2ZKWA

Crystal structure of human cu-zn superoxide dismutase mutant g85r in space group p21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
149
Chain Sequence
TKAVCVLKGDGPVQGIINFEQSNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of human Cu-Zn superoxide dismutase mutant G85R in space group P21
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 38
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zkwA00
2VR7A 1TO4A 4A7GF 1RK7A 2R27A 3KH4A 2AQPA 2Z7ZA 4L05A 2SODB 4OH2A 1PTZA 1SXBA 3KM2A 2XJLA 1BZOA 3KM1A 3HOGA 2C9SA 2V0AA 2Z7WA 1OZUA 1YAIA 3QQDA 3F7LA 1Z9PA 2WZ5A 1S4IA 4A7VA 2AEOA 1SDAB 2WWNA 1L3NA 3RE0A 1P1VA 5KBKA 1SXAA 1PZSA 2XJKA 3CE1A 1E9QB 1E9OA 2WZ6A 2JLPA 3GZQA 2AQQA 1Z9NA 1SXNA 2LU5A 2AQRA 2E47A 3GTVA 5KBMA 5KBLA 1XTLA 2Z7UA 3CQPA 2WYTA 2GBUA 4U4IA 3S0PA 2ZKXA 1B4LA 1OALA 1EQWA 3HFFA 1CBJA 1TO5A 3H2QA 2WWOA 2NNXA 1DSWA 1Q0EA 2E46A 4N3UA 1YSOA 1E9PB 1JK9A 1SXZA 4MCMA 1F1AA 1SOSA 4BCZA 1FUNA 1N19A 1XTMA 3GTTA 3GZPA 4A7UA 1IBFA 2JCWA 1SDYA 2AF2A 1UXMA 2GBTA 1EJ8A 1SPDA 4BD4A 1KMGA 4N3TA 1IB5A 1OEZW 3QQDB 1COBA 2WKOA 1F1DA 3KH3A 3SODB 1HL4A 2C9VA 2K4WA 1ESOA 3ECWA 3KBFA 5CU9A 1JK9B 4OJAA 2ZKYA 3F7KA 1N18A 1E9OB 3ECVA 2WZ0A 1CB4A 1PU0A 2VR6A 3LTVA 1UXLA 2APSA 3GZOA 4B3EA 2AQTA 3H2PA 3MKGA 4A7GA 2Q2LA 2VR8A 2C9UA 2ZOWA 4FF9A 3PU7A 1IBHA 1OAJA 1U3NA 4A7SA 1SXSA 3MNDA 2GBVA 1E9QA 1XSOA 3ECUA 1SXCA 1HL5A 1OZTG 3T5WA 4BCYA 4MCNA 1B4TA 1F18A 2AQNA 1BA9A 1JCVA 3KBEA 1MFMA 2ZKWA 1IBDA 2WKOF 2AQSA 1SRDA 3L9YA 1AZVA 1QUPA 3CQQA 3GQFA 2WYZA 2Z7YA 3HW7A 1F1GA 4A7TA 3L9EA 1DO5A 3K91A 1IBBA 1YAZA 4A7QA 1E9PA
chains in the Genus database with same CATH superfamily
2CHZA 4GH7B 3GKZA 2GTZA 2WLZA 3PL6B 2EDXA 3SDCA 2OJZH 3K6SA 1XWVA 3FL7A 4IBSA 1JDAA 1K3IA 1NGYA 4F24A 1G6RB 2V0AA 4KKLC 5HDBB 5D6DA 2XACC 5F6IB 3NCEB 3QO0A 1J0IA 1AXIB 1CQYA 3TJPA 3D33A 3J7HA 4PY7A 4W9ZA 4E9XA 4NCDA 4AJVA 5CCJA 4XCCH 1NANH 3GSVA 3L08A 4E2OA 3QUGA 2YA2A 3VNYA 4G3YL 4BSVA 3NYKA 1OWRM 4GY4A 1U8LB 3DX2A 4LCWD 1MVUA 1E3ZA 7FABH 2IPKA 3ALXA 4Z7NF 5DQDL 4R2GB 4IMKA 4M1CC 4OJEH 4HDIB 2NYZA 1J11A 4XMVA 5LQBL 2X3CA 1MCQA 1JPFB 2DMCA 2OI9B 4RZCB 5JNYB 1TMCB 2VJ0A 4CMMA 4PG2C 4DK3A 5EOCL 4KK5C 4YC2B 2BHYA 5T1LA 2ZAGA 4PJIA 3VRLF 1RZPA 3LH8A 3MNMA 5GHWH 5GIRB 1AG6A 3W5NA 2GFBB 5D1XD 2F53D 4LLQB 1A6AA 2ICEB 2NX5E 2OMZB 3PAVA 3MRRB 2BVEA 3S35X 4R7NB 4F57H 2ED9A 1CPUA 1EO8H 3WFBH 3GPSA 4XB8A 3GMLB 4PJ5B 4GW1B 1TQTA 5FF6B 1XX9C 2UVFA 5C08E 4GI8A 4DN4L 4IM8A 2JMRA 3CMOH 5KG9A 1HQRA 1XH0A 2IEPA 3WFEH 5IVZB 4JMNA 5KYXB 4LSVH 3N06B 4X99B 4F9LC 3IBEA 1GGIL 1T0NB 3FQXA 2NTSP 3LS4H 4N2FA 3HC4L 3K4ZA 4OKVA 1D5XB 4PJIF 1CGSL 1QD0A 4AQEA 4TLTA 1KLFA 4AVIA 1JG9A 3E6FB 5AW5B 4OSUH 1E8XA 4XVOA 3LEXA 1K8IB 1HL5A 4OI8A 1JVOA 1HYSD 3WNMA 1TPXB 1FLTX 4N2GA 5K39B 3ZDXB 1OCWL 5DJXB 5JW4N 4Z76A 4F15B 1DVFC 1CURA 2LGNA 3T3ME 4ZUUA 5CNHA 1SVCP 1JN6A 1P0SE 1RZJH 2WXRA 2D9QB 3A67L 3AWFA 2IG2H 2A3TA 5DDHB 5CEZL 1MRDH 2B0SL 1FVEA 3W57A 2YBRA 1ACYL 2CMRL 3MNZA 2NW3A 2VLRA 1JV5A 2R1YB 3DNKA 4X50A 4XN9A 3CJJA 3EO0A 3TBWA 2YXWA 4PJDA 3HMXL 1E2WA 1ZXQA 2XNAB 1I4FB 5FA4A 5IFHL 3QIBB 2N59A 3RY4A 1MAMH 1RU9L 2ZG3A 2N3JA 1K72A 3U4AA 2Q7AA 1DVQA 3GSNA 1MCOH 3QORD 3VB8A 5I75C 4JM2F 1SUHA 1HCVA 4UT6A 3VD7A 4DKAA 2M8XA 1AKJD 2AZAA 1SDAB 1FBIL 3T6XA 1KN4L 1FPTL 1AS6A 1MCJA 4DEPB 2Z93A 3Q01A 1QWUA 1PZAA 1IL1B 4AXWA 4IDJH 4LCCC 1OGPA 4QAWA 3WGVB 1IM3B 3FB5A 1XDTT 3MRMB 5L2KB 5GGQH 1RULL 1DO6A 3L45A 3SCMB 2WUCL 2OCFD 1EGJA 4PJDF 1WYJA 2MEJB 1M1XA 2DICA 3IXAB 2GI0A 3RUGA 3WTTA 3P40A 2YD1A 1BVLB 3ILQD 3RNKA 8CGTA 5FYKH 1ZTXH 5E5MA 3VGEA 4AEIL 2DEYX 5HI5D 4OLXH 4Z7UB 4IU3A 5I0DA 2ZWSA 2BSRB 2NR6C 3ARBD 4KAQL 4X9HA 1YSOA 2OXHB 5C92A 2EUXA 2AQ2A 3GSQB 1VPOH 2X2JA 4KV5F 4NRYA 5F70A 3S3SA 1EZLA 4PWEA 3TV8A 4LLVA 5DVPA 4AI7A 4PB9L 5H94B 3LKPB 5D96B 3HZ3A 3NEOA 4NO2B 1XR8A 3WTWA 1A7PL 4KX9A 4G1MA 3AZUA 3BQVA 1TSRA 3WV0A 4PRDB 2DWEB 3Q44A 4N0UA 1BJMA 4AL8L 4Y0GA 3DHMA 2ETWA 2NY7L 4WHYG 4ZZFA 4KI5C 4OFPA 3ZZ1A 4IGBA 1QOKA 4R5TA 3WXVH 4POZD 4J7RA 3RUGF 2ZCLH 3GS7A 3MNVA 3MXWH 1MUJA 3QUYC 4XP9H 2QVTA 4QY8A 5BZWA 4DPRA 4Y16C 3SO3B 4NOBA 1U3NA 1MFDL 1F4XL 3PPEA 5D7JB 4BE6A 5ACMA 2A9BA 6FABL 4TNVF 1M6OB 1ZY9A 5K9JL 3ZUCA 3DGDA 1NCIA 3X1NA 4NZUH 3G9VA 4D94A 4Q9CA 4NP9A 5BV7B 1NC2D 3P0YH 2X9XA 3LKOB 3QDAA 2ZUWA 2CO7A 5HGHA 4JM0A 2CM6A 5T5FA 2X4OA 4PR5A 3F7VA 3V5DA 2B5IC 5CJ5A 3FTUA 1B9ZA 4L8CA 1FFOB 3EDDA 3B9KD 4HFWB 1TJGL 3EUDA 3GYRA 4MNQB 2PYEA 4Q56A 3SDDD 1KZYA 2DS4A 3ARFC 2PTUA 5KS9A 3BLPX 1NBZB 3MLXL 2B1AH 3OSVA 4HHWA 4KMTH 4M7KH 4MJ6A 5BCAA 1HILA 2X4SB 5LBSH 4P5KA 4Y9FA 1NLDH 4XNZB 1VERA 4I18C 2YAQA 3DURB 4L05A 4XVSH 4WWOA 1QZNA 4QO1A 3WFHB 4N6RB 3BKJL 4PV9A 2QQKH 1I9EA 4O9HL 1FZKB 1G4MA 4UMSA 5E5LA 2R0WL 4ENED 1KBBA 3FT3A 1E28A 3BO8A 3CTTA 4RA3A 1P1VA 4UB0L 4N0YH 1M2VA 1UH3A 3LQMA 1G5GA 3FAWA 3GLZA 4ZD3L 5E0FA 5BZDB 4W4OC 1G9NL 1OO2A 2AQRA 4N0CC 2ZXGA 3GIVA 3KPLB 1OKEA 2J5LB 4FQXC 4PJHA 5KS9F 3K71B 2C7FA 2X89D 3WFDH 1BM3L 2ADJA 3FRUB 3CLWA 2W81C 2CPCA 2VLLA 5JQHC 4HKZA 4WW2C 2NY3D 4AGLA 1EQWA 4XCEB 5EDSA 