2ZK7A

Structure of a c-terminal deletion mutant of thermoplasma acidophilum aldohexose dehydrogenase (aldt)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
230
Chain Sequence
FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNASMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVKNASAYVTSKHAVIGLTKSIALDYAPLLRCNAVCPATIDTPLVRKAAELEVGSDPMRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal tail derived from the neighboring subunit is critical for the activity of Thermoplasma acidophilum D-aldohexose dehydrogenase
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase related protein
total genus 80
structure length 230
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.118: Glucose 1-dehydrogenase (NAD(+)).
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zk7A00
4HX5A 4D3FA 1UZLA 1I3KA 2GF2A 3QWBA 3GHYA 3ZHXA 3G79A 3HADA 5EQDA 2O23A 4NZ9A 1U7TA 2NSDA 1HYEA 2AE1A 2HSDA 2ZJ1A 4XWYA 3HG7A 3MCVA 1EBUA 3KLMX 2W2KA 2AG5A 3GUYA 4OO3A 3WICA 1X15A 4GBJA 3CTMA 2GGSA 2B35A 1F0YA 2O48X 4A10A 5IF3A 4MPDA 4QSMA 4FCCA 4XB1A 1QKIA 3IOYA 2VNAA 5KKCA 1ZXLA 4NMHA 1U8XX 2Z1MA 3GZ4A 4AJ1A 1VM6A 2GN8A 2QHXA 5LCXA 4IDBA 4HFMA 4PG4A 2FR0A 4MIYA 4TQGA 3TQHA 2J3IA 3IJPA 3D0OA 2PK3A 3F47A 1T2AA 4UVEA 3TOZA 4CL3A 4C7KA 5U1PA 4IS2A 1GCOA 2F00A 3D4NA 2VNSA 2PKRA 4FR5A 4MVJI 1VSVA 2A94A 3JQAD 3TDKA 1A7AA 4NU6A 4JNKA 1I32A 2P5YA 5BNTA 4NJOA 1Y8QA 1Q0LA 1E3LA 4M8SA 4B3IA 1XWFA 1MC4A 3DAGA 4NFSA 4TSKA 1PJ2A 5EIOA 5TS3A 2PD6A 4GPD1 3ZWMA 1LA2A 3DTTA 4WLVA 4DREA 3GH3A 1ISFA 1AHHA 3D3WA 4BGEA 1ORRA 4J1QA 5FF9A 2NU7A 4K28A 3UKOA 5COQA 1N92A 3JQ8B 3GY0A 3I4CA 1QLHA 3KB6A 3IAHA 5CDUA 1C3VA 1E6WA 2Y1FA 2NNLD 2EP7A 4ZQBA 3G17A 1NQ5A 2Q4EA 4EZBA 1E0DA 3S2FA 2DAPA 3NJ4A 1K6XA 4KQXA 2Y05A 1WPQA 4E2WA 3BMOB 1LLQA 3QWFA 1BVRA 3VTZA 1B3RA 5C7OO 4CLEA 3QA9A 4L73A 4NBRA 3DBHA 1QXSA 2BI7A 2WEKA 3E6AA 4U7WA 3O9ZA 1KY5A 4OHUA 1T2DA 4FGSA 1WP4A 4R51A 3WGGA 2X6TA 3BTOA 3DFUA 1OI7A 1LSJA 4IIUA 2Y93A 4Y67A 4BO6A 1BTOA 1LX6A 3JCZA 3GDGA 3ZV3A 4DQVA 5JAZA 3PJEA 5CDYA 4WCFC 1GEGA 4R1TA 1ZSYA 4N5MA 1Z7EA 2PGDA 3O8QA 1YE3A 2QX7A 3IKTA 4OL9A 4BNTA 4LISA 1B7GO 2EWMA 4M87A 5HS4A 3RUDA 2A9FA 3O26A 5IG2A 4PRLA 3WX0A 4E2ZA 2PNFA 4MIEA 1TLTA 4G81A 2OL4A 2QQ5A 1U3TA 1E1MA 1WZIA 2Q2WA 1L7EA 5KJCA 1FK8A 4XQGA 5TC4A 1ZVMA 3JQGA 3VVBA 4KMSA 2C82A 2D2IA 3DZIA 2LDXA 5CPBA 4D0SA 3RWBA 4ONEA 1EUDA 1AUPA 1F17A 1RKXA 3AOGA 4XYEA 2ZTUA 4YVFA 3NKLA 4A03A 2BRUA 1K3TA 2X7HA 3SC6A 4R54A 1XG5A 2QRLA 4XR9A 3MOIA 2NQTA 4MP6A 4UEJA 1R37A 2V6FA 4XZ3A 1E7YA 3RUAA 2VYVA 5JAMA 2YV1A 2BMAA 2UUOA 5CEFA 5ICSA 3VPSA 1U9JA 4OKNA 2ZB7A 2BGKA 3ETEA 3OQBA 1R6DA 1JVBA 4PG7A 3S2EA 1H9BA 1UDCA 5EERA 5ER6A 3H2ZA 4CMJA 1BW9A 1HKUA 2DLDA 1DFHA 1RWBA 2JCXA 2R00C 1SB9A 4CQLB 5I8WA 1PQPA 1Y8QB 1D1TA 4BNZA 3S1LA 4FC7A 4XRGA 3HHPA 4YDRA 4AJ2A 2D3TA 3GNQA 4EJMA 4LSMA 4WEOA 4E5PA 3E18A 3PWKA 1HTBA 2O3TA 4N5NA 4JJGA 2EGGA 4MO2A 3SC4A 3A28A 1ZBQA 3FR8A 4A73A 5B4TA 1XLTA 3KSUA 3FPLA 4KUHA 1PJTA 4ZGWA 2I99A 3GOHA 1PL6A 1I2ZA 4CQMD 1LRJA 3MEQA 2V7PA 1OFGA 2I66A 2EKLA 1DC3A 1KEVA 4CM4A 1NWCA 2B36A 3K2BA 4Y6SA 1NASA 1I2CA 1DO8A 2EP5A 2W4QA 3OJEA 4JGBA 3C7CB 2RH4A 4NR0A 1N7GA 4CR7A 3QY9A 1E92A 3OQ1A 3FRJA 5AQ1A 1VC2A 2W8ZA 2FZEA 4IQGA 2WD7A 2DTEA 1XCBA 4TKLA 2Y1GA 2C54A 1YB5A 5JFOA 2O4UX 3GFGA 3PHGA 2B0JA 1I3MA 1LSSA 2AHRA 3B1KA 2FN7A 3H5RA 4OYRA 3V8BA 3WYEA 3AUSA 4YRAA 2NU6A 5L7WA 5HM8A 2P5UA 1U7HA 4YAGA 2OBYA 3M6IA 3KBOA 1LLDA 3WMXA 5A9SB 3LF2A 3SLGA 4XEHA 4WCDA 2O2YA 3QVXA 3UCFA 3ZWAA 4AFNA 4D41A 2EGHA 3HDHA 1U2DA 3GEMA 3JYOA 4FOOA 1LQTA 3GEGA 4CV3A 2O3UA 1GV1A 3U3XA 4OSPA 4U8GA 4FS3A 4L74A 4UVHA 4XGNA 4PLVA 1DIAA 4J16A 2JJYA 2HU2A 3GRKA 1PEDA 2AQ8A 2OOSA 4Z0PA 1DAOA 4JJFA 3IKVA 2Y66A 1DJQA 5L45A 2I3GA 2I6TA 5HRUA 2DU8A 2NV6A 2YDYA 4QXMA 1DEHA 4IQ8A 1EDZA 3H9GA 3DL2A 3G0OA 3IP1A 4IDCA 3JYLA 2GERA 4WE3A 4PG8A 3W6UA 2AQIA 3OJOA 1J0XO 3GQVA 1ISIA 5A5EA 4G5HA 2VUSA 5TSDA 4W6ZA 1ZXBA 1G1AA 4YR9A 5KJEA 1IYZA 3PXXA 4ID9A 1TT7A 2ZJ0A 5CP8A 3ZH2A 3U4HA 4MVJP 1BXKA 2BH9A 3ZWYA 4R9SA 3RBZA 2IXAA 1UZMA 1O9BA 3X2FA 1Z7BA 4TVBA 5TT0A 4RCVA 1MXHA 1OC4A 4CQLA 4YT4A 4YT8A 2BFOA 3GDOA 1JKJA 2NM0A 4QX6A 3UUWA 4BNFA 5A03A 4P22A 4PLWA 1XYGA 5L7YA 1LRKA 3DTYA 3QIVA 4FFLA 1PJBA 3GG9A 2PY6A 3L6DA 1H9AA 2HMVA 4G65A 1EK5A 1Q7CA 2SCUA 4QECA 3CPSA 4E3ZA 5CG1A 1FDTA 4FPXA 4PGFA 3I23A 1K5HA 2CFCA 3GHHA 3KYCB 2W2LD 5F21A 2VN8A 3VPGA 4E4YA 2YV2A 1BVUA 1JKFA 1RM4A 3MJCA 3VH2A 4YYZA 2RHCA 2B37A 8LDHA 2YDXA 1O8CA 4JP2A 4MVJF 4E5KA 4FOSA 1KVUA 2PTGA 3K8ZA 3PDUA 4U0KA 4YACA 1HWYA 1M6WA 2P9GA 1N9GA 1BMDA 3BTSA 5TRTA 3ZU4A 1HRDA 2JFGA 4DUPA 1PJ3A 3NYWA 2EKPA 1WAMA 2OP1A 5G4KB 3LQFA 3ONFA 1V6AA 2PWZA 1ZO8A 4II2A 1LDBA 4XGKA 4Q9NA 4HV4A 4DWVA 1EQ2A 1MA0A 3ONEA 4KP7A 3ST7A 5A5FA 4W9NA 2ZYAA 1XQ6A 3BYZA 2X22A 3NJ8A 3TRIA 1DHTA 1GYQA 2DQ4A 3KO8A 3W4IA 4UULA 2JAPA 2IODA 4P4LA 4YCAA 4D45A 3JQCA 3CUKA 5T5QA 3WIEA 1X13A 5IXSA 2W2KB 4RVGA 2AEMA 3BMQA 4R01A 5JC1A 2J3JA 1B15A 4B8WA 4OXKA 1NAIA 1P1KA 2WYVA 4LRTB 3WLEA 4DL9A 3QSGA 5THQA 4GI2A 4BGUA 3RUIA 1OBFO 1N1GA 3P7MA 4CMHA 4AVYA 4E21A 3FBTA 4DVJA 