2ZK7A

Structure of a c-terminal deletion mutant of thermoplasma acidophilum aldohexose dehydrogenase (aldt)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
230
Chain Sequence
FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNASMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVKNASAYVTSKHAVIGLTKSIALDYAPLLRCNAVCPATIDTPLVRKAAELEVGSDPMRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal tail derived from the neighboring subunit is critical for the activity of Thermoplasma acidophilum D-aldohexose dehydrogenase
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase related protein
total genus 80
structure length 230
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.118: Glucose 1-dehydrogenase (NAD(+)).
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zk7A00
3GDGA 2GDZA 2BFPA 3FTPA 3SLGA 4NG5A 4DYVA 4OAQA 1J49A 4LCEA 1EFKA 4BO5A 1HE2A 2UAGA 1HE5A 4GL4A 4E4YA 1ADBA 4R69A 1Y6JA 1CQJA 2EERA 2D4AA 3QA9A 3GPIA 4M87A 3BAZA 3GNTA 1I5RA 1L7DA 5EMHA 1ML3A 1Y5MA 2DU8A 3OQBA 1RYEA 2I65A 2XXBA 2EKQA 3C24A 5KCZA 4INAA 3LC7O 1YL6A 3F5QA 3GGGA 2J3IA 4D3DA 2O48X 4W9NC 2JCYA 1N9GA 3HDHA 4KQXA 2DQ4A 5GZ6A 4B79A 2HMVA 2I76A 4TKMA 5CEEA 1LJ8A 4G2NA 5A3VA 1HSOA 2IZZA 2EP5A 1NHGA 3D3WA 3H5NA 3ADOA 4OO3A 5ES3A 5I8WA 1GV0A 4BNZA 3B1FA 4B8WA 2B4RO 4EEZA 4NJOA 1R0SA 2R6JA 4ALJA 3JQAA 3MTGA 4Y67A 3MZ0A 4R1SA 1P1IA 4K26A 3U49A 2OBYA 4KDEA 2Q99A 4UUNA 1E1KA 2I99A 3ASVA 3KBOA 3RC2A 1X1EA 4HX5A 4WLEA 3GMSA 4PZCA 5BNIA 2W2KB 4BNMA 2H63A 1LDEA 3K2BA 1P0FA 3DDNA 1ZEMA 4JGBA 4U0JA 5T5QA 1I2CA 1J4AA 4GGPA 2Q4BA 3WS7A 4IM7A 1Q1NA 4TWRA 5JAIA 2LDBA 4R68A 2FZEA 1HZZA 5A5EA 1WWKA 3INGA 4FGWA 1LDGA 1Z73A 3DFUA 4S1VA 1UUFA 2ZYAA 3FCOA 3BHIA 2VNAA 2GD1O 4G65A 2Q2WA 4AJLA 5DULA 5I7VA 1I32A 1I3LA 1BXGA 1XLTA 1RKXA 2V7PA 4WKGA 1UP7A 3PZRA 1Q7BA 1DRVA 4J90A 3JD1A 1LBEA 3JYPA 1PZGA 1PU2A 1R4NB 2DC1A 2X0NA 3V8BA 1HL3A 3HADA 2A9FA 3E6AA 3I9NA 2X22A 4GWKA 5TT1A 1BSVA 4MO2A 4N5LA 4EJMA 4FSHA 1EMDA 3HUDA 3TFQA 2HK9A 2C2XA 2P4HX 4E5YA 5K6AA 1DFGA 2AEMA 4HWKA 4NZ9A 5DF1A 3EK2A 4FJ1A 5DDIP 3W6ZA 1GY8A 1N7HA 1T1SA 3FSRA 2Y0DA 5JCJD 3HB5X 1BXZA 2GZ1A 4J91A 5EN4A 4GVXA 1OC4A 4GH5A 4ZHSA 5I9LA 1R0LA 3PI7A 5ADHA 1NR1A 2B83A 4KTVE 1PZEA 4HY3A 2ZATA 5C7LO 4J4HA 4WLFA 5DCYA 4FD3A 1UDBA 2Y1OA 5COQA 4DVJA 1F0YA 2O2YA 2AQIA 2NQ8A 1FMCA 5AXAA 2FWMX 4YT2A 4DPMA 2AE1A 5U4QA 1H6AA 4CM3A 4ZJUA 3MJEA 4WLUA 4A03A 3LLSA 4WEQA 4IIUA 3EZYA 4N5MA 3V1YA 1IE3A 2DVMA 2ZB4A 2ZCVA 1Q7CA 1G1AA 2EWMA 1XDWA 2XAAA 3C8MA 3ITKA 5JO9A 4Q3CA 3VPFA 3WGTA 4E13A 1R15A 2O3RA 1OI7A 4ZD6A 1QG6A 2IODA 2UUOA 4IS3A 3N7UA 4QO7A 3FD8A 3PGXA 1YE3A 3VH1A 4E30A 3ONFA 4M8SA 3RBZA 4IDAA 1ZMTA 4CLXA 3GGOA 4I5FA 3W1VA 3HZZA 2WDZA 1P44A 2B36A 4PCVA 1KBZA 4DLLA 3S55A 3O4RA 1I2BA 1HLPA 3NDIA 4B3HA 3INRA 5KJFA 1GL3A 3B20A 4JN6B 3WGQA 4ZICA 1T26A 3LSYA 2GERA 3PYLA 3CZMA 3SC4A 5BSFA 2DUWA 2VTDA 3PHGA 4JJFA 4BMNA 5A02A 5KJ6A 4BNJA 4LRSB 5IDQA 3OIDA 2NLOA 1JAXA 2Y0EA 2RHCA 4DQXA 1PIWA 4PRKA 1AHHA 3VZRA 1JVSA 5CDTA 3L07A 3RC7A 3WXBA 1D3AA 2AW5A 8ADHA 3K31A 3JQFC 4R5HA 1U2GA 5A03A 4WCFC 4BNYA 3DOJA 4LCJA 4RVGA 4RF5A 1PJCA 3K8ZA 1NQTA 4U8GA 2C54A 3KO8A 5T8KA 2IRWA 2GYYA 1SBYA 4PVCA 1YJ8A 2GGSA 1WDKA 2X0IA 2JAHA 2BFMA 1HDZA 3KV3O 4DUPA 2FPGA 4OMUA 3ON5A 3BTVA 3TDKA 3I52A 1F14A 4GMFA 2CUKA 1SB8A 3CTMA 4Q3AA 3LT4A 4YJFA 4FOSA 4WE3A 5L7TA 2YZ7A 3GAFA 1TEHA 3CINA 4YWJA 1DAOA 4D44A 1QYCA 5C5IA 4L4RA 3PK0A 3U4DA 3AI1A 4E33A 3TZ6A 4OL9A 4CV2A 1F12A 1T4BA 3GZNB 7ADHA 4J49A 3OQ6A 1R4NA 4CMEA 4U0KA 1YB4A 2JCVA 2JKVA 4W4TA 3RJ9A 4BV9A 1GDHA 4PRLA 5KVSA 3I4FA 3I83A 1V35A 4RVSA 1U5AA 5KVVA 3FNEA 2YQ4A 3FNGA 3I6IA 1RM4A 1T2AA 4NK5A 3UH1A 3SX2A 5CG2A 4W7HA 2XPCA 4FPXA 4IGFA 2VRBA 3IAHA 1N8KA 4H7PA 3C85A 3QW2A 1U8FO 2OFPA 3F5SA 3PDUA 4BQPA 1O5IA 2AEFA 4FN4A 4QFDA 3GLQA 4UEJA 2QZZA 3Q9NA 1E7MA 2DUUA 2GZ3A 3U4CA 5BNTA 3WGHA 3IL2A 5JLAA 1NM5A 2QZ9A 1F8FA 3B1KA 4MJLA 4BB6A 1Y1PA 2YJZA 4NR0A 5MGBA 2VRCA 1E1LA 5L3ZA 1SEPA 4RV9A 2EF1A 1DLJA 2G76A 2BFAA 3PWZA 3PWSA 3DTTA 1Q2XA 4RGBA 1VI2A 1V3VA 1R12A 4AFNA 3A14A 5L7YA 4IZHA 4IDEA 1NPYA 2CVOA 3SJUA 4MKZA 5I7FA 4BQRA 2WE8A 3C7DB 4QQRA 1U1IA 1VE9A 2W8ZA 3DAGA 1JKJA 4JP2A 4DIOA 1WMAA 4NH4A 4ZVVA 3ADPA 2EW2A 2VYNA 3UKOA 2B5WA 4K28A 4NJMA 3UF0A 4DIBA 5A3JA 1TT5A 4H3VA 4IS2A 2Y93A 4W99A 1A27A 1O0SA 3BHMA 3QVXA 2ZB7A 4MPDA 1YO6A 5F1OA 1I8TA 1K2WA 1P1FA 1B16A 2E49A 4L73A 4P22A 3IKVA 1P3DA 2Z5LA 2HMWA 1QR6A 3MJCA 3L9WA 1XG5A 3K30A 4CM8B 5TLSA 4B3IA 4LVUA 3TOXA 5L95A 1E1NA 2NU8A 2Q4EA 1X0XA 3TSCA 1HEUA 5JC1A 3VOSA 3TOZA 1TXGA 1D8AA 1RJWA 2NU7A 3TZHA 4BS9A 2C07A 3RROA 1ADCA 1PS0A 2PD6A 4I1IA 1XR3A 4KZPA 4QUKA 1JKFA 5COAA 1MV8A 4BGUA 1DOHA 1LU9A 2RAFA 4TZTA 3I4CA 3L77A 3T4XA 4NMHA 3TJRA 4NNJA 2EKLA 1HKUA 1FDTA 4PLFA 3GUCA 4MDHA 3VVBA 4GSLA 4OGWA 3T4EA 2XF8A 4IBOA 3K73O 1E3IA 4J7CA 3C1AA 2PY6A 2IDZA 3ZZNA 5CAEA 3K6JA 1N5DA 3AI3A 3Q9UA 5COBA 1A71A 1W0CA 3I9LA 1E5QA 1VJ0A 4I5GA 5IZ4A 4XDZA 3I9OA 5KJCA 1WZIA 2FR0A 2OOSA 4IMRA 2V65A 5L51A 1WXDA 3QWHA 4MVJG 2EIHA 3UAGA 2OBNA 4GLOA 4FFMA 1L7EA 4G81A 3RIHA 4DMLA 1LDMA 4J9VA 4F6LA 5KJEA 1CEQA 