4XX1E 5KYUA 1I1CA 4DGWC 3UYPB 5CFAA 1CTMA 1J0HA 5I5JA 2QLVB 5FEBA 1IBGL 2HG5A 4PCKA 3Q5OA 3WFCL 2XFXA 2KH2B 3LS5L 3ULVE 4ZNEA 1QLRB 2DIAA 3Q2CA 2B3RA 1KPUA 5CN1A 4ZOCA 1U58B 1NFIA 3TZVD 1EZSA 5ESVA 3ZDYF 3Q1EA 1S9XA 4X98B 3NJHA 1II4E 1GMIA 2AV1A 4K3EH 4LPWA 4KK8D 4YIQA 1BG1A 3N42F 4Z6AT 1P9MA 5I73B 1A9EA 4G7VL 4J8RB 2BSDA 5I5MA 4WHCA 4Y19D 5K9QG 2CHNA 3DOSA 3DX6A 2OMBA 1WK0A 3DX9B 1A5FH 1L0YA 1YEFH 3SGJA 4LAQH 1ZHNB 3EBGA 1XCTA 5DZJA 4BHUA 4FGMA 3H85A 4NQUA 3U2IA 2EVHA 4GUPA 3O2VH 5H8DA 3VXRB 1IQDA 4U3CA 1H5BA 2X4RA 3OLIA 4ZXBB 5I66B 2EDLA 4X9IA 2H2SC 3REVA 3NSYA 3MOQA 4S10A 3CZEA 1X4YA 4JL2A 4PRBB 4TNFA 4XVUC 3MRCA 2QADD 1UH2A 1V3KA 4L9LB 4XCNB 3POCA 3CK0L 5F3HB 4Z5RB 5BUAA 1ICTA 1CGVA 3KJ4C 4L4TA 4Y4KC 1L4IA 4NN6C 1N64L 2J43A 1RIVH 4J3TA 3U4KA 1SJHA 3L9YA 4XBEL 1FGVH 3EUUA 4N8CL 3WKPA 4XMTA 5LKNA 3MLRL 1H3GA 4V2BA 4PWKA 4MQXC 3UEZA 1ETA1 4D0BB 3VYNA 2XTJC 3ZE0B 4DOHB 1IGCH 1KGCE 2YPLA 4B27A 4CMHC 1ID5I 2ADGB 5EV7A 2EYRA 4J6RL 1HNGA 1Y0LA 5I1KH 3HG2A 3M8OH 4XNUH 1PYWA 3KR3H 3BGMB 3QQ3B 2RACA 2MCPH 3T1FB 4UUJA 2NNFA 3D0LA 1K4CA 4UQ3B 5IHHA 5CMAB 2AQ3A 5FV2A 4KRPD 1ITCA 3TEUA 3IN0A 2DRUA 4WI8A 1AACA 2IH1B 5D2LA 3D9AH 2XIBA 1U8PB 1UFGA 3FJTA 3ZSTA 5KBDA 2XQYA 3RNQB 4YXLL 4HUCA 3DIVA 1J18A 2OXGB 5B1JA 1WV7T 4P3WA 3ZE2B 3HG1D 4Y1AE 1DDTA 4GRWB 1AP2A 2AEIT 3G9AB 1N4XL 2UUDH 3HFFA 2DQFB 1UZ6F 4R84A 5ID1B 5BVPH 2VSMB 2D4DA 2VDML 3WS3B 1DJGA 3BPCA 4YHMH 5D5MB 3JWNE 1J8HA 2FLMA 4WFHE 3VM5A 1HS6A 1TJMA 2WJ7A 3ETTA 5LGHH 3X3GH 3EGXB 5IR1B 3ARWA 4OF8A 4AT6B 4NWTL 5MHSD 32C2B 5D2LF 2R2BB 4P2RB 3IT8D 5DUBA 1EFXD 5DRXB 4HEPA 3FU8A 2OPCA 5HJDA 1T66D 3ROOA 1WC7A 5IJDC 1YO4A 2FJFA 2BP0B 2HVJB 3IWVA 4NM4H 3BQUA 4TV3A 4K7PL 1IGTB 4OGXL 5T33L 1OE1A 1WF5A 3JV5A 2CJTA 5IW6A 2DQ6A 5G4OA 4UDTA 2M2DA 4EUPG 2NNRA 4NAQA 1NCBL 5GSVB 4WI3A 1EHXA 3DHJA 2VUKA 1J5IA 5KSVA 1TQVA 3HI6H 1THAA 2L8AA 1AHWC 1FIGH 4GSRA 4GXVH 3F85A 4PBDA 3S3CB 4GW4B 4AIZA 3AM8A 1N5AB 3KPSD 5I24A 1W91A 3NUKA 5G55A 2YEVB 1WAAE 4KVNH 3M1CA 2FSDA 3TA3B 3L3OA 3QUKA 4EDXA 5LGYA 3BSZA 5DUPH 4ISVB 3NACL 2BOCA 1KTBA 3Q8FA 5J57B 3QJQB 4M5YL 2MH4A 4CKQA 5J1SC 1RUAH 2QMKA 2H9GA 5CZRA 3OZLA 2APXA 1FAKT 4GKOA 4LF3A 1RK7A 4EEEA 5EOCJ 5CAYB 4WV1A 4WTZG 2ZCZA 2GG1A 1AD0B 2NXYB 4AQ1C 5KW9L 5EU6E 1UFUA 4L5FH 2LABA 3HNVL 1I1AD 3I02B 3IFOB 4WEBH 4D9RE 5IQ7H 3MLTB 4ZMZA 3ZDZB 4MMYA 4CL7A 1OSZA 3F84A 4YE4L 2XKNA 4P5MA 2DQGL 3LRLA 1YNTA 2EIMB 5B7MA 1K3ZA 5D70L 5KSBA 5HHVL 2EE3A 3VGFA 2P8LB 1LEIA 5E08H 5DD6B 3IDNA 2R1XA 1IT9L 3PWNA 4H8WH 1GC1L 3EW3B 3US0A 4MZ2A 3IDGB 1X5JA 3HE6A 3ZE1E 2APVA 1XEDA 1WJ3A 4NJ9H 3W0WA 4HUKB 3FONB 2VQ1A 5J8OA 5I74B 3OKDA 3TYFA 5BO1H 4QRTB 2WXQA 5I17B 3GSUB 2Y2TA 3C9NB 4GAGH 4HIIA 4M4PA 4IDLA 4YX2H 3QDHA 5BOPA 4ZS6C 3GUTB 3IMWA 2FX9L 2P24A 5DK2A 1JGEA 2J6WA 4QF1A 2EIBA 4K2UL 1YNTF 2OS7A 4M9PA 5E2UH 4L1BA 5LDSA 2VDPL 2QDWA 5KSBF 2UY7A 3FFCD 1BZ8A 5KUMA 1SFDA 1NEZB 5I30L 4HS6B 3OKEB 4EXKA 2GBAA 4DIXA 1RFDL 2PPFA 5J1AA 2D73A 2K4WA 2WGNB 2AANA 1ZGLA 3JV6A 1IEAB 2I69A 4B9FA 1UWXH 1LE9B 1GY1A 1E5AA 3QFJE 1T0MA 3GO1L 2Y36L 4JB9L 2ICWB 4LIQL 4P4KA 1JOIA 4WY7H 3HLAB 2VKXA 1GOHA 2YARA 5T3ZL 5IVNA 5ADOL 4CADA 2E86A 1EAOA 1W6LA 2ZP8A 1QFHA 4GQZA 1RZKL 3OAWA 4MS8D 2KMWA 5AKRA 5D1QA 4F7MB 2CLRB 4UNUA 4A37A 3L4ZA 5HPMB 3BIKA 1M7XA 4I48A 4K9EH 5T3XH 1HAWA 4JFQA 3ZHKA 2AABH 1CFQA 2C9AA 5JIHA 2GSIA 3K6NA 4LMQE 4XZUA 5J13B 1P1ZA 1QFOA 2Z64C 3GINA 3KNBB 4FX5A 1FSKB 5DYOB 3FMGL 4O51B 4KPHL 4H1LA 3BWSA 3W39B 3D6GA 1ZA6A 2G4GA 4X0NA 3V4PA 3PXJA 1HWGB 4K0OA 1KCSH 2FGZA 4DESA 4GBXC 5ETUB 3EGSB 5I1CL 3JWDC 3ZVVA 1J7VR 3RLSA 2QL1A 4X83A 4XI5C 5SWQB 3BZFA 1K85A 4AENA 3RHWF 3HG4A 3U46B 5L88H 3VI4A 3FW6A 4PYHA 5GPRA 1MZZA 3EFFA 2EEAA 3X11B 4LGSB 4I3SL 1E43A 4XOCA 3F6JA 3QNXB 2PXYC 1YUHB 2N1TE 4ONGL 4P2QD 4PIBA 2EUWA 1PJWA 3GBLA 1P4IH 4Z8FH 1E27A 5HHMD 4X9YA 2OKMA 2WVVB 5E1IA 4MJ4A 4PU2A 4KK6D 1PF3A 3BPLB 2FO4A 1MCPH 1BP3B 4NZ8A 2HTKD 5DHVA 1E5ZA 4PRAA 1LMIA 1RPUA 3X12B 1J12A 1HIML 4XWOC 5I6MA 5JORB 2EDOA 1PGRB 4OLZH 1YN7B 4WSJA 5MP6H 5HJ3A 3LPGA 2AK1L 2Y0SA 5TFSH 1KJMB 3QDJA 3DTXA 5I71B 1I7ZA 1NCWH 1UOWA 2CH8A 2XV6B 1TUPA 1KBGL 5IBLD 3NCFB 3VI4F 4MZRA 3MA9H 4PJXE 1YMMB 4QXTA 2VRAA 3OC8A 3HI1A 1MFCH 3K5SA 1IM9A 1MXGA 2B3IA 2C3XA 2Y06H 3EOYG 4H25B 2J8UB 4N6QA 2AF2A 5HHPB 2GBTA 5TQ0H 5BVJB 3WNKA 4NQDA 3V0WL 4C58B 3EXLA 1OAKH 2NY0C 3M07A 5E95B 2FB4H 1J9RA 3AMKA 1S5IL 3WEAA 4DETA 2UXFA 4YWGL 4ZI8A 3HPLA 4LFHD 3LEYH 3SGKC 5T5FH 5KBPA 3BZEB 1AI1L 1R1CA 3A6BL 2EEBA 4JCMA 3AQDA 4NQEB 3LV3B 3QWOB 4J3OD 2Q76B 3TXAA 2DI8A 3M1BA 4JPSA 5IEKA 5HVFB 4HZLA 3OJMB 4KJWD 1KT2B 1M57B 1CG9B 1OT2A 3QR0A 4IRZA 4MNGA 1CLCA 2R0ZH 1PLCA 2JCCE 4KDTC 2IWEA 4J6IA 1MCBA 9CGTA 2I07B 4QHNA 1PG7X 1GGTA 1OF2A 2YGVA 4PJAE 1OP5H 5CGTA 3G5WA 2F5AH 2HN7A 1UZGA 2WXGA 3VFWB 4XMLH 3HR5B 1MF2L 2EH7L 4WI7A 1OVZA 3TV3H 3QI9D 4V1DB 5H4ZA 1NOAA 1QBMH 4EN2A 3ET9F 3U7YH 3CH1A 2JJSA 2JKIS 2X1WL 5EZJB 3UADA 3ARRA 4M56A 3CFMA 4NQQA 2FLBT 2W91A 2YFOA 5C09B 3VH8A 3WKMH 2FSEB 4J4PD 4F80A 1FH5H 4AGPA 1IGML 5J0BA 3MYJB 4OIIL 5DF0A 1C5DA 3DJTA 4N5ED 