4NHEA 4PLGA 4OJNA 1E1KA 3JQAB 4Z0TA 1ISHA 2FZWA 3DBRA 1YB1A 3VTFA 1PWZA 1LC0A 2IDZA 1F8FA 1PZEA 1DC5A 1NNUA 1B26A 4R3WA 3D1LA 2ZCVA 3KTDA 2VHYA 3DEYX 5A3JA 3W8EA 1GL3A 4OSOA 3DHNA 2C2YA 2NVBA 1PX0A 4EJ0A 3HDYA 4CLRB 1R4NB 4YB8A 3I5MA 4OXYA 4YRBA 3PTZA 1TEHA 4B8ZA 2DUWA 4CQMA 2QW8A 3CIFA 1YDEA 4J2OA 4NK5A 3ZU5A 3ZU3A 4BKPA 4XYBA 2Z95A 1J6UA 3V1TC 1FDVA 4K1LA 4KTTE 1E7QA 3CINA 5BSGA 4R9RA 2UVDA 2EKQA 3I9LA 3KSZO 3LDHA 4D44A 1B16A 1E7MA 2Q1WA 4OAQA 2XXBA 3UF0A 4Z9FA 1IUKA 4EUEA 4Z9XA 4RVFA 4WASA 1M66A 3IUPA 4YJFB 5KVCA 5A3VA 2WMDA 1LNQA 2X0NA 2VHWA 3DHEA 3E82A 3K92A 4MVJG 1LDMA 1LC3A 3ZWXA 1HE3A 3U09A 2OFPA 1YBVA 4D79A 2C59A 2HO5A 5JW6A 4FD3A 2NU9A 3IMFA 3NT5A 1ZMTA 2H5LA 1NQAO 1EMDA 2QYSA 2B4TO 1Y9EA 3GG2A 2HRBA 4OGWA 1LDNA 1NX6A 2E82A 1PQWA 1SMKA 4DQUA 4GH5A 3RC7A 4IIVA 2OZPA 3FNFA 4I8XA 4LN1A 3N7UA 4MKRA 4NJMB 4RVDA 4EUFA 3ZI0A 3PHIA 2YV3A 3BXXA 5JY1A 3F1LA 3HZZA 2RHRA 3WBBA 1IY8A 1U8FO 3RFVA 2GO1A 4DMLA 4BO5A 1HETA 1LXCA 2IZ1A 3U9LA 2TMDA 1I33A 4QUKA 1GZ3A 5JXWA 1SOVA 2CY0A 4AJPA 5TIIA 3DONA 2PLAA 4NFHA 1X7HA 1YOVB 1QYWA 2B5WA 5ILGA 5GZ3A 3KRTA 2I3AA 1KS9A 3WQSB 1H2HA 4BKRA 5COBA 3LK7A 3Q9UA 4INAA 4NH4A 4OKIA 1AGNA 3LLSA 4DBVO 2YZ7A 4IBOA 1QG6A 4TROA 4WJZA 4QEDA 1C0PA 1Q0QA 3DR3A 3EZLA 1FJHA 1ARZA 4MP3A 1UUFA 3K96A 1EE9A 2Y0CA 1HDOA 4DRYA 2AEFA 2I9PA 3L9XA 4GSKA 1DLJA 1MG0A 3ZV4A 2GDZA 4L75A 1PIWA 3RVDA 4IMRA 3DZBA 1GAEO 1ZEMA 1GZ4A 4I5DA 3GPDG 4E31A 3QWAA 4YWJA 5EN4A 3DOCA 3WNQA 3DB2A 4YEDA 3ZW8A 1YQXA 4NG5A 1YL6A 1BRMA 1DDOA 1EUCA 3FTNA 4E5NA 1JW9B 5C3MA 1EBFA 4JQCA 3MWEB 2QRJA 4OIMA 1GFSA 2ZQYA 1X1TA 4Y9DA 4LCEA 3T4XA 1EVJA 1MC5A 4RGBA 3NEPX 5B4UA 1FMCA 4RPKA 3V2GA 1VE9A 5ICMA 3C3XA 5CEJA 3W4JA 4ZRNA 3BZUA 3CKYA 3BHJA 2DBVO 4CMEC 2WD8A 4MDHA 3MZ0A 5C5IA 2TMGA 3JTMA 1TT5A 4RPLA 1GQYA 4MVJD 1PGJA 2NADA 3M2PA 2J3HA 5U9CA 4B4WA 1E5LA 3ZHBA 1SOWA 1ZJYA 2FSSA 4XDYA 1QV7A 1I3NA 4DLLA 1KEPA 1HSZA 1XKQA 1IPFA 2E49A 3WOHA 3TJRA 1KEUA 1QMGA 2FHSA 3GVIA 1UAYA 2UDPA 2VUTA 3TN7A 3NGXA 1Y6JA 2X58A 3CZMA 4D3SA 1T1RA 1F06A 2UAGA 3DHYA 3PYLA 4BNMA 3ZV6A 1H5QA 4GMFA 4Z9YA 4AJKA 1PL7A 4RPGA 4RF3A 4YT5A 2FOIA 1T4BA 1YBAA 4J1TA 3E48A 3UOGA 1ZK0A 3OFSA 2NTNA 1GZ6A 4CMEA 4PVCA 5EQFA 1NFQA 5KVVA 2GRAA 2PKQO 3JYNA 1QR6A 3NDRA 3QW2A 1AE1A 3F1KA 3K6JA 4CLXA 1ENYA 1L1FA 5B4VA 4GMGA 3CMCO 3Q1LA 1YJ8A 3D3WB 1GDHA 5BNIA 1HZZA 3GLQA 3K30A 3OEWA 4RL6A 5K6AC 4RLSA 1M2WA 1VKOA 5JDCA 3OJ0A 3ZNNA 2P4HX 4OOFA 3RUCA 4II3A 1Q7GA 3QHAA 4J7CA 3A4VA 3C8MA 2NLOA 2AW5A 1WMAA 4OQYA 3WBFA 3GFBA 2VWHA 3Q2IA 3H9EO 3PWZA 2V6GA 1N7HA 4CUKA 4LSWA 4J49A 3MTGA 3KZVA 2YJZA 1EUZA 1YQGA 1Q2XA 4J90A 3SX2A 2NTVA 2Y0DA 4BB6A 1J49A 1DRWA 3I9OA 4Z6KA 4CR8A 3NUGA 1D3AA 4JROA 4P4NA 3A14A 1I3LA 4A26A 1UXJA 3ZWNA 5K9ZA 1TXGA 4PLTA 1T24A 3B1FA 3ENKA 1KVTA 2VYVD 5JC8A 4A5OA 2Q46A 1G0OA 4DTIA 2C20A 4UEKA 4TRJA 2Y67A 4R5MA 4O5OA 2FSVA 5IN4A 4DIBA 3WGIA 2BLLA 3H3FA 4LVCA 3LYLA 1ONOA 2ILTA 1LQUA 3ASVA 2R2GA 1D7OA 3KM0A 5L4SA 3TZKA 1A5ZA 1IZ9A 1V3TA 2YFHA 2R00A 1XDWA 1VJ1A 4YRDA 3CXRA 5ES3A 2EG9A 1BSVA 1X14A 2C07A 2G1UA 1HDRA 3IDSA 1YKFA 4U6SA 5LC1A 4DBZA 4DIOA 5TX7A 4DYVA 3UGKA 4EUHA 1X0XA 1RPNA 2PH3A 3F5QA 3UCEA 3NTOA 4MOWA 4IJKA 3A9WA 4S1VA 2HJSA 2GZ3A 2H9IA 3VKUA 4AJJA 3HSKA 1Y1PA 3WNVA 3ZDFA 5BNFA 4B4OA 1P31A 2Y1OA 1LUAA 4W7IA 4BNNA 5BQFA 5BR7A 5A04A 3DZKA 2Z5LA 1Y5RA 3VH3A 1BDMA 1PZGA 5DCUA 2IZZA 4ALKA 4BO3A 4GX2A 4QFDA 4XDZA 3GZNB 3VPXA 4LVUA 1ZH8A 4HP8A 1BDBA 3AI1A 3DOJA 4XYMA 4NBUA 5IFLA 4QTZA 5A9SA 1I10A 1QP8A 2Q3EA 1W0CA 4H3VA 5CDSA 2QRKA 1UXHA 1DSSG 1Z6ZA 4IQ0A 1ZZEA 1QV6A 2FPIA 3WGHA 3WJ7A 2CZCA 3AU8A 1JVSA 1ENPA 4PLHA 2Q50A 5T57A 3T7CA 4PZCA 9LDBA 5TJHA 1PJ4A 1DIHA 3S8MA 4K26A 4KWIA 4ZQHA 3JV7A 2FPGA 3DFZA 3DBVO 4BMSA 3M2TA 5EJ2A 5IAAA 3WMWA 2E6UX 2VRCD 1EFKA 2QZZA 2OGUA 4WNIA 5ER9A 3AM5A 4BNWA 1ML3A 1NFRA 4NI5A 1GY8A 4BNUA 1G0NA 4TWRA 2WYUA 5KNLA 5F3RA 3GVHA 1NWHA 1ID1A 2C7GA 3PFWO 5T67A 2X1HA 3TNLA 3QV1A 4J4BA 3SEFA 4DQXA 1A9YA 1D4FA 5BSHA 1P1RA 5MDHA 1I24A 1KVSA 2DKNA 4ZVVA 5FWNA 3G1UA 1IHXA 1ONPA 3AFNA 4Q3DA 3KETA 4YAJA 1L7DA 3DXFA 4N18A 4L8VA 2JCVA 4M49A 3RJ5A 4DC0A 1UXKA 2W90A 4JXKA 3PVZA 3IP3A 3EC7A 3U49A 2JHGA 4J4TA 4CM8B 3MTJA 5DBGA 1DFGA 2UYYA 3FPCA 4R1SA 3B1JA 3H3JA 5A9RA 1ZMOA 3EHEA 1KBZA 4CM9D 3AWDA 4XYLA 2YQ5A 4GVXA 3WGZA 2UUPA 3E03A 1ULUA 5CPFA 5JNLA 4QO8A 4RF4A 1BW9B 1HYGA 1ZK2A 2P2SA 1PGPA 4RF5A 1VL0A 4CV0A 3FN4A 1KC3A 3W6ZA 5JS6A 3JQGB 4ZICA 1MGOA 3PQFA 3JYPA 4K6FA 1RYEA 4GKBA 3RROA 1YONA 1C1DB 3JD2A 4L76A 1AN9A 2NVUB 4EI2A 1IL0A 3JQEA 3RASA 5G0VA 3JQ6A 2JD1A 2NQ8A 4FFOA 3WWYA 2CF6A 1C1XB 4PLFA 4NU5A 4MKXA 1R4MB 3AY6A 3WWZA 4LMPA 4CMIB 5CAEA 3EUWA 3A1NA 1E7WA 1HDGO 3IS3A 4IZHA 4UVDA 1BG6A 1SNYA 3LT0A 5KJ1A 1NBOA 1P1JA 3R3JA 2P91A 5T8KA 1CERA 1I01A 2P9CA 4QQRA 3KOUA 4LK3A 2E4AA 3HNPA 1UR5A 1KVRA 1BGVA 1UH5A 4CUZA 2V65A 3AI3A 4NDNE 1H0KA 5F1PA 4ZN6A 2UV8A 3D7LA 4I1IA 3F5SA 3VHRA 2BF7A 4K9DA 2VT3A 4YJGA 2WTBA 3GN2A 3PHJA 2C5EA 3I9KA 1ISMA 4WK6A 1Q0HA 3ADPA 1E1NA 4J0FA 3JD4A 4OQZA 3BMNB 1VKNA 1GTMA 3D4PA 4OM8A 2HK9A 2FP4A 1M76A 4HWKA 1MG5A 4JX8A 2BGLA 3OECA 4NK4A 3O03A 2OBNA 2GUGA 3PGXA 4LW8A 3I3OA 