR0A 2ASDA 1R9TA 1I50A 4YP3A 2W9CB 2VUMA 1RYRA 2V4QA 3HKZE 3V6HA 4FBTA 2UUBH 5CAEB 1T36A 3VPDA 4ECTA 3RB3A 1CQJB 4BBSG 2UVWA 4C5CA 1RK6A 3GQCA 1VKZA 4PWQA 4Q0YA 3ORQA 2E2HA 5LL6b 3MR2A 2IBKA 3FKIA 3MFIA 2VQDA 2R7ZG 1MZBA 5HBRB 4YAKB 5KFKA 4I7HA 2HJWA 2JEJA 3IN5A 4DL6A 2R82A 5DG9A 5KFWA 4EYHB 1I7LA 3PR4A 4GC6A 2WDTA 4R8UA 2FK3A 3CQZA 4EFEA 5DGBA 4GLXA 1SEIA 4RB0A 4DLKA 3BABA 3RF2A 4BWSC 4EEQA 2VQEH 5IYZF 3JAMW 4F4ZA 5D1OA 2RGRA 4DL5A 4LFBH 3OUZA 1E4EA 4EBDA 5DQGA 4IWYA 3TQ1A 5CA1F 1V9PA 3KTMA 3KAKA 5KX5F 4DV6H 3UQ8A 4J9RA 4UCTA 5KFRA 5C1OA 4U7CA 1OWTA 4J0MA 5IT9W 1M0TA 2J6SA 4BBRG 3PW4A 2WB1A 4A3IG 1EZ1A 3JSLA 2FJZA 3HOVG 2JA7G 3HOZG 1V4YA 5K2MA 1E4FT 4ED7A 4JYAH 4A3JG 4IWXA 4ZQIA 1W93A 3VPBA 2UVRA 4LF9H 3CVZA 3K3PA 4O3PA 1UC8A 3HXLA 3T1YH 1DV1A 1FKAH 3LMLA 3RGZA 1N34H 1EUCB 2AGOA 4EBCA 4LFAH 2ZDHA 5EZYF 3JZIA 4BY7G 3BQ2A 5L1KA 1S0OA 5DLFA 4DV3H 1TWCA 4CC5A 2RGVA 1IOVA 2FE3A 2P0AA 2YZNA 4HR7A 5J2UF 2UVUA 4TUYF 2XCPA 5EDWA 4Q43A 5KFUA 2W71A 4DUZH 2GLTA 3LP8A 4NXNH 1UNNC 3QFFA 4LF5H 3N6XA 5EOYA 5IYBG 3JRWA 2R85A 3KXYT 5KFQA 1KBLA 4EGJA 4LH6A 4R7RA 2W8LA 4FU0A 3J7AK 4BY1G 1S9FA 3PO2G 2O03A 4O3NA 4HNTA 1N33H 2W6ZA 4X62H 3N40P 4J9LA 1I94H 4LF7H 4ED1A 2XD4A 4QW8A 4XYMB 1K83A 3RB0A 3AYHB 4ZHQF 1IBKH 3T5HA 2YRWA 4J9SA 2Q2TA 3RV4A 2B63A 3GV5B 4DV7H 4EG0A 4C2MA 5FD5A 2VA3A 5A2QW 4IAJA 1WCMA 3OHAA 3Q8RB 3GV7B 1SCUB 5KKNB 4DR6H 1V51A 3WO1A 4DL7A 5KFJA 3BAAA 2JA6A 5C44G 1Y1VA 2CW8A 4ZOLF 1M7JA 4X66H 3H0GA 4ECUA 3N44B 4C5AA 4DV2H 4TV9F 2KSWA 4O2AF 4EEYA 2C2RA 4YB8B 5LXTF 4QWCA 2DIKA 2IA6A 3PO3G 1XNRH 1B33N 2FPGB 4ECZA 3N43B 2HVSA 2J6TA 3GILA 3N8DA 1TAEA 4TV8F 1TWHA 5IP7G 4ECWA 1BNCA 1WH2A 5GONF 5KT2A 2RF4A 1I3QA 4RB3C 4DV1H 4ECSA 2OWOA 1C3OA 1M0WA 2R7NA 4JI7H 5EWGA 3E5NA 3L2PA 1CE8A 3K5IA 3GIIA 2OLSA 2W9BB 5T14A 1BJTA 2IP4A 3RGXA 3GIJA 2OH2A 4JI6H 2VR1A 4UCOA 4O3QA 3R5FA 4XZ3B 5KFAA 5KT6A 4QWEA 4O4HF 4DV0H 4F4YA 3RBEA 5KFZA 5C4XG 4TQSA 3BJYA 1ZETA 4ECXA 1Y1WG 4O3SA 1RJQA 3GTLA 2C2DA 5FPRA 5KG4A 3GIDA 1L2ZA 2CKZB 3M9OB 2ZJTA 4B3TH 4QWBA 1TA8A 1N56A 2JA5A 3EPGA 2M05A 5BPFA 2Q2UA 2MCTA 5IP9G 3GTPA 4MA5A 5KG5A 4J9MA 4Q45A 5DG7A 2C35B 2FMAA 4A3MG 4ME6A 3T5LA 4JI0H 2CQYA 5DQIA 5KG2A 5C1PA 1GSAA 2R7ZA 4J9KA 1M6VA 4ETSA 1XMQH 3L4KA 3JSNA 2VPSA 5JQWA 1IBMH 2NU7B 4YQWA 2V5AA 4ED0A 1HNZH 4QIWA 1JLLB 2R93A 3T1HH 