2X6BA 4RNRB 1IRAY 3FUMA 4DGIL 3PCYA 1UUNA 4QOKD 4QXUH 1CL7L 2H7WA 2XWBB 1EXUB 2XOTA 2R27A 1YA5A 1V3MA 1F58H 1O7DC 2FQFA 5GRYA 5EDXA 3QDGE 1BQUA 5ICZB 3ZT6A 3NZSA 1S7TB 5A2JH 1HSAA 3QUMA 3CFBB 3O4LE 4JRXD 4FP8H 1T2QL 3IM1A 4IHOA 4DTGH 1D7DA 1FRGH 3DXAA 2CUIA 3BKYH 4FEIA 3QR1A 2DYSB 5C0AE 2ALWA 2NY4B 5EMYA 3MCLH 3WNNA 43C9A 2P5WB 3NJIA 5D7IE 3VFTA 2A83A 2E6QA 1AYRA 25C8H 2QHRH 3VDAA 1ONQA 1ZSDA 3H56A 4GO8A 4H0LC 1DJIA 1YPZF 4KHTL 3WDHA 4ELDA 4GG6A 2FQGA 5EBLB 5CN3A 4WSGA 2JFCA 1ZGLP 2DF3A 1A4KB 5GGVY 1R75A 4WUUE 1FG2A 3BOVA 3L5XL 4O5LH 2DI7A 2C8NA 3TBSB 4JKLA 5CEYA 2I9LB 4AYMC 1UB5A 4F2EA 4QWWC 3FB6A 3I3DA 4YL4A 2FO1A 2WWKT 2WSKA 3L8QA 4ADGA 2X2YA 5KVEE 2H3NB 4PGDA 4G8IA 1AC0A 1A6ZB 1XTMA 1LO5A 3IFNL 2Z3FA 1ZJBA 2AV7B 4ILDA 5BS0D 5JPMA 5D93B 4FS0A 3IS1X 1NIAA 3MBED 4H20H 5DJ8A 4AQZA 3VG0H 1O9ZA 4KJQC 4IJ3C 5KSUA 1HHIA 3MUUA 4DW2L 2JIXB 4GG6F 5E8PA 3RGVB 2CNYA 4OJAA 1Q72L 1P5VA 3CVHL 1NBVH 4JDZB 3FQRA 3PFQA 5SWSA 5AKTA 1XZ0B 4NC1E 2E9GA 2CIKA 4G8GA 4Y5XC 3VW3H 3MJWA 5BW7A 2O6FA 2VR8A 1TZ8A 2WZAA 1BOGA 4Y2DA 4PSPA 1OAJA 1NINA 3FTYA 4X6DB 1ZHBA 4LEOB 1L5GA 4FA6A 2VXSH 4TTDD 3WJMA 4JAMA 1JYWA 5DO8A 1UUSA 1PCXA 2A74B 2D03L 3C6LD 1UWEH 2BOBB 2F7RA 3DI3B 4NXKA 2OSWA 1H3UA 4PRIB 4WHDA 2VXVH 3O3AB 4QRRB 4RBPK 2XZQH 4U1IB 4K5PA 5IF0A 3NEEA 4QHKI 5A2BA 5MEPA 1EHAA 3KWXA 5JOFB 3NAAH 2RMNA 5EZPA 1NCDH 5IIEB 4ZS7H 2PWGA 5I1HH 3FO9A 3JV0A 3OGCB 3DMMB 2DYPB 2CDEB 5SX5H 1IX2A 1R3IH 1C12B 1SOQA 4M6AA 1W72B 4YO0B 5K5YA 2QQLH 1FIEA 2XLLA 3CFIC 4Q9BA 5L6YH 1AO7E 3KXFB 5JTWA 1JPTH 1BW8A 3FHAA 4Z3GA 1JPFA 1FI8C 3DSFL 3KCPA 4BZ2L 1LO4H 1BIIB 4RZCA 4ZO7A 3RVUD 2IV9A 5JIPA 2B4CL 4MS6A 4GOSA 1CICC 5MEQA 4BFJA 1UYWH 1EPFA 3PHOB 3EDEA 5HHOD 4TUKH 2EC9U 5HDBF 5INCA 3ML9A 2GHZA 5EWIL 1QLEH 3FSVA 3KW7A 3P4OA 5GIRA 4DGYH 4ERSH 3QHZH 1RY7B 3DV4A 5F1OB 4A63A 5IFAL 2ICEA 3WCYA 2BNQE 2OMZA 1UEYA 3MN8A 4TL4A 1ETJA 1PD6A 1JPEA 1YQVH 2HJFA 2KI6A 3D48R 1I9IH 4Z7VE 3CMGA 4GP5B 1CZ8L 3QNYA 5LAXB 4HAFA 2UYLA 1TO5A 4PVMA 2YD3A 2ZJSH 4PJ5A 4I9WD 4JKKA 1BMGA 1G6VK 2XQYG 3LD8C 4OTXL 2Z31C 2V9TA 4JGNA 4XBMA 5ICUA 1YJDC 1QABA 5CSBA 1KTDA 4NCC2 5B38B 1BMZA 3QXAB 1K6QL 3CFEA 3DX7B 1NAMB 3K6OA 1JAEA 5GGTL 4AYBA 1NAKL 3SEPA 5J11B 1J88A 1NCNA 3SPVB 3BKMH 3L1OL 1LM8V 1CYXA 2LLGA 4XMPL 5L0QB 5DURB 3TFBA 5LBVA 5D1XA 1AQKL 2XCMC 1ND0B 1M1SA 1T21B 2DMHA 3BSZH 1LL1A 5K39A 1AIFB 3F7KA 1IFHH 3NZ8B 3QUZA 1IC0A 1ID2A 4OUOA 1OGAB 2VIRB 2ZSWB 2CDGB 3PQYE 3CUPB 3SYAA 4ZRGA 3OJDB 4HEPG 6PCYA 4PJ7F 3D39B 3HFML 4A7SA 3R06A 3Q9QA 4NENA 1H3WM 4JFOB 1O75A 4L8SB 1VZIA 3MV7B 5E2JA 2EDBA 3B7UX 3H4FA 2P9RA 4M7JH 2I7OA 1LDSA 2O1AA 5GGRY 1TCRB 1A7NH 1CGUA 3H3PL 5ALCH 3QUHA 3QIBA 4YDLC 1IBDA 4OY9A 4X6CA 5K93A 2A9DA 1YY9C 3SY6A 3V0HA 2ZX6A 3S3JA 3TOPA 3UC0H 1MFBL 3UJJL 1JZ8A 3NABL 3RDTA 2PMZA 3BYYA 3HHMA 2DV6A 4PV8A 4UAOB 3RY6A 3GWJA 3QZLA 1XCQB 5I18H 3MKKA 5B1AB 4PJEE 4GQQA 1UENA 2VLKE 3EFOA 1I8MA 3SKNB 3BAEL 4JRYE 4OM1L 5E2WL 4O4YH 4M1CD 4PY8I 1A1OA 5IB1A 1FV1A 2QR0B 3F12B 1B3JA 1D9KB 2VLJD 1SGKA 4XOEA 3T0WA 4JZNA 4Y5YC 1G0XA 1Q94B 4E9QA 2GK0B 4KK5D 4UINH 4NM8H 3V9FA 3IXAA 3IKKA 1L3NA 4OFQA 3TU6A 2FNWA 3EAKA 4X6CF 3NSXA 4LGRB 1OTUC 5EF1A 2PLTA 4Z7UA 4GRLD 4F5CA 3OG4B 4MZ3A 4FQJH 2Y22A 4WEMB 4U7SA 4P9MH 3T3PE 3BVUA 4OGQC 3ARGB 2OXHA 4NNPH 4EN3A 1BBDL 2A6KA 2VC2H 3FT2A 4IKLA 2P80D 1SMOA 2IPTL 2FWUA 2PP9A 3QORA 3WLWC 5FDWA 1FNHA 1PKQB 1PX3A 4XPHL 5GRUH 4HXBL 5I9QB 3IJ9A 3LKPA 1E6OL 3T0EE 2HKAA 4LL4A 2L0DA 4QHPA 2AVGA 2G3XA 2YD8A 5F9AC 1RJLB 2DWEA 1BF8A 4PBWD 1NBYB 2BXYA 2NDGA 4ZW8A 5SWZB 4PWGA 3ULVL 4RESB 4F37K 4KX8A 4DSYA 3VXUE 1Q90A 3BX7C 1C16B 5FW6A 1YNLH 2ZUSA 3NTCL 2VRKA 3A21A 3P4NB 1X9UA 4XNXH 3H6JA 4QRUB 5ICXB 4MB3A 1HKLH 4JDEA 1OCCB 5I1IL 4Z7UF 3UGXA 3FYIB 1RVFL 3CN1A 4G7YH 5D7JA 4BRVA 1MJ7H 1OW0A 2XQBH 1YEGL 2FQEA 4OCYH 4R0LA 4M8QB 2JKLA 4H1LH 3LKOA 1OTTD 2VR6A 4J23A 1HE8A 3LNIA 3V4PH 1BD2D 1SQ2N 1R0AL 5KN5B 3MV9D 1BAGA 1J1PH 3VFOB 3STLB 3VG9B 3JXAA 3KDPB 3FCUB 4MNQA 4YHLL 3FOMA 2DQHH 3GMOB 4JQVC 3B2VL 4HEME 1HZHL 2G0KA 3VU1A 4HKXA 1SLWA 4UQ2B 1GZHC 3TNMB 2X4SA 1KEMH 1PZUB 4X4XA 3M7FB 4TUUA 3WIHA 1HNYA 1ZV2A 1MPAH 1UWYA 1DQMH 2QV4A 1U2YA 4D0CA 2QSCH 2V5RA 3PG2A 3B83A 5HHQB 1UVQA 2NRDA 1NMAL 4G9DB 3GZKA 4N8UA 1E42A 1S78C 1RZJC 4AIOA 1BFSA 1XF5B 5DHVH 4H8PA 5FK9B 5DRWB 5FM5M 1XF3B 3GGWB 2N1KA 5F72S 4P23C 2FECL 4JLRB 4UT9L 3Q1SH 3QCTH 3QRLA 5IESH 3QIUA 2ED6A 2JK5B 3QXVA 5AFAA 5BZDA 2VERA 3HRZC 1NEUA 2H1PL 4MJ5A 2ZX7A 4TOYH 1JMZA 3K71A 4H1LG 5TJWK 4Z23A 4B97A 4FNRA 4G5AA 1HU8A 1OT1A 1Q0XH 2FWLB 3NZHL 1T83A 4XO3A 1UA6H 1YMHB 5J3HC 4GS7B 5D7LE 3ENEA 3UYPA 2NR6D 3FQYA 3RTQB 4KROB 1XGPA 3AXLB 4RRPG 1FVDB 1HCFX 1TQSA 5KBLA 5FB8A 5EZLB 1S7QB 3S35L 1QW8A 1QLRA 4ZQTA 4MCYB 2BK8A 4F7PA 4X98A 2HWZH 3BUYB 3MREB 4MHHI 2AXJA 1BOYA 5C7ZA 4U1SA 4M48L 4O00A 1DQLL 3ZHNA 5FCUL 4IRZH 4KI5D 1IKFH 4C59B 4RGOL 3ZTNH 5ITBH 2P52A 4JCWA 4UQAA 3DX9A 4JR9L 4PTUB 3MNWA 4I77H 4LLYB 1HZKA 3QUYD 3TESA 2HKFL 4OCSH 3BC9A 3H9HB 1CGWA 3AUWB 5FA3A 4MFHA 2ZX8A 5DSCB 4NWUL 1RLWA 3O6FC 4RMBA 4Y16D 5EU4A 1MQKL 2Y25A 4JZJC 4LOFA 1W9XA 