2ZKWA

Crystal structure of human cu-zn superoxide dismutase mutant g85r in space group p21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
149
Chain Sequence
b'TKAVCVLKGDGPVQGIINFEQSNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of human Cu-Zn superoxide dismutase mutant G85R in space group P21
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 38
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zkwA00
1YSOA 2K4WA 5CU9A 1TO4A 2V0AA 2WWOA 4B3EA 1IBFA 2WZ6A 1YAIA 2XJKA 3GTVA 2GBTA 2AQTA 1EQWA 2E47A 1N19A 2JCWA 1SOSA 2C9VA 1SXSA 1SDYA 2WZ5A 1U3NA 2E46A 3CE1A 1F18A 2WYTA 1COBA 4BCYA 1SRDA 4BD4A 1SDAB 1B4LA 1MFMA 2AEOA 3KM2A 4N3TA 2ZKYA 2AQRA 3ECWA 1IBDA 2WYZA 4L05A 4A7VA 5KBKA 3QQDB 4A7QA 1SXBA 3LTVA 3SODB 1PU0A 1HL5A 1SXCA 3KBFA 2ZOWA 1JK9A 1ESOA 2XJLA 2AQSA 2WKOF 1TO5A 1DSWA 1Z9NA 3L9EA 1AZVA 3F7LA 3PU7A 1F1AA 1SXZA 3ECUA 1SPDA 1UXMA 1HL4A 1L3NA 2C9SA 3CQPA 4MCMA 2C9UA 4FF9A 4MCNA 2JLPA 3KH3A 1XTMA 4A7UA 1E9PB 1PZSA 2VR6A 1E9QA 1IBHA 1B4TA 2Z7WA 1CBJA 2VR8A 3GZQA 1QUPA 5KBMA 1OZUA 1F1DA 1XSOA 3MNDA 3HW7A 3GZPA 2ZKWA 1E9OB 2WZ0A 4A7TA 2R27A 5KBLA 3KH4A 2Z7YA 2Z7ZA 2LU5A 3HFFA 3H2PA 1Z9PA 1BA9A 1Q0EA 3ECVA 1YAZA 1XTLA 2AQNA 1FUNA 1OALA 1CB4A 1SXNA 2VR7A 3HOGA 4OJAA 1OAJA 3QQDA 3CQQA 1OEZW 2NNXA 4BCZA 3GTTA 4A7GF 1S4IA 1BZOA 1P1VA 1PTZA 1E9QB 2WWNA 3RE0A 2ZKXA 3T5WA 2SODB 3MKGA 3KBEA 1N18A 2WKOA 1IB5A 3K91A 1RK7A 1JK9B 4N3UA 4OH2A 1E9PA 1OZTG 1UXLA 2AQPA 3KM1A 2APSA 2AF2A 2Z7UA 4U4IA 1EJ8A 1JCVA 2Q2LA 2GBUA 2GBVA 3H2QA 3S0PA 1IBBA 3F7KA 3GZOA 4A7SA 1E9OA 1KMGA 4A7GA 1F1GA 3L9YA 3GQFA 1DO5A 2AQQA 1SXAA
chains in the Genus database with same CATH superfamily