4I9NA 4IM7A 3LT4A 3GRPA 3QQPA 1ZNQO 3DBHB 1U4SA 1UP4A 5C37A 4PZDA 1HDZA 4NQZA 1EE2A 2IEBA 4NBVA 1UDAA 1U3VA 1JLLA 4DYDA 4RDHA 4A0SA 4PG6A 3GF4A 3PQDA 4Y6RA 1QORA 3UAGA 4Z0HO 2HRZA 3TL2A 1YQDA 2FWMX 1KIFA 2B5VA 5AYVA 4LGVA 3UCXA 1IB6A 1VJ0A 5AXCA 3WGTA 2X0IA 1P1HA 3HN2A 2V6MA 1UAGA 5C7LO 2NACA 5DOZA 1HSOA 5U4QA 2O3QA 5DBIA 1IPEA 4BNYA 4TKMA 1MV8A 4OOEA 1YBMA 2Y1CA 2WDZA 4R1UA 3WB9A 1CETA 2X5KO 2ZQZA 4ILKA 4J4HA 1GADO 1PJQA 4QT0A 5ENVA 3SXPA 4AJHA 2X5JO 5DP1A 3EW7A 2VZ8A 3ZZNA 3LSYA 1TI7A 5JPIA 2J3KA 4LCJA 2Y1DA 4WNCA 5A02A 5H81A 2I5PO 1TVEA 4DGSA 2HQ1A 5FEUA 5JDIC 1DPGA 2JKVA 2JCYA 5AOVA 1H6AA 5C7IO 3QVSA 4QFCA 3UW3A 2GN4A 4BOYA 4HNHA 2Y0EA 2CD9A 3WFIA 4GX1A 3FNGA 2AG8A 3GDFA 2DC1A 4BGIA 2IE0A 3JSAA 4O6VA 1LEHA 4CPDA 3RFXA 1H93A 4IDFA 4CR6A 4IGEA 5A9TA 1N8KA 2FMUA 3RKRA 1GEEA 4BO1A 3TZCA 1H6BA 4JLWA 1BHSA 1ADBA 4N7RA 2PGJA 2EJVA 4N54A 4CM9A 4F45A 1DIBA 3C1TA 3JQFC 1F14A 4UUOA 2ZB3A 5HWSA 4BNVA 1XA0A 1DXYA 4CM4B 4EGFA 4TZKA 4RO0A 1SAYA 4R69A 4RV9A 4ZU3A 4D0RA 3OM9A 1LLUA 3JQ9A 4HFJA 4E5YA 3ROQA 2AQHA 4EITA 4JK3A 1GYPA 1KVQA 1U3WA 4CMCA 2O7SA 4ALLA 2ZIZA 2G82A 4JBGA 2VUUA 4BHTA 5IDQA 2X5OA 2PV7A 1CYDA 1GCUA 1BWSA 1GUFA 3IQDB 3PK0A 4AJOA 3EAGA 4ALNA 2HLPA 1E1LA 2Q2QA 4BO2A 1YL5A 2X23A 5TF4A 4J2HA 6ADHA 1R0LA 2X8LA 3BMQB 2VT2A 3ICCA 3V5NA 1VRWA 1DHRA 5L7TA 3ZWWA 4MINA 1C1XA 3PJGA 5BT9A 4CODB 2FY8A 4UVIA 3WQRA 1OMOA 4OH1A 3WTBA 1BXZA 3ZNQA 4YQYA 1PS9A 4IMPA 3BTVA 3FTPA 5T6BA 2VOEA 2DPHA 3EYWA 4J1SA 5KOIA 3C1AA 1YS4A 4I5GA 4K6CA 3T7EA 3EGOA 4DIFA 3K31A 4PRKA 3HQ4O 3F4LA 3G49A 3FWZA 4CMAA 1P74A 1V8BA 4F6CA 5K6AA 1NYTA 2QYTA 2GD1O 3OH8A 5G0SA 3TZHA 4B4VA 4E5MA 5IXYA 1EQUA 2YFQA 4JBHA 3C1OA 3L6EA 1YVEI 1HYHA 1SO8A 3ONDA 3WYCA 2VRCA 3ETGA 1JDJA 4H7PA 3JD1A 5A06A 2DUUA 2NUAA 3I9NA 5L4LA 1ISGA 1D1SA 3TFQA 1Y81A 3AK4A 3PLRA 1VLLA 4CJXA 3ZHYA 3GK3A 3ANNA 5JAIA 1NVTA 5L51A 4RLHA 2DPGA 3INRA 1HE5A 1E3IA 1X7GA 2E37A 5CDTA 4P4GA 1LSOA 2DTDA 4BNKA 1YWGO 1PZHA 3OBBA 1E3EA 3UXYA 4CLOB 3DMYA 4E2YA 1UP7A 3FF4A 3HUDA 1N5DA 4BKUA 1T2CA 3D5QA 3RAJA 4XKJA 1XEAA 4HXYA 5F1OA 3WSVA 1AHIA 4H16A 3LLVA 3C7AA 3Q3CA 4HY3A 5KVQA 4L4XA 3COSA 4Q3NA 1R15A 4QO7A 1JN0A 3AY3A 2J8ZA 3MWDB 4GGPA 2VYND 1ADCA 3RUEA 4X54A 1CWUA 2GCGA 4H15A 3JQBA 3RKUA 1YJQA 4D42A 5JO0A 4BQPA 2D1YA 3ROPA 1I36A 2DTXA 3FD8A 3OICA 4WECA 4XQEA 4ALMA 2P68A 4YQZA 4YJFA 2YYYA 3FSRA 4BIIA 1EEHA 3OP4A 4BO7A 4CM6A 4BV9A 3PYMA 2YQ4A 3FCOA 2HUNA 2FRDA 1YDWA 2AEJA 4WCFA 3ZGYA 1PGOA 1Y8RB 4XCVA 3DAFA 3WGYA 5IDWA 1SEPA 1NFFA 2BKAA 1C0LA 3FWNA 3IJRA 4FFNA 4J7UA 4CM7A 5LDGA 3ZWOA 3RC9A 1R0KA 5KJ6A 3BA1A 2VHVA 1XQ1A 2ZTVA 3JQ9C 3OJLA 4JP3A 2C29D 3OHSX 5HS6A 3E8XA 5A1TA 2X4GA 3SJ7A 5ILOA 5JCJD 1H2BA 2HMWA 2PA3A 1OAAA 1JWAB 1UXGA 1UZNA 2WSBA 1DLIA 3GAFA 4PG5A 5IN5A 1S7CA 3PEFA 3RFTA 3V1UA 5LDHA 3MJ4A 3KYDB 1X7DA 2IXBA 3R0IA 1ISJA 1A7KA 5EMHA 4DC1A 3GT0A 1LDYA 3H6KA 2POQX 4KOAA 4D3DA 1A9ZA 1JKIA 2H63A 1RM5A 1YOVA 3N74A 5JDCC 2D5AA 5I7FA 1NM5A 3S55A 2H1SA 3TFOA 1EFLA 1X1EA 1ZKMA 4CL8A 1EDOA 4RZHA 3AJRA 2VZ9A 3AY7A 5TT1A 5BSEA 4MKZA 4GAEA 3M1LA 3STHA 3JQ7A 4NPCA 3P19A 4ZA2A 4RVSA 2AMFA 4W9NC 1KC1A 3RI3A 1U1IA 2P4QA 1N1EA 1OC2A 5I9MA 1UP6A 4CMGA 2Q2VA 4FJ2A 3NAQA 2C0CA 4ESOA 1LRLA 4ITUA 3HFSA 3AOEA 4XIYA 1KERA 4W99A 1DAPA 5G4LA 1NHGA 3I83A 4JCOA 4G2NA 2PR2A 4BUCA 1IE3A 2ZB4A 3GNSA 2BFAA 1XHLA 3WS7A 1O94A 4A27A 1PL8A 2XF8A 3ZV5A 2GASA 4DPLA 5F1KA 1DIGA 5G4KA 1E6UA 3WSWA 3QVOA 3RUFA 1VSUA 4RZIA 1I30A 2GPTA 3RIHA 2O4CA 3AUTA 2AXQA 1XU7A 3L0DA 5KVSA 4DPMA 3PIDA 4XJSA 1CIVA 3QE3A 5DNAA 4RDIA 3AUAA 3WFJA 3CMMA 1XGKA 5B37A 5KKAA 2B69A 4XX0A 5F5LA 1M67A 2CVQA 1K6JA 4NNJA 4KZPA 3DC2A 5K0ZA 5L53A 3E9QA 2JHFA 4BKQA 4PN3A 1W6UA 5JLAA 2C7VA 2A35A 3AM4A 3R6DA 4DLBA 1IULA 1A27A 2J5KA 4PIVA 4CM8A 3O4RA 4PLYA 2HK7A 1HE4A 2QIOA 3ROKA 3QP9A 4C4OA 4Y6PA 3GR6A 2XPCA 1KETA 2RIRA 4TMFA 4F46A 1CQJA 4XQ9A 1QSGA 4YJHA 4Q3BA 4GWGA 4MJLA 4RJTA 3WJAA 3DBLB 4IDEA 3PHLA 1ZFNA 4L0QA 5J23A 1ZIDA 2J6IA 3GVPA 4XJTA 4KUEA 3EZYA 3UICA 2Q99A 1HDYA 2VWGA 3KV3O 2W2LA 5L95A 1U5CA 1PTJA 2Y1EA 2FR8A 4BO4A 3I6QA 3VH4A 1NQOA 4D46A 4YXFA 1U4OA 1NHWA 3PI7A 3L77A 1GR0A 5L40A 4PLPA 4PLZA 1DRVA 5DDIP 3ROMA 3VVCA 4AJEA 2CDCA 3P2YA 1LU9A 5ENDA 4TZTA 4XR4A 5DBFA 2PD4A 3DQPA 4KWHA 4UEOA 4Y8VA 3F6YA 1FDSA 4FB5A 1T2EA 4GLLA 5KIAA 4B4UA 4GL4A 3TZQA 2BELA 4IJVA 2B4QA 1V0JA 4UUMA 1PWXA 4KDFA 2NWQA 2OMEA 2WJPA 3RSHA 4CLOA 5HTOA 5G0WA 3DDNA 4UUPA 3F3SA 1A71A 3FI9A 5DULA 5FI5A 4ZHSA 3V2UA 1FXSA 5L4NA 4D43A 1MP0A 5KWEA 1XU9A 3JQBC 4WLEA 1SC6A 2C5AA 5DOVA 5G2OA 3E5MA 1E77A 4E6PA 1K89A 1IOLA 1YH3A 3DWFA 5G0TA 2X9VA 3KXDA 4CV1A 1ZW1A 2Q1UA 4BNIA 4J43A 5L9AA 1WZEA 3GAZA 1GUZA 4DPKA 3S2IA 3QVWA 1EVIA 2I67A 1NTOA 1OOEA 1MXFA 1VJTA 2IEDA 1IZ0A 2F1KA 2G17A 7ADHA 2YY7A 1LBEA 1P0CA 2J5RA 3OEYA 2XAAA 4Q39A 3G1TA 2BFMA 2HK8A 2JD0A 4JBIA 3DAPA 4YJDA 3PJDA 3AI2A 4E32A 2Q4BA 3HB5X 4AJLA 4BQRA 2VTEA 1Z45A 3T4EA 4MIOA 5JDIA 3NTQA 2GZ2A 3JQAA 1BXGA 3NTRA 2Y99A 2AA3A 3D64A 3INGA 3ASUA 1NPTO 4R68A 6LDHA 3AM3A 3H4VA 4TRRA 1Q7BA 4ZQFA 4TRNA 2RCYA 1IHYA 2Q45A 1J4AA 3W4KA 2O7QA 4ZQEA 4UREA 3GGGA 1T1SA 1FDWA 3LVFO 1YO6A 1GPJA 1P0FA 