3TN7A 3P19A 4WUVA 5AXBA 3N58A 3ITDA 3ST7A 3BMQB 4NDNE 1ZNQO 3S8MA 3RFXA 3EW7A 4CLRB 1H9AA 2EG9A 3GHYA 1UP4A 4GKBA 1G0OA 4D42A 1IHXA 3UCFA 5KKAA 1I3NA 3VKVA 4AJKA 3WBFA 5TT0A 4RJTA 3AM4A 4MVJF 3L9XA 4BOYA 5K9ZA 1EQUA 2CY0A 2JD2A 1KETA 1Y8QB 3KEOA 5L9AA 1MC5A 3LDHA 1I0ZA 4OOFA 2AQKA 3EHEA 1NX6A 2YDYA 4L74A 3LYLA 3NTOA 4WCDA 3VDRA 3JQ8B 2P9CA 1A5ZA 1GQQA 1YH3A 2O3TA 4XIJA 3VPXA 3JQDA 3RU9A 1JWAB 1T2FA 4CQMD 5KJ1A 3Q0EA 4II3A 1I10A 1KEVA 3DZJA 4XYLA 5JMPA 3V1UA 1Z75A 3B70A 4A0SA 4GKVA 5CPBA 2OP0A 2BRUA 2QRLA 5TRTA 4R3WA 3ORFA 4MVJP 3TFOA 1T2EA 3AOGA 2WWRA 1GQYA 4Q3BA 3S2EA 2VNSA 1FDSA 1XEAA 4EEXA 1ONOA 2FRDA 4TRNA 2QW8A 4I9HA 4IQGA 2HKIA 4IDGA 3Q2IA 4DPKA 4WEOA 4RVFA 4E2XA 4AJEA 2X9VA 1K0UA 3RUHA 3L6EA 4D0SA 3PHLA 4KWHA 3MJSA 2J5KA 2B5VA 4QTZA 3TL2A 1KEPA 4XQEA 3DZBA 4GX1A 3BZUA 1ENYA 1MXHA 1YB1A 4Z0TA 5DZSA 4HV4A 1Z6ZA 2D3TA 4EJ0A 4TRJA 2UV8A 5TNXA 1PS9A 1JWBB 1HYHA 5DP1A 1NYTA 4YRAA 3ZW8A 1YKFA 3NT4A 1QKIA 4Z9FA 3DZHA 3HE3A 4WOJA 5A05A 5C7IO 3FHLA 5DN9A 1K3TA 2GZ2A 2HMUA 4CM1A 4CM5A 2NM0A 1VL8A 5ILOA 1JA9A 4AVYA 3JQBC 1J5PA 5JO0A 4LSWA 2P9EA 3WOHA 5B4UA 1E3EA 4J7UA 2GASA 2YV3A 1SPXA 3F46A 1B26A 1GFSA 1PQUA 3AK4A 4RPLA 5CDYA 1UAGA 2DFVA 1B2LA 2G1UA 2JJYA 3X2FA 1YONA 1HTBA 4OXYA 2BLLA 1NQ5A 3KHUA 5HA5A 1ZCJA 2GPTA 2D8AA 1VRWA 3IP3A 4UUOA 2PZJA 1GCUA 2D0IA 3U9LA 3RUCA 4EI2A 2X23A 2GR9A 2YUTA 4YRBA 3LC1O 5IDWA 3PIIA 1A7AA 4MVJD 3JD4A 1HLDA 4HADA 4TMFA 5A5FA 1PQWA 3OJLA 4XYGA 5HM8A 1DIGA 1VSVA 3E5MA 3AUSA 4RVDA 5A06A 2D1YA 4WECA 3BTOA 5JY6A 1R66A 1WPQA 4P8RA 3KETA 3BTUA 3IDSA 4FGSA 1ZFNA 4QT0A 3UOGA 5ITVA 1WDMA 1PX0A 4JJIA 4RVUA 3GVIA 5H82A 1ZJZA 1NPTO 3G3EA 5EPOA 1OMOA 4GAEA 2O2SA 3WSWA 1R6DA 3WQQA 4EUFA 3EAGA 3O38A 2Q1SA 4ALNA 1LLDA 3GT0A 3WNVA 1E3WB 2JL1A 2FY8A 2NVBA 2Q46A 3GF4A 3ZV4A 4A73A 3ROPA 4XYBA 1PGNA 3QP9A 2BD0A 2EKPA 3Q6IA 3WQSB 4C7JA 2W4QA 3Q2KA 1DRUA 1ONNA 2E6UX 1UXHA 3E9NA 3UCXA 3O9ZA 1LC0A 5JFOA 4ZQGA 3JD3A 1PJBA 5CEFA 4UVGA 4E12A 2DKNA 5L7WA 2C2YA 3RUDA 5JSFA 3W4KA 2FP4A 3MOIA 3GH3A 5EIOA 3AOEC 1EEHA 3PLNA 4IDFA 4J1TA 2GCGA 3UUWA 3SC6A 3WGOA 3BMNB 2Q1TA 4BNTA 2A92A 3PYXA 1VJ1A 3MJTA 4L8VA 1XQ1A 4ALIA 4A7PA 4AJ2A 3FWNA 4JQCA 3STHA 1E0DA 1U3TA 3E9MA 3FBTA 2CNBA 4YPOA 2WMDA 3DXFA 1LLCA 5HBRA 3ROKA 3UFXA 1EVYA 4DRYA 3V2GA 2HUNA 5T6BA 4DIFA 4P4LA 2VWPA 2Y66A 5IN5A 1BDMA 1CYDA 3LC2O 1JAYA 1TB4A 3FR8A 3ROQA 1LEHA 3ZWPA 4RF3A 2NV6A 5HRUA 1OC2A 1V8BA 2IYOA 4OQYA 3R3SA 4ZQEA 5AVOA 4YAJA 3NJ8A 4MP3A 1E6WA 4BO0A 5FEUA 2PGDA 4R5MA 4BNIA 5F5LA 1DFHA 4IDDA 1KOLA 1RM5A 2DTEA 3VDQA 4GVLA 9LDBA 1PL7A 1Y5RA 1T24A 2ZKLA 1ONPA 2VHWA 2Q1WA 3RUIA 2CFCA 1IZ9A 2JFFA 4NBWA 1JQBA 1AE1A 1BDBA 2BGMA 2BH9A 1QYXA 1ENZA 1B3BA 1TT5B 3HN2A 3NTRA 4L0QA 1N92A 2VOJA 4W6ZA 3NDJA 2Q3EA 2PGLA 4N7RA 3QIVA 1V3TA 3GR6A 4LMPA 5FWNA 3PHJA 4YJFB 1T1RA 4LW8A 1IUKA 1VL0A 2BKAA 4ALKA 1YOVA 2WM3A 2BFOA 1IULA 4L4SA 3VH3A 4WK6A 4IXWA 5HS4A 3GZ4A 4RPKA 3E03A 2AQHA 4YDRA 1KVQA 1XKQA 2X7HA 1SZJG 5L4LA 5JCJA 1Z7EA 4YA6A 1C1DB 2AXQA 4KOAA 4BGVA 1PJSA 4OOEA 4KUEA 2B4TO 3H9QA 4QFCA 1VC2A 4DQUA 3P5SA 3P2OA 1BRMA 5DBFA 1R37A 3ZWCA 2LDXA 1WLYA 4XQCA 1NVTA 2J3KA 5DT9A 4DLBA 4FOOA 4YTEA 3DWFA 3D4OA 1ULSA 1KEWA 1ZO8A 3RSHA 4XB2A 6ADHA 4B4VA 4H16A 5KKCA 3W4JA 5BQFA 5CDSA 3GEGA 1GUYA 1O9BA 4A26A 1QYVA 3PQDA 2C20A 2D5AA 4IQ8A 1F8GA 2EEZA 4CR8A 1SC6A 2ZTVA 2FR1A 2Q50A 1E6EA 1IPEA 2O7QA 3E48A 1GR0A 3ZWOA 2PKQP 3JQAB 5BR7A 3DBRB 2JHFA 1LRLA 1Y8RB 2QYTA 3BXXA 2VZ0A 1DPGA 2J5QA 1YQXA 1V6AA 4MOWA 4Y9DA 1BVRA 1E92A 5GY7A 3GVPA 3VPGA 4NPCA 4GMGA 3AY7A 1C0PA 1UDCA 3V2HA 4CLRA 3IS3A 3WJAA 1NVGA 4Z0PA 5KNLA 3ZN2A 2RIRA 2CMDA 3PWKA 5L40A 2X6TA 4YAIA 1WDLA 3VH2A 1H9BA 2V6GA 1PJTA 1CETA 5BT9A 2HO5A 4UUMA 1DAPA 1IYZA 4EGFA 3DOOA 1LRKA 3GDFA 1H93A 4JJGA 4CMAA 1HDRA 1ZMOA 2OXIA 3U62A 2YFHA 1K6XA 4KTTE 2VWHA 1PL8A 2C7GA 3WFJA 4D0RA 4LRTB 4DC0A 4TROA 1B14A 3DC2A 1QORA 4YT8A 4J43A 1ISGA 3RUFA 3JQ8A 2NU9A 1M67A 1HWYA 3FI9A 4PGFA 1K5HA 1Q0LA 4GI2A 3NYWA 4J6FA 4LMRA 1ZW1A 1HDXA 5DBIA 3HG7A 4R4JA 1A9ZA 3EVNA 1PEDA 5GMOA 1UJMA 2B0JA 3C1TA 4XJTA 5IAAA 4ND2A 4I8XA 4B4UA 1AXEA 4Z9YA 1ZEJA 2DPHA 5B4VA 4RORA 3OETA 4EUEA 1PGQA 4Q3EA 4CMKA 3E82A 3COSA 5KWEA 1DFIA 3H5AA 3SVTA 4URFA 4GX5A 3LT2A 3ZWWA 3CE6A 3GVHA 3JQ6A 3JQFA 3DBLB 4HKTA 3U4HA 2VYVA 3RVDA 1UXGA 1LQTA 1BXKA 2FPPA 5FI5A 5THQA 5DCUA 1O6ZA 1UR5A 1KC3A 4IIVA 3UVEA 1QYWA 3KB6A 1C1DA 3CMCO 1HYEA 2VN8A 3H2ZA 1AXGA 1LSOA 4GSKA 4Q39A 3UW3A 4XD2A 3IJPA 4HXYA 1U28A 1OBFO 1YJQA 4IZIA 4EW6A 3OF2A 4KWIA 4EUHA 2WEKA 2NNLD 1VKOA 1PQPA 3C7CB 2PV7A 1LNQA 1VJTA 3RKUA 4PLPA 3HB4X 2GN8A 3AW9A 1J0XO 1GU7A 3GY0A 3LVFO 3ZU4A 1LSJA 2QX7A 2QIOA 4FBGA 3IP1A 3M2TA 5A9SB 1FJHA 3MCVA 1A4UA 4CLHA 2SCUA 3OSUA 2OHXA 3WSVA 4CQLB 4D45A 5CPFA 5IFLA 3BTSA 4RO0A 1GV1A 3GEDA 3DL2A 2I66A 5JAMA 4JK3A 4CLOA 4J4BA 4OJNA 1I3MA 3GRKA 4HP8A 4AJJA 2QG4A 4XKJA 4ND5A 4BKOA 2IEDA 3OEYA 3ZV3A 4A2CA 3TZKA 2FMUA 4Y6SA 3RAJA 2PNFA 3HFSA 3OEWA 4XRGA 3VVCA 3PFWO 2QRKA 2AA3A 4DBVO 2F00A 2PH5A 2WYWA 3WMWA 4MP8A 3WYBA 5T64A 1PTJA 4F46A 2NTNA 2FSSA 1EUCA 2BELA 1IOLA 5HWSA 2Y68A 4IJUA 3H7AA 4PVDA 3H2SA 2VUTA 4KP7A 3TPCA 3H6KA 1EE9A 3W8FA 4AJ1A 