4JRXE 4A2MA 4UMSA 1RULL 5D7HA 3SKJL 1XL6A 3G5WA 4KNUA 2Y4SA 1MCIA 3UBXB 3N91A 3EJYC 4NO3B 1QVOB 4DJMA 3D0AA 2EDOA 3K2UL 4JANB 1J11A 4PCTA 1Z9SA 1BPLB 1RK1A 4U6HB 4PRPA 5J06A 3KXFD 2FB4L 3W0WE 3P4OB 1GOHA 3QPQC 5F6IB 4UYPA 4KK5C 3ZJAA 4PS4L 5E2WL 3UCQA 1YEHH 2QKSA 4AMXA 1QLEH 3DROB 3RWCB 4OLYH 3D12B 4KUZH 1U8QB 1QLRB 3G5ZA 4LOFA 4O9HH 3SKMB 4PJ9D 4Z0XB 5T1MA 4D9QE 2E9BA 4PGEB 4D8OA 3WE6B 2FX8H 1GYAA 3ARGB 2DD8L 3N1MC 1WPCA 1UWEH 5EO0B 5DRWB 1DUYA 1OW0C 1D9KA 4MNGE 2UUDK 1L9SA 2C9UA 1BWWA 2ICCA 3G9AB 2JQZA 4M9OA 3ZQ9A 3SBWA 1R3HB 3UG3A 1IC5L 3WNMA 4UT9A 5IGXH 3QNXA 4QGTA 1E5CA 1AO7E 5T3ZH 5D1XE 5DDHA 3BZ4A 3NSCA 3CLFH 3DWTA 1IM3D 1MJJA 4DP4X 2WLMA 1EVTC 4I9WE 2OKMA 1EJ6A 4QOKE 2PW2A 3V5KA 4MQTB 3TWCH 3FT4B 5MEND 1FN4A 1BYNA 4JJ5B 1Z9PA 3NFSL 4DH2A 4HXBL 4FNUA 3QUKA 5FKPB 1BG1A 2XSKA 2V8LA 2WXQA 1HESA 3CD4A 1C5CL 3LEVL 5E1AB 4LLQB 4L2YA 3SDDB 1WS7A 2DMGA 1JDAA 1NCBL 2VUKA 1PSKL 2BRRH 2C8NA 1JHLH 3KPSA 3QCTH 4I2XA 3UTZA 1ZHKA 1WZAA 1KJ3H 2CLZA 2VXQL 3GKZA 4FNLL 4KKNA 3V0JA 2YR3A 3U82B 3TO4C 1WD8A 3JQOB 4Z3JA 3M1BA 3MRKA 5EZOL 1DJSA 2DLEA 3PQYE 5CD5C 1TNMA 2WUCL 3SKOB 4TSBH 3CPLB 4OAWA 5AZEL 4GY4A 2E7HA 3HJ0A 1OE1A 4P2OB 1SVZA 3A4FA 3VRJA 2AABH 2WP3T 4JN1L 3BZ5A 4GLRI 2G3XA 4R0LB 1HWHB 4H88L 1V7NH 4PGZA 1T20A 4TRPL 3TZVB 4B9ZA 4H4NA 4A7GA 1CLYH 2QELA 1UACH 3IJ7A 2NY4B 3TT1L 5CCKH 3QFJD 2APVA 4J4PA 2ADJB 3SYQA 3LXBA 2WC7A 5DRZB 3KYMB 1N2RA 5BRZA 4M7KL 4UT9H 4FQ1L 4M43L 3RWHA 3UEQA 4OJYA 3TXAA 3FAWA 1YMMA 5FK9B 2HT4D 3CUPA 5D7SL 2EDYA 4XGZB 2D7NA 5D2NE 4YFEA 2YD3A 4L5FL 4UTBL 5E00A 4JPKL 1XCQB 3WAJA 5BV7H 5CSBA 3X14A 4U3HA 4OQTL 4KKBD 5DRNA 2VXUH 3V4UL 3P3TA 3A6BL 3VFSB 3A22A 3H8NA 4QWWC 3I74A 4OJFL 1W16A 2PTTA 4UQIM 1JK9A 1I75A 5T8IA 3LQZB 3VI3F 4X6DE 2BP0B 3F05A 4FN0A 4D9LH 5AVRB 4IKLA 2C9SA 1FORH 1HINH 3DUSA 3VNYA 2VQ4A 3MXVL 4LPVA 1U93B 4V1DE 4GI8A 3LKNB 4EXKA 1DFBL 2WQSA 1YJDH 4GIPD 4XI5D 1XD0A 1XZ0B 4EQ2A 1FNHA 3KS0H 2FEJA 1BZ9A 3RDTD 1KGIA 3LZPA 4CN4A 4M61A 3DO7A 1NEZB 2DYPD 3DVIA 3EDDA 1TQVA 5J56B 2Q7AA 5AW8B 3OXRB 3T6WA 2EVJA 2WBKA 1T6VN 1PNDA 2XIBA 1TTAA 2BP8A 2PO6C 2B5IB 5DJYB 2VT0A 4XWGH 4ZNEE 4GXVL 4F57H 4XHJC 4X7SL 1MI5E 1D7CA 4H2CA 1SBSH 3MJ6A 3GJEA 