2JEIA 1P8LA 2UXCH 4MAMA 3PW0A 3ETHA 3KALA 3M9MB 3TIGA 2DWCA 2Y0SE 2GPWA 2CZGA 1UC9A 4A2AA 5FLXW 3RJ0A 2DLNA 2W57A 1GLVA 3MJFA 3Q8PB 2R8JA 2ATLA 3I12A 1GYFA 5FD6A 4C5BA 3C0FB 2IMWP 1I6UA 2C2EA 3BG5A 3MR6A 3SE7A 2XC9A 2HHHH 2JA7A 2JA8G 4ECQA 2NUAB 1N36H 2R84A 4A3KG 4A3FG 2YU9A 2E2IA 1DGSA 2PMZA 2ZM6H 4DR7H 4UCSA 3G6XA 2UVVA 5D1PA 1XMOH 3QZ8A 4A3EG 1CS0A 4TQRA 1TWGA 2R7MA 2WAQE 4CC6A 5LYJF 1Z2OX 5KG7A 4WBNF 4JI2H 2R6FA 1IOWA 2YZGA 2C00A 3OSNA 1PX2A 4NXMH 2PN1A 4YBZB 1C30A 4RB2C 5KFXA 3FDSA 4AYBE 2YL2A 1T3NA 4E4TA 3SI8A 1GO3E 4UCRA 4NLGA 3HKZA 4R8UB 4F50A 1ZQ7A 2JEFA 4HNUA 1RYSA 1A9XA 5D1OB 4IHJF 1JKJB 1E4EB 4O4IF 4QJFA 3RB4A 1KJQA 2V9WA 1AUXA 3N42B 3VMMA 4J9PA 3EYYA 4ED2A 2C28A 4LF6H 4DL4A 4A3GG 2NVYA 4DR4H 1VAJA 2HVQA 4YJ2F 4YY3H 5EWEA 4DL3A 3RTXA 5KFEA 1JX4A 1IBLH 4EFBA 2R92G 1HNXH 3Q8QB 5KFYA 4RZQA 3MWMA 4HYKA 4YHHH 3R23A 2RDIA 2Y0SA 2FPIB 3K5HA 3RFCA 5KFFA 2XCAA 5KFHA 3HOYG 2DZDA 1AUVA 1K1SA 1JDBB 4J9OA 2SCUB 3I4MG 4O4LF 4HNVA 4JV1A 3H40A 2VUGA 4DR2H 1GSOA 4UCVA 2X0SA 2VOBA 3R5HA 4ED3A 4ZI7F 3HOUG 4MV4A 3HOWG 5FJ8G 1KEEA 1KJ8A 3OSPA 2HGSA 5HV6A 2DPJA 5C3EG 4JV2A 3JRXA 3G8CA 3KHHA 4JI1H 3K3VA 4GKKH 1DV2A 5D8DA 3T5KA 2R87A 4YR3A 2V59A 3ETJA 1EHIA 3MR3A 3RBDA 1VS0A 3RIZA 2WAQA 2W8KA 3BA9A 1S0MA 5KFBA 5L1JA 5KG0A 2W9CA 4Q44A 1N32H 3H3VH 4MTEA 2C22A 3GTMA 4Q8EA 1JIHA 3HOXG 2VPQA 1VBHA 5DG8A 4QW9A 4MV7A 2W6MA 3TQTA 5KFDA 3DF7A 2JEGA 4A3CG 4B3MH 4YJ3F 3V4SA 5I47A 1N48A 4G3IA 1B6SA 5J2TF 3TINA 5FPOA 3V6JA 2ASJA 3PW7A 3PW2A 4GKJH 2YZMA 1ULZA 5DGAA 1Y1WA 5F9NA 5KT4A 1A0IA 5JVDF 3GV8B 2PVPA 3PR5B 4DUYH 4AQYH 1S97A 5KT5A 4ED6A 4U6PA 2PBZA 2BR0A 5JUMA 3HB9A 4EBEA 3G6YA 4FM9A 1S0NA 2W9AA 1EUDB 5C5JA 2NVXA 2WYOA 4UFZA 4Y8VB 3VPCA 5L9XA 3KHLA 4XX0B 1X9NA 4PDBA 4JI3H 4I4TF 1XNQH 4O2BF 5CA0F 2W6QA 5LP6F 4YAJB 3L4JA 4IRKA 3BQ1A 1HNWH 2VUMG 3NGDA 4LSXA 5KG3A 2XCLA 2FK2A 5KFOA 3RAQA 2UXDH 3PW5A 3MWEA 2YYAA 5KFSA 2BQUA 3M9NB 1AN7A 3Q1KA 2XIGA 3V4ZA 3H4BA 2AU0A 1KJIA 1RJRA 4MA0A 1W96A 2YS7A 3FKIG 5IWAH 3UFXB 3KHGA 2ASLA 5LOVF 4LFCH 1WR2A 2W6OA 2ZDQA 4ECYA 2DPIA 4F4XA 1KC7A 3H20A 3PVXA 5L1IA 4DV4H 3RAXA 5EWFA 5KFVA 3IG0A 4K0KH 3WNZA 5IYCG 4JV5H 4XYLB 1BGWA 4J9NA 4KHPH 4QWAA 2R93G 2FP4B 3U9SA 4O3RA 4LSAA 2V4RA 2CW7A 4A93G 4DR5H 3OTOH 2NU6B 5KFPA 4JI4H 1SYXB 2FLNA 1S68A 2W6PA 3KHRA 1HR0H 4EYIB 5KFTA 5LA6F 