3OH8A 4UAGA 3MOGA 3QV1A 3GAZA 3M1LA 4QSMA 3GN2A 1YOVB 1HZJA 2PH3A 4RPHA 2C0CA 3UXYA 5G4KA 4FS3A 3Q3CA 1KY5A 1VM6A 2CDAA 3GGPA 1DC5A 1WNTA 4BNHA 4M55A 4W7IA 3L6DA 1LLUA 2I67A 4HFRA 4CMGA 1DC4A 4GBJA 1E7YA 2HQ1A 5LDGA 4YT5A 1VPDA 2D2IA 3PPIA 3JQ7A 1Y9EA 3AY6A 1IPFA 1CJCA 2CF6A 3KTDA 1O8CA 2HK8A 4ALMA 4CQMA 5I9MA 4OH1A 2D5CA 3PVZA 3ZNOA 1NTOA 3ICCA 2CDBA 4RDHA 4W82A 5JAZA 1AGNA 3WMXA 4UVIA 4AJIA 4CLEA 1TA4A 1YVEI 2EJVA 4EBFA 5F1PA 4HBGA 4XZ3A 1J6UA 4FR5A 1DDOA 1BG6A 4YQZA 2A94A 1CF2O 1ISHA 4HFJA 4XGNA 2GN9A 3AWDA 2W98A 4UULA 4Y98A 3RC1A 4O0LA 5IXYA 1U2DA 1NVMB 3H4VA 4BIIA 2PZLA 4B3JA 1GZ4A 1B0AA 1E6UA 2DTDA 4J1SA 3GPDG 1YDEA 1LDNA 3OJEA 3X2EA 2H5LA 2YV2A 1MC4A 4UVEA 1NFFA 3Q1LA 4CUKA 1XYGA 3NAQA 4OYRA 3CXRA 3ZWXA 3ZHXA 4E5KA 1DSSG 1ZK0A 2X58A 3ZWAA 4CM4A 5EQFA 4W9NA 5I7EA 5TGDA 5I7SA 1UZNA 1V3UA 2PWZA 4U5QA 2NUAA 4BKQA 1HSZA 1TI7A 4WNCA 2O4CA 2VT3A 3F47A 3OHSX 1T4DA 3Q11A 1O95A 3D1LA 3I9JA 1LC3A 3RUAA 3ZNQA 4AJ4A 4Y8VA 2DPGA 5U9CA 1JW9B 1ZK2A 3N74A 1ISIA 3NEPX 1YB5A 1N7GA 4RF2A 2NVUB 4Q3DA 1HE3A 3KYCA 3ZDFA 1W73A 4CM7A 5EL0A 1SOWA 1NWCA 1NHWA 1YXMA 2E4AA 2EGGA 1A4IA 1JTVA 4NI5A 2VZ8A 4L75A 4DXHA 3ROMA 5ICMA 3FR7A 4FC7A 2XOXA 1ENPA 1H0KA 2VUUA 1YQGA 5CDGA 1R0KA 1CQIA 1ZVMA 4L76A 1RM3A 2ZB3A 5AXDA 3TNLA 4E2WA 1DO8A 4DLAA 3RQSA 1GUFA 1XELA 1YS4A 5L53A 1ULUA 2XXJA 3ETGA 3F4BA 2W90A 2I6TA 4Q3NA 3OBBA 1X1TA 4OKIA 4JNKA 4NQZA 3PTZA 1DXYA 4XA8A 2X5OA 4WJZA 4GX2A 1P1RA 1PGPA 1X7GA 4HFNA 3E8XA 1B8PA 3RI3A 4ZN6A 3DAPA 1B8VA 2RH8A 3PJDA 1SMKA 2V6FA 5U1PA 4WOKA 4AJNA 5IZCC 4J2OA 2P5UA 5JY1A 3RBXA 2EW8A 5EINA 4FJ2A 4RDIA 3ENKA 3KUXA 4OSPA 3OJOA 1RWBA 3LT1A 1KERA 3AUUA 3HQ4O 4ND1A 3H9EO 1SCUA 2Y1EA 1BW9B 3OJ0A 3D5TA 4MINA 3G79A 3QVSA 1E3JA 4QECA 4Q9NA 1HRDA 3VTZA 4NJMB 4CL8A 3C7AA 1QV6A 2UVDA 1I3KA 2DBQA 2QRJA 4ZRMA 1P1JA 2CZCA 4FFPA 1FF9A 4NFHA 1QYDA 1T25A 3HWRA 2ZB8A 3LK7A 4R01A 4F3YA 2HSDA 2ZK7A 1C0LA 1Y8QA 4UVHA 3GVCA 1SEVA 1FDUA 2E82A 3WQRA 2AEJA 1EK6A 1QRRA 5ITWA 3OFSA 3FRJA 4BO9A 4YBZA 3T7EA 4Z3KA 1LTHR 2VUSA 2BI8A 4BNKA 1F06A 1MFZA 5JE8A 1AN9A 1LUAA 2P5YA 1ISFA 1L1FA 2FPIA 5MDHA 4I08A 3GC6A 1PJLA 2OO5A 1HDGO 1YGYA 1DHTA 4CMBA 4C4OA 1B8UA 3ICPA 2GLXA 3CMMA 4IUYA 3IUSA 1D1TA 3DZGA 1QXSA 4FFRA 3LT0A 2PKRA 3CKYA 1EUZA 1C1XB 5ER9A 1A9YA 2C7VA 3ZU5A 4BO4A 1CIVA 3M2PA 3RWBA 3JYOA 4CMJA 2AMFA 4N5NA 2DLDA 3JQEA 3CZRA 2BI7A 3IUPA 3QWAA 1AUPA 2C5EA 3JD0A 3UN1A 1P33A 1E7QA 1KY4A 5TQVA 4D46A 3JV7A 1X15A 4OM8A 4XGKA 1MA0A 1EVJA 3OIGA 2EHDA 5ILGA 2HRBA 2C5AA 4R16A 3MTJA 4RVHA 2WYVA 4J0EA 3KYDB 3TF5A 1C14A 5JXWA 4U6QA 1KS9A 1LDBA 2Y67A 2NVUA 1JN0A 1YBMA 2EXXA 2VHXA 4TZKA 5KTKA 2Y99A 1DIBA 3WYEA 1LSUA 4NU5A 2GO1A 1KVUA 1LQUA 2I9PA 4R3NA 3L6OO 2P2SA 3QWBA 5AOVA 3RFTA 1EVIA 4B4OA 1BGVA 2NTVA 4HNHA 3PZBA 5DCWA 3VHRA 4CMIA 4E21A 4D3FA 5B1YA 4J0FA 1YL5A 1DEHA 3AU8A 2POQX 4HUJA 3EDMA 4XWYA 5TJHA 1NPDA 1N9GB 1ENOA 4K9DA 1R4MB 2Q49A 1MP0A 5DBGA 4CV3A 3DAFA 3JQGB 2GN6A 3VAZA 4CQLA 1MGOA 3W6UA 5KOIA 4AG3A 4CUJA 4P4NA 3QHAA 3S2GA 2GNAA 2JAPA 4FIZA 4PLGA 4X54A 2QYSA 2VZ9A 5TJ9A 1P0CA 4XB1A 4BNLA 4MKXA 3E9QA 3QVTA 3ONEA 4BO6A 3K2EA 3FF4A 3WGGA 1HT0A 1M6HA 3ZHZA 2QHXA 1H2HA 2H6EA 3W4IA 3NKLA 3ZNNA 1GPDG 3S2FA 1U4SA 2Q2QA 3ZWBA 5ENVA 4YRDA 3FNFA 3UGKA 1MG5A 3BMCB 5G0SA 2VHVA 1MFPA 3WYCA 1X0VA 3AM3A 4BB5A 2B37A 2CDCA 3ZNPA 3SEFA 4E0BA 4PFJA 5ER6A 1NXQA 1PWZA 5JDCC 3EY4A 3WLEA 1RPNA 5TS3A 4Y6RA 3A4VA 2HJSA 3FNHA 4I5EA 3NT5A 2OORA 3OECA 3V2UA 3RUEA 3IQDB 1UH5A 4II2A 5G0TA 1FDVA 1Z7BA 3D7LA 3O03A 3KYCB 4UEKA 4J3FA 4MIEA 2X0RA 4OIMA 4XEHA 2VCYA 3FWZA 4J1NA 3U0BA 4ONEA 1GYPA 3DQPA 1P9LA 3D3EA 3CEAA 4BO3A 5IN4A 4RLSA 1WVGA 4RPGA 4N54A 3EGOA 4NU6A 1Q0HA 4YAKA 4DGSA 1M66A 4E2YA 5EQDA 2VTEA 3ZW9A 1W8DA 1H6CA 2UUPA 5AYVA 2DT5A 4O5OA 3RKRA 4NBVA 4RF4A 5JDIA 2HMTA 2O50A 1I2ZA 1KC1A 4D7AA 3D3WB 4EYEA 1PJQA 5CFZA 3F9IA 4WLVA 4GX0A 1O89A 1GEGA 3DBRA 3H8VA 3BYZA 5DP2A 4O6VA 4E5NA 1NR7A 4BNXA 1W6UA 2DFDA 3JYLA 2BMAA 1QMGA 4FW8A 5T57A 1H5QA 2JD0A 3EZLA 5L4NA 3HSKA 4BVAA 3EC7A 2Y1FA 3MEQA 2EGHA 2J3HA 2R00C 1XU7A 4CL3A 3RU7A 1SOVA 4JBIA 4YEDA 1H6DA 2NVWA 5A9RA 2X8LA 2RH4A 3W8DA 3PYMA 3ETEA 3G1UA 4LVCA 4MP6A 1YL7A 4R51A 3U5TA 4XDYA 3JSAA 5LCXA 1YQDA 2BGKA 3K92A 3WWYA 2HK7A 4PZEA 4UUPA 5ENDA 1DBVO 1QP8A 2Y05A 4S3MA 1PJ3A 4ESOA 1ZSVA 3WBBA 5C3MA 1GYQA 1R4MA 4P38A 5BNFA 4E5MA 5TF4A 4FDAA 4KQWA 4O59O 5CG1A 2IEBA 4YJGA 3A1NA 3L0DA 3HFGA 4M49A 3DTYA 4DA9A 1NQAO 3D64A 3GUYA 2O3QA 3IJRA 1IB6A 2UDPA 3AU9A 1Y7TA 4DC1A 2NTJA 3JQBA 2P4QA 3HDQA 1Z74A 2J3JA 1IHYA 2PLAA 3GMDA 4PG6A 2HAEA 3FN4A 3VPSA 1QLHA 1GD1O 4CUZA 1GTMA 2O3SA 3AFNA 1SB9A 1LXCA 1XQ6A 4ZQFA 1MLDA 1EVZA 3QE3A 5TC4A 3ANMA 4G5HA 1ISJA 4BNVA 1C1XA 3PEFA 3ZWVA 3PLRA 1ADFA 3H65A 3GQVA 4FJ0A 3DZKA 4BO1A 2W2LA 1N2SA 2DM6A 1XCBA 3E1KA 4JP3A 3SXPA 4TKLA 5IF3A 2ZTUA 1IL0A 4FB5A 2VYND 3KVOA 3I1JA 4DQVA 1GYRA 3ZU3A 3QLJA 3ENNA 1Y81A 1LRJA 2CVQA 3DO5A 1ZJYA 3KM0A 4IXTA 5ICSA 3GFGA 3MWDB 4E5PA 1GQ2A 4BNWA 4RLHA 1HDYA 5B4TA 4ZQHA 3GHHA 4BNNA 4F45A 4PLCA 4Y6PA 3A06A 3I9MA 4CV0A 1EK5A 4ID9A 2ILTA 1M76A 1I01A 2IZ0A 3DHNA 4J4TA 5EJ2A 5K0ZA 3ZV5A 3WGZA 3WIEA 3AOEA 2FSVA 4DL9A 1Q0QA 5A9TA 