5AYTA 1CFVL 2O5NA 1MVYA 3NJXA 4J3BA 4MA8H 1LEGB 1ZVHA 4JFDD 5C92A 2HWZL 2EIZB 4UQ2A 4X80H 1JZDC 3N42F 4GXUN 2XRAH 2VQTA 3MGOB 3O9WC 2CALA 4CAGA 2XVKA 4XCYB 2VLKB 1NICA 5L8LB 2Z93B 3SDYL 1NDGB 4IRSC 2DJMA 1QLFA 1RJCA 1A6ZA 5K39A 1AC6A 2YPVH 3ARWA 6FABL 2Z31C 4AV4A 2XIDA 5F7DA 1Q72L 3CHSA 4Q9RH 1PG7L 3UGXA 2DQJH 1Q94A 3EJZC 5T3XL 4YXHH 2WXKA 5FYKH 4BRJA 2DLFH 3L5HA 4BEIA 4BYHA 4FQXA 4X7FC 3CSPA 1X44A 2GJ6D 2QVTA 1S7SA 3BAKA 3LDBC 2FATL 1OCWH 1UT9A 2R83A 3ENEA 5ESAB 3VU2A 1HKLL 2BSRB 1I1AC 4GRWB 5ISZB 3G5XA 3F01A 4OLWH 4PJGE 1EO8L 3MGTB 4KZDL 3S3JA 3SQBA 5KS9E 1GMEA 5EULV 4XBGB 1VKXB 4ORGA 2XV6B 2VRQA 1BEXA 3P3RA 1J86A 3BI9X 3NTCL 4LCIL 1LEIA 4MJIE 1NLDL 3QJHA 3G08B 4GEJA 1IKNC 4WHYG 5MEPA 4M3HA 1BQLL 3B6SA 4AGNA 1TEYA 5CJXC 5C0FB 4QHUB 4JPSA 1ASQA 2KUTA 3LIZH 2EABA 4OGQC 1MPAH 2ZICA 1U8NB 1JZEA 2V17L 1XH3B 4AUJA 1U8MA 4LQFH 1GGBL 1Z3GH 1PLGL 3NIGF 5DLMH 4HJTA 5A16A 3CQFA 5I0XA 1XV8A 3RZCD 2IXQA 4H8VA 1CWVA 1CD9B 1HOCA 1IZKA 2ATPB 4C83B 4WW2F 4TNEA 3DX1A 4PRIB 1ZJAA 4FQJH 3B1TA 3BUIA 4UI2A 1FO0B 4IBWA 1E5YA 1RZIA 2QDVA 2GJZB 3OAYH 1CFMA 2DIAA 1SY6L 2XKUA 5HI5D 4HGWB 2V3EA 2ZXQA 2CIIA 4HUXA 4P2YA 4YHKL 1RH8A 3N43B 4PJDF 4JFQB 4JM4L 3BSZL 3D33A 2QPEB 4DQOH 2FUTA 3DMMD 4MFHA 2CJSA 5DUPH 5CJ8A 3VH8A 5B4MC 4JPVH 2H47C 4FD0A 1UB6B 3MROB 1SOKA 3ILQD 3SB3A 1FDLL 2OP4H 4HQQL 4JQIA 3T3MB 5CSGA 3WY4A 3U83A 1E3ZA 1UB5A 3CLWA 4PD4J 1OQOA 5EORL 4BFGA 1EDQA 1J05A 4X0KB 3V52H 2AP2A 3QIBD 1QAWA 1UATA 1TSRA 5JR1L 5I1KH 1W0VB 1Z1WA 1MVUB 3GM0A 2E8ZA 3APMA 2ZPKL 1A3RL 1RZJL 5DJ2B 4JZJC 4K2UL 4F2MB 5LG6A 3BH9B 1TTGA 1T5XB 1OSPL 5C0BE 4UIMB 4PUBH 4XOAA 2JIXD 3VD3A 3SPHA 1TU2B 3TP4A 3HC2A 4LDCA 2WTRB 3J7HA 2R39A 5HHME 2OK0L 4P2QA 3IJEB 4TUOA 1BZ7A 3BLKA 1JGUL 2ADGB 2EDWA 3C60B 4KK8D 3NIDB 1MIML 4KO6A 3NCFB 5H8DA 1LL1A 4BA0A 1T0MB 4EOWL 2FJUB 3IYLW 4NKOB 1NTDA 1P5UB 2DQCL 3SDXA 3WFEL 2HLEB 2G2RA 2P80D 2AGJH 2I60L 5D7IF 3LEYL 4K5OA 2VSDA 1E27B 