1J5EH 2I87A 4FS1A 4Q8FA 2BQ3A 1S10A 4RNOA 4IR1A 1JXLA 3H4DA 3Q2OA 4A3BG 4RAZA 2UXBH 3GLKA 4JV0A 4BXXG 3ORRA 1FJGH 2F4VH 5KFCA 1RK5A 3MWDA 3J80W 2UU9H 1Z2PX 5BMVF 5BR8H 1PK8A 4MV3A 4M7EA 1EYZA 5KT3A 3RB6A 1S03G 3RUPA 5KFGA 5JVLA 4RZRA 4F4WA 1JDEA 4LF8H 4GC7A 4JUZA 2UUCH 3WO0A 1VBGA 5DLGA 1RJPA 4DR1H 2ALZA 4LH7A 2R8KA 4ED8A 2ZDGA 2UUAH 3GTGA 1FVIA 4O3OA 4I55F 2YRXA 5KFIA 4ECVA 2HVRA 5LMUH 2QK4A 5FLMG 2I80A 3TIIA 3BA8A 2R8IA 3MFHA 1BXRA 1CQIB 3V6KA 3GTKA 5KG6A 2R92A 4LMYA 4X65H
chains in the Genus database with same CATH topology
4UCUA 4J0MA 2VQFH 1M0TA 5IT9W 4RAYA 1N32H 1B04A 4MTEA 3JSLA 4JI0H 4JI5H 1E4FT 4JYAH 4ETSA 1XMQH 4MV7A 4LF9H 3DF7A 3L4KA 3CVZA 3N41B 3JSNA 4DV5H 2VPSA 3T1YH 3HXLA 1FKAH 1XDNA 3LMLA 3RGZA 3J81W 1N34H 3RIZA 1HNZH 3M4IA 4X64H 4B3MH 4LFAH 3T1HH 1P8LA 2UXCH 5FPOA 1ZHSA 4GKJH 3KALA 4DV3H 4CC5A 2RGVA 4A2AA 1A0IA 5FLXW 2FE3A 4AQYH 4DUYH 3RJ0A 2W57A 1Z2NX 5LMNH 5FD6A 1GYFA 4RB1A 4DUZH 4NXNH 3C0FB 1I6UA 4B3RH 4FM9A 3N6XA 5EOYA 2E5LH 4LF4H 4LF5H 2WYOA 3KXYT 4UFZA 2HHHH 4LH6A 4R7RA 4APMA 1X9NA 4JI3H 1N36H 1XNQH 4PDBA 3J7AK 3PN1A 1DGSA 2ZM6H 4DR7H 3FMAA 4UCSA 1VS0A 4B3SH 2O03A 3L4JA 5D1PA 1XMOH 1HNWH 1N33H 4X62H 4LSXA 3N40P 1I94H 4LF7H 4CC6A 2UXDH 1Z2OX 4JI2H 1AN7A 2XIGA 3F8NA 4MV9A 4NXMH 1IBKH 2Q2TA 1E4GT 3KAJA 4JI8H 4LFCH 5IWAH 4DV7H 4RB2C 5FD5A 4MTDA 5A2QW 4IAJA 3H20A 4DR6H 4DV4H 4UCRA 2YCHA 3IG0A 4K0KH 4JV5H 3BAAA 1BGWA 4KHPH 2CW8A 5D1OB 4DR3H 4LSAA 2WE6A 4OX9H 4X66H 2CW7A 3N42B 3N44B 1O75A 3EYYA 4A2BA 3OTOH 4DV2H 4DR5H 2KSWA 4JI4H 4LF6H 1SYXB 1S68A 1HR0H 1ZHQA 1XNRH 4DR4H 1J5EH 2HVQA 3N43B 4YY3H 2HVSA 3RTXA 1TAEA 1IBLH 4EFBA 1HNXH 2UUBH 4RZQA 3MWMA 4YHHH 1WH2A 4RAZA 2UXBH 4Q0YA 4RB3C 4DV1H 2OWOA 5LL6b 1M0WA 4JI7H 2F4VH 1FJGH 1MZBA 3L2PA 3J80W 2UU9H 4I7HA 1Z2PX 2VUGA 5BR8H 1BJTA 4DR2H 3RGXA 4UCVA 2VOBA 4JI6H 4M7EA 4UCOA 4X65H 1S03G 4DV0H 2HGSA 2WDTA 4LF8H 4GLXA 4EFEA 1SEIA 4RB0A 2UUCH 3BABA 3RF2A 4DR1H 4BWSC 4EEQA 2VQEH 2RGRA 4LH7A 3JAMW 5D1OA 5FPRA 2UUAH 4LFBH 1FVIA 4JI1H 1L2ZA 1IBMH 3K3VA 4GKKH 2ZJTA 2HVRA 5LMUH 1V9PA 4B3TH 1TA8A 3KAKA 3BA8A 4DV6H 3UQ8A 4UCTA 2Q2UA 2MCTA 4LMYA 3BA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG0 A;  2ZJT A;  3M4I A; 
#chains in the Genus database with same CATH topology