2BDNL 4O2FB 3W37A 1HHJA 1Q38A 4FDWA 2RCSL 5AWNL 5JPNB 2Z4QB 1OAXH 4XN7A 4ZAKA 3J07A 4M62L 2ZSVB 5T5NF 1Q4NX 4PRBA 3CQFA 1QFWL 3TZVA 3EGDB 4XCNA 1Y6KR 3FCGA 3ISWA 1KENH 4QHKJ 1UASA 1KXVA 5F3HA 4MMXB 4QXWA 4PJ8C 2HFFB 4G9FE 2Y5QA 2MQ3A 3CIAA 3MACL 4NO0B 4LSSH 3JTTA 4XR8C 2Q2LA 4OCRL 1DQKA 1FFPB 3X13B 3ARFD 5HGAB 5JDJA 1X4ZA 3C2AH 3D3VD 2R4RL 3X3FL 3MNDA 4OZIB 3HS0B 3DIDA 1PLAA 2JH2A 3V6OE 1EJOL 3KPQB 5K1JA 1LE5B 4Q4EA 5I0WA 4EBQL 4GMSL 1I1FB 2PABA 2QPUA 1KXTB 3QUMH 4ZSOA 3LN5B 2H4EA 2ALAA 2EDDA 2HLAB 1N10A 1PFOA 1RJYB 4AZUA 3GMPB 4NZDA 4U1NA 3V0VB 2EE0A 5EULV 2DZEA 2DLEA 2YLKA 1YVLA 2DQEL 1F42A 5B8CA 1MCRA 2FECI 2ED8A 2A4EA 1CF1A 1AGEA 1XF4B 4NLAA 3GSRA 5DQJA 5CMAA 2FL5B 5FYJH 1SLXA 3U1SH 2A7BA 3KVDD 4TSBL 4N0CD 5DVMA 3RX9A 5EUOB 4FQXD 1PEZA 5I23A 1HJCA 3DK0A 3ARTA 1CDJA 2VXQA 1CDUA 2VISA 2COQA 3B5TA 4N8VA 1VF5C 4XVTH 3M7OA 1MW1A 1QRKA 1OAZL 1VEOA 2K9UA 1N5YH 2X4UB 1TKWB 5E2TL 3VQ1C 3RIFF 1BECA 3HN8A 1ILUA 3BH4A 5I0ZA 3EYFA 3D0AA 2MQCA 1TENA 3QZWB 5JHLL 2NQDA 3JQOB 4K4KA 5EG6C 3OX8A 1T4KA 2E7BA 4XPFL 1OAQL 1FLRL 2LU5A 3GTVA 1VB9A 2AVFA 5TF1L 2IVFC 4TULH 1HESA 2BSTB 4XXCA 3ZKND 3WNJA 3FF7A 3FH7A 5CM1A 2DPKA 4TSAH 3B9VA 3MBXL 2NY6C 32C2A 4ORGB 4FOMA 2JF1A 3BT2L 4GKSA 3EH3B 3HUJA 3L3KB 3MV8E 5DRXA 4JHWL 4PP2B 5D1ZC 1IFGA 3RIKA 1T1XB 4MB5A 4P5RA 1KF9B 1JWUA 2B1HL 1OE3A 5C6TH 3U30C 4HS8L 4WI0B 5C0DB 2CE6A 3VXME 1NCCH 4DP2X 4GRWF 2IWKA 3BAIA 2VM9A 1SZNA 4NQCB 4QTIH 3RWCB 1Z0MA 2H2SD 1NDMB 3AT8A 1LWJA 2LLNA 4GLRH 3HEIB 4JFFD 4YGVB 4ZO6A 1RUQL 1BLIA 2J88H 1QFWI 5GSVA 5EEWA 4M7ZC 3PXHA 4XVUD 4YFLI 2A6DB 2O5ZL 1IGFL 3B6SB 2AJUH 2VAJA 4LVOC 4U1GC 1E2VA 1ET8A 3QZWG 5F3FA 4X0KB 4JPIB 1EA9C 2VMFA 4IMLB 1BQLH 4JCLA 1A9VA 4FLRA 2OMVA 4Y4KD 5ALBH 2DJ4A 4GW4A 4JMXA 3UYRH 1A6TB 4P3CH 1N5AA 3HUJF 1UM4L 1LJMA 5CJ8A 3TA3A 4FQ2L 4AV0A 2MHAB 4MQXD 3G5YB 5F3BA 2PPCA 3EDKA 2PWHA 5CD3B 2DAVA 3TJHC 2WLJA 1AGDA 1BF5A 4X6FB 5GS2D 3T5WA 5HYFA 1T03L 4D3CH 1S5HB 5DJDA 1IZKA 1GGBL 1R3HB 3P3YA 4XC1L 4O2EB 2HZHA 3CHSA 3US1A 1E5BA 4N5UA 2UZYA 2WNWA 2K45A 3AJ7A 2AQSA 3U36A 5HYJD 1QUPA 4FFYL 1HQ4A 3MHZA 2BNRB 4JQXC 3QQ9C 4X5LA 1A47A 1OGTB 3K91A 3S8FB 4FG4A 4L3EE 3TL5A 3NSJA 2F9BT 3KPSA 4OQ1A 1JGLH 3HBPA 2VAAA 2YQ2A 4O02A 2DWDB 3DUHA 4Y2LA 5IW1A 4WHTA 4W68A 3EO9H 2X1PA 1MI5E 3CZFB 4LCWB 3IDGA 5HYQB 2GB2A 4L8DB 1A22B 4FYQA 5C8JB 4PCYA 4B9GA 4X5RA 1OAUH 1SVZA 1V7NH 3VX1A 1QRND 4DP1X 4OR1A 4LKXA 5DFVC 4PB0L 4XE5B 1T7VA 4QRTA 3BPNB 5CCHE 5GGRB 3IDYC 4OLUL 3VWJB 5I17A 3C9NA 5JO5A 4J12A 3Q2WA 5EU7C 2FATL 4IIQB 4OGYH 4EMZA 4TVPE 5CN2A 4LRIA 5BOJA 5F7BA 3EBAA 4GSDH 3UC2A 5TPWL 1KY6A 4CC4C 1L6PA 3V0IA 4Q6IA 1INDL 1JL8A 1KB3A 4Q6YA 1RK0A 4BH7A 3OKEA 3SQOL 2CKBL 1RURH 4OB5H 2YD5A 4F33A 4UOZA 4FABL 2X70B 2KC0A 2E3VA 1CLOL 4JPQA 4B50A 3MRQB 1P7QD 3OXSA 4J2XA 1DHKA 4ZFOL 1GXEA 1Z3RA 1BFVL 2ENQA 1HHHA 4W93A 1IB5A 3HLAA 3U7WL 4Z95L 2XUWA 1YC7A 3MZGB 2VCOA 3MGTA 5L4IA 3A22A 4MA1C 3GMRA 2BP8A 4J1UB 5CU9A 1I3RB 4FFZL 4F7MA 4XNYH 3CX2A 2DIJA 4GRMA 1JP5A 4EDWH 3EF4A 4OCNC 3MRJB 4XXWC 5D7SH 2DLIA 1IBHA 4M9OA 3R8QA 2XV2A 3Q5YA 3IVKB 3WXWL 4PD4J 3K80A 3DGCR 2V3FA 2RHEA 2VXTH 3S5ZA 5AD0A 4LLAA 5KYWB 4L4VE 3SDCC 2EKSA 1OM3H 3MR9B 1GYVA 2LTQC 1BGXH 5ETUA 5CUSL 3IFPA 1MFMA 1G5AA 3KGTA 1UM6L 4Z7AA 2B1OA 3JWOH 2OR9L 4MMZB 5D6DC 4HX1B 2VDRL 5E9DE 3O8XC 2VDMB 2DQMA 2EXYC 4S0SD 1CE6B 3HR6A 5MEND 2BHUA 2ZOLB 3O9WB 3EBHA 1NZRA 4B9KC 4M6NL 1QX1A 1AKJB 4F9PA 4AQ8A 4HWEL 4BRJA 4B5EA 4IMKC 4FQIH 1QA9B 5I1JL 2WC7A 3IJSB 1BLNB 3L2NA 3X12A 3NCJH 2OSLB 2XN0A 2DH3A 2V5SA 1YN7A 4RBPH 5C2BH 1U8OB 1ED3A 1TLKA 3T4YB 5LGJA 2FD6L 5DT1H 2IIJA 3F6LA 1CLZL 1FFNB 2EO1A 4HCFA 3C60B 2OAAA 4D0DB 2BPBA 3E2HC 1KCKA 1R3KA 4ZS6D 5HDWA 4NKOB 4N2EA 5ABDE 4YUEL 4FTVB 1YMMA 5E1AB 5DD0L 4YR6B 3QJSB 3RVXC 2VZTA 1MJ8L 1I8AA 3ARBB 4H25A 1MIEL 1RIHL 2J8UA 4G6AC 5BVJA 3U9WA 2X09A 4H8WC 1XGYL 1J0JA 1U30A 2DMGA 4GIOA 4UZGA 1EV2E 1PY9A 3BIBX 3REWA 3KPRE 3LKSB 1OY3B 4Z3JA 4BZYA 1JPGB 4GQ9H 2AJZB 5C0IB 1E9PB 4NQEA 3P77B 2Q76A 3KL5A 3GSWB 3RZCB 2VERN 5KVEL 1SOKA 3UTTB 4DP4X 2ROXA 4A2HA 3JZ7A 1KT2A 3ZYJA 3D85D 4BJLA 2ESVD 5C0CE 5LXGL 2GUYA 2I07A 2R7EA 1JNNL 3MDJA 1C8PA 3QJVB 4YSPA 2XWEA 4RDQF 1CU4L 4G2AA 5FO8B 2CUHA 4B3VA 3MU3A 4EJ1C 3P54A 2X28A 4V2CB 3V0DA 4DGUA 3LQZB 4XNMA 1KB5A 3AC0A 1R5VA 2WWMC 1WPCA 3K2UL 2FYVA 4AQAB 4YNYA 3VFRB 4HLZH 4OZFG 5D71L 5EO0B 3TVMA 1AGBB 1W80A 4P5TB 4NUQA 2ZOWA 3HI5L 2PW2B 2DJMA 4MD0B 5EIIA 2AK4A 1EMTL 1I9RL 3NFNA 1IU1A 2XX1A 1ZK5A 3SO5A 3SDDB 1Q1JL 5D8JH 5B3NA 2LAGB 2YPKA 4XI5D 1MRCL 3LVTA 5F96H 2MQ0A 2IAND 3LKRA 1S3KH 4NNYB 5AVXB 2DBLH 1X5MA 5DD5H 4NT6B 2R2CA 3RU8L 1X5IA 2ORBL 4N2NA 2KLRA 3GXUB 2PXYD 3CFBA 4K9EC 3FO0H 4HFUL 3M17A 1M7UA 4ZTPH 5CGBA 3W56A 4ODVL 3HVDA 3LHPL 2WN2A 1MDAA 3UZQB 4YHIB 3QI9A 4BFIB 1JBJA 4M43L 4L2YA 3PWJB 5E5UB 4UTBA 1CI5A 4AW7A 1KCUL 5BZXA 2P5WA 1T20A 5AVZB 3UIYA 2A9AA 5AALA 1CDYA 1JF5A 3AREB 2VDPB 4J4PA 4XWOD 3CDCA 1WT5A 2Z1KA 3MLWL 4FQ1L 2V2XB 4DO6A 3EOAB 1E4JA 1YEDA 1KCLA 4HXAL 1ZVNA 2VQUA 4KMLB 4XP5H 5DRZA 5ANHA 1FDLL 1XL4A 4Y4FB 1TQBB 1GGYA 5FYLE 3PHAA 4QOKA 5GRJH 