2C59A 3ETDA 1GAEO 2V6MA 4BKRA 1GUZA 5EESA 4CPDA 4DREA 1UXIA 3NGLA 3VTFA 4B4WA 1MX3A 4IQ0A 4YXFA 2WSBA 1NP3A 3D0OA 4B7XA 3MJVA 5CHEA 3GVXA 2OL4A 4ZRNA 5A9SA 1ZBQA 4UEOA 4R9RA 5A4DA 3IKTA 3ASUA 2GF2A 1WP4A 2VWGA 5F5NA 4NHEA 3UICA 3QVWA 1FDWA 3P7MA 2O23A 3EVTA 4PG8A 3WGYA 4UVDA 1QSGA 4CM6A 3WLFA 3H9GA 4YVFA 1BVUA 2X86A 2VOEA 4XYEA 4R1NA 1U8XX 4RPJA 3UCEA 2X9NA 1XA0A 2J8ZA 4IJWA 4BNUA 2J6IA 4AJOA 3O8QA 1YBVA 2Q45A 4YR9A 4IMPA 4M86A 4F6CA 5FYDA 3L4BA 3ABIA 5I9NA 3ZHYA 4CV1A 2PD3A 4IINA 4XYMA 4DTIA 3LF2A 1LLQA 2YYYA 1P31A 2NACA 4ROSA 4D43A 1B15A 2RHRA 3ONDA 3U3XA 3LF1A 4TQGA 3CSDA 1SNYA 5JCXA 3K96A 3K9QO 1MUUA 3DBLA 2WYUA 4DPLA 3D5QA 3AJRA 4ZU3A 4BO7A 1ZKMA 3TL3A 2IXBA 1UZLA 2D59A 5F1KA 1YDWA 4A27A 1XWFA 4FFNA 2FHSA 4YJGB 4JCOA 3PHHA 1DHRA 4L9RA 4ZA2A 5JBIA 2R2GA 4PLTA 4MIYA 4O63O 5BSGA 2GSDA 1E5LA 4YJDA 4RCVA 2VHZA 1BTOA 2Y1GA 3DZIA 3FPCA 5JYEA 1A7KA 3ZHBA 5FFFA 3I6QA 2OGUA 3EMKA 1HETA 1LSSA 4AICA 3RCBA 3VH4A 3QRWA 5CP8A 3OIFA 4LGVA 3WNQA 4BNFA 5HTOA 4ALLA 1CRWG 1OAAA 2GN4A 2ZYDA 3RASA 4BMSA 1BWSA 2PKQO 4R41A 2EJWA 4XR4A 4D41A 1GZ6A 2B4QA 5J23A 1RYDA 1VKNA 2PTGA 4TSKA 1Q7GA 3KXDA 1AHIA 4L4XA 3PQEA 1HXHA 3O26A 3G17A 4WASA 4ND3A 5A04A 1M6WA 3WB9A 5KIAA 1Z45A 3JQCA 2YHIB 1TLTA 2WD7A 3OA2A 4YJHA 2P91A 1KYQA 4KDFA 4C7KA 4JXKA 2VQ3A 2JD1A 3JQ9C 4J7XA 1JU9A 1P1HA 3NV9A 3PQFA 3DOCA 4CM9D 2A4KA 3RFVA 1NAHA 3DMTC 4BGEA 3AFMA 4GPD1 2Q1UA 3ZGYA 1U5CA 3C1OA 1ZZEA 1HDOA 4CM4B 1DC3A 4KUGA 1I36A 2B69A 3BMCA 1U3WA 4WGGA 3UHAA 2I3AA 3M6IA 1EBFA 2F1KA 2G82A 1C3VA 2PD4A 3FTNA 5GZ1A 4MKRA 4E2ZA 3WG9A 2ZYGA 4FCCA 4NFYA 4AJHA 3TWOA 1NNUA 3NJ4A 5IG2A 4PLHA 4P4GA 3LLVA 1NFQA 2ZQYA 1U9JA 2DAPA 2HMSA 3EUWA 3HDYA 3NX4A 4JBHA 3BMOB 3IMFA 1S6YA 4DWVA 2BF7A 1GEEA 4U7WA 3NTQA 4E32A 2HCTA 5L45A 2OZPA 1DIAA 1M2WA 2ZJ1A 2I5PO 4CM8A 2FOIA 1DIHA 4XQGA 5G4KB 5JYDA 1Y8RA 1E7RA 2ET6A 3IIEA 4J1QA 4MVJE 3AUAA 4CR6A 1P77A 1FK8A 3QY9A 5CEJA 4XIYA 5T67A 4PG7A 2O3JA 4E3ZA 2P68A 1EZ4A 2G0TA 4QO8A 4LN1A 4BGIA 1ZK1A 2H9IA 2RCYA 3ANLA 3RC9A 2JHGA 4H15A 3K5PA 5GZ3A 5JDCA 3JQ7B 2YDXA 1PS8A 2WE7A 4NIMA 4Z3DA 2FN7A 3KZVA 1LX6A 1D1SA 2PK3A 2Y1DA 3IOYA 3R6DA 1X7DA 3CUKA 4CQMB 1D7OA 4I9NA 1XIVA 3HDJA 3GA0A 2ZIZA 3NDRA 4FC6A 2V6BA 1N1GA 1OZAA 4WNIA 4JROA 3AI2A 2JCXA 1XSEA 1E1MA 3KSDO 3F6YA 3WWZA 3ULKA 4BO2A 2HU2A 4NBRA 4MIOA 4YB8A 3SJ7A 1Z82A 1ZSYA 2BGLA 4YCAA 2W2LD 3A28A 2PFGA 4CLOB 1KVRA 3INTA 2EP7A 5EERA 1YBAA 4OHUA 2H1SA 4LSMA 4M54A 3C3XA 4BMVA 1XGKA 1ZUD1 3GG9A 2OUIA 1G6KA 1UZMA 4ZQBA 2DBRA 2HLPA 3G49A 1I30A 3DBVO 1BW9A 1LA2A 3KSZO 1DIRA 1LI4A 4NBTA 3SBOA 1U3VA 3AM5A 3V1TC 4WCFA 2HRZA 5JPIA 5IZCA 3PIDA 1PGJA 3OICA 2JFGA 5CDUA 2C82A 3HNPA 1JVBA 4Z9XA 3V5NA 2O4UX 1NBOA 1NAIA 1XU9A 1WW8A 1BHSA 3OA0A 4J16A 1NWHA 1YRLA 3WJ7A 4R54A 2NADA 2PR2A 1U7TA 4JBGA 1DJQA 2Z95A 4MVJA 3GEMA 3VZPA 1W4ZA 3T7CA 4GWGA 2TMGA 1EE2A 4YACA 1U7HA 4TVOA 5DNAA 3OQ1A 3TRIA 5IDXA 2IE0A 1BMDA 1HYGA 4FFOA 3GNQA 3GZNA 4NBUA 2VHYA 3WGIA 4J9UE 4EITA 1I24A 3PGJA 4YQYA 3JD2A 3NRCA 4RQUA 3PXXA 1U3UA 2WD7B 4YJHB 3KSUA 1X7HA 1UAYA 3H9JA 2DTXA 2ZJ0A 3KOUA 2YV1A 1T2CA 2NWQA 4R1TA 1I33A 2EV9A 1D4FA 5JAQA 3O8QB 1TVEA 3BIOA 3LU1A 4R9SA 3JYQA 2X5KO 3D4NA 4DMMA 2DBVO 4FQ8A 3GK3A 3ZWMA 2PA3A 2VWQA 1E3WA 1NFRA 2PZMA 1E3SA 1DLIA 1P74A 4XQ9A 1G0NA 2X0JA 4J2HA 4Z0HO 2IZ1A 3EYWA 5TSDA 2OP1A 1JKIA 1X14A 1SAYA 3GRPA 3PFFA 4LISA 3H3JA 2E37A 1V9LA 4PLVA 4BO8A 3IC5A 3GN1A 4TRRA 3HN7A 3WIDA 1ZK4A 2GUGA 1B7GO 3DR3A 3F3SA 3VZQA 3TQHA 4CMEC 1EQ2A 3DMTA 3PJFA 5I8ZA 1TT7A 3I23A 3R1IA 4A10A 5B12A 3DZFA 3BMQA 1KIFA 1QLJA 1U4OA 1F17A 3GDOA 4CMIB 4QEDA 5C7OO 4CMCA 3B6ZA 2YY7A 1PL6A 1UP6A 5TIIA 4XR9A 3QWIA 4YT4A 1N1EA 3DBHA 3NGXA 2C29D 3OMLA 3GNSA 3RBVA 3DMYA 3B1JA 4OKNA 1JDJA 4JLWA 3M1AA 1IY8A 1VSUA 4IDBA 4IJVA 3MWEB 1DRWA 3U09A 3A9WA 4HNGA 1VL6A 3G1TA 2YQ5A 4MVJH 4XRRA 4D3SA 1ZXLA 1NASA 5C37A 1LDYA 1P1KA 1DC6A 4JX8A 3WX0A 3GG2A 3ZI0A 4IY1A 5IXSA 1MXFA 2E48A 3RD5A 2IYPA 4OQZA 4QXMA 5IDYA 1H94A 3OJFA 2CSUA 1UXJA 3HJAA 3WDSA 3AUTA 3ANNA 4DBZA 3QWFA 1E77A 1PGOA 4XJSA 3VC7A 4OXNA 2FZWA 3ZWYA 1R16A 1GPJA 3KEQA 1ID1A 4CR7A 8LDHA 4XGIA 1QV7A 1PSDA 2AG5A 5B37A 1GZ3A 1OFGA 2Y1CA 3SLKA 4OXKA 3TZCA 5H81A 5G2OA 4CODB 1B3RA 1T2DA 4CMHA 3FPLA 3VPHA 1EFLA 3JYNA 1ZXBA 3E18A 5L4SA 3NT2A 3KRTA 4RQTA 3VZSA 4IGEA 1PJ4A 4R1UA 3KYDA 1HE4A 4E31A 4K1LA 1ORRA 3KYBA 2BHLA 2Q2VA 3GOHA 1PR9A 2ZCUA 3ZWNA 1KVTA 4GLLA 5F3RA 1KEUA 3H9UA 4ZGWA 1K6IA 2ZTMA 4ND4A 3F1KA 4CM9A 3QQPA 1RM0A 3WFIA 4BHTA 2HDHA 4FFLA 4PLYA 4UREA 3LQFA 3R0IA 5TX7A 5BSEA 1YWGO 5T8KC 4PZDA 3L4SO 3ZH2A 7MDHA 4BNGA 4EZBA 3BHJA 3DHEA 3WTCA 1JLLA 3QJ5A 1A72A 4I9UA 4KUHA 3DONA 3W8EA 2AG8A 5AXCA 4LK3A 3H3FA 3I5MA 1BXGB 3JQ9A 5G0UA 4MVJI 2NSDA 5IJZA 3PJEA 3ZCXA 2Z1MA 1MG0A 2WTBA 3CH6A 3E5RA 1H2BA 3KLPX 3PHIA 2P9GA 4M89A 5FF9A 4B8ZA 3MJ4A 4ILKA 2AQ8A 2DBZA 1C0KA 4YYZA 3U4IA 5JC8A 5BSHA 3TZQA 3LZ6A 2Y0CA 3FBGA 2ZQZA 1EBUA 1M75A 1H6BA 1CERA 5G0WA 3ZV6A 2VYVD 3DB2A 4IJKA 3S2IA 4O1MA 3WICA 4N18A 3D4PA 2YHUA 4WCFB 2I3GA 4KMSA 1P45A 2J5RA 4BV8A 3F1LA 4E6PA 2CVZA 3CPSA 4BUCA 4DYDA 4B7UA 1PR3A 1SO8A 4GQAA 3R3JA 1VLLA 2CD9A 5LDHA 3NUGA 3DBHB 4WLOA 4RL6A 5THKA 