3E5RA 3NT4A 1B8PA 1QYDA 4RQTA 5BSFA 3C85A 1VL8A 1R4NA 2OUIA 4GQAA 4WUVA 4DLAA 3KLPX 2NVUA 3WR5A 4EJ6A 3VDRA 2A4KA 3ORFA 3LT1A 4M55A 2Z1NA 1PU2A 1ULSA 3PJFA 4FFMA 4HFNA 2HAEA 4IPTA 5FYDA 4DMMA 4CMIA 4E0BA 5L3ZA 5JY6A 1GQQA 2RBEA 4ALJA 3DZHA 4NFYA 3W8DA 1AXEA 2A92A 5EPOA 1O6ZA 4RVUA 1DJNA 1B3BA 3PZBA 2G0TA 3QWIA 4FN4A 4BKOA 4L9RA 4HADA 4FJ0A 3RJ9A 1N9GB 2CVZA 4W7HA 1V3UA 2VCYA 1A72A 2YHIB 2W98A 2ZYGA 3F46A 4HBGA 4XGIA 5DCWA 3F9IA 1Q1NA 3OF2A 5KTKA 1CRWG 1NVMB 2QG4A 5ITVA 4EW6A 4IY1A 3B20A 1FDUA 1I5RA 4MVJM 2VYNA 2ZATA 4FBGA 4YAKA 3L07A 3SJUA 3L4BA 1JA9A 2I65A 1CDOA 1D8AA 2EXXA 5CHEA 3U62A 5JSFA 1KYQA 2DBRA 5KCZA 3JQ7B 1ENZA 3C7DB 2BFPA 4IDGA 4I5FA 3LC1O 3FBGA 3PWSA 1NR7A 1H94A 3KSDO 2DBQA 3ITKA 1C0KA 1NPDA 3JQDA 4FQ8A 1CQIA 1EVYA 4F6LA 4B3JA 2OO5A 3ZWBA 1HL3A 2ZB8A 4PVDA 1MLDA 3NX4A 4BO8A 1GU7A 4ND1A 4Y98A 4I9HA 1SBYA 3VZRA 3W1VA 3PYXA 5GY7A 3NDIA 1E3SA 1JQBA 3LC7O 1E5QA 5ADHA 1WLYA 4J6FA 1K2WA 4WGGA 3HDQA 1C0IA 3ABIA 3I6IA 3RBXA 5H82A 1RM3A 2IZ0A 1A4UA 1S6YA 5FFFA 3WGOA 1HEUA 3ZNPA 2HDHA 2CUKA 3HFGA 1VPDA 4O0LA 3TL3A 3IL2A 4Z3DA 2WWRA 1QYXA 3CEAA 4B3HA 4ZJUA 4A7PA 3IUSA 2Y68A 1MFPA 2WYWA 2VZ0A 5EL0A 2CDAA 1LDGA 2D0IA 3BAZA 1P1IA 3BMCB 3WGQA 4CUJA 2VWPA 4MVJA 2VRBA 1ZK1A 1EVZA 2ZYDA 4KDEA 4DA9A 3GGPA 1CF2O 3RCBA 1Z74A 2B4RO 4GVLA 4BVAA 5G0UA 3HN7A 4FW8A 5JE8A 1HDCA 4EDFA 5CG2A 1LJ8A 3EMKA 3KYCA 3PRJA 4B79A 3U4DA 4U0JA 1I2BA 2B83A 3QJ5A 3VZQA 3KEOA 5AXDA 4R16A 3VH1A 1NXQA 3HE3A 4FC6A 5IZCC 5A05A 3JD0A 1Z73A 1ADGA 1ZJZA 3E1KA 4CM1A 5DZSA 3LZ6A 2D4AA 1T4DA 4CMKA 1ZCJA 3L9WA 3OIGA 4J1NA 5T8KC 4YAEA 3OSUA 3Q0EA 4FGWA 3H65A 4ND5A 1XELA 1HF3A 3OIFA 3M1AA 5HA5A 4GWKA 2H6EA 1HZJA 2JFHA 4R4JA 3WG9A 3A06A 3OA0A 1MUUA 4XYGA 4L4RA 1P44A 3PLNA 3PQEA 3HWRA 1U5AA 1P45A 3N58A 4WLUA 1HDXA 1WDKA 4Q3EA 3GVCA 4UVGA 5AVOA 1O95A 4CM3A 4WLOA 5CFZA 1DB3A 3MJVA 2RAFA 5EINA 4CLHA 1LI4A 5IZCA 2PZJA 4R5HA 4YPOA 2X0RA 4ALIA 2LDBA 3DZFA 2YHUA 3WYBA 4B7XA 4IJUA 2CSUA 2YHIA 5IDYA 2Q1SA 2EW2A 3UFXA 3VDQA 1QYCA 2NVWA 4Q3CA 3RC1A 1R4MA 4I9UA 5TGDA 3BTUA 2VWQA 4FFPA 1A4IA 3L4BC 4AJIA 1M75A 2WD7B 3MOGA 1YB4A 2JFFA 4IDAA 1I8TA 3BIOA 3UN1A 2PZMA 1J5PA 3GVXA 3OIDA 4GX5A 1V35A 3EY4A 4J9VA 3TF5A 5B12A 3V2HA 3FNEA 4FDAA 4WOJA 3H2SA 3E9NA 3TZ6A 3VPHA 2EJWA 5F5NA 1ZUD1 3RU7A 3ZWCA 2PD3A 3R3SA 4LMRA 3PP8A 1UDBA 4J0EA 1BXGB 5DCYA 3QRWA 4Q3AA 4IINA 1XR3A 5DF1A 1HLDA 3ZWPA 1EK6A 2HMTA 1HLPA 2BI8A 2I76A 4PZEA 4WEQA 4AICA 3WLFA 1UXIA 2GSDA 3U4IA 3DOOA 4ROSA 2FR1A 3VZPA 5CDGA 5JYEA 3CE6A 1B2LA 1P1FA 5TNXA 4BNJA 3RC2A 4Z3KA 4OXNA 2V6BA 4OMUA 4IZIA 4GKVA 4B7UA 1YGYA 1KEWA 4XIJA 1G6KA 2ZCUA 1DC6A 1GUYA 1PZFA 2GYYA 3VOSA 4YT2A 2OHXA 3ICPA 4HNGA 1DRUA 3INTA 4EEXA 1U2GA 1WW8A 4J9UE 1GQ2A 1JTVA 4PFJA 3ENNA 1P77A 3EK2A 1P33A 3AUUA 4U6QA 3C24A 1E3WA 3G3EA 3WDSA 2D8AA 2HMSA 5I8ZA 1O89A 3ZWVA 4FIZA 5JMPA 1SB8A 4BB5A 4ND3A 2PH5A 3WIDA 1B0AA 3JQFA 4PCVA 3TPCA 4TRMA 3PIIA 4B7CA 4E12A 2RH8A 4LRSB 4EBFA 2IYOA 2OP0A 3RUHA 3BMOA 1Y8RA 2D59A 4XQCA 1X0VA 1QRRA 1PR9A 3GA0A 4GSLA 3CSDA 3AW9A 5TJ9A 3DMTA 4HUJA 3NV9A 2VTDA 3AU9A 1TA4A 5COAA 4BS9A 1LTHR 4YAIA 4FJ1A 1E7RA 5DN9A 4CLRA 3I1JA 4E2XA 3PDJA 2EERA 2EW8A 1R66A 1W73A 1ZK3A 2HMUA 2QZ9A 4URFA 5GMOA 3I4FA 5JCJA 5CEEA 4P8RA 2GR9A 4CMBA 1HXHA 3GN1A 3RU9A 4R3NA 1MB4A 3HJAA 3V1YA 1TB4A 3BHMA 2DFVA 4BNHA 3SBOA 3H9JA 1PR3A 3CZRA 4IJWA 2X9NA 5IZ4A 1V3VA 3P2OA 1DOHA 2EIHA 1JWBB 1PQUA 2CDBA 5I9LA 3EVNA 3KYDA 5IDXA 3Q9NA 5MGBA 4RF2A 3ZN2A 1VL6A 1F8GA 1PGNA 1RYDA 3QWHA 4A2CA 2ZK7A 3AOEC 5DP2A 3Q11A 2C2XA 2EF1A 4L4SA 2OORA 1H6CA 1UJMA 4W82A 4ZRMA 3GC6A 4KTVE 4NBWA 1ZSNA 5JBIA 4IGFA 4YJGB 1NQTA 3OA2A 1B8VA 1NPYA 2PFGA 3ETDA 3NGLA 4P38A 4UUNA 1OZAA 5AXAA 1XSEA 4BO0A 1WMBA 1FF9A 2DFDA 4YTEA 4WCFB 3KVOA 5ITWA 4JJIA 2CVOA 3VKVA 2ZTMA 9LDTA 3SLKA 3RD5A 2O2SA 3K9QO 5T64A 5B1YA 3TSCA 2NTJA 2PGLA 3F4BA 2EEZA 4N5LA 3WTCA 2R6JA 2DT5A 4C7JA 3GUCA 1F12A 2E48A 1PJLA 2FPPA 1JU9A 4EYEA 1O5IA 2YW9A 2GLXA 1HE2A 1NR1A 4XB2A 1T25A 4M89A 1C1DA 3RBVA 3B70A 5I7SA 1GPDG 3HDJA 3VAZA 2VHXA 5I9NA 3GZNA 4DXHA 1RJWA 1ONNA 1GD1O 3OETA 3GNTA 3ADOA 2X0JA 1WWKA 3H8VA 1Y5MA 3ZU2A 4KUGA 4NBTA 1ADFA 3NRCA 4M86A 1JAXA 3GMSA 1R12A 4CQMB 1RM0A 2HJRA 1E3WB 3PPIA 3R1IA 4E30A 1KOLA 1XIVA 3GEDA 1E6EA 3LT2A 3MJTA 1YL7A 2JAHA 3Q2KA 1PSDA 4S3MA 4WKGA 1NVGA 4F3YA 2CNBA 2O3RA 4HFRA 2O3JA 3DBLA 4RPHA 4KQWA 1GYRA 5DT9A 3LC2O 4O1MA 4TVOA 3IIEA 4UAGA 3ZCXA 1C14A 4IDDA 2X86A 5A4DA 4YA6A 5FI3A 3MJSA 5KJFA 3OQ6A 4ZD6A 2NU8A 3X2EA 1DBVO 2VHZA 4M1QA 1ZEJA 4RORA 1PJCA 5AXBA 4MP8A 3H5AA 4XD2A 2D5CA 1P9LA 7MDHA 4ND4A 3QVTA 2BD0A 2VOJA 3GMDA 3H7AA 3BMNA 4FFRA 3MJEA 4PLCA 1HT0A 4ND2A 1I0ZA 3JD3A 3H9QA 5HBRA 4IXWA 4M54A 1AXGA 1WNTA 3DZJA 1PS8A 3DBRB 1JAYA 4XRRA 2DM6A 3UH1A 2WM3A 1Z75A 3ULKA 3ZW9A 2O3SA 3ZNOA 4R41A 1ZK4A 1O0SA 1Z82A 2GN6A 3GPIA 3L4SO 1SZJG 4WLFA 2P9EA 4EEZA 2BHLA 3UHAA 4GLOA 4CM5A 4J3FA 1CEQA 4BMVA 2EHDA 3GGOA 3U5TA 1P3DA 1WDLA 3PFFA 4CV2A 1PGQA 2HKIA 2Q1TA 3L6OO 1E3JA 4AL4A 1H6DA 2VQ3A 3LF1A 5EESA 3U4CA 3DO5A 2GNAA 4BGVA 3KHUA 4IS3A 2BGMA 3W8FA 1EZ4A 1W4ZA 1N2SA 1GV0A 1M6HA 1YXMA 3EVTA 4AJNA 5JMWA 1K0UA 3KYBA 4J91A 4O59O 2JD2A 3I52A 3Q6IA 