2ZKGA

Crystal structure of unliganded sra domain of mouse np95
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
201
structure length
190
Chain Sequence
b'TECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of hemi-methylated DNA by the SRA protein UHRF1 by a base-flipping mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 62
structure length 190
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 2zkgA00
4PW5A 2ZKDA 3F8JB 2ZO1B 3FDEA 3CLZA 3BI7A 2ZKGA 2ZKFA 2ZKEA 3F8IA 2ZO0B 2ZO2B 4PW6A 3OLNA 2PB7A 3DWHA 4PW7A 4NJ5A
chains in the Genus database with same CATH superfamily
4F0PA 4F0QA 4PW5A 4RZLA 2ZKDA 4YGIA 3F8JB 2ZO1B 3Q0BX 3Q0CA 3FDEA 3CLZA 3BI7A 2ZKGA 2ZKFA 2ZKEA 3F8IA 3Q0DA 2ZO0B 4R28A 2ZO2B 3Q0FA 4PW6A 3OLNA 2PB7A 3DWHA 4OC8A 4PW7A 4NJ5A
chains in the Genus database with same CATH topology
4PW5A 2ZKDA 3F8JB 2ZO1B 3FDEA 3CLZA 3BI7A 2ZKGA 2ZKFA 2ZKEA 3F8IA 2ZO0B 2ZO2B 4PW6A 3OLNA 2PB7A 3DWHA 4PW7A 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PW5 A;  2ZKD A;  3F8J B;  2ZO1 B;  3FDE A;  3CLZ A;  3BI7 A;  2ZKG A;  2ZKF A;  2ZKE A;  3F8I A;  2ZO0 B;  2ZO2 B;  4PW6 A;  3OLN A;  2PB7 A;  3DWH A;  4PW7 A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 4F0P A;  4F0Q A;  4PW5 A;  4RZL A;  2ZKD A;  4YGI A;  3F8J B;  2ZO1 B;  3Q0B X;  3Q0C A;  3FDE A;  3CLZ A;  3BI7 A;  2ZKG A;  2ZKF A;  2ZKE A;  3F8I A;  3Q0D A;  2ZO0 B;  4R28 A;  2ZO2 B;  3Q0F A;  4PW6 A;  3OLN A;  2PB7 A;  3DWH A;  4OC8 A;  4PW7 A;  4NJ5 A; 
#chains in the Genus database with same CATH homology
 4PW5 A;  2ZKD A;  3F8J B;  2ZO1 B;  3FDE A;  3CLZ A;  3BI7 A;  2ZKG A;  2ZKF A;  2ZKE A;  3F8I A;  2ZO0 B;  2ZO2 B;  4PW6 A;  3OLN A;  2PB7 A;  3DWH A;  4PW7 A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...