4HALA 4XC3L 3S36H 3SHSA 3CSGA 3FAXA 5TK2A 1XF2A 1QPPA 2W9EH 3CNKA 4AEHH 1I8KA 3NCWA 3WE6B 4RMVA 1PZBA 3GJFA 1FGNH 1CXFA 2V17L 3OSKA 3RPIB 3BEVA 3ABKB 3BAJA 5GGSB 3N44B 1D5ZA 4M5ZH 1YEIH 4JRXA 3T6ZA 5C3LD 3ULUE 1MHPL 3ZZSA 2NY0D 4DVRL 2LU4A 3SDYL 2AZUA 3F5WB 3EYOB 3PWVB 3A0OA 3RYMA 2EUZA 1IGJA 2Z92A 4JKPL 5EEUA 1F3JA 1GL4B 3EYQC 3G04A 3NA9H 4IGBC 2GUOB 1JI1A 4RISL 2JIXA 4R5VA 3QRFM 3WFZA 3RGVA 4Y19B 2XXMB 1TOXA 1MREH 2YK1L 1K5WA 2YZ8A 1AMXA 5L2KE 3KD4A 1R6VA 4JDZA 5E8DH 4XVJH 2WINB 4A7UA 3ATBA 4OCWL 4BZ1L 2O61B 5C0FB 1THCA 3Q8AA 4LEOA 4X7SL 1HK6A 4TLSA 3G6AB 5EEZA 2OK0L 1HL4A 3PGFL 3VE0B 4AOFA 4TNWF 4N26A 4OFIA 4HPHA 1J8RA 4C56E 2NY1B 3D4CA 3LRHA 4P07A 5KZCD 1UH4A 2Q1EA 4RGNC 1Q9OB 1HI6B 2DQJL 2C9UA 1MHHA 5TE4L 5TGBA 3BDXA 4ONHA 4WUKH 3KPOA 4GG8B 5DR5L 4EIBA 3K0WA 3LMJL 2VXQH 2X4TB 1TDQA 3D05A 5JOFA 3VXPA 5BUPA 1HXYB 1GPOH 2HRGA 4DO5A 2BXZA 2CR3A 4KHXL 2ZIDA 4XBGA 3SE8H 3OGCA 3PNWB 1IJ9A 2CDEA 4GRWH 4KJYA 4YN3A 5AW1B 3LQAL 3WUWB 1W72A 4LPYA 4MA8H 1UURA 1AYOA 3ESVF 3KXFA 4YHOH 2J6EA 2EEXA 2H1XA 3LOWA 5TDOA 2GJ6D 4DPBX 3MV11 3C6LA 4HHAB 3K2KA 1BIIA 2RR3A 3CGTA 1T1WA 4AUJA 1TTFA 2EYSA 3SYOA 3GHBH 4KRNA 3O0RH 4JFUA 1RIUH 2J55A 3U6XA 3VA6A 1J0ZA 5I2IA 4L18A 4ALAH 3CFTA 2V9UA 1U95B 5DJYB 4XP1L 2W80C 1DE4A 3ZTJH 1RI8A 3SIKA 4DAGH 5IW3A 3OKLB 1KLGB 2BS71 1A9BB 2J1ZA 2JI2A 2XQ0A 4W70A 1M3IA 4NO3B 3QCUL 4AVKA 4QWWD 3FTWA 3C75A 1DBAL 2DQCH 3GBMH 1WRFA 1AZCA 3E8UH 1GSKA 4N8VG 3VI3E 1OE2A 4YSTA 2DWYA 4FNUA 3J2PA 2VL5A 4XB7A 3B7RL 4KJPD 4Z7QE 5B38A 1A1MA 1E4WH 1P9MC 1MN4A 5EOTB 1QO3B 3DX7A 1NAMA 4HYTB 4KJQD 1D5BB 1UACL 4FXKB 3SJVB 4PJGF 3ZL4H 3F05A 3QEQD 4MD5B 4K23L 3FB7B 2X9WA 4KITB 5I5RA 5JYMA 2FHCA 4Z7WA 2XIIA 1ND0A 1T21A 1MHEB 1PG7L 4Z0BH 2J73A 3CFKA 4JO1H 1ZDQA 3BN3B 1MFAL 1OGAA 2VIRA 1H5BC 2P5EB 3IMVA 3CUPA 4UNTA 1JK8B 1ZLWH 3IGLA 5L8JB 3AWEA 5DD1H 1UEMA 1K8DA 3CBRA 1ECZA 5E6IA 1KIRB 2O5XH 3TTYA 2CK0L 2A1WL 3N9GL 4L8SA 2JELH 2W38A 4QTHA 2DDQH 5JOEA 4NUGH 5IHUL 3C12A 2NMSA 5FGCB 3ZHFA 4UMGA 2V2WB 3F7YB 1DL7H 5IVXB 2ZKHH 2JQMA 4AJWA 2NT0A 1IAOB 2JXMB 1Z5YD 3N91A 4AW4A 4ANXA 1JYVA 4Z7WF 4HJUA 4AGOA 1MEXL 2E4FA 2JTYA 3OZ9L 3VRIA 1X9LA 2APWA 2A77L 2VWEC 5JR1L 3ATFA 3S88L 3FRPB 4LSQH 4L1TA 2VM3A 4PJFE 4OZHB 4PREA 1X6NA 4DVBB 3L54A 4IU2A 4H88H 3DIFB 4PJ9B 3F12A 8FABA 1PBYA 2DKSA 5TE7H 1QNZL 1CICD 1BAFL 3LN9A 3BIAX 1GTFA 4P9HH 1I1AB 2AKRB 1XB8A 4BM7A 3TNNB 5HXMA 5E4EC 4EI6B 4HWUA 1IAIM 5SV4A 3EG9B 3MRDB 2WJ5A 1UQSA 4HC1A 1FJ1A 1FN4B 3TTSA 2J21A 3W9DB 2OL3L 5D4HA 4MYWB 3IPBA 1A7QH 2WY3B 1WBZB 2DTML 3ZSSA 4Q89A 5AVVB 4QXGL 4FNLL 4LVEA 3FUDA 1ZT4B 1GMEA 4DPAX 3F83A 3FQWB 4BQCA 2GITB 1QKZH 2CDFA 3F58H 3EJJX 4LLDA 1SEQH 3ZE0E 4NDMA 4ZMAT 1RJLA 2Z31D 3GZQA 5F0MB 3PV6B 2P8PA 1AQMA 2CLVB 5SWZA 4AMKH 4NUJA 1HZLA 2FJSA 4LSTH 2AFNA 2IOOA 2VSKB 1GAFL 2AP2A 4G42B 5ADPH 4S0HA 3FRPG 1GYWA 1TNNA 3D87B 3P4NA 4YSEA 4M1DH 2FJUB 3BFQG 3S3DB 4WVRA 1JSYA 4P2CG 5IGXL 1MIMH 1S7WA 3VD3A 3OTTA 4E0RA 2VR9A 2XN9E 1ZANH 3IGFA 3FDWA 5BMFH 4GRLA 3T3MB 2FR4A 3B8YA 5HVHC 4XP6L 3BQUC 4JK0D 5LJYH 5AZUA 5JXAH 4JPKH 4MAUL 5JIDA 4DCQB 2P80A 1F1AA 5DS2A 1NLBH 5IMKB 1BYNA 4H13C 5EC1A 4AYDC 3TP4A 5L8KB 1FNLA 3WMPA 5B39A 5FO7A 2MPAL 3N2JA 5KN5A 3P9LB 3VFOA 1HXMB 1QSVA 3STLA 2BERA 1QI5A 1EHKB 2YEQA 4E41D 1N6UA 1QP1A 4Y88A 3WL9B 3VWKA 4QUOA 2CGZA 3MRFA 4W6YB 4UQ2A 3RFRA 3FU5A 1FNSH 1ZSHA 3AM8C 3HC3H 1MNUL 3SPIA 1KEGL 5D5ME 4G6JH 2JJUA 1YY9D 3DO4A 4JO3H 1RPQA 5AW0B 1JPSL 3L3OC 1NKOA 3KLHC 2LT9A 5HHQA 4C55A 5KVDH 2IQAB 2E7MA 4G9DA 4RAUA 1D2PA 4ODHH 1S7XB 4E5XB 1UTDA 1NFDB 1Z9MA 1A4JA 4AGNA 1XF3A 5F7HA 3GGWA 1BX2B 3QAQA 5F1NA 5I76A 3S9DB 1YEEH 4Z7NE 1BD2A 4NPYA 3OMZA 4RFOH 9PCYA 1LWHA 3DLQR 5H4YA 5IEHA 2F54D 3TN0B 1KELH 4LSDA 5MI0B 3WN5B 3NDYE 5E1QA 4ZO8A 1OTUD 1MCNA 4QT5A 5DFAA 3TO2B 4I3RL 1YMHA 5AOMA 4QGTA 1N0XL 2YRBA 1HVXA 1TFHA 3I2CH 3RTQA 5DU7A 2E4TA 4P2QB 5IQLA 1CXLA 5C0BD 3WLWD 4BQ9A 2ZAHA 2W65B 5J1TC 4NQXA 4U6VH 4DGVL 1IFRA 5IQOA 3HE6C 1L6XA 4X9FA 4AMWA 3E0GA 2IF7A 2KS0A 1JZGA 2ZCHL 3RWHA 2WHVA 2J4WL 4FHBD 3SY0B 1XD0A 1JXKA 2I85A 3MAWA 4BIKA 2QKIB 1MHCB 1TQCB 4PTUA 3ULAB 5L4MA 4K5OA 4G8EB 4R7LA 5M94B 1BZ9B 1PNDA 4MTMA 4PQXA 5GZOA 2IALB 3H9HA 1U8CB 4CAGA 4K94H 3NT0A 2F19L 1ZLDA 4JRWA 1SM3L 3V7AG 1KB5H 3ZDZE 1UHVA 3RB5A 4KKAC 3HMXA 4O2FA 4HIEB 1DQDL 4U1KB 1SYSA 3OJVC 3SZKC 4LCUB 2OYPA 4B9PA 2EH8L 2UXVA 2OZ4L 2FX8L 2X6UA 2ZSVA 5GJSH 5KBKA 2E9IA 4KWUA 3BP5B 2WQWA 5FR3A 4IRJD 4LPXA 1F8TL 1UB6B 4FZEL 4PUBL 1G1KA 4P4KC 3U25A 1KLUA 2VDQH 5TK4A 3FO2A 1SDYA 4LSPL 1V3LA 3K6FA 4FN0A 5BRZA 5JHDD 1PLGL 5D7KE 3X13A 3SBPA 4KO7A 4JW3A 2YQBA 1QFPA 4ANKA 1O5PA 1LE5A 2X40A 5D1QC 1HXKA 2R29L 4A2DA 4DQOH 2WLLA 4CGTA 1INEL 3ESNA 3WDJA 4LVHB 2VDLL 4AGMA 5LNDA 3OPZH 4JO4L 4FKKA 3TT3L 4UTBH 1I3GH 1S78D 3DARA 1CJYA 2HKHL 4Q9RL 3L4UA 4HBCL 4DK5A 1U41A 3VFGH 3PWUA 1C5BH 1WO2A 3QDME 4P23D 1AVAA 4K3HA 5JW5A 3NIGF 1W8NA 1G7JB 1TZHB 3CCHB 3DO3A 5IHLB 3BP4A 3BUDA 1QSFD 1A2YB 3V4UH 2R56H 4QRPD 2PKDA 5JW3L 3VSVA 4KXDA 4LFHG 1MCDA 2EE2A 2EICA 4YK4C 1F6AB 5J6GB 2R8SH 1TKWA 1NGWB 1A4AA 5J3HD 4J3OG 5SX4H 2YGOA 