3TOXA 1NAHA 2AE2A 5I7EA 4BL5A 4D7AA 3ITDA 5IJZA 3TWOA 4WLNA 3BHIA 1VI2A 2OXIA 4GGOA 2CMDA 2G5CA 1W8DA 2DVMA 4WOKA 1Y7TA 1NP3A 4AJ4A 3K5PA 3O8QB 3I9MA 3O38A 4I08A 3P5SA 2JL1A 4MVJE 3SVTA 3FHLA 5JAQA 5GZ6A 2GN9A 3S2GA 3D4OA 1SEVA 3AFMA 4RVHA 4FSHA 3K2EA 5TQVA 4BO9A 3U0BA 1WVGA 4YBZA 4BNLA 2J5QA 4IUYA 4U5QA 3H5NA 3D3EA 4AG3A 3I9JA 1LDEA 5I7VA 3RQSA 2GZ1A 3ANMA 3PGJA 1T2FA 2DBZA 4NJMA 3NT2A 3ON5A 4XA8A 3DMTC 1SPXA 1WDMA 3K73O 4BNGA 1R16A 2IRWA 2EV9A 2X9GA 4ZQGA 4BV8A 3VZSA 1KY4A 1DIRA 1ZSVA 3ANLA 1LLCA 1SCUA 4CLDA 3ZHZA 2CF5A 4J7XA 3VC7A 3H9UA 3FR7A 2WE7A 2XOXA 3D5TA 4GX0A 3WXBA 3KEQA 3QLJA 2PZLA 1MFZA 2YUTA 4NIMA 4JN6B 2IYPA 5JCXA 2XXJA 4WPGA 3EDMA 1DFIA 4RPJA 1CJCA 2AQKA 1B8UA 2O50A 1YRLA 3BMCA 3VPFA 1TT5B 4JIGA 4BMNA 3UVEA 1K6IA 4W4TA 3B6ZA 1QLJA 4MVJH 4E33A 3PHHA 4R1NA 3E9MA 1WXDA 3IC5A 3JYQA 2Q49A 4BNXA 3JQ8A 1PJSA 4HKTA 3DZGA 1PS0A 3HB4X 3OJFA 4RQUA 3OMLA 2G76A 3KUXA 1MX3A 2PZKA 1U3UA 1R0SA 2ZKLA 1B14A 1ENOA 4IXTA 4I5EA 1DC4A 3CH6A 1Y9AA 3NDJA 4O63O 1LSUA 5JYDA 2PKQP 3PZRA 4E13A 2ET6A 1T26A 1E7SA 2ZTLA 3LU1A 3FNHA 2HCTA 4YJHB 5TLSA 5JO9A 5H83A 5THKA 1U28A 8ADHA 1V9LA 1QYVA 3WQQA 5GZ1A 2WE8A
chains in the Genus database with same CATH superfamily
1JBKA 1P61B 1I2DA 4HX5A 3MUEA 3VGJA 3LQ1A 3DTNA 3UH0A 5B6IA 3QE2A 4ZTZB 3G5LA 4HGNA 1N2ZA 3RGWS 4HUQA 1D2NA 1NJ2A 3DGEC 1FSGA 1YA4A 1T4MA 2AG1A 2CK3D 3B9RA 3OLZA 4BLVA 3ADBA 3B7GA 3HYLA 3I34X 3M4NA 1UKEA 2AE1A 2HSDA 2ZJ1A 4MJ3A 1E3QA 1K3UB 3K32A 3EQ7A 2WAAA 1PTJC 2OXRA 5D8DA 3WICA 1L3CA 2PX3A 1K4YA 2IGTA 3A2MA 4OO3A 3L1JA 4DADA 1T3HA 2CFTA 4O4IB 4EOGA 4WJLA 5J2UA 1PT9A 3LIIA 4HNRA 2X8JB 4HTFA 4WXHA 3M4XA 2NG1A 4X97A 2NU9B 1I1OA 3E2IA 2MYPA 3C3AA 4P7JA 5JNSA 1IM2A 3I3SR 2ZIGA 2P3SA 1J24A 4NMHA 3IOEA 1BS1A 3OLCX 1KI9A 1GRRA 3B85A 3FH0A 2PLWA 2ZXEA 4C0JA 3S29A 1VM6A 3N75A 5AVYA 1N8TA 3GJ7A 4LJ4A 1V41E 2CE7A 5J5AA 5LCXA 1GNTA 1L4FA 1GTSA 4R83A 3GA7A 4JOBA 4BBAA 1EFAA 1I14A 4MIYA 4ZK2A 2J3IA 2JFWA 3G5MA 2PX5A 3F47A 4QIHA 3R7FA 1PSZA 1X2BA 5KQGA 4Q9LA 5F33A 2F00A 2ASEA 3D4NA 1AKRA 1HRKA 2H2IA 4LJ5A 1GU1A 2ODNA 4FR5A 4MVJI 2A94A 2PCJA 2QS9A 3JQAD 4R9UC 3UKJA 3MMXA 2BMFA 4GQIA 1UJ6A 3COVA 1Z15A 2OHIA 3EY9A 2P5YA 2IHZA 5KCMA 1FU4A 2BEWB 3JVIA 4XASA 3JQRA 4Q9KA 2DB3A 2C04A 2P4UA 3HYTA 1WL8A 3L1VA 3TSAA 3BZBA 2FEKA 1E3LA 4FCVA 1UC9A 4M60A 5ICGA 3GFRA 3DAGA 2XQJA 2VA8A 1FMLA 1FVXA 3VPCA 3DH0A 4B33A 3ZGOA 1PUXA 4KQMA 5A0TA 2LCQA 3LBYA 1D4OA 1PBTA 4A8HA 1F8YA 3D2AA 4HPWA 4WLVA 4V0QA 1NYRA 4DREA 3EGDB 2P3LA 3PFIA 2Y4NA 4GKAA 1ORRA 1PX2A 3I92A 5FF9A 3UKOA 4O3MA 1M10A 1H1TA 1Q16A 1Z5WA 2I4RA 3C2QA 3JQ8B 1PFWA 4UZSA 3GCXA 2BCJQ 1GTZA 2B98A 3IAHA 5DBHX 4BDSA 1C3VA 1EI9A 3KTAA 3VO9A 2G77B 2FR8C 2EP7A 4C30A 3G17A 2H51A 3GB9A 5ALTA 3ZK7A 1E2UA 1UOOA 1E18A 4PE5B 2DAPA 4Q1AA 3ZYCA 3SF8A 4OQNA 3SFVA 1FFAA 1V8OA 1YCFA 2HEGA 2Y05A 1FNBA 5CD1A 1LLQA 1U7PA 3R77A 1FUYB 4OUDB 2G9RA 5G40A 3CR7A 1FW8A 5C7OO 5I48A 2W0MA 3VISA 4L73A 3DAOA 5C8XA 1QXSA 3LA8A 1NZDA 1KY5A 2XA1A 4FGSA 2XH8A 3D4LA 4RV4A 2Q29A 5EP1A 2JVKA 2MSWA 2X6TA 3GDHA 4LE1A 4IIUA 5FLEX 4FGJA 1Z6QA 2Y93A 2E4YA 3FZYA 3Q12A 4QYSA 2FXVA 2W2TA 4K2HA 1N8SA 4Y67A 3JCZA 4F1JA 2NUPB 4HL6A 1R8JA 2G1AA 2V58A 4DQVA 5BVGA 3CKMA 1V11A 4D5EA 4RCZA 2G04A 1A98A 2Y1XA 3UGQA 1OYWA 4R1TA 2CT8A 2IUEA 3QYFA 4N0EA 4NICA 1FTNA 1T13A 2YVLA 3SD7A 3I45A 5CVDA 5LOVA 3NBXX 4N5MA 3GCGA 1KAMA 1R4ZA 3O8QA 2QX7A 3WP1B 4N41A 3M6LA 4JCCA 4LISA 1NI3A 4B3FX 2Q0XA 4M87A 1U1FA 3EFOB 1R9JA 2AJCA 2A9FA 3O26A 4X1YA 1MX1A 4PRLA 2EKZA 2PNFA 3FM9A 1L6RA 1YE8A 5BXQC 1G20E 1M2OB 2EU8A 1BDJA 1BMTA 2OL4A 3OPMA 4AZTA 2Q62A 2QQ5A 1E1MA 3HCCA 2YVKA 3IQHX 3OCZA 2V7XA 4R31A 4XVHA 1XMIA 2FMFA 1VGVA 1Z4MA 4ZWNA 5TC4A 3B51X 5I9BA 5A7GA 3G2LA 4KMSA 4D0SA 2XUZA 1UT6A 1QHEA 3KT3A 3ZX4A 3CLUC 4AMUA 5KB3A 1EUDA 4IH1A 1I5OA 2FZKA 3AOGA 4P5PA 1QO0A 3IHKA 4H4DA 4M0KA 2JEZA 4HDNB 3ZU6A 1K6EA 3MPOA 2QRLA 2VS1A 4XR9A 4KH1A 4MP6A 1XEXB 5DLDA 3N2KB 1R37A 1QIFA 2GAAA 2VYVA 5JAMA 5CEFA 3KQLA 2W00A 5FO0A 1PFQA 1XZEA 2C2ZA 2BGKA 3ETEA 1ZNZA 3IXLA 4EZBA 5BN5A 1RQXA 3KYIB 2WKSA 5CA1F 3H2ZA 3RH0A 4ZDKA 1TM1E 4UZFA 3M6VA 4UBLA 5IJ9B 1GO2A 2VAMA 1PQPA 1D1TA 1WB5A 1TJ5A 2RBGA 3KT6A 2ZSUA 1B0ZA 4FC7A 4GOMD 1KOFA 4K0KB 2SKEA 1ZH4A 4IIBA 4RHXA 4HVLA 1CVRA 3H11A 4MAAA 5L3SA 1FFWA 1JWLA 2AFIE 3JWEA 2NO9A 3UK7A 4WEOA 3CLRC 2J1LA 4E5PA 3RTDA 3LLMA 1C8KA 2F9MA 1KEKA 4DC9A 4NS1A 4MO2A 3SZOA 1T8RA 1XLTA 2IXFA 3DFIA 3NJRA 4DLZA 1UPCA 1Q95A 3FPLA 4RZ3A 4DNFA 1WCIB 1WEKA 2ZJ4A 4JFAA 1PL6A 4CQMD 4IRMA 5KU1A 4MKGA 2W48A 5BV8A 3ZD7A 3N2LA 5K7SA 3L79A 2PDAA 1ZD3A 1OFGA 4M37A 4MV6A 3O94A 2XDQA 3WLSA 4CM4A 1NWCA 2XBUA 3U37A 2GBLA 3NUZA 2FQQA 2G7ZA 4A6DA 5JNRA 2WUGA 1NASA 5E6SA 2ZCJA 2EP5A 2OM6A 2TMKA 2QLNA 2I7DA 2PKYX 2AKYA 1NATA 3D3NA 5AJHA 3D6VA 4TVKA 2H08A 4NR0A 4HVAA 3WV5A 4CR7A 2IHVA 3QY9A 4W5HA 4CNBA 1YJAA 3FRJA 4X8MA 4F5WA 2R5FA 1IUPA 2Z83A 4C01A 2WD7A 1EDBA 1Z36A 1KKLA 4KG7A 3KJGA 4TKLA 4R1PA 3U1VA 4Y2YA 1CUJA 3GFGA 5IXJA 3GI1A 5D5HA 4CIXA 1M2GA 2H1WA 3LKZA 4ZMRA 1XZKA 4E30A 2R86A 2R8YA 1P0QA 1O6FA 4AJ9A 2H2AA 3ICQB 3RRMA 3M6IA 4PC1A 1K4MA 2F1JA 3WMXA 2PGIA 1O9GA 3LF2A 