2VRCD 3OM9A 1ADGA 3PP8A 3F4LA 2OMEA 4K6CA 3DHYA 1DB3A 2NQTA 2R00A 1C0IA 4QX6A 5HS6A 5JNLA 3BMOA 1NQOA 5LC1A 5JW6A 5G4LA 1PJ2A 2IXAA 3S1LA 2VT2A 2RBEA 1FXSA 4XCVA 1K89A 4PN3A 1EDOA 1PWXA 1MB4A 3PRJA 5KVCA 1O94A 4RZIA 9LDTA 4ITUA 1CDOA 2HJRA 4TRMA 3WTBA 1XHLA 2JFHA 3I9KA 2UYYA 4BKPA 3BA1A 2W2KA 4HFMA 5G0VA 3BMNA 5DOZA 2WJPA 4AJPA 5KVQA 4M1QA 3PDJA 1E7SA 4PLZA 5JDIC 1UXKA 4YAEA 2X1HA 4WLNA 4YAGA 3JQAD 1K6JA 1EDZA 1ZSNA 3L4BC 4Z6KA 3QVOA 4BKUA 3ZU2A 4PIVA 4CJXA 2X5JO 1OOEA 5K6AC 3H5RA 4U6SA 3DFZA 4EDFA 1DJNA 1WZEA 3AY3A 2FR8A 2O3UA 3DEYX 4NFSA 4BL5A 4EJ6A 5FI3A 3CIFA 3JQGA 1E7WA 2CF5A 2O7SA 2GRAA 1ZK3A 2YW9A 3OP4A 2G5CA 4A5OA 4WPGA 2WD8A 3WR5A 1ARZA 2A35A 1GADO 2TMDA 4B7CA 1ISMA 2YHIA 5H83A 4TVBA 1S7CA 4NK4A 3I3OA 1KVSA 1V0JA 2YFQA 1IZ0A 1CWUA 3KLMX 5F21A 4IDCA 2ZTLA 4OSOA 2X9GA 5DOVA 5JMWA 5AQ1A 4PG4A 4XX0A 2NU6A 1HF3A 1HDCA 5JS6A 1PZHA 4D79A 4PG5A 3PJGA 2B35A 4RZHA 1PZFA 3QSGA 1E3LA 1WMBA 4I5DA 1WAMA 2G17A 3VKUA 1EUDA 2PGJA 2X4GA 4GGOA 2QQ5A 1Y9AA 2PZKA 3JTMA 4PLWA 6LDHA 1UDAA 2AHRA 1GCOA 1ZIDA 4IPTA 4JIGA 4AL4A 4CLDA 3P2YA 4MVJM 1ZH8A 3GFBA 3HHPA 2AE2A 3RJ5A 5A1TA 4K6FA 2Z1NA 3JCZA 1X13A 3G0OA
chains in the Genus database with same CATH superfamily
2Q5IA 3GDGA 4FI3F 2VC2B 3KSMA 4G1EB 1T8WA 5ESXA 2BFPA 3SJBA 3C3KA 3TLYA 2K6GA 2A86A 1OZGA 5J47A 2UAGA 4EELA 2VP2A 3BB1A 4GL4A 1ADBA 4C06A 1Y6JA 2Z2XA 4YPFA 4I9FA 4A0QA 5AJYA 1GGMA 1IOWA 3QA9A 4M87A 3VUFA 4U2FA 1I7NA 2PMBA 2WV7A 1O95C 3O74A 2H0AA 1TL7C 1BEEA 2NYVA 4X41A 5FUBA 1KFJB 2DH5A 2VF7A 4Z2YA 3FI0A 4INAA 3L7BA 3L02A 2I6SA 3R5XA 1T1EA 2ZYWX 3LC7O 4N49A 3QXHA 3PGMA 3TOSA 4ENSA 2P9YA 1IJEA 1XDZA 4EHJA 1ECLA 2JCYA 5G1NA 1VPWA 2VDLB 3TEJA 1QZUA 4CTOA 2R6ZA 2I76A 2GBIA 4TKMA 1WJGA 4X66B 5JYBA 1H2FA 4GKKB 4KNWA 4LY0A 5IKEA 2IZZA 2PX0A 3HH8A 3D3WA 1BWQA 3H5NA 1E2LA 2CKMA 4MYCA 3N70A 4OHVA 4BNZA 2PLFA 4B73A 2LD4A 4R31A 1A9PA 5JCPA 1A8IA 3SVLA 3HVHA 2PMFA 2R8RA 1RKUA 2DF8A 1OQAA 3W9UA 3IP7A 4O4IB 3HY6A 1OYOA 3JARA 2HF7A 3LPCA 3WK4A 4F9TA 3EBOA 3ESAA 1T6ZA 4Y67A 2F59A 1NNEA 1M2GA 1NT2A 3A6ZA 3L1HA 4TTTS 3ABRB 2WTXA 5CK5A 2DBYA 4HNTA 1RQ2A 2GHTA 5BQ5A 2WG2A 1Q0ZA 3BF8A 2WIJA 1VMIA 1JAIA 2WUEA 2QM3A 3O93A 4HX5A 3W77A 1GWNA 4B6RA 3GMSA 5EXTA 2A5JA 2YRXA 5JUWA 3DVAB 1LDEA 4FLMA 3DDNA 2OGSA 5D5PA 5JNTA 5CH5A 4QGBA 3NH6A 5CHYA 4QOJA 4LV6A 1J4AA 4GLFA 3SQXA 2PZAA 4XGQA 2Q4BA 3WS7A 1Q1NA 5JAIA 1GNVA 2FZEA 1OBVA 4NL4H 2QY6A 3DE3X 4FE4A 4WZBE 4FGWA 1LDGA 4HDKA 5LQKA 4QBFA 1WL8A 1D9ZA 3PFGA 4JT4A 4M53A 2VNAA 2GD1O 1P4GA 3MIIA 2Q2WA 2JFUA 2VXYA 4BZXA 3S81A 1XLTA 3ZJUA 1CUCA 1JUDA 1UP7A 1Q7BA 3CCCA 3PD1A 1DXQA 1LBEA 1DZIA 4FK8A 3RJZA 1PU2A 4IRMA 1RPTA 2X0NA 2NU7B 1PW7A 3E6AA 3HADA 3Q7SA 1BSVA 1JDBB 4MO2A 3TK1A 4COKA 4EJMA 2X3FA 3FTQA 5EIXA 1E9AA 2BP7A 3FROA 4Y6GB 5J59A 1KYXA 1SA0B 2I34A 3NALA 5DSXA 4LJ5A 2M9MA 3UYKA 3PG5A 1V16B 2W6QA 4IMJB 4IQ4A 1GZSA 4QBKA 5M34A 1Z63A 2J85A 5SY4A 5D51S 5K6AA 1RQPA 5LQCA 2A3RA 1DFGA 2AEMA 4HWKA 4NZ9A 3W6ZA 2PN1A 5ITZB 5LZ9A 1N7HA 4DMRA 2XLBA 2I4LA 3FSRA 3QOFA 4I1RA 4J91A 4PPQA 1QTNA 4YO7A 4GVXA 2J46A 1KZHA 1OC4A 4F5YA 1MABB 4DEXA 1PNRA 2IY7A 2PT9A 5DHRA 3AEQA 2LCQA 5IHXA 5DSTA 4HGQA 2XVXA 4B44A 2B83A 1T5TA 4D8TA 1P6QA 2ACWA 4PAWA 1PT9A 1XDDA 3U7RA 3QUAA 4WLFA 1E3MA 2BFDB 2NXJA 4WBNB 1ZGHA 3CGWA 4OEHA 3X1DA 2HXGA 5ECWA 4ZTBA 1ZUNA 5A6SA 1XO1A 1S8FA 2FWMX 3P2KA 3WNZA 2AE1A 1WB4A 4RZQA 4LTDA 4DPMA 1H6AA 3A70A 2J0QA 3EPPA 1FLNA 3CJRA 4JFRA 5HSGA 4WEQA 2W00A 4EO9A 1IE3A 2ZB4A 3PPWA 3QLVA 4HWTA 1RDFA 1VIYA 2X1VA 4NQRA 1G5RA 5CURA 4ZPXA 2WFLB 3S40A 1XD8A 2ZBUA 3DXZA 1KMQA 2VDWB 3ICOA 3KJHA 1EXVA 3A2MA 2F3TA 2O3RA 4IF6A 1RYYA 2RFLA 5EOVA 2YVKA 1ZESA 1YJBA 2NO4A 2PWPA 5K4GA 3DV0B 2JAXA 3RBZA 2HHJA 1ZMTA 2OWDA 4CLXA 3ZZ1A 3W1VA 4JEMA 3HZZA 3WSTA 4HZGA 2WAXA 3KOXA 1Z0ZA 1P44A 1QHYA 2OXFA 3CH7A 4PCVA 4DLLA 3BJIC 4OF4A 3S55A 1I2BA 1LPMA 1NJGA 4B9EA 4G25A 1GL3A 2CL5A 3B20A 1PVVA 3FW1A 2JGKA 4ZVLA 3SFTA 3WGQA 3N0XA 3PYLA 2R79A 2YVLA 4X60A 2WIAA 4L02A 2DUWA 2YZGA 1VE1A 4QQNA 2N75A 4BMNA 5AKKA 5KJ6A 1Z15A 4D8YA 5FNVF 5FPTA 2EZ9A 3HU3A 2UVPA 1VA4A 3HYLA 1QG2A 3FYUA 4RFLA 2A14A 4X3PA 2XUFA 5IABA 4ZU1X 1PIWA 3PDIA 4PWZA 5DGIA 3FMOB 2YASA 1FRNA 1OE0A 2JHAA 1Y9DA 4WD3A 5AKJA 5FTMA 3WXBA 4EOGA 2Y0PA 3PL5A 4IFEA 2CJXA 4NDAA 2AW5A 5IJ9B 3JQFC 1U2GA 2O5CA 3CIOA 3D6UA 1JKXA 4BNYA 3DF9A 4RHTA 1L8AA 3T3EA 1IHDA 3HP7A 1PJCA 2KYRA 2ZJYA 4KQ9A 1N1MA 4RF5A 4OXQA 4G9EA 3OLXA 4UM5A 4HATA 4I9GA 4PVCA 1SBYA 4UJ5A 3VU9A 5I5EA 5BWLA 3HCPA 1KI6A 2FPGA 3WHLA 2OCPA 3TTYA 4C6TA 4QTYA 3BTVA 1F14A 2ZBGA 3ZTYA 4U7DA 3ETJA 1KH1A 2J31A 4Q3AA 4UDYX 5EVCA 4QRIA 2W6CX 1Z4PX 3H1BA 3F5MA 1TO1E 3LUFA 4MS4B 4BLTA 4BU1A 5JIBA 1E63A 1HOTA 3T34A 2YZ7A 1SHTX 4AZWA 3BG5A 1BYUA 3UW1A 1C7IA 4EG1A 2AZMA 1YZUA 4MULA 1E8DA 3GAFA 5DH9A 4EY6A 4D44A 4HR7A 4WQMA 2PMDA 4L4RA 1ZJ5A 3AI1A 5LNK1 4FB4A 7ADHA 4CV2A 1G8SA 3EXEA 3Q85A 4TM7A 4OX9B 1OV4A 5B6PA 2JKVA 1ZA2A 2JCVA 2P79A 1BWPA 2J67A 4GOJA 5KVSA 3GGCA 4FOLA 3I83A 4QUEA 4RLFA 4UAVA 1OWOA 1XZCA 3M1YA 1B1CA 2XZOA 5LL6P 1S5PA 3MT0A 2QAIA 4YC7A 1URPA 5D1NA 4MLDA 4DNPA 2HQSA 3CKKA 4A91A 1CNEA 4UMDA 3I6IA 3UH1A 1M3SA 