 4UCU A;  4FBU A;  2VQF H;  2NU9 B;  2J6U A;  3HBL A;  4RAY A;  3GIM A;  1B04 A;  1TWA A;  4HQ6 A;  5IYD G;  2XGQ A;  4JI5 H;  4RU9 A;  3OHB A;  3N41 B;  4DV5 H;  3GIP A;  4M9U A;  1XDN A;  2W9B A;  3J81 W;  3M4I A;  4X64 H;  2FB9 A;  3GIK A;  3R5X A;  4WD3 A;  2FLP A;  1ZHS A;  1WSC A;  2FK1 A;  2B63 G;  2RDJ A;  3OUU A;  4IRC A;  3U9T A;  5JH7 F;  3EPI A;  3BQ0 A;  2R7K A;  3PZP A;  1WCM G;  5F9L A;  1KJJ A;  2J9G A;  1Z2N X;  1GSH A;  5KG1 A;  5LMN H;  3LWB A;  4RB1 A;  2JA6 G;  2XGP A;  1Y1V G;  3GIQ A;  4IR9 A;  4IRD A;  4MV8 A;  4B3R H;  4FS2 A;  4RNM A;  2E5L H;  4LF4 H;  1GGO A;  4QIW E;  3H0G G;  2W70 A;  5KT7 A;  4AYB A;  2AGP A;  5H80 A;  4APM A;  4I50 F;  2I8C A;  4J9Q A;  1T94 A;  2R86 A;  2FKL A;  2R7L A;  3PN1 A;  3MR5 A;  4QWD A;  2GPS A;  4EGQ A;  3FMA A;  5DQH A;  2QYZ A;  3RV3 A;  4B3S H;  4RUA A;  5BPH A;  4MV6 A;  2BQR A;  4YR2 A;  5CB4 F;  3G6V A;  2NU8 B;  2AGQ A;  1B6R A;  5L1L A;  3I4N G;  3GTQ A;  3F8N A;  4IZO A;  2WB1 E;  4MV9 A;  5KFN A;  2YS6 A;  1Y14 B;  1E4G T;  3KAJ A;  2WTF A;  1I7N A;  4L1K A;  2AQ4 A;  1SFO A;  4JI8 H;  4MV1 A;  5C8Y F;  4A3D G;  4RNN A;  2FLL A;  4MTD A;  2R8G A;  2VA2 A;  3GTO A;  4RUC A;  4ECR A;  2YCH A;  1DIK A;  1KJ9 A;  2PMZ E;  1TWF A;  3QZ7 A;  2W7O A;  2YW2 A;  2R8H A;  4DR3 H;  2V58 A;  2W6N A;  2WE6 A;  4OX9 H;  5KFL A;  3Q8S B;  2FPP B;  1O75 A;  4A2B A;  3T5J A;  4DL2 A;  4A3L G;  5KFM A;  3GTJ A;  2JA5 G;  2W7P A;  1K1Q A;  1ZHQ A;  4YR0 A;  2ASD A;  1R9T A;  1I50 A;  4YP3 A;  2W9C B;  2VUM A;  1RYR A;  2V4Q A;  3HKZ E;  3V6H A;  4FBT A;  2UUB H;  5CAE B;  1T36 A;  3VPD A;  4ECT A;  3RB3 A;  1CQJ B;  4BBS G;  2UVW A;  4C5C A;  1RK6 A;  3GQC A;  1VKZ A;  4PWQ A;  4Q0Y A;  3ORQ A;  2E2H A;  5LL6 b;  3MR2 A;  2IBK A;  3FKI A;  3MFI A;  2VQD A;  2R7Z G;  1MZB A;  5HBR B;  4YAK B;  5KFK A;  4I7H A;  2HJW A;  2JEJ A;  3IN5 A;  4DL6 A;  2R82 A;  5DG9 A;  5KFW A;  4EYH B;  1I7L A;  3PR4 A;  4GC6 A;  2WDT A;  4R8U A;  2FK3 A;  3CQZ A;  4EFE A;  5DGB A;  4GLX A;  1SEI A;  4RB0 A;  4DLK A;  3BAB A;  3RF2 A;  4BWS C;  4EEQ A;  2VQE H;  5IYZ F;  3JAM W;  4F4Z A;  5D1O A;  2RGR A;  4DL5 A;  4LFB H;  3OUZ A;  1E4E A;  4EBD A;  5DQG A;  4IWY A;  3TQ1 A;  5CA1 F;  1V9P A;  3KTM A;  3KAK A;  5KX5 F;  4DV6 H;  3UQ8 A;  4J9R A;  4UCT A;  5KFR A;  5C1O A;  4U7C A;  1OWT A;  4J0M A;  5IT9 W;  