3O3AA 4G42A 3TS8A 1CL7L 2LV4A 5I9QB 4TVUA 4UQEA 1CS6A 4RFOL 3S9DB 3L3DB 2GTWB 3UTPE 1OQXA 3WTTA 4FQCL 3GMMA 2W65B 3MRRB 4U1GC 4PVLA 4R7LA 5B8CC 3GSNA 4JAMB 3CFTA 5JNYB 4QJ3B 3RWDA 5JW5A 2ICES 2Z8VC 5KTEH 3EH1A 4FABH 3TJEH 3UTSD 1EZLA 3ZGIA 5AVZB 2R1YA 3BAIA 2H1PH 4P4KA 4FLRA 4BXSV 1U21A 5FM8A 3DBXB 4IBTA 1YPZB 4A63A 4BXVA 3RTQA 4Y9BA 2CHDA 4PJBB 1HE8A 1XR9B 2BS8A 2P44B 2O5XH 4ZQTA 7PCYA 2CQVA 4ZUUB 3MLPA 4MJ5B 3TT3H 1NOLA 2ALAA 4NQCD 4K73A 2YLKA 5KSVB 2DJUA 3QI9D 1IBGL 1Q90A 1BQRA 2J44A 3BJLA 4FFYH 3IGAA 3U1SL 1JXJA 2BVQB 4M8UA 1IJ9A 1Y18A 4FLHA 4KDTA 5C0AB 1KTRL 3DO4A 4HXAH 5C09D 1HHHB 1HZLA 3QUZC 1K85A 3IDIA 1MCOL 2CKBA 3JWOL 2O61A 3CX5J 5ECJE 4F7KA 4XN4A 1D5RA 5AAWA 3EUUA 2YUVA 4PTUA 3SOTA 5D72L 2QQKL 4GS7B 5J6HB 3MRMA 4Z76B 2KBGA 3FUDA 3P11H 5FHBH 3O3DA 3IDGA 4IRJC 5IBUB 1ORSA 4PRNB 3UABA 4G6FB 5C0ND 3VFOB 5HI4C 5I2IA 5I6MA 3L17A 3PJLA 1AP2A 3KVDD 4L4TE 2HCZX 3KL5A 3U79A 5GSVA 3U36A 4DEUA 4WKZB 3RDJA 3OM3B 3TVMD 3BUDA 2Q7YB 5E9DA 2Q8BL 4J3TA 3Q9QA 4YH6A 1C1EL 1CDUA 2QBWA 2IBZX 1EWHA 2AEWA 2YPLB 1A6UH 3GZKA 4MDIB 4KAQL 1GHFL 4DK3A 3VXSA 1N5AB 3TV3L 3IF1A 5BO0D 1SUJA 8FABA 1VFOA 3OPZH 4HK0B 4X6CE 2UZYB 2YHGA 4JZOA 3IN2A 4X98B 1WC7A 2EIDA 4U05A 1YN7B 2FE0A 3FTXA 5LQBH 5I0YA 2O72A 3NVQA 4X8JA 4AQ1C 1UH3A 2MQ0A 4G8FB 3FFCA 2AXFA 2EIJB 3RNKA 3U4BL 4J7RA 2OR9H 4JHVA 1ZDSA 4AMWA 4OI7A 2VRKA 2ZXGA 5CIPH 1DEEB 1KIRB 1UENA 3CXFA 3QO0B 5SWSB 2NUPB 2TAAA 1F02I 3VMOA 3DX4A 1HXMA 4PLOB 4AEFA 2QTEA 3K4ZA 4YDIH 5I8EA 5C6PB 2MKWA 3HRZB 3QDJB 2B4CL 4BFRA 2MCPH 3L3OB 4G72B 4YSDA 2CKBH 3U1QA 1CDJA 3BXNA 1SHWA 4PV8A 1PVHA 2IWKA 3AB0C 4BD4A 3EUDA 5BZXA 4G7QB 2WOYA 1DVFC 3HE6D 4MXQC 5H2BB 5L8JB 1OAQL 2EKSA 2FECL 1B88A 1SXBA 5AUMB 3EYUH 5I1DB 2VDRB 3QQ9D 4KX7A 3OKKB 3TA3B 4PJCE 1M7XA 5C7XL 5EPMB 4WK0B 1AGFB 3UG5A 2W9DL 3HZMA 2VRAA 3KYKL 2W0KA 4WFFE 1I1YB 4JRYA 1IIKA 1N8ZA 1S7RA 4MCMA 1XAUA 1R0AH 1DANU 2BIQA 2XQYA 5LLIC 2V9QA 2VZVA 