1T2AA 3GJ3A 4CN8A 5C8ZA 1XYYA 3EFEA 1CNMA 4J0GA 2IYWA 4EHDA 4H7PA 2OFPA 3F5SA 3RRZA 4ZHQF 4Q1VA 2PSEA 2J7PA 4O5AA 5KOYA 4Q82A 4QFDA 2Q3MA 3UOWA 3MUOA 2WQ6A 3I73A 4EYOA 3ZVKA 2ZULA 4KNYA 1E7MA 2GZ3A 1L4NA 5BNTA 1LF5A 3THWB 2LBPA 1WBDA 4IDQA 1VFNA 4IXMA 2F48A 5BSKA 2WTMA 3T38A 1BFDA 1SVLA 1ZUIA 2ZUTA 1SEPA 2VPXA 4RV9A 1XF1A 1P61B 2ISSD 3PWZA 3E22A 3HJNA 3NDPA 2YWJA 4KMMA 3EVDA 1VI2A 2XV1A 3PGKA 1L4UA 1R12A 3GD5A 1L5VA 3V7FA 4AFNA 3TECE 1I7LA 4IZHA 3KEMA 3LW7A 1JECA 2AVDA 5H0IA 5D3MA 4XVHA 3CF6R 4RELA 1UT6A 1OGYA 2JI6A 2A9OA 2C98A 1RKQA 2WE8A 4KB5A 4BQRA 2O54A 2P2GA 3K15A 2PL1A 1SU4A 1VCIA 2YL2A 4GQIA 3TD2A 4C0JA 2W8ZA 1AS2A 2XUQA 1MX5A 2OQ2A 4CYMA 4DIOA 4O2AF 3G5UA 3AWIA 2WWYA 1C3OA 1PWYE 3ADPA 4A1FA 4FEAA 4AMVA 2QJOA 4K28A 2CNWD 2IZ6A 4H3VA 5FQNA 1LK7A 2P3SA 4TUYB 3WLTA 4AO6A 2B20A 5DI3A 5EP4A 1T5DX 5IAKA 5UKDA 3H0CA 4MPDA 4EP1A 4RXUA 4B8YA 5JZOA 1I8TA 2E1RA 2ATXA 4AYWA 2NZ8A 1CUIA 4MW5A 3TS1A 4DQKA 2CCGA 1T9CA 2Z5LA 3TE6A 1UBTS 3UMGA 3IQEA 4CEJA 4TTJA 2J6CA 3TZLA 2YVQA 3ME5A 2QUAA 4PV7A 4YK7A 4B3IA 3TOXA 2I71A 4DV7B 3SC2A 3MTBA 1OZFA 5L95A 2NU8A 2X3UA 2Q4EA 2RGRA 2I29A 3H8SA 3TLEA 4AMYA 1HEUA 2J3DA 3OPQA 1ORVA 2FWAA 1IUPA 1D8AA 4BRUA 2V7VA 4HB3A 4PX5A 3RROA 2Q2NA 1ADCA 3THSA 3PQ3A 4ZO9A 2VPTA 1WRBA 1XR3A 4KZPA 1R0CA 5KOHB 1UMDA 1ND5A 3BCUA 3NS7A 3QLTA 5COAA 1MV8A 2ZR7A 4Q4HB 4B3DA 3PRYA 2ECQA 4YUWA 2W71A 3MF4A 4MVYA 4DXAA 2ZJ5A 1W59A 4HN9A 2IUFA 3D43A 3DJYA 3PX3A 3O94A 4K9NA 4ILEA 3SJAA 3OKAA 2HREA 3NLLA 4F06A 4MDHA 3VVBA 5FBHA 4BLPA 1OX6A 4IBOA 2BBTA 2JHCA 2VS1A 3EZ6A 1BGXT 3ZZNA 2IDZA 1RWQA 2A9RA 3P9ZA 4JASB 4H35A 4KPUB 3SKXA 5IFKA 1WBBA 1QK3A 1CZNA 3CRZA 1N5DA 3ADDA 4NCHA 2JH3A 2XXAA 1YFKA 4TMYA 3DXYA 3V2IA 1F51E 2RGGA 3EDRA 3EIFA 4R1PA 2PUVA 1E5QA 1VJ0A 1N2HA 1E4OA 1KTVA 3OZTA 4I5GA 5IZ4A 1DBSA 1JXAA 4IVQA 1IY9A 4XDZA 4HRVA 3CONA 4QDZA 2ZPAA 2R5FA 4RKQA 3UENA 1Q0PA 2R4QA 3ZS8A 5L51A 1OILA 3QWHA 4MVJG 2MWMA 2EIHA 5DYTA 2AMYA 4BWFB 1TM7E 2V5VA 4GM0A 4GUDA 2H2IA 1MD9A 4GOXA 4DMLA 1LDMA 2HEGA 2WUDA 5KJEA 2J9XB 3KT8A 2DWUA 1XBTA 2Q1YA 2ZIUB 5AO9A 3PXGA 3TN7A 1OFHA 4Q1AA 1GA4A 3E9EA 3PCTA 4V02A 4IIFA 4F6RB 2HFJA 3ITDA 1Q11A 1PYDA 1G18A 5ECYA 3ST7A 1ZNQO 5K3EA 3RFXA 2PR7A 3ESYA 3MWJA 2R1ZA 3STYA 3WGVA 4CLRB 5J2UF 1DDIA 3A11A 1C0EA 1L3BA 1X7WA 2EG9A 3CSSA 3GHYA 4FQ7A 4GXRA 1OBHA 4JR1A 1UP4A 4DQLA 4UBOA 2A9VA 4D42A 2GCEA 1J70A 1IHXA 3UCFA 3O92A 1I3NA 1JI3A 4AJKA 1G66A 4WGFA 4W63A 4MVJF 2IV7A 4CG3A 2PUAA 3BREA 4UCFA 1XAJA 4I19A 1KETA 2G9RA 2R8PA 4YV2A 2F43B 2RI1A 3ESRA 4R2IA 3H84A 3EF0A 4GYWA 3UHOA 1TU4A 4FUQA 2R48A 2YN2A 4RMJA 1WF3A 1XKLA 4NENA 1T8TA 3JQ8B 3VDRA 3K70C 2K2WA 1BQ4A 3GBSA 4FWIB 4C2UA 3MELA 4M1WA 1GRNA 1LH0A 1MA3A 2ZVJA 3A4MA 5H7XA 4LG1A 3RU9A 2GK4A 1PWEA 3Q0EA 4II3A 4XEUA 2PS0A 5EXDA 3QOYA 1G20B 4F4JA 5IJWA 3DZJA 4G0UA 3L7CA 2KHZA 2Z43A 1Z75A 4HRAA 4KYTA 2ZRBA 3GBPA 5CYOA 2BFFB 2PL3A 2ZPUA 3C6MA 2QP3A 3ORFA 1O4VA 3KQYA 4N9QA 1T2EA 3PJRA 2XQJA 4L08A 1QP0A 2WWRA 3UC5A 2O5VA 3GFRA 2ZUWA 3TG2A 1Z5PA 2DH6A 4G5YA 3BXFA 5KHOC 1G4AE 1GRQA 1TNDA 3FSEA 1AO0A 1UJNA 2QW8A 2OV1A 4I9HA 3SZUA 1F3LA 2JLRA 5A5DA 2W2QA 1GAXA 4E2XA 4Z8YA 4D0SA 1PF7E 3DULA 2BM9A 2FEMA 3WK7A 1Y3FE 1RMQA 2QRNA 1F2VA 4H0CA 1GLVA 5AI9A 1AQYA 3UV3A 3NH9A 4GX1A 4MK4A 1IUOA 1MXHA 2AFHA 4LE0A 1YB1A 4Z0TA 3QQ5A 1Z6ZA 4J94A 2D3TA 4F56A 2R66A 5J63A 2HB6A 2CKDA 1QZ3A 1N8NA 3W3ZB 2XVYA 5E3IA 2ZDQA 1PS9A 3PPXA 5HDBB 5TNXA 1DEXA 1PFQA 5D2CA 1E2BA 2BF4A 4FVTA 1JDTA 1YKFA 2PUHA 3NT4A 3WLRA 1OBOA 3DZHA 2Q41A 5CCEA 2YKGA 2VQEB 4QWWA 3OCJA 1R0YA 4U2CA 5J40A 3RS7A 2BT4A 2GZ2A 2HMUA 5E2IA 1TU3A 3IALA 4CM1A 4C0AC 2NM0A 3QMVA 1NX9A 3CW9A 3OLVA 4WL0A 1L5KA 2D5BA 3TW4A 1T43A 1YI8A 4CKCA 2FFBA 5JO0A 2P9EA 1GPYA 1P60A 1E3EA 4L6AA 3WOHA 5B4UA 2YV3A 1B26A 3AK4A 1RZUA 2BKVA 1ZN8A 1CUEA 1T0UA 2QR3A 3I30X 2X2OA 3IIJA 3Q40A 4O4JF 3Q0TA 4AG6A 4RTPA 4OGFA 3RYFB 3T0GA 1HTBA 3RKSA 2BLLA 1NQ5A 3KHUA 1E20A 1GSHA 1NZFA 1WSWA 1HLGA 1KMHB 1VRWA 2XLCA 3DMNA 4CQNA 3VA7A 1E18A 2D0IA 1Y89A 4JT2A 3Q9LA 4O3MA 2HY7A 2QD1A 2WLTA 2X23A 1KYZA 2JIRA 2GR9A 2YUTA 3R0VA 5ESRA 3LC1O 4YRBA 4A2PA 2H3HA 3C7KA 1C30A 1CUWA 2GAFA 3JD4A 4MVJD 1GSOA 1KP2A 1PQWA 5HM8A 1FXWF 1H22A 3E5MA 4RVDA 4C21A 1MOSA 4BMXA 2H4YA 4P8RA 3PUJA 2W8BA 2WRZA 4FGSA 2OZEA 4HXEB 4C5BA 3K2IA 3EZ9A 3ZC3A 4C7OB 3UOGA 5DK4A 3W5HA 1WDMA 1KJIA 2ZXFA 2CNDA 3WBKA 4MPRA 2OM2A 5H82A 1PV1A 4X7MA 2OUKA 5EPOA 1D4AA 1AX9A 3AY0A 2C2OA 1R6DA 3B89A 1P2DA 2CJPA 2WB2A 3GJ8A 4HK4A 3KZMA 1QHFA 2MIIA 2EL7A 4OA5A 3C97A 4Y3UA 5E4TA 4BJ3A 1R4AA 3KOZA 4QUHA 3NDBB 1LLDA 1XAHA 3RYIB 2EX4A 4EF6A 1GGVA 1L8LA 1M8GA 1KTIA 1DCKA 3G8CA 4A73A 1H05A 3ROPA 4XYBA 3QP9A 3R5SA 3RIMA 3ZJVA 1FB5A 5K1ZA 3LW8A 4IFIA 2Z2IA 3PKJA 3KQWA 2TMYA 5MGNA 2W4QA 2VO1A 1H1DA 1RE1A 3B2NA 3GLVA 5IJXA 2E6UX 1JZQA 2ALJA 3E9NA 1IZ7A 1SKAA 1XRQA 5EHNA 9ATCA 1LC0A 4WERA 3PWTA 1A8QA 3QEKA 3FCXA 4N0DA 4ZK2A 4DR5B 2H4WA 4LS3A 3WGNA 3TM5A 2CGEA 1WP9A 2Y1WA 4KGVA 5F76A 1MVNA 2PJDA 4BE7B 5HUHA 2YXBA 4QSHA 2XVZA 4UVGA 5IBRA 4E12A 1Q3KA 2C2YA 2CLOB 2XUDA 2VJDA 1N2ZA 1P6XA 1U3FA 1Z8NA 2DWPA 2LUOA 2R6FA 1JDUA 2FP4A 3QYJA 2K7ZA 3MOIA 3NM5A 4KQGA 