4XEHA 3WIUA 3DWIA 1QGAA 2O2YA 4N12A 1D2EA 3QVXA 4D41A 2R5NA 3HDHA 3PD7A 2RAUA 2FW1A 4HK4A 2ISQA 4JC4A 4NVRA 1LQTA 5LZ2A 2LKDA 4CV3A 1IBLB 1Z4JA 2O3UA 2WUFA 5EP3A 1GV1A 3U3XA 5M34A 2ZRLA 2HTEA 1E2GA 1RR6A 3IAM1 2HL6A 3DZ8A 4PLVA 1DIAA 2RGUA 1G5PA 4XGNA 3WFZA 1Z3IX 4ROTA 4AMYA 1UANA 3L8MA 1E4OA 4YI3A 1UZAA 1CX9B 1D2RA 2JJYA 3GRKA 3CLSD 4M0FA 2XLCA 3NHBA 1FB5A 3V4OA 3ZDRA 3W5AA 3RS9A 2I3GA 1OR8A 2Y6VA 2O1WA 3FUWA 1EDZA 3R8CA 3DL2A 3DLTA 3K0CA 4C6TA 4WBNF 3WGUA 5A5EA 3MXTA 2FSHA 4G0ZA 4MV5A 1GPMA 1OASA 1ZXBA 3BVPA 3FCAA 5HMLA 4DLTA 5LKAA 4C43A 2YTZA 1T36B 2QV7A 5DIFA 2PS1A 4IR7A 1UDWA 4I1OA 1JHVA 2HLDD 4ID9A 1RE1A 2YYAA 3NI2A 3U4HA 2BH9A 4LZPA 2NUTA 1I94B 5KNDA 1V5FA 3LSTA 1UZMA 1O9BA 3KR9A 1W85A 2P27A 4G1BA 4TVBA 5TDHA 3STTA 4RCVA 1YS7A 2L2QA 1MXHA 1RMTA 1OC4A 1Y9JA 3MSXA 4GPAA 3RT9A 2BGUA 3EARA 4QPDA 1JG4A 5K2MA 1XD9A 2XQIA 4YT8A 2BFOA 4QX6A 5JEDA 1THZA 1C9KA 1GQOA 3USCS 5A03A 1W94A 4EHNA 4L5BA 1LRKA 2QXTA 3DL0A 4M1KA 5DWDA 5A4KA 2HWKA 5LQDA 3DLCA 5JCOA 3HVKA 1PJBA 1X1RA 3M89A 2R3SA 1ZD8A 1KDVA 4YN3A 4QSHA 3V1KA 3DVAA 4H35A 2SCUA 1Q7CA 2DY1A 2Z8YM 5EFOA 3AINA 1MW8X 4ZHQA 3A6EA 2VSNA 4YRJA 4FPXA 3A31A 4GMKA 3L18A 2CFCA 2I1WA 1IVSA 5F21A 1Q1ZA 3KQQA 4MVCA 5ALXA 1TZJA 1AUOA 3DLAA 2R0QC 1YU6A 4MR9A 1KEEB 1OI4A 1MHPA 3KJQA 3MJCA 2RHCA 3VMMA 1MJNA 2ONCA 5DX1A 1EZZA 5DNYB 2G4LA 3CJRA 2WQ6A 2D4HA 2PTGA 3K8ZA 5EHIA 2B9EA 2ZW9A 3NYRA 3C6QA 5EWMB 1E79A 2P9GA 2MYNA 2RG7A 1N9GA 1BMDA 5TRTA 3R7AA 3SMVA 1HRDA 3GEHA 1D9ZA 4YXWA 4BQIA 2L19A 2IEYA 5DLQC 3BF7A 1HMPA 1WAMA 3H5VA 3RYTC 4EQ6B 2XMGA 4YASA 2PWZA 2X1LA 2EBUA 2A1TR 3VR6D 2GAJA 4XGKA 4LVNA 2BWJA 3EXEB 1MA0A 1QGDA 4KP7A 4YP5A 2OV3A 3GUVA 3IMKA 1KSGA 5ADWA 4U7JA 2JRLA 4G0OA 5A5FA 1IAQA 1X1SA 1XQ6A 2WUVA 1E63A 3BYZA 1IVYA 3TOVA 3V4FA 2X22A 1AMNA 2EKBA 4NE7A 3TRIA 5IM4F 1DHTA 3W4IA 1B0PA 4GC5A 4UULA 2I8CA 3A6GA 1CNFA 1RXIA 2FHPA 3HN6A 3JQCA 1VHDA 4QUGA 3SWWA 5IXSA 3BSYA 2XYVA 3E05A 2YMMA 3PI6A 5GP1A 2GLTA 2WKQA 5KYGA 1O6BA 3K9LA 5D1HA 2P5TB 4S12A 2VPQA 3QSGA 4DL9A 5THQA 4BGUA 3P7MA 4GM0A 1TKCA 3VSCA 5K0SA 5HW0A 3FNIA 4YK7A 5J40A 2LPMA 4B40A 1LCIA 1Q14A 4E21A 2H3HA 1KE2A 4IDHA 1JAIA 2RH9B 4R2JA 2R47A 3NO4A 1XQ9A 4FLFA 4BVKA 2Q4RA 2PMWB 3M3DA 4EUKA 1F8FA 1JKMA 1JSRA 3KALA 1PZEA 3KK0A 5J9FA 5DNUA 5E7JA 4R3WA 3FPBA 4IF4A 5HKBA 2QNBA 2IFTA 2VHYA 3T5MA 3OE1A 4CEHB 2ZIVB 3IQIX 3TBHA 1NXVA 5JRZA 3IPAA 5JQWA 3N6VA 2P77A 4JBXA 2M9MA 1M8GA 4NARA 3OIVA 4ZODA 2F7SA 2JZCA 4G41A 2P6NA 5LJLA 4KREA 4OXYA 2JJMA 4O1HA 4YRBA 5AVSA 2QW8A 3WYAA 2ZJ2A 2OZLA 3OPYI 4GLBA 2WFLA 3ZU3A 1VXOA 3I2KA 1RQRA 3T95A 1M9NA 1T9GS 1E6KA 3CX7A 1XKXA 2JCBA 1PG5A 2R7LA 5B3LA 3EGDA 1L8LA 4Z4GA 1U2QA 2DKOA 2W4IA 3LDHA 4Y1RA 3KSZO 3UK1A 2VXYA 4D44A 1EVKA 2C4WA 1D9XA 1ONSA 3FYSA 1E7MA 4PAWA 1XTRA 3ZTWA 5F23A 2XKJE 2MHCA 4MCJA 4Z9FA 3RSOA 1EGAA 1XRJA 4EUEA 4Z9XA 2D1QA 4YJFB 3IUPA 1HTTA 1NXTA 4X6XA 5A3VA 4DR6B 1KHTA 2I33A 5E8JA 4QLAA 1T29A 1HA3A 1WUTA 1LDMA 1LC3A 1QS0B 1Z0IA 1PUIA 1L7RA 1CRLA 3AESB 4KXFB 5EE3A 5LXTA 1COZA 2HO5A 3LQQA 5JW6A 2OD2A 2PLNA 3WK4A 1F2TB 3NT5A 3EXG1 2OR3A 2VNJA 1CUWA 1Z2CA 2WHRA 3GG2A 2WP0A 1UL1X 2I54A 2HRBA 4AP6A 2J48A 1NX6A 2EX1A 2ZYTX 3ED5A 4JA2A 4MQFA 4MV4A 4DQUA 2J6HA 5TMDA 3RC7A 1NVKA 2OZPA 3FNFA 3N7UA 3WWCA 3IQEA 3F73A 1R5OA 3BXXA 3MFYA 3UB4A 2BJWA 3PA6A 3T5TA 4Y2GA 1U8FO 3RFVA 1L5NA 4YHBA 4M99A 4WFQA 4BO5A 1RTKA 1S4MA 1GA1A 3WHIA 4Y6OA 5HFJA 1IXRC 3TW0A 4B09A 3KX2A 5ESRA 4JYMA 4BRSA 3I0MA 2CY0A 1SKYB 3EIFA 2UZAA 1N25A 2PLAA 4NFHA 1X7HA 4RKWA 4ZOBA 3TQRA 2IPAB 5AICA 2QVXX 3JS5A 2EQAA 4C6TB 1T8PA 5GZ3A 1M33A 3SJBA 5CFNA 5KYYB 3FZQA 2I3AA 1NP6A 2HSGA 2X77A 2XZPA 4ZO8A 3WQSB 2JGDA 4RMJA 5BUZA 2QX8A 2Z6VA 2HSEA 1ZCZA 1EGMB 4M88A 4FNMA 3AUKA 2Q4TA 3IQZA 4O4HB 5COBA 4UMFA 4OKIA 3RV3A 3LLSA 1PW5A 4Z2AA 4IBOA 3RVLA 1KZHA 3PFBA 4QEDA 4UAJA 3MQ2A 1Q0QA 1AKMA 1B93A 1DWUA 2OTCA 3ED1A 3D6HA 2G80A 3IR7A 4BBZA 4DCJA 2UUCB 3QBJA 1L7PA 2I9PA 4GBGA 1XAIA 3RADC 2FE1A 1GDTA 3HTXA 1J00A 3UWSA 4C22A 3IMEA 3M4YA 4F4UA 1ZEMA 2AW3A 2QN9A 2OV1A 3C3DA 1GHTA 1XLWA 3C1UA 3FDJA 1E2IA 3GPDG 4RFSA 4P4SA 3Q8MA 2ZWPA 3QPDA 1KOJA 5EN4A 4EFDA 4FMPA 3WNQA 4JX9A 4YEDA 3QGMA 4N39A 2BP7A 2REXB 3AIKA 1W76A 4D4KA 1Y8CA 4YY3B 4QHYA 4WFKA 2R4QA 1VJ5A 2BEKA 2V9CA 1UKVY 4IO1A 2ATCA 1X7WA 2Z04A 4LZJA 4OIMA 1XMQB 3FNBA 2BFNA 2C4KA 2AYZA 2P40A 2H4JA 1NMZA 2INGX 3CX3A 1JKJB 1XZCA 2QZPA 1XQYA 4F04A 5JVDF 2CHUA 1EVJA 3EHDA 1PQ4A 2YOHA 4INOA 4RGBA 1K92A 1PFYA 3S1AB 7REQB 4TM7A 2W9XA 2VPIA 4LV6A 5AJVB 1RYFA 4MUMA 3V2GA 5C1OA 5ICMA 3C3XA 3CHYA 4RNCA 5LB4A 4TM8A 4ZRNA 3W4JA 4EZEA 2UUBB 1GKYA 1H8ED 1N6LA 1HE1C 4KJZA 3BHJA 4QXRA 2DBVO 4CMEC 2C3OA 4N65A 2QN8A 3MZ0A 5C3UA 5SY4A 5A2QA 1TT5A 2CXUA 3OZFA 2C97A 1G9TA 4RPLA 3FY4A 3EGIA 4DM3A 2IYYA 2HLNA 2IYFA 4B4WA 3NOXA 2KWIA 3JWHA 3TOSA 1VPWA 4KFUA 2JLVA 1MAVA 1ZI8A 3OKCA 1QV7A 4ATNA 1I3NA 1KEPA 2NO7A 1FLDA 1HSZA 1XKQA 3HSYA 3LX4A 4XWWA 4CCYA 2E49A 2P65A 4LHYA 4DLYA 1SU6A 4J03A 4FYXA 4XX0B 4BFLA 5C8ZA 3WLTA 4DF3A 1V96A 2HBRA 2OLEA 2PSDA 2UDPA 3H1EA 3Q15C 4FYYA 5JAUA 3SDBA 5KOHA 4X7PA 2VZEA 2VUTA 3SYRA 2VJYA 1Y6JA 1BEUB 2X58A 3ZLVA 1WDTA 1YQTA 1F06A 