6TAAA 1FIEA 1FFNB 2RIKA 1HDMA 1FFPA 5MENE 4XXWA 3DK0A 1JGVL 1FVDA 1ZV2A 2CG9X 1CZ8L 4NUPA 4Y19B 5JIPA 4S1QH 1QG3A 4X4XB 1QFUH 4APQD 1AXSB 3GZPA 3CVHH 1KIQB 4ODHL 2FD6H 3U9PL 2NNAB 3D07A 5TF1L 4WU5B 4N9GA 3ARDC 1A1NA 4GQ9H 4LXFA 4P5MA 5K9KB 2UY6A 2OQJA 2K8QA 1EHKB 3DV4B 2QV4A 4OI8A 3M86A 3ZDYB 1TUPA 2WBXA 1TQCC 4HIIA 4I18C 1N59B 3JV4B 1MFDL 1YEEL 5BOPA 5I19L 1XSIA 2HUEA 2VKXA 1Z9MA 4L3EA 4LKCA 3UX9B 2IPKA 5F89B 5IQOA 1KBGL 3QEGL 3FCUB 4OU3A 2D73A 3VA2C 2WINA 5F97E 2G5UA 3ZZSA 2FH8A 1DSFL 5IW6B 3GM8A 4JKPH 2EYTB 1XGUA 2EC9T 2OJZH 4AE1A 3EOAB 1RZKC 3VFUB 2ZJSH 3OAUL 2G5RA 2IWFA 1WAEA 3ULAB 3WO4C 3MGAA 5I30L 3BWAB 4EF3A 1FL5A 3QFJE 5FYJD 4HWNA 1X7QA 4DGIL 2KLTA 4W9EC 5MEOB 4XVSL 5ACLA 1INQA 1NH6A 1TZHA 2YIHA 4YFLF 2IPUG 1PDKA 2CBOA 3QUYB 3LV3B 1T89C 4N8CL 1IBFA 3SPIA 5J1AA 1NFDE 3QULA 2XWZA 4XC1H 2A6JA 4DKAA 3HMXL 3AXHA 5C08D 1T0NB 3GHEL 3VFTB 1F5WA 1JV5B 1DQLH 1QSED 2WLJA 4QXTA 4F58H 3SGKC 1PZ5B 3R7RA 2ARWA 3IPEA 3DVFA 3MCKB 2H9GB 4FXGC 2WBJC 3EJUA 1T2QL 3FONA 1RJYA 5IUSA 4NSKA 1G9EA 4JFFE 4JRXB 4E5XA 1PAZA 5DVLA 2EDQA 4WNQB 4DKFL 3NABL 5IW3A 4HIXL 4QY8B 5C6TH 4I5BB 1UA6L 3UCRA 4JO1H 1M2VA 3IDMA 25C8H 4KH9A 3G6AA 1GXEA 3RLSA 3AXLB 4I7ZC 5CGMA 4AGPA 1E4WL 1R6VA 2RACA 1TZIB 3W0WB 7TAAA 5L2KE 2E56A 3VFMB 4JS7A 1I9IL 2BVTA 2LFGA 4K3EL 1J1OL 5I23A 1AZCA 5EH1A 2J1YA 4HWBA 1T4WA 2J1KA 3CMOH 2YXFA 1UHVA 3FTWA 2P5WE 4L3CB 1HXYB 3DUUB 4XPGL 2DH3A 3TBTA 1BIIA 4NKQB 3VI4E 1OAZL 4Q6IC 5MHSE 1P5VA 2VJ8A 5DSCB 3HFFA 2HUHA 2P9RA 3DTDA 4F9PA 2D2CC 2JMRA 4TULH 4MNGB 2APXA 4JFDE 4XP5L 4RMSA 4ENZA 2GCYB 4PJ7F 4U6XB 5INDB 3P9LB 5IVXA 2R7EA 1AO7B 2A74C 4P9ML 3B7SA 5GRZA 5IQLA 1EJOL 2WSKA 1CFNA 5EMYA 2NT0A 2VDOB 3D06A 5DZ9A 2Y07L 1EXUB 4JO2L 3SDCD 3BZEB 2ZG2A 5EF2A 3VFVA 4QOKB 3BVNA 1XR8B 4HKZB 4ALAC 2PCPA 3A4DA 4Z7UF 1OHQA 2DQFB 1FC1A 2PWGA 1JXKA 1N12A 1YQVH 2GKIA 1WP6A 3QCUH 2GJ6E 5SV3A 5K9OB 5CMAB 1KWKA 1AJ7L 2VL5B 5B21A 3BQVA 5K5YA 3WXWL 