4HQKA 3BEOA 4Z1MA 2OHOA 4UATA 2Z6VA 3UUWA 1DAGA 4KXQA 3SC6A 3PDHA 1YZNA 4YX9A 5KYNA 3BM5A 1HK7A 3I01M 3IGFA 3GZTB 2XIJA 3C8ZA 4IVNA 3ND5A 4OQEA 4QUGA 2IS2A 2GPAA 4L8VA 1KY2A 1XQ1A 3H16A 2P5SA 5K2MA 4A7PA 4AJ2A 3BUSA 1CUYA 3STHA 1TJPB 1P7VA 3E9MA 2KS6A 2CNBA 3D8SA 3IR7A 4JSTA 1B6SA 3DXFA 4PYLA 1ZA1A 1YHNA 3COYA 3VYUB 2F4NA 3UFXA 3RRMA 3A3OA 2I3ZA 1Z2CA 2F8MA 4G5FA 1GGHA 4G5XA 4TXHA 2AFIA 3V2GA 2X1MA 1GPWB 1Q3TA 4BJ1A 5C1OA 2EJCA 4JLVA 3FR8A 4PHGA 1LEHA 3AG5A 4RF3A 4L5IA 3INYA 5HRUA 1PNTA 1AS3A 3PBKA 1N6RA 1OC2A 4RVCA 4C87A 1WW2A 3NWOA 3F7TA 3R3SA 3GB9A 2EDCA 2ZWPA 5CA0A 1FQKA 2OFFA 1XTJA 1YDGA 4GS5A 4YAJA 4DANA 1Z47A 2F3RA 4QDTA 2PZGA 1L5NA 3TB6A 4BO0A 5FEUA 4PTZA 1JHUA 1NZDA 3NBMA 4BNIA 1RPJA 3QKIA 1RWMA 4FWTA 4QTUB 2EJUA 1GFIA 4KHZA 5F5LA 4D9JA 1UWLA 2V96A 5BSUA 3MQ4A 5K0GA 1FSSA 1QONA 1ONPA 4H18A 2NZJA 5I5GA 4R6WA 3WE7A 2PRYA 4DHWA 3OT4A 4BP3A 3AFGA 2ZGVA 4PAGA 2Q1WA 4UM7A 1O5TA 2G09A 1HMYA 4GI5A 4B6JA 3S6JA 4HQFA 2QMQA 2JFFA 1JG2A 3H1GA 1AE1A 3AR5A 1EUDB 4RYLA 4YRQA 2W4MA 3UOAB 3N0TA 1QYXA 4OI4A 4R05A 4WMLA 3I8XA 3SWWA 4H2DA 3T1YB 4ZZ3A 4FYYA 4X45A 4L72A 2L19A 2GKGA 4NFLA 3COPA 2C78A 4F5ZA 1T0JB 2XJ9A 3VZBA 2F3QA 5DW0A 3O4VA 4ALKA 2ODBA 3WMRA 4KAXA 4QQ8A 2R0QC 2O8VA 1DRJA 1YNOA 1C3JA 1ODKA 2OFWA 4IXWA 2QL7A 5HS4A 2Z8XA 1RIIA 4RPKA 3E03A 1Z37A 3SFZA 2AQHA 4U5XA 1XKQA 2OKCA 2R96A 2X7HA 1J2RA 3LGXA 1N9KA 5I9TA 4H0NA 1Z7EA 2DKFA 3N39C 1DQRA 1QIFA 3O31A 1NW4A 4OOEA 3T52A 1X1QA 1XWWA 3B3QA 2HBYA 3ZZ0A 3SFVA 1QCDA 3FPEA 4DQUA 1FBTA 1Q92A 2ECKA 2QL5A 4ZCRA 3K0AB 4IV0A 5DBFA 1BYIA 2DHQA 2FUCA 2QUBA 4C4AA 1CR2A 5F64A 3ZWCA 5JSZA 1TD9A 1E1RD 1GLGA 4M0UA 1M6EX 4YTEA 4D3YA 3EMBA 1W0KA 1ZO8A 3U3DA 3RSHA 4BFXA 1CY4A 1W4CA 4MYTA 4RENA 4H16A 1RTKA 1J23A 1K88A 1GQFA 5FUWA 4WBNA 3W4JA 3FYHA 2EGUA 5CDSA 1O9BA 5F51A 4Z7NB 3L5OA 3V7WA 3M8KA 3PQDA 5J2UA 1AQLA 2EEZA 3KVYA 4HH4A 1HEYA 1YR3A 2Q50A 4FS8A 1E6EA 2MINB 5BN4B 1QJCA 3ETLA 4O4IA 1W1UA 5D6NA 4EHAA 2YXNA 5BW8A 3ENQA 3RHSA 2PZBA 5BR7A 1OT3A 1BIFA 1F60A 2JHFA 1IY0A 3F6BX 3BXXA 2G1KA 3HV2A 5EHIA 4BAZA 3EA5A 3ELWA 1R50A 5BO5A 2R8OA 3VKHA 4TWBA 5CGQB 1SBCA 1YQXA 4I3HA 3K0CC 1FC0A 2Q3DA 2RGUA 5DX1A 3ZWQA 5C0OE 4NPCA 2Q5OA 2OORC 3AY7A 1ZN9A 1PVOA 1C0PA 2B92A 2P65A 5E9QA 3IUQA 3IS3A 2MDTA 1ECPA 4AY6A 1UBGA 1X9HA 5KNCD 4UXJA 4Z0PA 5HZMA 4HGNA 3RGGA 5KNLA 2IHUA 3W3AA 1HTWA 1Z06A 4UQLA 3I2GA 3P94A 2O1SA 5JFOA 1QHGA 3M6MD 5L40A 2ZUDA 2ORWA 3HRIA 1N4DA 2J4DA 2V6GA 1UOPA 2WICA 1CETA 3RS0A 5BT9A 5KTRA 5HKKA 3WKCA 3ORSA 2GM5A 2WVGA 1QF7A 1RKBA 4JJGA 4CMAA 1ZMOA 3RG2A 3EXHB 2OXIA 4RTRA 2COKA 1K6XA 2HDWA 2YFHA 4ZVNA 4Z4CA 2ORED 3H99A 5DRTA 2ZKIA 1RBZA 4A0FA 2TYSB 3DC2A 1C9DB 1KJJA 1G7CA 4YT8A 5AJVB 1K75A 1WUKS 2C8LA 3M89A 2NU9A 5AD1A 2PMEA 2PWBA 1XEFA 1HWYA 3CBGA 1K5HA 2F64A 1UBRS 4I55A 4OTZA 3K1TA 2XZDA 4LMRA 2AYYA 1ZW1A 4KO8A 4X5OA 4C78A 4EQ6B 4TMVA 1HDXA 3AP1A 1RP7A 5DBIA 4FCWA 4R4JA 1S96A 1A9ZA 4UHJA 2OHJA 4O1IA 4LF8B 5CIYA 4W5OA 1BE8A 5HMMA 3QVKA 1DTEA 1UJMA 2B0JA 4HEJA 4NCJA 3W90A 3I28A 4MV6A 5ALHA 1N6NA 3RANA 3LVRE 1JJBA 3CW2A 2XD9A 3P45A 4I8XA 1AXEA 1T3SA 5EJAA 2F8SA 2HC9A 5B4VA 3OETA 1E79D 1PGQA 2RHHA 3A3NA 4Z51A 4MLZA 1KXZA 3KU4A 4O29A 4QATA 3COSA 2SNIE 2RC6A 4V39A 1UWKA 3LQRA 1Q1QA 1OXBB 1MOZA 1N5KA 2ZYUX 4ZO4A 4HEA6 4GX5A 4KGXA 4Q39A 4UMFA 3LT2A 5AICA 5DNYB 3O6VA 2OZLA 3ED5A 5JQGA 3CE6A 3TIGA 4ND6A 2AI1A 2REQA 3U3ZA 4KWTA 5DHSA 1E98A 4UNSA 3EXEB 4ED9A 4W1SA 3ABSB 2WLSA 1TAQA 4DNQA 2DFLA 1O96A 1EX9A 1T9ZA 4A23A 1F8YA 2A67A 3Q3JB 5JV5A 4QXPA 4D2IA 3BSFA 5F73A 3HK2A 4XX0B 2H9YA 1KYIA 3A6EA 4IIVA 1SXJA 3UVEA 5AFSA 5CFOA 3BFKA 3FLBA 3D3KA 2VN8A 3D2CA 1D1PA 4BUZA 4AAYA 1EP1B 1YZVA 4JL6A 4HXYA 3O84A 1U28A 2R97A 1Z6XA 3O1JC 5CFMA 2YNMA 4OB8A 3TJMA 4EUHA 4RSHA 3VR6A 3GLGE 1XUOA 2WWVD 4RM3A 4PC6A 2K5UA 4KMRA 2VR1A 1UC4B 4G5QA 4RMHA 1KQ3A 3RKUA 3IPRA 4CT5A 4F9GA 1GU7A 2R6CA 3H1EA 2QX7A 1KU0A 3KQQA 2JBWA 4FBGA 4NCIA 4ZEOA 3WWOA 1NG1A 1TFUA 4W6QA 2FK7A 5CVVA 4OAPA 4QUDA 3NNDA 3L0SA 4YXWA 3EQZA 1H8HD 3BGSA 4MQ5A 2VK8A 4CQLB 1UJ2A 4FT4A 4KJXA 1P7YA 4RO0A 2WMOB 3GT7A 3PDIB 2HIMA 4EB6A 4MCAA 1GN9A 2ZJZA 4EW2A 1G5FA 4ETNA 3MUEA 4NS1A 4JENA 1H2ZA 1NF8A 2FKAA 4NV0A 1YKSA 2QG4A 4XKJA 3TB4A 4DMKA 1SXIA 5KYWA 1H3FA 3JWHA 5EIBC 3GPBA 1REQB 2R7NA 2J9YB 2OO5C 2FMUA 4ZVTA 2AOUB 1TQ6A 1IAVA 3RAJA 2PNFA 4BU0A 1RI5A 3OEWA 4LVNA 4XSHA 3OU2A 1P0PA 5DRYA 4AY3A 2AKEA 2IUSA 3FH0A 1JNYA 2QG9A 1NJ5A 2QMEA 4BFYA 2YC4C 3CNOA 2PH5A 3VPAA 2OB2A 1TZJA 2JA1A 1O7JA 2AT1A 5T64A 2YMMA 4F46A 2NTNA 3UH0A 2FSSA 1O94D 2QNIA 5ITSA 1K4KA 3GJ6A 3OM0A 4JC8A 5F7JA 2P9FA 2WIKA 2P78A 2ZWVA 3AF5A 4A2WA 5IKPA 5MN5A 3H6KA 4K9KA 3LQKA 3HP1A 4AKTA 1J8MF 4MS4A 3CF4G 3G5AA 1W75A 1UIMA 4UAGA 5TDHA 1HTTA 4X20B 4F4UA 3G59A 3NHWA 1K98A 1X87A 3VR5A 1RNLA 1SGWA 4QSMA 4JXXA 3SC2B 2QR5A 3LJKA 3STXA 3VDXA 1E0JA 4D1YA 2PH3A 3QX8A 2X0EA 4RPHA 2EEPA 4OLAA 2R25B 2O8FB 5G4KA 5PGMA 7GPBA 5CYGA 1QAQA 2OENG 4UHHA 4XARA 1DC5A 3L6DA 5JVDB 1NBMA 3IVAA 4HFRA 3HB0A 5JVDF 4X1IB 1DKLA 2AV6A 4P33A 3ELUA 3SIRA 1VJ5A 1EWTA 1FUUA 2H08A 4WN9A 5LDGA 4UTRA 3E7PA 2DLCX 3PPIA 5JJIA 3AETB 3KAQA 1NUQA 3JQ7A 4QPDA 2JZNA 3QX3A 