1M0T A;  2J6S A;  4BBR G;  3PW4 A;  2WB1 A;  4A3I G;  1EZ1 A;  3JSL A;  2FJZ A;  3HOV G;  2JA7 G;  3HOZ G;  1V4Y A;  5K2M A;  1E4F T;  4ED7 A;  4JYA H;  4A3J G;  4IWX A;  4ZQI A;  1W93 A;  3VPB A;  2UVR A;  4LF9 H;  3CVZ A;  3K3P A;  4O3P A;  1UC8 A;  3HXL A;  3T1Y H;  1DV1 A;  1FKA H;  3LML A;  3RGZ A;  1N34 H;  1EUC B;  2AGO A;  4EBC A;  4LFA H;  2ZDH A;  5EZY F;  3JZI A;  4BY7 G;  3BQ2 A;  5L1K A;  1S0O A;  5DLF A;  4DV3 H;  1TWC A;  4CC5 A;  2RGV A;  1IOV A;  2FE3 A;  2P0A A;  2YZN A;  4HR7 A;  5J2U F;  2UVU A;  4TUY F;  2XCP A;  5EDW A;  4Q43 A;  5KFU A;  2W71 A;  4DUZ H;  2GLT A;  3LP8 A;  4NXN H;  1UNN C;  3QFF A;  4LF5 H;  3N6X A;  5EOY A;  5IYB G;  3JRW A;  2R85 A;  3KXY T;  5KFQ A;  1KBL A;  4EGJ A;  4LH6 A;  4R7R A;  2W8L A;  4FU0 A;  3J7A K;  4BY1 G;  1S9F A;  3PO2 G;  2O03 A;  4O3N A;  4HNT A;  1N33 H;  2W6Z A;  4X62 H;  3N40 P;  4J9L A;  1I94 H;  4LF7 H;  4ED1 A;  2XD4 A;  4QW8 A;  4XYM B;  1K83 A;  3RB0 A;  3AYH B;  4ZHQ F;  1IBK H;  3T5H A;  2YRW A;  4J9S A;  2Q2T A;  3RV4 A;  2B63 A;  3GV5 B;  4DV7 H;  4EG0 A;  4C2M A;  5FD5 A;  2VA3 A;  5A2Q W;  4IAJ A;  1WCM A;  3OHA A;  3Q8R B;  3GV7 B;  1SCU B;  5KKN B;  4DR6 H;  1V51 A;  3WO1 A;  4DL7 A;  5KFJ A;  3BAA A;  2JA6 A;  5C44 G;  1Y1V A;  2CW8 A;  4ZOL F;  1M7J A;  4X66 H;  3H0G A;  4ECU A;  3N44 B;  4C5A A;  4DV2 H;  4TV9 F;  2KSW A;  4O2A F;  4EEY A;  2C2R A;  4YB8 B;  5LXT F;  4QWC A;  2DIK A;  2IA6 A;  3PO3 G;  1XNR H;  1B33 N;  2FPG B;  4ECZ A;  3N43 B;  2HVS A;  2J6T A;  3GIL A;  3N8D A;  1TAE A;  4TV8 F;  1TWH A;  5IP7 G;  4ECW A;  1BNC A;  1WH2 A;  5GON F;  5KT2 A;  2RF4 A;  1I3Q A;  4RB3 C;  4DV1 H;  4ECS A;  2OWO A;  1C3O A;  1M0W A;  2R7N A;  4JI7 H;  5EWG A;  3E5N A;  3L2P A;  1CE8 A;  3K5I A;  3GII A;  2OLS A;  2W9B B;  5T14 A;  1BJT A;  2IP4 A;  3RGX A;  3GIJ A;  2OH2 A;  4JI6 H;  2VR1 A;  4UCO A;  4O3Q A;  3R5F A;  4XZ3 B;  5KFA A;  5KT6 A;  4QWE A;  4O4H F;  4DV0 H;  4F4Y A;  3RBE A;  5KFZ A;  5C4X G;  4TQS A;  3BJY A;  1ZET A;  4ECX A;  1Y1W G;  4O3S A;  1RJQ A;  3GTL A;  2C2D A;  5FPR A;  5KG4 A;  3GID A;  1L2Z A;  2CKZ B;  3M9O B;  2ZJT A;  4B3T H;  4QWB A;  1TA8 A;  1N56 A;  2JA5 A;  3EPG A;  2M05 A;  5BPF A;  2Q2U A;  2MCT A;  5IP9 G;  3GTP A;  4MA5 A;  5KG5 A;  4J9M A;  4Q45 A;  5DG7 A;  2C35 B;  