1U91A 4F2MB 3GJFH 5KSAB 3IS0X 4PPTA 4NS0A 5AL8A 1MRFL 4KTEL 4I18A 3BDYL 3MUZ1 3QWRD 3WO4B 4UM8B 4TQEL 1TTRA 1Z2KA 4JY5L 2A38A 2K6WA 2Q10A 4KV5E 4LCIH 3PWPD 2HA1A 3RWIB 4CVWA 1OB1A 4F3FA 5I15L 1ZHLB 2BSTA 2ZZUT 4U1JA 3WD5H 3V10A 3PWLB 4TSCH 2KDYA 3BD3A 5JQ6H 5ID0A 2G3MA 1E5CA 4JN1L 2GC7C 4YBLC 1NIDA 5GRWA 1PNCA 4W4OA 2A73A 3V52L 3BAXA 1CBVH 3L3KA 1E6JH 1A7RL 5JUEH 1KGCD 4FQXA 4PTTA 4PP2A 1S7VB 5FYKD 4K8RC 3GHEH 2BVYA 2E47A 3O6FD 5C0DA 5C2UB 1ZV5A 4JHAL 3HZYB 1ORSA 4MAYB 4UQEA 4TVPL 3QQNA 4FQLL 1FNAA 2BSEA 3GDCA 4LNRB 4NQCA 2JTDA 2KZKA 4HS3A 1RH8A 4LDCA 2WN3A 3QJRB 4L3FA 2BSSA 4MHHG 5BZZA 1WUZA 3H2QA 2A6DA 1IAKA 3V95A 1OHQA 3LPWA 1ROCA 4PJBA 1R3JA 4CSPA 3MBEB 4PJ8D 4X0KA 3GHPA 1CF8L 5L9DH 1CGXA 4N0UE 4S0TD 3RQ3A 3NIFF 2YXFA 3T1WA 4N20A 5TDPB 1SPDA 1MZYA 2Z0UA 4KTYA 5F7YC 4PRPD 4TMPA 2R39A 1B0GA 4U0RB 1CDGA 3Q6GL 4M4RB 1KFAL 3MO1B 1NMCB 1W72H 3AT0A 4PCSA 4X6FA 1IAII 4YHNB 2K4AA 2QSQA 4A66A 3UTSD 1S5HA 2J6EH 3QSKB 4X4KA 3WOVA 5LCVH 1XGTB 2NSQA 1NC4D 4HT1H 4ZMTA 1CFTA 3HN3A 2V7HA 2VUYA 3OKMB 4OFKA 1DBML 4PJBF 1NGQL 1PZ3A 4NQVB 1LNUA 1ZJAA 3EH2A 3FN0L 1OGTA 4Y7MA 2VH5L 4O58H 4RGMC 5IFJB 4Y4KA 5IB4A 4L1SA 5FUOL 3WKYA 3D34A 2PCPB 4S1RH 1TTUA 3QK0A 5BXFA 1SRDA 1KN2H 1SFHA 3HC0A 4X5XA 2A6IB 3I75B 1G7PB 5HYQA 5ESAB 4UT7L 5LBGA 4L8DA 3ZMNA 3MODH 1CDBA 4Z78A 1DVTA 3FU0A 4QI3A 4V1DE 2W07B 3NJJA 5I6PA 3J8F7 2FGWL 1NAMH 1MVYA 2XBZA 3O2DL 5GGRA 3G6JB 5DD3H 4NZRH 2J1KA 5E6RB 5HHOB 3IDUA 2NY6D 2PTTA 3D52A 4IIQA 4OQTL 3RAJH 3GI9H 4P4RA 3VXSD 4U6XA 4MSWB 2AJSH 1YG9A 3Q8BA 3NP4A 4MLIA 2R69L 4GKZB 5D1ZD 2DYRB 4N85A 5DQ9A 1CYGA 2J2ZB 4ETYA 4CDHA 1U8NB 2GABA 4J28A 3MRNB 5TE6H 1KNOA 3KYNA 1ODUA 3ULSB 2WTRB 2I32A 5AOJA 1VENA 5EU6D 1JZ6A 3P0VH 3BD4A 3CSYA 1NQBA 1P4BL 3G5XB 7PAZA 3ZTEA 1UJTA 1G6RL 3D5OF 1DDHB 1PQZA 2VM4A 2X70A 2O93L 5JPMC 3Q6FA 5T1DL 3C6SA 3MRQA 2YZ1A 5EO9A 5EHFA 2RIKA 4Y7OC 2KT6A 1AHKA 1A6VH 1QVOB 2ITCB 3CAFA 3IKCA 2WXFA 4BFRA 4M93C 2DQDH 1I7RB 1H15B 1RZIB 4K3GA 4JFPB 1M53A 4PN6A 3B56A 3OF6D 4ELKA 1RKRA 5I1LA 2YJLA 4HF5L 3IU4H 3C8DA 4PLKC 5BW7C 2Q86B 1A7BA 3RWDB 4Y2DC 1DBJL 2IH9A 2Y9RT 4FXGB 4LL1A 1IBYA 3QC5X 4QCIB 3TJHD 1P7HL 1OQXA 3VFSB 1JXJA 3CV5A 5HSFA 5JA8B 5K59E 3IVKA 4JKWA 4X7TB 5C07B 4AUUA 5C0NC 1AXSB 4JREC 3T0XA 1HWHB 3CZLA 5DZVA 3H7BB 4NNXB 5GHWL 2PPEA 1BIHA 5F0LB 1I7TA 1W15A 3PL6C 4F91B 4CU7A 4PI2A 3MR9A 2JI1A 2Y69B 1EHLL 1DVYA 4DP9X 1GZQA 1YCSA 1DJSA 3OKKB 1L9OA 3S96A 5LG6A 3MV01 1Y07A 3QQ9D 5F6IC 4BH8B 4TQIA 4F57L 3VTAA 4YH6A 2DLHA 2G75A 4HC1H 4L4TE 1Z9OA 1A3LL 4M8RA 1SJEA 5ERWA 3INUH 4HK3J 5I8CB 4FD0A 4BBWA 2ZOLA 5KEZA 1B0RA 1GOFA 4L1LA 1JUFA 4XCYA 1J48A 2H41A 4ELMB 5IHZB 7PCYA 4JFDB 1JRHL 4AYSA 5F6HI 4MLSA 2EIDA 2W9LA 1V54B 4GFXA 3BWAB 4LP8A 1QA9A 4DKFH 5D72H 1M05B 3LS4L 1X5HA 3KGUA 2E59A 1BLNA 2YPLE 3CLFH 5D7HA 2X6MA 2F68X 4EZMA 2VLJB 2X1QA 3BYTA 4UOW1 4ZMPA 4YC2C 3EOBB 4MKTA 5DFVD 3S34H 1JZ4A 1FVCB 3CFCH 1WA0X 4OJFL 1IILE 1MJJB 2IJ0C 4QLRA 2ROYA 5KTEH 2DWTA 4OH2A 4PRIE 5D6CB 2ICEC 5I8OL 4FTVA 3NN8B 3QXDA 4UTCA 4YR6A 3QT2A 3HKZA 5D2LE 1WTLA 4MJJA 3RWFB 5MENA 4N2AA 4MJID 4WFEE 2ZXBA 1H3XA 3GKWL 2I26N 1NDGB 5FYLL 2NY2B 1F6FB 1U42A 3O11B 3QFJB 3I9GL 4QHUB 3CC5B 5G5DB 1ASPA 1JPGA 4E68A 4ZUVB 5DJAB 3P77A 4PRHA 3RZCA 3UTTA 2NYKA 3ULUL 3EKCA 3UAJA 4TF4A 3CDZB 3NCYS 3Q2VA 1VDGA 4BQ8A 3QYMA 4EZKA 3VACA 4S2SB 3UAFA 1FZJB 4IBZA 4X4MA 3UBXI 5EOCH 1TPXC 2VQ4A 3LQZA 2WWKO 3QUZC 4OLYL 2B59B 2CO6A 4KGJA 4F15C 5EN2B 4KGLA 3DROA 4E9LA 4PJCB 5GGQL 4AQAA 3OKOB 1N12A 2GW5A 1DVFB 3VFRA 1X5LA 3CVIH 3ME0B 3MRPA 3KZ8A 4FMVA 5EO0A 2EDTA 1FP5A 4P5TA 3VM7A 4IJTA 3EO1B 4B7IA 1M3JA 3ES6B 3V0EA 3WE1A 4N90E 2E8ZA 2C9VA 4YZFF 1JXDA 2MWCA 3SDCD 2GIMA 3QFDA 3VMNA 3EF7A 3IAQA 2R0LH 4QHLA 4CKVX 1QSEE 3QIBC 3WENA 4ATTA 1ERNA 5B39G 3MLUL 4DN4H 2X4PA 3SDAD 2OMYB 3D85A 3O8XD 4NT6A 4NKIH 2DIEA 1IARB 2EXYD 3RDTC 4GUQA 4KZEL 4OGAC 1GGIH 1F2QA 1HYSC 3HC4H 3L3HB 2XPGA 4WJ5A 3UZQA 1CGSH 4BFIA 3CDGA 5INDA 4LE8A 5JOPE 3PWJA 4M03A 1KYUA 3ZN6A 3WXVL 3R19A 3ZTDC 1NGZA 3AREA 2FIKB 4YSDA 1BAWA 4A6YL 1WCBB 2BX5A 2I27N 1MCHA 4LCCB 5GSRB 3SCMC 1I9JL 3D39E 4UM9B 4EXPX 2EDRA 2CKBB 5HJGA 1CFVL 1CD9B 3A67H 4KY1L 3CFJA 4PJXB 2B0SH 2E5EA 1TCMA 1ACYH 2CMRH 4Z77A 1TETL 1D6EA 5ISZA 1Q0YL 3NH7L 4ZFOB 4EN3C 3HMXH 3RVXD 4K9JA 1MFVA 1MY5A 3QJOA 3S7GA 5IFHH 4G6AD 4DK6A 3Q8CA 1RU9H 1IC4L 1YEJL 5D96C 5FUCE 3F5WA 3EYOA 4JN2B 2IDFA 3S37X 1RZFL 2B1AL 1NSNL 1WS7A 4HUXB 3UBHA 3DC0A 4GT0A 3RP1A 1U93A 1YEKL 1E4KA 1FBIH 3GSOB 1JERA 1FPTH 1KN4H 2G5UA 4HJJL 4GW5B 2M1KA 1G9ML 2VQTA 3G5VA 3IPFA 4XVSL 4PJAB 3X17A 5GGVH 1CT8A 4ACTA 5C7XL 1O7SA 1F4HA 2WINA 2YOAA 1Q9LB 3QUYB 3SO3C 1JNHB 1KXQE 4CSZA 1RULH 2YA1A 3FNKA 4YDJB 2WUCH 5D7JC 5C0FA 5CINL 4OFVA 3CVDA 3BVNB 3LXUX 1OW0C 4JUTA 3BH8B 2WWMD 3VE0A 1AD9B 3N44F 1Z9LA 4PGJA 4JPVL 4Y4HA 3QG6A 2VDRB 3NFPA 4NOFA 4HUVA 3MROB 3FUIA 5C0JB 2BJMH 2H6UA 4KAQH 1IBFA 1W0YT 4WDIB 4GPVA 4XTRC 5DZOA 4AKOA 5DFTA 3SGKA 2WNGA 2VLRD 1EWHA 1PIGA 2FK9A 3T2LA 1XR9B 4YZWA 3S5LA 2XSKA 5E6ZA 3GDBA 5HJBA 3ARFB 1FYTD 1A7PH 2J12B 2X38A 3APFA 3VB9A 3QDGB 2HRLA 3RL2B 4F8QA 4AL8H 