3I6ZA 1T0PA 4OU5A 1IPFA 3W0LB 1CJCA 1Z9BA 1T5OA 4UTPA 4FFSA 4UW9A 2D5CA 1E0AA 3BA6A 4LZLA 4IEEA 3HCRA 1AGNA 4LGMA 3WMXA 4B2YA 7YASA 5K0CA 5JD3A 4EBFA 1I1OA 2ZM6B 3OPYB 1UFKA 4AKSA 3N8NA 2LXNA 1TZ2A 1E2MA 2GA8A 2PSFA 5YASA 1H85A 4YUAA 2BR3A 1YA6A 1JQDA 4NOKA 4KDRA 3TMAA 1CF2O 4WVLA 4MW1A 4HFJA 1I4EB 4UULA 4AF6A 2DMRA 2J09A 5D7BA 1U2DA 4H7IA 3RVBA 5GJBA 2O2EA 3MWKA 1SZPA 4ON9A 2HPVA 1XVVA 2ZI5A 1F3OA 2W6ID 4TWIA 1E6UA 4LHVA 5CYFA 5AM4A 2HU7A 3GPDG 4AZ3A 1YDEA 1CZUA 5D8DA 2XSZA 2C2KA 3K8YA 2C9OA 2CYAA 3JR3A 4I36A 2YV2A 1TTPB 2WD9A 1J00A 1MCZA 2C5BA 2Q8QA 2WJZB 4WZBA 3I12A 4BV2A 5IYZA 3EXAA 2CFTA 4OYRA 4XSVA 4YDHB 4JQSA 1XQXA 2RH9B 3W7BA 3ZHXA 1L4GA 2X58A 3MWLA 4OQXA 2FG6C 3T41A 5EQFA 1T4CB 3ZBUA 3ZWAA 4CM4A 5I7EA 1W44A 2BEJA 4PZ0A 5H70A 4CT0A 1KDTA 1FP4A 3O4IA 4REMA 4WNCA 5LFAA 2VT3A 1BQ3A 1F1BA 2PUJA 2X76A 4UNPA 1O95A 4Q47A 4LMBA 2VSFA 5FBWB 4DNOA 1LVHA 4K86A 1J0CA 4PBTA 3T1NA 4WXHA 4ZANA 2RGCA 3RUAA 3FUCA 4AJ4A 2F4VB 2PMCA 5F78A 5FOXA 4CNQA 4RC9A 4EZIA 5HNKA 4G0NA 3N74A 3OJWA 4S04A 4NENB 1TUGA 1YB5A 2IEIA 2GBFA 3NEPX 4HS4A 4RF2A 2I22A 3L79A 3VFDA 1EVKA 4IL5A 4BMYA 3ZD9A 3DE2X 4DKJA 4IUCS 1OAOC 1LGYA 1SOWA 3HUEA 4P81A 4CM7A 1YXMA 1NHWA 1H23A 2E4AA 2FLWA 3G5LA 3TRFA 4JYZA 5EZQA 1U4NA 4QG3A 2VZ8A 4L75A 5IMSA 3OHPA 1SCDA 7AT1A 4E5SA 3EWIA 4FGLA 4CF7A 3E2MA 5BXQC 3X1KA 3RRXA 1CQIA 4E2WA 3AHGA 3OQHA 3TNLA 4Y6LA 1GUFA 5L53A 4XAQA 2O8NA 3KOMA 2QOEA 2XXJA 3CR7A 2W90A 3DMPA 3RTCA 2G5GX 1FNBA 1XZ8A 4OKIA 5BYJA 3UAVA 1Z56C 2FQXA 4RZSA 4UTXA 2OXCA 3DLPX 4YCSA 1GGKA 4A92A 4F72A 4WJZA 4BC0A 4GX2A 1G8PA 4KG7A 4PNEA 4LSGA 3TAUA 1BQEA 2A84A 2QGFA 2W2XA 1S2DA 3CX4A 4DJAA 5IZCC 4MKHA 4PO3X 3NFYA 4A82A 1EM8A 5JY1A 1BRTA 2FFHA 4ITVA 3RBXA 4C4TA 4IR7A 2WNSA 4Z86A 2IV3A 3Q72A 2V45A 2EW8A 3F2IA 3L7AA 3ZKAA 1EWQA 2HLDA 3KUXA 3F97A 2CL6X 4NEQA 5EJ8A 4PYOA 5T4FA 2Y2VA 1E3QA 1RWBA 2Q7XA 3HEAA 3RTGA 3WA6A 4E88A 1PR6A 2X40A 2O2GA 3L41A 4ND1A 5D3QA 5HE9A 1RP1A 5BQ3A 1KYYA 5EIAA 1LY1A 4L07A 2CUZA 3M82A 1FRQA 1C5KA 3O4GA 4QECA 1E3JA 1WPGA 1HRDA 3DVLA 4ZAYA 2R47A 3OQVA 4BLWA 1G7RA 3R74A 2BDUA 1X7WB 2LPMA 3C7AA 2GM3A 4ZT3A 2CFIA 3GGJA 3U61B 3FUUA 1I3KA 2DBQA 2UZIR 1KZ6A 2W2TA 2ZR9A 3KPUA 4G4JA 3AW8A 4NBNA 1JRLA 5FJJA 1DOZA 4GD3Q 4RD1A 4GECA 4LYDA 3C4JA 3KAPA 4ROTA 3FSGD 4NFHA 5HW0A 4LIPD 4D9CA 2ZB8A 4LQ4A 2R1VB 3KTAA 5E6SB 1V5IA 4UVHA 1P19A 3M3HA 1SEVA 4YUVA 3L5KA 1W29A 3GCGA 3GLFB 1CUFA 4OGGA 1TC1A 1XRJA 5BYAA 5AW9A 3A6JA 4WOPA 1Y3BE 4BO9A 1LB1B 4G86A 2QY9A 4YBZA 3FOWA 2W22A 2JFOA 1P1BA 4GOND 2X42A 1EINA 4DOMA 4L8FA 3BXHA 1VHDA 1F2TB 2VUSA 4KNVA 4RVNA 1F06A 1P0QA 4KIWA 5F77A 4CIXA 2FMTA 3Q3VA 4P4SA 4UD2A 1ISFA 5DHPA 1PSZA 1SVSA 2JEZA 1EUYA 1O58A 4ISCA 3ZS9A 3IUNA 2IQ5A 5KMGB 2OO5A 1JWLA 1YGYA 1NP7A 5CMLA 4RHYA 1B8UA 1LPPA 1MH9A 3ICPA 3AHFA 3TIIA 1N2CA 1CUUA 2NUPA 2JLQA 3CMMA 1DEAA 5I51A 2QAGA 2BFFA 1SY7A 2OVFA 3RVOA 1FP7A 1CIVA 2ODQA 5LDDC 3JYOA 1I13A 2TSYB 4N5NA 4WCVA 4HAXA 3U4GA 2PRZA 2B34A 1G2PA 2WTNA 3CZRA 3LWNA 3N28A 3QMPA 4MQMA 2BI7A 2P2LA 2XNKA 4GNKA 4EAQA 2YVUA 2XNDA 3E3NA 4U39A 4CKBA 3FKSD 4P54A 1XE3A 3ABZA 1X15A 5AM3A 3GFOA 1O2DA 4QTTB 3ZIAD 3WWCA 5C1BA 1PYOA 2VH1A 2ZAOA 3FOBA 3LHIA 3PX7A 2VXBA 4M8KA 4RVHA 2WYVA 1QNFA 3TSYA 1RVV1 3KYDB 2R65A 3TF5A 5JXWA 1X80B 2BJVA 3F4KA 5JADA 5FBKA 2XQIA 1KS9A 2Y67A 2YIMA 1JN0A 4BQIA 1ZGAA 2EXXA 2ZRIA 1WZUA 3QEOA 2AS0A 4L3VA 4PANA 1DIBA 2Q5JA 3CLTD 1LSUA 1ZVQA 1KNXA 2WTEA 4R3NA 4LWPA 1SBQA 1CW2B 1GUDA 1LBHA 4K88A 3F73A 1TTQB 2P2SA 3IIKA 3HO1A 5AOVA 3RFTA 3EB9A 1EVIA 4B4OA 1RXUA 4HNHA 1X7YB 3Q2OA 1YF3A 4G4SO 4GDFA 4CMIA 1JE1A 4D02A 3SJZA 1YL5A 3WMEA 2AFHE 2POQX 1XFDA 2J9FA 4ZO6A 3M83A 1O08A 3CPHA 3N75A 3EDMA 4D8WA 5IM4A 1RXWA 1DWUA 3MK31 1Q1EA 1KNQA 1YAJA 4EHLA 4RA9A 4X8OA 2Z57A 1ENOA 1R6VA 1T6NA 4K9DA 5C8XA 2CXTA 4TMZA 5B55A 3G68A 1OI4A 5CFQA 3N2GB 3DAFA 5EUBA 3W05A 3JQGB 3M7IA 2C5FA 2J33A 3TXAA 2X15A 3VO8A 2VA8A 1BCSB 1A04A 1MGOA 2YWCA 3JATB 1WW3A 4RMGA 4RZ3A 2AG0A 2ZBRA 2GDJA 4NU8X 3L8GA 1AUOA 3S2GA 3TEMA 3UPDA 4R83A 2JAPA 4EAAA 4CEHB 1YU9A 3E8MA 3T4UA 4HNAA 2ZIXB 4X54A 4BX9A 2BSQA 1JEEA 1N5RA 4C7OA 1P0CA 4XB1A 1WUYA 2BSAA 4U8HA 4D9NA 3GFQA 1Z7WA 3ONEA 3ZE0B 4BO6A 4IH1A 3K2EA 5JISA 3WGGA 1N78A 1HO3A 1RAAA 3DFFA 3PVCA 2IDKA 3HXOA 2PRKA 3ZHZA 1OV6A 3ZEAA 4NYJQ 5IAOA 1SCUB 4FTWA 4Q1FA 2IA5A 2X8BA 1GN8A 4RZUA 3ZNNA 2XDYA 3QPDA 1S02A 4GBMA 4KACA 1TKRA 4IHJA 3S2FA 4AXBA 3CLHA 3ZVNA 2A3NA 2ZS8A 3KYIB 3UGKA 5ALYA 2HTFA 2ENUA 5E6UA 4TMTA 3SVZA 4LF7B 3EGXA 1G17A 2VHVA 3TLAA 1UINA 4L0DA 4MRMB 3MYYA 1KORA 4F71A 5EWJA 1NSTA 4LV8B 3BL6A 2EYQA 4JLMA 3C3DA 3OC6A 3ESZA 1FFSA 4E0BA 3VTKA 1ZNXA 1NXQA 1PWZA 1R74A 3EY4A 5ER6A 5JDCC 1ZGGA 4GXQA 5I45A 4G1VA 4B6GA 5TS3A 1J9ZA 4OU4A 3EQ8A 2G07A 4Y6RA 3ZDEA 2OVBA 1GTZA 3I32A 3D0QA 2OORA 3OECA 3V2UA 4BASA 2XBMA 2M2IA 1UH5A 2NN3C 2R751 1AC5A 3QLVC 1FDVA 1MNQA 1W4RA 3D7LA 3KYCB 4F97A 3U7IA 1FDOA 2A8YA 3OCVA 1CZLA 2IEZA 1OREA 3GJRA 4IWXA 2D5IA 4GI1A 4LXGA 1E9RA 1D6JA 3U0BA 1GYPA 1GZVA 1P9LA 5M7EA 5KQPA 4JI0B 1M5RA 3VO9A 2WPDA 1AKEA 3L40A 4MI1A 3RV4A 3S2YA 5IT4A 3ZXUB 4D98A 1GR1A 1HQYE 3GLUA 4PTYA 4EVQA 1W96A 4RV5A 3CU5A 4QRDA