2FMA A;  4A3M G;  4ME6 A;  3T5L A;  4JI0 H;  2CQY A;  5DQI A;  5KG2 A;  5C1P A;  1GSA A;  2R7Z A;  4J9K A;  1M6V A;  4ETS A;  1XMQ H;  3L4K A;  3JSN A;  2VPS A;  5JQW A;  1IBM H;  2NU7 B;  4YQW A;  2V5A A;  4ED0 A;  1HNZ H;  4QIW A;  1JLL B;  2R93 A;  3T1H H;  2JEI A;  1P8L A;  2UXC H;  4MAM A;  3PW0 A;  3ETH A;  3KAL A;  3M9M B;  3TIG A;  2DWC A;  2Y0S E;  2GPW A;  2CZG A;  1UC9 A;  4A2A A;  5FLX W;  3RJ0 A;  2DLN A;  2W57 A;  1GLV A;  3MJF A;  3Q8P B;  2R8J A;  2ATL A;  3I12 A;  1GYF A;  5FD6 A;  4C5B A;  3C0F B;  2IMW P;  1I6U A;  2C2E A;  3BG5 A;  3MR6 A;  3SE7 A;  2XC9 A;  2HHH H;  2JA7 A;  2JA8 G;  4ECQ A;  2NUA B;  1N36 H;  2R84 A;  4A3K G;  4A3F G;  2YU9 A;  2E2I A;  1DGS A;  2PMZ A;  2ZM6 H;  4DR7 H;  4UCS A;  3G6X A;  2UVV A;  5D1P A;  1XMO H;  3QZ8 A;  4A3E G;  1CS0 A;  4TQR A;  1TWG A;  2R7M A;  2WAQ E;  4CC6 A;  5LYJ F;  1Z2O X;  5KG7 A;  4WBN F;  4JI2 H;  2R6F A;  1IOW A;  2YZG A;  2C00 A;  3OSN A;  1PX2 A;  4NXM H;  2PN1 A;  4YBZ B;  1C30 A;  4RB2 C;  5KFX A;  3FDS A;  4AYB E;  2YL2 A;  1T3N A;  4E4T A;  3SI8 A;  1GO3 E;  4UCR A;  4NLG A;  3HKZ A;  4R8U B;  4F50 A;  1ZQ7 A;  2JEF A;  4HNU A;  1RYS A;  1A9X A;  5D1O B;  4IHJ F;  1JKJ B;  1E4E B;  4O4I F;  4QJF A;  3RB4 A;  1KJQ A;  2V9W A;  1AUX A;  3N42 B;  3VMM A;  4J9P A;  3EYY A;  4ED2 A;  2C28 A;  4LF6 H;  4DL4 A;  4A3G G;  2NVY A;  4DR4 H;  1VAJ A;  2HVQ A;  4YJ2 F;  4YY3 H;  5EWE A;  4DL3 A;  3RTX A;  5KFE A;  1JX4 A;  1IBL H;  4EFB A;  2R92 G;  1HNX H;  3Q8Q B;  5KFY A;  4RZQ A;  3MWM A;  4HYK A;  4YHH H;  3R23 A;  2RDI A;  2Y0S A;  2FPI B;  3K5H A;  3RFC A;  5KFF A;  2XCA A;  5KFH A;  3HOY G;  2DZD A;  1AUV A;  1K1S A;  1JDB B;  4J9O A;  2SCU B;  3I4M G;  4O4L F;  4HNV A;  4JV1 A;  3H40 A;  2VUG A;  4DR2 H;  1GSO A;  4UCV A;  2X0S A;  2VOB A;  3R5H A;  4ED3 A;  4ZI7 F;  3HOU G;  4MV4 A;  3HOW G;  5FJ8 G;  1KEE A;  1KJ8 A;  3OSP A;  2HGS A;  5HV6 A;  2DPJ A;  5C3E G;  4JV2 A;  3JRX A;  3G8C A;  3KHH A;  4JI1 H;  3K3V A;  4GKK H;  1DV2 A;  5D8D A;  3T5K A;  2R87 A;  4YR3 A;  2V59 A;  3ETJ A;  1EHI A;  3MR3 A;  3RBD A;  1VS0 A;  3RIZ A;  2WAQ A;  2W8K A;  3BA9 A;  1S0M A;  5KFB A;  5L1J A;  5KG0 A;  2W9C A;  4Q44 A;  1N32 H;  3H3V H;  4MTE A;  2C22 A;  3GTM A;  4Q8E A;  1JIH A;  3HOX G;  2VPQ A;  1VBH A;  5DG8 A;  