1E9OB 3O4LB 4WLCA 2DW5A 2NY7H 4RQQA 2KL6A 3PNWA 1OP4A 3BE1L 5IBUG 3TO4B 3FOLA 4K3EL 5C0AB 5T3XD 5IJVB 3HIZA 4M7LH 3H53A 3HNSL 4GO9A 2LFEA 4APQB 1QR1A 4WFFE 4KKZA 2ZD0A 1H6UA 3K74B 4ZO9A 3QEUB 1MFDH 4HHAA 1YEFL 4KRMB 5HYSB 2ZG1A 3BUBA 3QIUC 5K9JH 1BXAA 5CJQL 4M61B 1RUKL 4LHQB 4HJ0C 2BVOA 1MW2A 2J5LC 2YXMA 4WUUB 1YYMH 2X1XR 3LIZA 1CMOA 1A6PA 3FN9A 3ARQA 1O6SB 3I6GB 5D9SB 1IBZA 5DJYA 1EEZB 2VN4A 4JPWH 5FKPA 4S1SL 3LH2L 4APXB 3HZVB 1IE4A 4WW2B 1A9BA 4B9IA 2C4XA 2KERA 4K71B 2NPLX 3GMMB 3ZHLA 3VRJB 3STBA 4QHMB 5IOPB 4PG9A 2IBBA 1UA3A 4KKCC 1W0WA 4MQ7A 1FGVL 2V9QA 5CBEA 4P48A 4TL5A 1XGQB 4OV6F 3VFUA 2XKUA 5I73C 1IKOP 4XNQB 3QC6X 5EOTA 3GT6A 3BKJH 3EYQD 2VITA 4IGBD 4DZ8B 4FXKA 4KVCL 3SJVA 1ZKAA 3ZY7A 3U0PA 1RCYA 1R5IB 4LBEB 4ONFL 1ORQB 2R0WH 4FQQB 2FLRT 1QHQA 3FB7A 3HNTL 2DBJA 4UB0H 3P11L 3GXPA 4MB1A 1QSZA 2NT1A 1TTCA 2VGLM 3JTSA 3C5SB 4LEXL 3R1GL 4QYOB 5DJ6B 2MCPL 2VXUL 3ILEA 1A7OL 3RKDC 1ZT1B 3VGAB 1BM3H 4CRPA 4N2IA 4EE2A 1DUZB 3F8UB 1KIRA 4ZOEA 4ZAKC 1I53A 2GYSA 3VXOA 1KJVB 1VACB 4L9LC 5ICYB 1R46A 1KXVC 3COOA 1QEWB 2V2WA 3F7YA 3U0TA 4OKDA 3WFCH 4RGND 3LS5H 4FKEA 2PYED 4JDTL 2CIIB 2F5BL 3WEXA 1EEYB 3T2QA 1JYNA 1B90A 1FO0B 1UG9A 3CZJA 1I8IA 2RH0A 1B9KA 1F1DA 1XAKA 1ZD6A 2H8PB 3MBWA 4KXZH 4POYA 5F6HJ 1RSYA 1UT1A 1ZS8A 4G7VH 4U1MB 2FEEL 2WLKA 1AO7B 1U3HB 4OD3H 1B3IA 4LP4A 4ZTEA 3G7TA 5JXEA 2XTJB 5K9OA 5LDUA 1H3PL 3NCXA 4FLHA 5CEZE 4FADA 1CXHA 3DX8A 3DIFA 4PJ9A 3IEAA 2D3NA 1U8KB 1EUTA 3AQXA 2YN3A 1VGEL 1HH6B 1TTBA 1UXSB 4FJZA 3IAGC 3N50A 3VFNA 2V2TB 1CLYL 1X5ZA 2CCWA 3O3UN 4GIAA 4NCC1 5IJKA 4AIEA 3N5AA 3C09B 5F88B 2AKRA 2BVPB 1K9TA 4EI5B 1JGUL 4BDVB 5J12B 1RXLA 2BNQB 2NX5A 3I50L 1W0VB 2HPTA 1E0OB 4R96A 3MRDA 1GJIA 2K8MA 1YPZE 4HIHA 4ZUTA 1JTTA 4XPAL 4Z7VB 3FCTA 3MX0B 3UXFA 1BMWA 1B4JL 2CXGA 4PD4K 2H0PA 2N0KA 3ARVA 3W9DA 1VFBB 1DQJA 2W0KA 5DK0A 1N64H 2J1YA 1WBZA 2QV2A 3F64A 3GLAA 2L04A 2SEBA 2P3YA 2Z35A 3EYSL 4XBEH 3EJRA 1IBBA 5C08A 1VSCA 4N8CH 3DYOA 1ZT4A 3CVHA 5CFHA 3MLRH 3NCBB 4FQCL 1W6WA 2W9DL 4GXVL 2JJTC 3O4OB 4C4UA 1H8NA 3PV6A 4XXCC 3DXAE 2CLVA 1TZIB 3UOAB 1NWOA 3T8VA 1NFAA 4ETQB 4J6RH 2EDWA 4Z7OF 2B14A 3BI9X 4H0HB 2XI9A 3WDIA 5A43C 3RWJB 3QIWD 4JEGB 4ZK8A 4ALAC 5KYYB 1R3LB 4JFHE 3L7EB 1E9QB 4LL9A 2VE6A 2ZUQC 5CKGA 3PQYB 3LRSB 5JZ7C 3DGGB 1VHPA 4QR7A 2C5DC 4PGCB 4L0PB 1WFMA 3H9ZA 4L5FL 4G80B 4WZ9A 1FZOB 3MXVL 3FQ4A 4WEBL 1L0QA 1RZQA 5EFIB 3ZRCC 5ITFB 4YXLH 3P9LA 1JIBA 1HXMA 4BINA 4L3CB 4HD5A 3VA2C 3P9MB 2Z31A 1P7QB 4EVNB 2XA3A 5LGKA 1N4XH 1MFNA 5AENA 3NPSB 4HUWA 4TLKA 1BVOA 3GZPA 4X6EB 1UD3A 2X0WA 5A2FA 4BZ2A 3TA3C 1CQKA 3TCTA 4F7TB 3E3QC 3UIZA 2VLKB 4M7LT 2FEEI 4NJ9L 2IQAA 5SWSE 4JRYB 3VFVA 4NWTH 4E5XA 4G8GE 1SF3A 3ILDA 1JVLA 3D2UB 1BX2A 4YX2L 3LXCA 5IB3B 4UQ9A 2NXYC 4FYSA 4ZQKB 1VEMA 5EF0A 2PYFB 1UCBL 3TBVB 2XDHA 2HMIC 3L5WB 4OGXH 4P2OB 4OW6A 2YKLL 4CDGC 2WQXA 2CJSA 1KC5H 2D7TL 5DEZA 3FTGB 4KZ0A 1SEBB 3T3PB 5FDYA 3WN5A 3F2LA 3II3A 1JHKL 4S11A 3Q3GB 4BSWA 1MCSA 4J3SA 2XBTA 3PGCB 3GMNB 5GGTA 2W65A 1ASOA 2BINA 2DH2A 4Y8AA 3UTQB 3EH5B 4GKNB 1ZK9A 3VXUB 5LAPA 3NACH 4OIAA 3GSNL 2VRQA 2WUBL 3CSPA 4LLUB 1NCAL 1J8HD 2G5BA 2DM2A 4M5YH 4UT6L 4WEUD 2QKSA 3BW9A 4ZFQA 3P4MB 4P9HC 4Y5YA 3RVVC 5F9JB 4G8EA 3SKJL 2QELA 3WHE1 1CGYA 2Q7NA 3PDOB 4LRIC 5CCKL 2B2XL 4KKNA 4MDJB 5KW9H 1K5NA 3ZRFC 2BNRE 1KWGA 3BP7B 3HNVH 1OWWA 4WENB 2MCMA 5F89B 3BQUD 4HIEA 5A16A 5F9WB 4JG0H 4HK0B 4LCUA 1EGJL 3WAJA 1CFSB 1KCSL 3W82A 3SGEH 3UJTH 4YLBA 5I1GL 4YE4H 5C0BA 1B6DA 4IIZA 2YUXA 1MVFA 1M6UA 3FBQA 1HINL 5F7KC 2VZ3A 5D70H 4NFCA 4PJ7E 1CE1L 1ULVA 3H55A 4LCWE 1IT9H 1A25A 1GJUA 2N56A 1YN6A 4HK3N 1DLFL 1BQRA 2WTPA 3H0TA 3OV6A 2VKWA 3KW8A 4CVXA 4IHBA 4NN7B 3J27A 2ESVB 4HIXH 3CHPA 4Q58C 3DBXB 4QKTA 3RY5A 4IOIB 2D31B 4LLWB 4XNAA 4OCMC 5FHAH 4AIXA 3KLHD 1T1ZB 3FQNA 4XH2B 4X5WB 5DZLA 4NZTL 4CC0A 3FKUS 5AVYB 1YLBB 5D1XE 2AXFA 3AW5A 2F53E 3AAZA 2FX9H 1GRWA 3MZTA 3VD2A 1A6UH 2HJLB 1I3VA 2VO5A 1QI3A 3HCVA 2NZIA 4JFED 4K2UH 1MH5A 2VDPH 1B2WL 1BVKB 1NCJA 2XA8L 4FRWA 4NN5B 4UDUA 4NXSA 3SGDH 2OL3B 4IRJA 2UZXA 3Q05A 3MA9L 2NOYA 1T5KA 4PW4A 5FO9B 1QPKA 1MFCL 2WBKA 3FQ1A 4GBXB 1TZAA 3IGUA 2F0CA 1XXDC 1QZ1A 4JQVA 4JB9H 2QQQA 4B9CA 4LIQH 4YFEA 1GZHA 1XSOA 3LEYL 4MS8C 4GSXA 3P4LA 3GS0A 4X6CE 5T3ZH 2MFNA 1RJZB 4B60A 3T6WA 1RK1A 4F9PC 4ANWA 4AQ8C 1R4XA 4UM8A 1N59B 4KU1A 1E7UA 1K4DB 4I13B 1ZHKB 3KDMB 1F02I 4G9FD 1RZKH 4MXQC 1KTJA 3HE6D 3D69A 3RWIA 3QXUA 2BMKA 1ZHLA 2JKXA 1EAPA 3AG2B 1NKGA 3FUHA 3N41B 3W0WD 4ZFFB 4RSYA 4P23A 2F5AL 3D12B 5I71C 2XHNA 3TV3L 3FMGH 3HRZA 2GCYA 1CFBA 3AROA 4LHUD 4MNHB 1QSFA 1JF1A 1QBML 4QRPA 5HDQL 2C7UB 3WKML 3T4AA 5I1CH 2P46B 3CH8A 3F7LA 4KKAD 5F1IA 4CN1A 2DQIL 1DTUA 2Q87A 4LNRA 4DZBB 1L7TL 1D2OA 2NY0B 5LN4A 4I3SH 4QXUL 4X4ZA 3GJEB 4TUOB 4RH4A 1D5MB 3E80A 3H9SD 2H45A 3D07A 3MRGB 4ONGH 1E3FA 4P4KD 5A40E 1AGCA 3UO8B 4G70B 2PO6A 3OR6B 4N24A 1PZDA 1X7TA 3PIQB 4LPTA 1B4LA 1B88A 3PJSB 4NI3A 5FS5A 1OARH 4R26H 5LVEA 1HIMH 2X4QB 4UT9A 4K94C 1PZ5B 2YOCA 5D1QD 3MCLL 1NM9A 3U6RB 4DP7X 1UD6A 4H5SA 1G7LB 1F4WH 5DHXB 2AK1H 4NBXB 1OM9A 4ZMLA 2HRPL 3O41B 4YHNA 2IFGA 