4CU5A 5JZVA 3PYLA 4S35A 2B8TA 2W6CX 5JI2E 4RPGA 4AMBA 4RF3A 3V48A 5C80A 4GZ6A 3K8QA 2FOIA 4LF6B 1CUIA 3UOGA 5LWQA 1UFVA 4HLUC 1C41A 4CMEA 5KVVA 2YKGA 2AL7A 4FT4A 2BKLA 2PKQO 2PQ6A 1QR6A 2W2XA 1R10A 3JYNA 3NDRA 3TLKA 1WPGA 3R3UA 2TMYA 3LKBA 1M1NA 3ZQJA 4XW2A 1L1FA 1R0ZA 2XMCA 4FZ3A 4BQFA 2ZWAA 5KQLA 3EVCA 3E7PA 3DE3X 4MB6A 3OWOA 1KPIA 2QAGB 4RZSA 3S2ZA 1GDHA 2VG8A 5K6AC 3OEWA 3BS4A 3P9ZA 4U3JB 5AIAA 1C9MA 1CZKA 2OBMA 1JIJA 4HDNA 4CKWB 4UU7A 2BFCB 2QD1A 3NM4A 1FNDA 3RUCA 1XVLA 5ICFA 2A88A 2WU3A 3KU1A 1YQQA 4OQYA 3NHAA 4Q7JB 3WL6A 3ZHQA 3EJ6A 4MCIA 5DH9A 1FRQA 4MWEA 4NAHA 1M6EX 5JZBA 2ZJZA 5LZ9A 2XCRB 5CLIA 5UKDA 1I4OA 1UK8A 4OBBA 5DLPA 3HZOA 4J49A 4Q4AA 1TYZA 3QKSA 4ZYUA 2ZEJA 3LUAA 1UC4B 1IPHA 2GOYA 3ZD6A 4DLSA 1GSHA 1YQGA 3PRKE 4L8WB 4BX8A 5E38A 4KPYA 2G9QA 1J49A 4V0RA 1J23A 2JHAA 4B80A 1NUQA 4CRWB 4LI0A 4O29A 4WESA 3A14A 1UJBA 2BKXA 3P9XA 4JP8A 4UTXA 4A26A 5LNK1 1T24A 3B1FA 1LGYA 3ENKA 3DDOA 3IHWA 4M9QA 4A23A 2VYVD 1HQYE 2C83A 2Z5FA 5JC8A 2H85A 3QU2A 4HDOB 4ZFNA 5FPQA 1LK7A 1OH7A 2VYCA 1YR6A 2C20A 4B81A 4ZIRA 4DV7B 3Q0IA 3BWXA 4TRJA 3TUJC 1MTZA 2Y67A 1EFPB 2IOQA 1J9ZA 4M98A 4EPXA 3K7EA 1NVDA 1UQTA 1K3FA 4ECAA 1LWNA 4RWEA 2V3WA 4ZP1A 1D7OA 2JNWA 3KM0A 4HN9A 5L4SA 2JK0A 3KKZA 4JYPA 5JU6A 1EEXB 4BFSA 2PRKA 2QTRA 2WSSD 4G25A 3E23A 5D84A 3TDMA 4YR7A 2O8CA 2I2WA 3MVEA 4BASA 3CXRA 3PWTA 1AUQA 5LC1A 3WKBA 4DIOA 1HDRA 4DYVA 1OLOA 4EUHA 1RPNA 2PH3A 3FJ1A 2IIQA 1C3XA 3R9KA 2V55B 3QKTA 4ZVMA 3FHTA 1QQ7A 2GZ3A 2V8BA 3HBFA 4XUGB 3VKUA 3HSKA 1T5BA 1Y1PA 3WNVA 3R0QA 4NL4H 3HA5A 1LUAA 4LY6A 4M9RA 4BMDA 4BNNA 3DZKA 3Q9SA 3PFKA 2ZE7A 4KXLA 4PYIA 5AK3A 4BO3A 1SKQA 4WGFA 5D6OA 5E6UB 4XDZA 3GZNB 3EVDA 1FUUA 2C9CA 4HAWA 2F1HA 4LVUA 4HP8A 4H77A 2FPOA 1BDBA 2HWUA 5I9NA 2RARA 2N0SA 2IP1A 5FPYA 1GCGA 1QTNA 4A0GA 4OGFA 3U4QA 1U28C 5JWOA 1WRBA 4H3VA 4UNIA 2A9OA 2F55A 1K08A 3DD5A 3FKQA 3SHWA 1N1DA 2QRKA 1UXHA 1L4YA 4MV8A 3NWBA 1Z6ZA 1ZZEA 1WOMA 2FPIA 1KEZA 2AXPA 2CNWD 2G40A 2JEYA 3NIFB 5DTQA 3JR7A 4HQ6A 3WJ7A 3RABA 5LA6F 4ANFA 1OZGA 2ERCA 1RLMA 1DI0A 3KXLA 4FUTA 1TZCA 4Q3OA 4ARSA 2GM9A 5LP6F 3OZEA 1FDIA 3S8MA 1ZGCA 1DL5A 2WMNB 4K26A 2IT1A 1E1QA 3O4GA 2R84A 3B8EA 2OO3A 4EG7A 4X65B 1R64A 4BMSA 1BDIA 1J06A 2COUA 3Q98A 2PUVA 5E4JA 4BTVA 1ZRSA 1EHYA 2PCLA 4KPFC 3DBOB 4LZOA 3JRXA 5ALSA 2QXUA 1G5FA 1NFRA 5CD9A 1DWQA 5DGIA 3VSBA 3VU8A 1I4DD 2WYUA 2A0UA 4JT8A 4QUJA 2AN5A 3GP8A 4QXQA 4ZAGA 3GVHA 5B3JA 5EKSA 2P79A 2XOEA 3MWGA 4EFNA 2PBZA 1K8QA 1ECLA 3MS7A 2X1HA 2JGMA 2OBFA 1RIIA 5SICE 1U3FA 1KXJA 4YMLA 3DOHA 3E8SA 4D9JA 3ROEA 4JLMA 4WADA 2PXHA 4LJAA 2ZKIA 1IHXA 4JV5B 5KU7A 2XUDA 1SHLA 3L0YA 2FP3A 2P2NA 3AFNA 1K27A 4OFBA 2F59A 2H16A 3WLOA 2ZITA 4YAJA 4EUSA 2Z0MA 3KETA 4FW9A 1E9CA 4F56A 1L7DA 1AGXA 1J0EA 1ANKA 2XSZD 3DXFA 4I9FA 1OLXB 1SWVA 5E9WA 3RJ5A 1GTJ1 4DC0A 5JS8A 2Q3JA 4A8JC 4AG5A 1R6VA 1FYVA 4CIDA 3NANA 4UASA 3EC7A 1QB7A 1VA4A 1EFHA 3BF8A 1ULHA 3F4KA 3GFOA 3IALA 3HEAA 1HE8B 1J56A 1UWCA 2QP3A 5TQJA 2C88A 2Q1XA 4RS4A 4PO1A 2GAFA 2Z6QA 1E9RA 2SECE 2Z3VA 2XT0A 4R1SA 3H3JA 4MKIA 4UEWA 4Z53A 5A9RA 3HMKA 3EVAA 1MO2A 1MPTA 1TUIA 3AWDA 3WGZA 5K01A 4BGDA 4R8VA 4E4RA 3J7AC 3MTEA 4I4TF 5KC9A 4AK9A 4RF4A 4YRNA 2FQWA 1BW9B 1GPAA 1ZS9A 1X7XA 2P2SA 3B2NA 1JJAA 3I58A 5TV2A 1IJFA 4RF5A 4EJSA 4EKEA 3FN4A 5DCLA 2JIPA 2PJUA 3O83A 1ZIXA 3JQGB 1GPKA 3E7DA 5DM60 2NXWA 2PT7A 5KO2A 1MGOA 5LLTA 1FQOA 2AXEA 2R5WA 1RYEA 2AMVA 2JBHA 3N2IA 4WXPA 3WQBA 2HT1A 3RROA 1WXGA 3QUBA 1VFNA 4UHFA 4F5ZA 3A4YA 4EI2A 1AMOA 1VPEA 1WUJS 1PCXA 3JQ6A 4II7A 2NQ8A 4EJ2A 1DQPA 2BE9A 4H60A 4X62B 2HT6A 3GUHA 4GPEA 3I64A 2R6DA 3H5IA 3NWPA 5CAEA 1E7WA 3PEYA 4IZHA 4UVDA 3KOOA 1Y34E 1QGED 2QN6A 1SPBS 3CNNA 5KJ1A 3HJTA 4NX2A 3R3JA 1J90A 1LPNA 1TQDA 1ESCA 1W0KD 2QTHA 2QZ4A 2Z4RA 1E4EA 3FAZA 1CERA 1JKXA 4P5EA 5PNTA 5EMLA 4C0HA 4C7MA 2AUMA 4KWEA 5BSWA 1I13A 2JASA 1KVRA 3CBQA 5GV8A 4ZO4A 1UH5A 1APBA 4WTOA 3OQHA 4NDNE 4QNNA 2BKVA 4Q4JB 1HLGA 3DUWA 2C8JA 4KVFA 4L0MA 4IV5A 1VDMA 2BF7A 3QUAA 1QHIA 2GJAA 4K9DA 4TTSA 2ACWA 1UMBB 1Q91A 2C5EA 4OHVA 4PZPA 4WKOA 1T9BA 1Q0HA 5CT4A 2IHUA 2BCGY 3KOYA 1UK6A 3AL2A 4PIMA 3LQKA 4TV9A 2CVFA 3BMNB 3DAHA 1V5GA 3DZCA 1YR3A 2YNMC 4ZCTA 3FBWA 1PEYA 2ZSAA 1V4BA 2CWDA 1X6VA 1ZM4A 3OCJA 4PU0A 1EFCA 2V54A 1DQNA 2YWBA 3WA6A 2GUGA 2PVSA 3T5PA 4RZXA 3I3OA 3GPBA 5KTRA 1TQ8A 3LT4A 3UXMA 4ENPA 3C3PA 3DBHB 4G09A 1U4SA 5C37A 3P1JA 1Y6ZA 3AF3A 2VZLA 2GPAA 1ZCFA 4Z7OB 2D2EA 1JT9A 2GN1A 2A4MA 1UDAA 5CIWA 1ST2A 4RY2A 1U3VA 3DT9A 3K0FA 4ZKEA 1JLLA 2YN4A 4KXMA 1ZNXA 1ZGGA 2BKEA 1CCWA 2E89A 2GXQA 4PG6A 3GF4A 4C5BA 1JHMA 1R8YA 2HRZA 1OYVA 1FFXB 1YQDA 1A5AB 1IATA 2FWMX 2HDNB 2WIFA 3R3XA 3EN0A 4NEHB 2OD7A 2AN4A 3ZTTA 3D2BA 3A7EA 1P1HA 3HN2A 4W63A 2AR0A 1EKXA 1ZIYA 3R9WA 5IYZF 2CXNA 5D6NA 3ILHA 4KI0A 4BNYA 5F2EA 3ODGA 3RTGA 4TKMA 5FI1B 4OOEA 3I73A 3LUPA 4R1UA 4RAOA 1F60A 5CVUA 3S3TA 2X5KO 4ILKA 2VDQB 4X3OA 4ZOEA 1OT3A 4QT0A 5FBQB 1L4HA 5IS2A 4AJHA 1WF6A 1E2KA 5JAOA 5DP1A 5LFAA 1U04A 3QMMA 4WK4B 4NDAA 4QU0A 3RG8A 1GSAA 1P7PA 4GZMA 3ZZNA 4EUNA 4EGAA 5FJIA 4K87A 4LCJA 1WU8A 2WZQA 4RD6A 2AFRA 4EARA 4FSDA 2BEUB 1J5XA 1SUIA 1T0HB 2H29A 2AVDA 1TVEA 1G42A 