3QRGH 3F7YA 2AJXH 2H45A 5FGRA 2DQIH 2Y7QB 2I7SA 1UA3A 5FYJU 4MAUH 3U6RB 3BISA 3RI5K 4BKSC 3PQYB 4P49A 4YC2B 4NNYA 4OLVL 2OMXA 1JXFA 3DRQA 4B9YA 2O1AA 1IU1A 1W91A 5D4JA 4TLKA 2PW1B 2EKJA 3LQAH 5BS0B 4OCWL 3WNLA 3F00A 1T2JA 5AOLA 1HL9A 4NUGL 5I5RA 3TO2B 4WU7B 1JF1A 1KEGH 2BS9A 3OMAB 3AGVA 3VGAB 2OI9B 2B3IA 1U41A 4H8WL 1SDAB 4HV8B 2CXKA 3U9UA 3Q8CA 4JW3A 4KJYB 2L7EA 1HK6A 2X05A 2DQHL 3OJVC 3E9TA 4LLUB 3JTBA 4UB0L 1MFAH 4WHCA 3OVUB 5DWUH 1MWAA 1IILE 4RISL 4CILA 5E6UB 1U4FA 2A4ZA 1NANI 3LNFA 4R90L 1T5KA 1BQHB 2AEIT 3O0RL 4HCIA 5IKCA 2BFVH 3CDGB 3G6JA 5CFHA 4MCNA 1TVBB 5DTFB 1PD1A 1DN2A 4XI5C 2MWCA 1E5AA 2X3AA 3GRWL 3CXDL 4HKBA 2MPVA 4WI3A 5D2NB 3WHE1 3AUWB 3VH8G 3FQUA 3MNWA 5DT1L 3IU4H 3UC2A 3CDCA 5E7BA 3OX8A 5DZAA 4WW1B 4ZUSA 4FMVA 3VCLB 3CDZA 3C08L 3BCFA 2YD0A 3O2WL 4NO0A 4YDLB 1B6DA 1RJZA 1U8KA 3OPUA 4L1LA 4NN5C 3CFDB 2XTJD 4X6DB 3TBCA 1FE8L 2XWJB 3GMOB 1I7ZB 2NYKA 4XTRD 3CFJA 2WLYA 2KPWA 4V1DB 3T65A 1T3FA 2FWOA 4B9PA 1XZWA 2E5EA 4JFYB 2DQUH 1A9EA 1JZJA 3QUMH 5J3HD 4HW6A 4F8LA 4ZUVA 2P24B 1IRAY 4PJDA 1NM9A 1T7ZA 4NNXB 1G4MA 1R5VA 1TTBA 1KBKA 4A6YA 2OMVB 2ZXEB 4GEIA 3S36X 2BZ7A 2DLGA 2OSYA 3RUGE 1R1CA 1A7NH 1B0RA 3T77B 3FQ1A 1F6LL 4NCC1 5IQ9A 3STLA 5T5FL 5T3ZE 1A1MB 5DHDA 3S37L 1YECL 5I74B 1S9KC 2QHRL 3BT0A 3MKKA 4UTAH 4MVBC 5IJKA 3NFPB 4JM2D 1MI5B 1C5DA 1JYXA 1K8DA 4J6RH 4DPCX 2X0WA 4ESKA 2W0PA 4XNUL 3GBLA 3LRMA 2VQ1A 3MRGB 3IXTB 5AAPA 2XDHA 3U30B 5IROD 5BW7A 3F58L 2A9CA 4YHLH 4GKSB 1PEWA 5DJCB 5E94B 3DUHA 4QGYA 2ADIA 3VDCA 3MJ9L 3SJVD 3U0WH 2XICA 5DD1H 3RAJL 1E5BA 1DVUA 1TJHL 1QQDB 3UTSE 1E40A 4WI2A 2XX0A 3AU0A 2X4TA 1MWOA 3V0IA 2CO3A 4JCLA 5IIEA 1KIUA 3P0YL 4AM0Q 5DHXB 1WA0X 3JV5A 4XX5A 3ARED 4DUXA 1G7LA 2X4SB 4PJEF 2CO2A 3OXSA 1WIUA 3SHSA 1FLTX 1FVCB 3NA9L 1HSAA 4YBLC 5SWQB 1HH6B 1T4KA 2BIHA 5AWNH 5D7IA 1MCHA 4JFPA 1IZJA 1P4LB 2J72A 4X8XA 1E6JH 1WAAF 4GRLA 4M6NL 3CSBA 2NZ9C 4PJGB 5FLUA 1JNLH 1O6SA 2BSSA 1F41A 5KS9B 