4QW9 A;  4MV7 A;  2W6M A;  3TQT A;  5KFD A;  3DF7 A;  2JEG A;  4A3C G;  4B3M H;  4YJ3 F;  3V4S A;  5I47 A;  1N48 A;  4G3I A;  1B6S A;  5J2T F;  3TIN A;  5FPO A;  3V6J A;  2ASJ A;  3PW7 A;  3PW2 A;  4GKJ H;  2YZM A;  1ULZ A;  5DGA A;  1Y1W A;  5F9N A;  5KT4 A;  1A0I A;  5JVD F;  3GV8 B;  2PVP A;  3PR5 B;  4DUY H;  4AQY H;  1S97 A;  5KT5 A;  4ED6 A;  4U6P A;  2PBZ A;  2BR0 A;  5JUM A;  3HB9 A;  4EBE A;  3G6Y A;  4FM9 A;  1S0N A;  2W9A A;  1EUD B;  5C5J A;  2NVX A;  2WYO A;  4UFZ A;  4Y8V B;  3VPC A;  5L9X A;  3KHL A;  4XX0 B;  1X9N A;  4PDB A;  4JI3 H;  4I4T F;  1XNQ H;  4O2B F;  5CA0 F;  2W6Q A;  5LP6 F;  4YAJ B;  3L4J A;  4IRK A;  3BQ1 A;  1HNW H;  2VUM G;  3NGD A;  4LSX A;  5KG3 A;  2XCL A;  2FK2 A;  5KFO A;  3RAQ A;  2UXD H;  3PW5 A;  3MWE A;  2YYA A;  5KFS A;  2BQU A;  3M9N B;  1AN7 A;  3Q1K A;  2XIG A;  3V4Z A;  3H4B A;  2AU0 A;  1KJI A;  1RJR A;  4MA0 A;  1W96 A;  2YS7 A;  3FKI G;  5IWA H;  3UFX B;  3KHG A;  2ASL A;  5LOV F;  4LFC H;  1WR2 A;  2W6O A;  2ZDQ A;  4ECY A;  2DPI A;  4F4X A;  1KC7 A;  3H20 A;  3PVX A;  5L1I A;  4DV4 H;  3RAX A;  5EWF A;  5KFV A;  3IG0 A;  4K0K H;  3WNZ A;  5IYC G;  4JV5 H;  4XYL B;  1BGW A;  4J9N A;  4KHP H;  4QWA A;  2R93 G;  2FP4 B;  3U9S A;  4O3R A;  4LSA A;  2V4R A;  2CW7 A;  4A93 G;  4DR5 H;  3OTO H;  2NU6 B;  5KFP A;  4JI4 H;  1SYX B;  2FLN A;  1S68 A;  2W6P A;  3KHR A;  1HR0 H;  4EYI B;  5KFT A;  5LA6 F;  1J5E H;  2I87 A;  4FS1 A;  4Q8F A;  2BQ3 A;  1S10 A;  4RNO A;  4IR1 A;  1JXL A;  3H4D A;  3Q2O A;  4A3B G;  4RAZ A;  2UXB H;  3GLK A;  4JV0 A;  4BXX G;  3ORR A;  1FJG H;  2F4V H;  5KFC A;  1RK5 A;  3MWD A;  3J80 W;  2UU9 H;  1Z2P X;  5BMV F;  5BR8 H;  1PK8 A;  4MV3 A;  4M7E A;  1EYZ A;  5KT3 A;  3RB6 A;  1S03 G;  3RUP A;  5KFG A;  5JVL A;  4RZR A;  4F4W A;  1JDE A;  4LF8 H;  4GC7 A;  4JUZ A;  2UUC H;  3WO0 A;  1VBG A;  5DLG A;  1RJP A;  4DR1 H;  2ALZ A;  4LH7 A;  2R8K A;  4ED8 A;  2ZDG A;  2UUA H;  3GTG A;  1FVI A;  4O3O A;  4I55 F;  2YRX A;  5KFI A;  4ECV A;  2HVR A;  5LMU H;  2QK4 A;  5FLM G;  2I80 A;  3TII A;  3BA8 A;  2R8I A;  3MFH A;  1BXR A;  1CQI B;  3V6K A;  3GTK A;  5KG6 A;  2R92 A;  4LMY A;  4X65 H; 
#chains in the Genus database with same CATH homology