3DNPA 3PS9A 4RZ2A 5K0BA 5IVIA 1N2HA 1YMUA 4DVGA 5JROA 2JKVA 3JZDA 4TLBA 1OTYA 5AOVA 1K63A 5DK4A 5C7IO 2GN4A 4HG2A 1QH1A 1X1AA 4ID3A 4H7HA 4JZYA 4DA8A 1C4WA 3WFIA 2X6QA 2QX9A 1KF0A 3AY0A 1YRYE 2AG8A 2DHCA 2ZUSA 3GDFA 4FFSA 4D9CA 4UTPA 1ISRA 3DLPX 3JSAA 4IJMA 4O6VA 1LEHA 1BU5A 3RFXA 4IDFA 1H69A 4MWGA 3REQB 4QYIA 2FMUA 3U3MA 3BWYA 3TBFA 3AW8A 3F6PA 2FPRA 3HM2A 1H6BA 4HCJA 4JLWA 5ALIA 2XITA 2C58A 4M7WA 1VHQA 1QIIA 1SG9A 2GILA 2VTKA 1WXFA 5EKTA 5F35A 1IUNA 2V3VA 5JQGF 2FAXA 2HJ9A 1DIBA 1RRFA 1CUHA 1R9NA 1T43A 1R0WA 1WVMA 4H6PA 3W5CA 1XRLA 3R3HA 2QTMA 1X70A 2NTYC 1SD5A 2HYDA 2WWIA 1V1JA 1OE0A 4EGFA 4CM4B 4J0JA 3V1LA 4RO0A 3PFHA 3O4IA 3RYFA 5FLKA 4YV2A 2BSXA 3IDOA 4B46A 2JG3A 1N5OX 2AFIB 3JQ9A 2I2DA 4AN4A 2ZSJA 4OA5A 5GIOE 2OV4A 2VC2B 2C9BA 3E2PA 5BY2A 1Z2NX 3FOZA 1KVQA 1Q1AA 1N77A 2FFHA 1EFPA 1ULBA 4FD2A 1QHXA 1OB5A 5D7BA 5BWLA 2CLLB 2G82A 2V9PA 4JBGA 1KORA 2X5OA 3ZCRA 1RIFA 1FYXA 1G6OA 4AJOA 1T2NA 4H18A 2Q2QA 4F5YA 2I80A 4M6WA 1ZNWA 1I6WA 4BO2A 5TF4A 2R97A 1Y4DE 1YC2A 1AUXA 3MA0A 2EFYA 4JR0A 4QDKA 5BRJA 5HK9A 4N76A 2PL5A 2N46A 1G8AA 4C7XA 1CZLA 2VJOA 1R6AA 1DBPA 1K8RA 1EIZA 1Y8AA 2A7XA 2DYKA 2CFSA 3AKEA 1FX1A 3P2MA 1C1XA 4MINA 1SCKA 2YCBA 5IT9A 2FGKA 1EAYA 4CODB 4P53A 2Z30A 1OVGA 3UJAA 3WTBA 4QDZA 4IMPA 4YQYA 4ZVTA 1SZDA 1ISSA 1JP7A 1U2GC 1XEXA 2YRXA 3P0FA 5T6BA 4KE9A 2DPHA 2PN1A 3EYWA 3V8RA 3KTOA 4BVLA 3C1AA 4K6CA 4K88A 5DTMA 2WG1A 3CURA 1F48A 3UA4A 1ZM2A 1C4XA 1C4OA 2NU8B 1J1UA 4F72A 1JU4A 3AIIA 4UDOA 4CMAA 3RS0A 2IV2X 1V8BA 2AI2A 5IU6A 1NYTA 2QYTA 2RJOA 3OH8A 5BV7A 2Z2JA 3A6HA 3SKVA 1U0TA 5G0SA 4DKXA 4YRSA 1ID8A 5SZHB 1VRCA 1SQ6A 4ER6A 4LRUA 1AH2A 1CHNA 2HHJA 2BEVB 1KYVA 3GGDA 2J4FA 3H11B 4YCSA 1KRXA 3QFSA 3GA5A 4MCAA 3P27A 4OGLA 3QPVA 4TT8A 1XZLA 5CBPB 2VDJA 3ONDA 2OFXA 2HW8A 3C16C 3C6KA 4B82A 4NATA 3P8ZA 3DXZA 4H7PA 4B6JA 3JD1A 2GI4A 4M0DA 2ODBA 5TQ2B 2XNHA 4OJQA 2CXHA 1ZUNB 1Z0FA 1ISGA 3J81k 3H0CA 3PLRA 3PPXA 3WL3A 1VLLA 2IYZA 2ZI7A 3R0JA 3GK3A 3ANNA 4MZDA 3IAEA 1NVTA 5L51A 2R68A 3H2JA 1FTSA 2DPGA 3C6BA 4HLNA 5ARDA 3TFQA 2E37A 1I4TD 2EL9A 4ZXFA 5KKNB 2MIIA 1CZNA 1JLSA 2OESA 1YWGO 1PZHA 3BG5A 1H8HA 4NZOA 3LPDA 3WYFA 4DMKA 1IWOA 1CE8A 1GPLA 2VUIB 3GCZA 4GZ3A 3F90A 3I0NA 5AO9A 3UXYA 4AY4A 1N5DA 1NUTA 4BKUA 3CF4A 1XZNA 2XQGA 3BRCA 1T2CA 2Q1YA 3PC6A 3RAJA 3OHMA 2HBYA 2WKWA 4HXYA 1FXWF 1Z4PX 1AHIA 1Z8FA 3LLVA 3QMPA 4H16A 3OIYA 4HY3A 4RY8A 2PM8A 3UUEA 5AVZA 1K7CA 3ANTA 1MF7A 1QHYA 4QPJC 1JN0A 3OZTA 2C5FA 3EMDA 3AJEA 4LNUA 4H9GA 2VYND 2JBAA 2GEVA 3GZTB 5EUQB 3JQBA 5ALYA 3JAKA 2Z58A 4Z4EA 1AG9A 5CYPA 3EEOA 3NM5A 4QARA 1DGQA 1G1MA 1OBVA 2J09A 2QPOA 4XTRA 4FHFA 3FD8A 3S99A 4EO7A 2L18A 4ZOLA 2IX9A 4LFBB 3FDXA 3PUWA 4ALMA 2P68A 2WSYB 2HDOA 1QFZA 5HDBB 2C78A 4Y2SA 2R1ZA 4BIIA 3ZEIA 2WD9A 4B3MB 3OPYA 3VA7A 1J2JA 1Z83A 4TS3A 4EF4A 4ZVKA 2EFHB 2FRDA 4PCLA 2AEJA 4HEA6 3V4VB 4XCVA 4QT4A 3O1JC 1JIQA 3IDZA 4Q1VA 1K8ZB 3UW1A 2HOQA 1C0LA 2OHFA 3FWNA 4J7UA 4IVRA 4XM2A 1L4EA 4ZVSA 3RC9A 4HB4A 3GUUA 3I2GA 3LNCA 3TRKA 4EVQA 1E2BA 1FTQA 4FNOA 4PXSA 3E22A 2VHVA 2EW1A 4TVSA 1E6MA 5FWXB 2CWWA 3BGIA 3OHSX 4PNHA 4X0EA 1BN6A 3T9EA 5A1TA 1XRPA 3QXGA 3SJ7A 5JCJD 1H2BA 1V5IA 2CLEB 2JH8A 3ACDA 1UZNA 2XEXA 2ZYUX 2JBAB 2QYHA 3SF8B 3RFTA 1XTIA 3N5KA 4HX2A 3OZRA 1X7DA 1NRWA 3AMVA 4C2AA 1C7JA 5HRAA 3BE4A 4G5FA 4KMMA 4FEAA 3IESA 1EJ6A 1M2KA 1BE1A 5EMHA 3WJAA 2AG6A 3P2IA 1FP4B 1LDYA 3H6KA 4QTUB 3ZY2A 1NQXA 4PN7A 1OLXA 3OCCA 2C8VA 3CX4A 1A9ZA 1JKIA 1KPGA 1TEXA 2OECA 2SHKA 1WUKS 2W5UA 3S70A 4TPKA 4YPFA 1H42A 5DLYA 3VSDA 5JDCC 3MHTA 1JB1A 4I4NA 5LP6C 5I7FA 3P26A 2AZMA 3QUSA 5F77A 3B5JA 3CX8A 5JJBA 2J0QA 4JITA 4G1CA 4CL8A 4FMDF 4DIDA 2QRZA 1C3EA 1RQ2A 2AOTA 2VZ9A 4NCXA 3TNDA 1ZWKA 3GX1A 2BEVA 3M9WA 2P9QA 3M1LA 4MCHA 3STHA 4RVSA 4XM1A 4LGCA 1W0JD 4M0CA 4RHFA 2J3EA 4KGXA 4W9NC 1N1EA 3FMFA 1OC2A 4QHSA 5JXGA 5KSWB 5EIXA 4QOJA 3ENZA 4DNXA 1PD0A 5FBHA 1X8KA 4RDCA 1NF9A 3HCAA 1HX7A 5EXPA 4LDQA 2VBCA 1JXMA 1S96A 1XBTA 4M1EA 1XXLA 4JVNA 3E15A 4G23A 3WE7A 4LNHA 3LP8A 3AVTA 1DAPA 5AI6A 1DMRA 4JCOA 3DOUA 1KU6A 4G2NA 2PR2A 4GC9A 3D0RA 5H80A 1IE3A 3H8SA 2HFKA 1XHLA 1RJEA 2J0UA 1QAQA 2BGJA 1O94A 1M73E 1JZTA 2ID9A 3IX7A 4G1EB 4F4JA 4BLWA 3LKDA 5BWNA 1D6SA 8GPBA 4ZT5A 3CW8X 3EWSA 1DIGA 1GNSA 5G4KA 1E6UA 3ESYA 3WLPA 3U19A 3WAKA 3QVOA 3NW9A 5B36A 1AJEA 3EGXA 2YWRA 4Z51A 2EAUA 1VBNA 2Q5CA 4RZIA 1D0IA 4GPBA 4OHCA 1COWA 4C05A 1I30A 3KPWA 4IHJA 1KO5A 1N3LA 4RJIA 4JLUA 2JLAA 3L0DA 3T3MB 4BC1A 5BR1A 4YO8A 4F5EA 2JGKA 4JOCA 4KXNA 2Q3BA 2ZTHA 1AMUA 2FMXA 1M2VB 3O90A 1N5KA 4YFVA 2HU8A 3TLEA 4IYRA 2ZBFA 4FGLA 3CMMA 4GECA 5JXJA 2R8XA 1EWVA 1IWPB 5KKAA 4INJA 5EXEA 4XX0A 3IBSA 3T9AA 2HCFA 1QBKC 4R2LA 1NMYA 2XUAA 1Z4LA 1EAMA 3VYSB 5K0ZA 2K2QB 1RJ9B 4QDJA 2JHFA 5KYUA 1MC1A 3RJZA 3FCUB 1MX5A 3S44A 4PN3A 2CXOA 5ITSA 2IZ6A 1QHNA 2A35A 2AWNA 2IA5A 3LK6A 3E1GA 4DLBA 5LDDC 3PNBA 3O4RA 2CL0X 1GTL1 4EH1A 4O4JF 2EFDB 3JVEA 3TE7A 2I3DA 1X8JA 3QP9A 4C4OA 4KX3A 4TV9F 1YQUA 3GR6A 3D2CA 2HF9A 3M5PA 4ND8A 2V4ZA 3OQIB 4Y6GB 4WOPA 5CX1B 1CQJA 121PA 1W25A 1WNFA 3W9BA 1VKJA 5HUJA 2J0SA 4DB4A 4OQLA 4HOYA 4LHXA 4Z5XA 5F2KA 2FN9A 4FR2A 2X2EA 3UB3A 1ECFA 2X2PA