2R4SL 3D0LB 4TSCH 4LCWD 1ZRUA 5C09E 3KR3H 4MSWA 4M5SA 2YBRB 3PWPD 5TH2B 2HRPL 4JHUA 4NKDA 2EACA 2OMNA 3T09A 4WI0B 1SN2A 2A9ML 5HI5C 1M1XA 4FQIL 1HEZB 2B59B 4QAWA 5F9WB 3BP7B 3GSUB 4KNSA 4A6YH 5HXMA 4Q9QL 4JFHD 3TCLA 1RSFA 5DJDA 3CU7A 2ESVA 4TNFA 3QBTB 5EZIL 2FEDC 2WCGA 2BO0A 4BFEA 5CN1A 4N2IA 4UNIA 4GRMA 5HHVL 4MD0A 4JFXA 2P8PA 3RJOA 5DZPA 2CD0A 3GMLB 2DLHA 4ANWA 3HUJE 3DX8B 2G4EA 1YRKA 1WCQA 3U4KA 1M7IB 3BP4B 2FQEA 3ERXA 4PP2B 3C8HA 3MX0B 1YEIH 3GSWB 3KMDA 3MXWH 4P23B 1IC1A 2VWEC 1OAXH 4XWOC 3WS6A 3QIBC 4WZ9A 1K8IA 4ABWA 4YAQA 2DKUA 1XGYL 2LGNA 2DBJA 1UADC 3NPZB 4BCZA 4WI7A 3BQUC 3MRIB 4PCYA 4U1SA 3NEOA 4KRPB 3V4VB 4OCYH 4B5EA 2WQXA 4JZNA 1RQ5A 2PUQT 3T2PA 3PP3H 1F3DJ 3MKGA 3TN0D 4IBUA 4Y1SA 4F7CB 5E5RB 3WUWA 4LL9A 3KWTA 1QTSA 3J8F7 1L9MA 1WEJL 2B15A 2Y7OA 2JJTC 3NEXA 1U3ZA 1E9PA 2BW5A 1MJ8L 4KK8C 4GSQA 1XT5A 4HGMA 1WLHA 2CO1A 2VITA 3WMSA 2X10A 3MTRA 4XNBA 2FEEL 4GW5B 4BINA 2NXZD 3KBPA 4ONFH 5DJXB 4LVEA 3SBPA 3UAEA 1H6TA 2NNCA 1DQQA 3FUJA 3SY0A 1ZGLA 5I1LA 5C0BB 3VWJA 2GQHA 5DZVA 2WYIA 1Q9KA 2F19H 4DW2L 4BFIA 1P84K 5HHMB 1IGJA 2V4LA 4QDGA 1E3XA 3WTYA 2P5ED 4DUWA 1S5HB 1T22B 3X3FL 3QHFH 2Q6WA 3RVUD 1PX4A 3S36H 5BRZE 5D9SA 2IDSA 3LHPL 4OUUB 4XNYL 3U1PA 4UYQA 4IU2A 1ZANH 2LHAA 3AS1A 2AVGA 3D2TA 2AJZB 2IQ9L 3Q8EA 1YMME 1TJXA 4NPKA 1FH5H 2JK5B 4OIBA 2OAAA 1OWRM 1U3HC 1EV2E 3IJHB 5I82A 3OV6A 5KEZA 5CCJA 1MDAA 1OD9A 3D18B 3VXRE 1M2OA 5J1SC 2YZ1A 3PL6D 4JHBA 3ESUF 4KTEL 4Y1AA 1F4YH 3P1VA 5DS8A 5FYKE 2MCG1 1JOIA 4Y5XC 3TF7C 3VU1A 3ATFA 4BFKA 3F12B 2VC2B 1U6AL 4U1MA 4LLWA 3S3CB 3TEXA 1P7KA 4L18A 2VN3A 4WEMB 4X7EC 5C3TA 2Y6TE 1XD1A 3OC5A 1WWAX 1QWUA 4OIIL 4MMZA 4WO4B 1UWGH 1L9PA 4YBQD 4ZYKA 4YS4A 4FL4B 3ZUCA 2D0GA 3HI5L 3HFMH 1XGZA 4CSPA 5IM7B 2FTAA 4EI5A 1BGXL 1BFTA 1JGEA 5I1CH 4JREB 4NZRL 3LKQB 3RVWC 2Y06H 4M6AA 4H25A 4OGAD 1K6QL 3X1EA 1LQBC 3C5XA 3FT0A 4G8IB 3MLUH 4F8OA 5C0NC 3B9KA 5CEZL 4DVBB 1U4EA 4WGWB 4X9YA 4LCCC 3QDMA 