 4UCU A;  4J0M A;  2VQF H;  1M0T A;  5IT9 W;  4RAY A;  1N32 H;  1B04 A;  4MTE A;  3JSL A;  4JI0 H;  4JI5 H;  1E4F T;  4JYA H;  4ETS A;  1XMQ H;  4MV7 A;  4LF9 H;  3DF7 A;  3L4K A;  3CVZ A;  3N41 B;  3JSN A;  4DV5 H;  2VPS A;  3T1Y H;  3HXL A;  1FKA H;  1XDN A;  3LML A;  3RGZ A;  3J81 W;  1N34 H;  3RIZ A;  1HNZ H;  3M4I A;  4X64 H;  4B3M H;  4LFA H;  3T1H H;  1P8L A;  2UXC H;  5FPO A;  1ZHS A;  4GKJ H;  3KAL A;  4DV3 H;  4CC5 A;  2RGV A;  4A2A A;  1A0I A;  5FLX W;  2FE3 A;  4AQY H;  4DUY H;  3RJ0 A;  2W57 A;  1Z2N X;  5LMN H;  5FD6 A;  1GYF A;  4RB1 A;  4DUZ H;  4NXN H;  3C0F B;  1I6U A;  4B3R H;  4FM9 A;  3N6X A;  5EOY A;  2E5L H;  4LF4 H;  4LF5 H;  2WYO A;  3KXY T;  4UFZ A;  2HHH H;  4LH6 A;  4R7R A;  4APM A;  1X9N A;  4JI3 H;  1N36 H;  1XNQ H;  4PDB A;  3J7A K;  3PN1 A;  1DGS A;  2ZM6 H;  4DR7 H;  3FMA A;  4UCS A;  1VS0 A;  4B3S H;  2O03 A;  3L4J A;  5D1P A;  1XMO H;  1HNW H;  1N33 H;  4X62 H;  4LSX A;  3N40 P;  1I94 H;  4LF7 H;  4CC6 A;  2UXD H;  1Z2O X;  4JI2 H;  1AN7 A;  2XIG A;  3F8N A;  4MV9 A;  4NXM H;  1IBK H;  2Q2T A;  1E4G T;  3KAJ A;  4JI8 H;  4LFC H;  5IWA H;  4DV7 H;  4RB2 C;  5FD5 A;  4MTD A;  5A2Q W;  4IAJ A;  3H20 A;  4DR6 H;  4DV4 H;  4UCR A;  2YCH A;  3IG0 A;  4K0K H;  4JV5 H;  3BAA A;  1BGW A;  4KHP H;  2CW8 A;  5D1O B;  4DR3 H;  4LSA A;  2WE6 A;  4OX9 H;  4X66 H;  2CW7 A;  3N42 B;  3N44 B;  1O75 A;  3EYY A;  4A2B A;  3OTO H;  4DV2 H;  4DR5 H;  2KSW A;  4JI4 H;  4LF6 H;  1SYX B;  1S68 A;  1HR0 H;  1ZHQ A;  1XNR H;  4DR4 H;  1J5E H;  2HVQ A;  3N43 B;  4YY3 H;  2HVS A;  3RTX A;  1TAE A;  1IBL H;  4EFB A;  1HNX H;  2UUB H;  4RZQ A;  3MWM A;  4YHH H;  1WH2 A;  4RAZ A;  2UXB H;  4Q0Y A;  4RB3 C;  4DV1 H;  2OWO A;  5LL6 b;  1M0W A;  4JI7 H;  2F4V H;  1FJG H;  1MZB A;  3L2P A;  3J80 W;  2UU9 H;  4I7H A;  1Z2P X;  2VUG A;  5BR8 H;  1BJT A;  4DR2 H;  3RGX A;  4UCV A;  2VOB A;  4JI6 H;  4M7E A;  4UCO A;  4X65 H;  1S03 G;  4DV0 H;  2HGS A;  2WDT A;  4LF8 H;  4GLX A;  4EFE A;  1SEI A;  4RB0 A;  2UUC H;  3BAB A;  3RF2 A;  4DR1 H;  4BWS C;  4EEQ A;  2VQE H;  2RGR A;  4LH7 A;  3JAM W;  5D1O A;  5FPR A;  2UUA H;  4LFB H;  1FVI A;  4JI1 H;  1L2Z A;  1IBM H;  3K3V A;  4GKK H;  2ZJT A;  2HVR A;  5LMU H;  1V9P A;  4B3T H;  1TA8 A;  3KAK A;  3BA8 A;  4DV6 H;  3UQ8 A;  4UCT A;  2Q2U A;  2MCT A;  4LMY A;  3BA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...