3ZYOA 4PP1C 1S7SB 3QYCA 4HV8B 3GLEA 2ARJQ 3ELAT 2WXIA 4HGWB 2CBPA 3TVMC 4G8AC 1KJ2B 4HOWA 2DLFL 1XGTA 2AERT 1A66A 1GOGA 4HKJA 1I8UA 3QZMA 2KYIA 1S9YA 35C8L 2MKWA 5DZAA 1N26A 5KZCB 1QWHA 3L3GA 3MV8D 2KPNA 4I0PB 3P30H 4L1DA 5JIKA 4FNPA 4Z0XB 3V0WH 5ECGA 3TPKA 1S5IH 2WNKA 4MQTB 4YWGH 4KZDL 1T5XB 2H1LM 4HIPA 4J3BA 5GS0L 3DPDA 3UG4A 1AI1H 3EIFA 3A6BH 1Q9WB 1OGSA 4KNQA 5B22A 4Y1AA 5HGDA 4CVZB 3RL1B 1HFUA 3S5LG 2HJKB 2VDNL 3PU7A 3QEHB 5IZ7A 5E1GA 1CWVA 3PFUA 5EZIL 1G7PA 2VT0A 1OLLA 2Y72A 4JANB 5ESAA 1JGDB 4IBUA 3ECUA 1L9NA 5JIIA 4KUZL 2NY4C 3C5JA 3MA7B 3PGDB 4JQIL 4QKXB 1J5CA 3VD5A 3HVNA 2AQNA 3FCSB 1NBVL 3OWRA 4P2AA 5CP7B 1WT5C 4YEFA 1MF2H 2EH7H 3DSNA 2OJEB 4XP4L 1NC4A 3O3DA 3PJNA 3U9PL 4N1HB 2N01B 4L2LA 2PR9A 3H8NA 3IJHB 3VW3L 1WLHA 2A9NL 3EYVA 2GJRA 4BQ6A 2V7NB 3QDJD 1LXMA 2VXSL 1DO5A 4K15A 1Q1PA 4LLMA 4ECNA 5L2JB 1IGMH 3VXMB 5I6LA 1OPGL 4K8RD 4PRNB 3UTZB 5AW2B 1HYRC 1NA8A 5F7EL 1U8NA 5IY5B 1IM9D 4ODXA 4DGIH 4PAZA 2OMTB 1CL7H 2YSSB 5J9PA 4NQDD 2NUTB 2HT4C 3PABB 3GD1C 1Y1DA 4N4YB 4MCZB 4JE0A 2C9PA 2K1MA 3IMSA 5J89A 5D93C 3AT9A 3SPCA 3B7TA 3TPUB 3GSXB 5DI8A 1NCDL 2LU3A 4M5TA 4W9IC 4X8XA 3DOIA 1Z9NA 1XAUA 5DXWA 5A2AA 3RGVC 1WAAA 1E67A 1IZJA 5AYTA 3D7PA 5L6YL 1KCVL 3ZKSD 2RFXB 2Q86A 4P3DA 3PP4L 1BFOA 2Y1AA 5D1ZA 4ODWB 3VFSA 5DO2D 3O3EB 1U8HB 2A74C 2N7SA 3HBZA 3L5XH 3R0NA 5IROA 1OSPL 5HBBA 4NKDA 4TUKL 5EU6A 1TEYA 1BQHB 3H42L 3H7BA 1YDPB 4MCMA 4DGYL 3UTOA 5GS1A 4BHUI 2UVEA 5I28A 3A23A 3EOTL 4DHLA 5J6HA 3I6SA 1YQVL 1CN4A 4NP4L 3OKKA 1GW6A 1ZDSA 5DJZB 2XWZA 2K0RA 3IFNH 1N0LB 2IAMA 4L3EB 2NNAA 1WAAF 4I89A 5EIQA 3D2TA 5KVGE 5I8CA 3HPJA 3OF6A 2FUTA 1F6LL 1GGUA 4Y19E 1MI5B 4CNIB 3QBTB 1DJWA 1JDCA 4XO8A 2M83A 3FB8B 3VUAA 4CW1A 1Q72H 1WWCA 3CVHH 1PZCA 5E4AA 1M05A 1MJUH 4JY6B 4NO5B 5F0JB 2AI0L 4UV4H 1ZEAH 2GTWA 2J1WA 5E8EA 3HBGA 4X6BB 4NQTA 3W9EB 4OLWL 5MERA 3OB8A 1CICB 5FYJD 3U2JA 3HAEB 4AGQA 4JS7A 2D03H 5A1AA 5DZPA 3OMNB 1BQHG 4JQXA 2WXMA 3HS8A 3LKNB 3NN8A 3MYZA 1LO3L 1A1NB 2ZAIA 5E6UB 4FA7B 2BWQA 3DRQB 5FOBA 3BN9C 2ZUUA 3DO7B 2HH0L 4G59C 2CRZA 3ZE1F 1NDGA 3SKOA 3B5GA 1HH9B 3U83A 2MOQA 1RJCA 2BIMA 3QFJA 5ALCL 1XH3B 4QHUA 1C8QA 4ZPVA 5T1JA 4N2LA 1JPST 2X10A 4LESA 2W0FA 4LQFL 5DJAA 4XO9A 1BXUA 2JV6A 5E9DD 1HHKB 2EDEA 4Q97A 2XG5B 2EXWC 4XMKL 4D7BA 5IMMA 5J11C 4U1HB 3MLSL 1KUMA 3FT0A 5CSZB 3QISA 5L0QC 5F8RC 1TVHA 2IC2A 3UP6A 3D25B 2WZ6A 1QFUL 1PPIA 4BZ2H 1PJ9A 3GF8A 5BUGA 4B5ZA 1J1XL 3MRLB 4K7FB 4O4YL 2B4CH 2QTEA 3WLBB 4PLKD 2B59A 4FFYA 5EN2A 5DMJB 2KDGA 2W0PA 3OKOA 3ZYZA 1ADWA 1IC7L 3LKQB 5EWIH 4MJIA 5I19L 1YZZA 5FECA 4UV7L 5E6IC 2G2PA 1MCLA 1JZHA 2X2HA 4OJCA 5IG7A 4L8SC 1TYEB 5FIEA 5C0ND 4YLCA 1L7IH 1W8EA 3WI9A 5I16B 3HG1E 1TJIL 2L7UA 4ANVA 1LK2B 3PL6D 4HCIA 3EYUH 1CZ8H 1KY7A 4MWFA 2WO4A 5I5IA 4U7KA 4DNLA 5CZVL 1XVSA 3T0VA 5FLUA 1PFCA 5TH2A 4OTXH 2K7QA 5E2VH 4NI6A 2OMYA 4YDLB 2X6AA 3ATDA 5FUCC 1DJHA 2OSYA 3OHXA 3KYMA 4RFNC 3MOAL 4UAOC 2WQ8A 4YPGB 1K6QH 3ZKXB 1S9WB 2O5YL 5GGTH 3L3HA 4C83B 1NAKH 1XMEB 3GFUA 1JK9B 1U92B 2IQ9L 4XMPH 5K33A 4R2GD 3RVTC 1LP9F 1MCKA 4YHYB 4XXWA 4GSUA 1AQKH 1D9KC 3OAYK 4O2CB 5EBMA 4XNXL 2P5EE 3NIDF 3ROLB 2AXGB 4FF9A 2FJGA 4HKBB 4X4YA 1NWPA 3CXFA 3V6ZA 4UM9A 4OAWA 4LU5L 2FT6A 4XO4A 2VR3A 2D0HA 3HFMH 3X14B 2XQBL 2ZOUA 4PJXA 2F54B 4MB4A 1KCRH 2X4NB 5FGCE 1F18A 5IVXE 2E27L 1A3ZA 3LNEA 4FQPA 1AMYA 4PGBA 2ZUYA 3ARGC 3SDAA 3VYOA 3O8XA 4KQ0A 2LQRA 5CJXA 3KE0A 3V4PL 1TYJA 3H3PH 3GEWB 4YSUA 5CEXA 1OAYL 1AQDA 1J1PL 3U4EA 2H3XC 4HPYH 3DHUA 3KPRB 3AU1A 4PJ5D 2ZPKL 1L9TA 3B2PA 4XMWA 1CD1B 1MFBH 4FFZA 3NABH 4NERA 3UJJH 3TCLA 1IMHC 3UBXB 4X5QA 1P53A 1BXVA 1J9SA 4OZHE 2G2NA 3TURA 2JCCA 4EKXA 1MPAL 1DQML 3V0JA 5C0CB 2QSCL 4Z9KB 5I6KA 2GAZA 2EAEA 3L3JB 1U36A 2WMPB 2HT3C 3BAEH 1M71A 2X7LB 4OM1H 4PJAA 5EO1A 1YAIA 4PJXF 5C6PB 1Z9PA 4R97C 2CJUL 2F8VA 2AEOA 4B9YA 4GRLC 5H37H 4HCGA 1RZ8B 2Y3NA 1RHHB 3QUZD 4CVUA 1S7UB 4WU7A 3Q1SL 4L37A 4RAVA 1SY6L 3ZRSA 2C9XA 3WEBA 1J5OL 4LASL 3B1TA 4CBZA 4IBVA 1K2DB 1JNJA 5GXBB 5C0JA 1LEGA 2EIZA 4WDIA 3OB0H 1H3VA 3SKMA 3D50A 4JZOB 5EH1A 3VG9C 1ZWIA 3IDIB 4KO9A 1Q0XL 2IPTH 4M02A 3T2OA 3QJTB 3AACA 2OMUB 2JCCF 4PS3A 2ZOTA 1P7KB 4XPHH 4HXBH 3VWKC 5EBGA 1E6OH 1CK0L 3PNRB 1R24B 5GGUB 1J0YA 1YUKB 3QIBD 1HSBB 1QI4A 3QDGA 3CXDL 1SXZA 1ZPLA 4YDIL 3UBXG 1KTKE 3RPBA 1JGVH 5AEAA 2WXNA 3O4LA 5C9JB 2FZ3A 3MLVL 5FGBA 3ULVH 3RDTD 4HJTA 4NGHH 4OGAD 4BD4A 5C0AA 5IJVA 1J8SA 3L6FA 1KYDA 1NICA 3QQDB 3N43F 5D7IA 1MWOA 5I1IH 1GR7A 4JJHA 4KTGA 3UZVB 3QEUA 3QULB 1BYOA 5F7LB 1RVFH 1OTTC 3FFCE 1JZIA 2GIXA 3PDDA 4ZT1A 1F4YL 1IM3D 4KOCA 1SDDA 4OCSL 5L2KD 5EU5B 4M61A 1XB3A 1YEGH 3SCMD 3C8HA 3RIAF 1BDYA 3WAKA 1OB0A 5IV2B 1IC5L 2CD0A 5KBNC 5DTFB 1EVUA 3DJSA 3LEVL 3OQRA 3VCLA 4AYFB 1ACZA 5D9SA 1U3YA 5C3TA 4U33A 2RA1A 1FYTA 4PW9A 1OAXL 5AVWB 5CGYC 4APXA 3BH9B 2Z91A 4FI6A 4GS7C 1A3QA 3RTQC 4YHLH 43CAA 4KROC 4EN3D 2CLZB 3BWUC 3TBTA 3W11C 3B2VH 4FA8A 3GMMA 4XX1G 3KBEA 4F27A 3VRJA 4FE9A 5D7IF 3LX9A 4OT1L 5IOPA 3QHFH 4OZ4A 4EZJA 1F11A 3H4HA 3N85L 3OD3A 3VX0A 4A7TA 1XGQA 1S9VA 2NCEA 3FSWA 3C5ZA 1NMAH 1NFDE 1VFAB 2OX5A 1KG0A 3QUML 2IBZY 2KPWA