3ULVC 5G4OA 2HLFC 1NIEA 4I0PA 5TE4H 5D2LE 1OAKH 3H0TB 4MZ3A 1A3LH 5HDRA 1LNUA 4M8VA 4OZIA 4YDVB 2K78A 35C8L 1ACCA 3FOLA 3T5WA 5F9DC 1T66C 4RMQA 1QWNA 4P3CH 1EMTL 4OZFA 5J13B 1U0QA 1MVFA 2MTPA 1EFXD 4O02L 5FYJE 4DOHB 3EYSL 1NIAA 3WJJA 1Z2KA 5KVGL 1UFGA 3VWKD 2D03L 4DESA 4NQVA 4OH2A 4XNZB 4XHQA 4N0YH 3PLYA 1DE4B 4JKLA 1VZGA 5I1JH 4L4TB 2UWEE 1MF2H 2GBUA 1IQWH 1I3UA 3T04D 3D51A 3FH5A 4RMVA 1DQMH 1OP5H 4APXA 3NACH 1JDCA 1A7QL 1HSBB 3H4HA 2P43B 1G6RB 3HPLB 3PDGA 5L9DH 3FCSA 4XCNA 5JQIB 5BO1L 3OAZH 5GSRB 1R17A 2VAAB 2XFGB 4H13C 4OLZH 3ARUA 4U1JA 1A65A 2UZPA 1JPGB 4ELMF 4LOEA 3O6FD 1E6OH 4UM8A 1E8YA 5FM5O 5HYJE 3UBFA 3ARPA 2YQGA 2DDQL 2E46A 2X4OA 2ZXBA 4HPYH 4XNMA 1H8SA 4J3SA 4PGJA 1ADWA 1OB1A 2AV1A 2IWGA 5EZJB 1BYOA 3HE6C 3KPNB 4N68A 4E5XG 1AI1H 4L05A 3H42H 5TDNA 1Q1JL 1PYWB 1FPTL 2I26N 2VZ1A 2R1XB 4E9SA 4XRCA 4F7EA 1DSWA 5CHNA 4L3FA 3QIWA 3BN3B 1H3GA 1IGYB 1QYGL 1I1FA 2EUWA 2JKTM 3O45A 2QLYA 1ETB1 3LKOB 4UQDA 2AZAA 2DIEA 2PETA 4PJ9B 2UYLA 5T1KA 3RX8A 4G7VH 1CFTA 4P59L 2HFFA 1HAWA 5D1ZD 2R51A 5LJYH 3C2AL 2HVJB 4Y4HD 5IMOB 3VXNB 3KPPB 1A2YA 2CK0L 4P5TA 2IAMA 3I6GA 4PJCB 3SKUD 2FIRT 3QXAB 4FCAA 4L29A 2JQAA 1RZ8A 4ZO8A 5LAPA 3WCYA 2FT8A 1C8QA 1GMIA 1IM3B 4CNIA 4HJ0C 5FKAB 4WUUD 4G6KL 1GIGH 2WM0A 2ZOLA 3LIUA 1T03H 1RUQH 3FK3A 4HD9A 5EN3A 1RU9L 2WCSA 1JF5A 4U1KB 2NRDA 3U7YL 3VFRB 3MLVL 2WHVA 2PYED 3NJMA 4XPBL 5MENB 1KEMH 1OAJA 1LGVA 2LABA 4KQ4H 2J3SA 1KACB 2B1OA 1ACYL 3BWZA 4OVUA 3G6DL 3Q8FA 2F8IA 4L9LB 4NWUH 4QLRA 3HC0A 2XN1A 4S1SL 3V6OC 2CDGB 3WMPA 4ZX6A 3WIFB 2YXVA 4M5YH 4N2OA 3KDMA 5HPOA 4N20A 1FVEB 3L3JB 1RIUL 1EHNA 4HC1A 3E38A 4HLJA 4PJ7A 4ZI8A 1P53A 3MRLB 3NIFE 5EN2A 2CUIA 1J1PH 5K33A 3A0OA 1AGDA 1NAMA 2X89A 5ALBH 4L8SC 1RZKL 3SDXE 1FLRH 1HCYA 3MA7A 5IG7A 5AL8A 2IALB 4XMKH 1YEWA 3IMSA 1EJFA 2EYRB 3FO2A 4YDZA 2ZAHA 3CLEL 4JDZB 4HWEH 1WCBA 1CD1B 3FUNA 3V0VA 4E41A 5L4IA 2F5AH 4GP8B 5TK4A 3CZFB 3OKDB 2G4GA 2MHAA 5C0JA 4ZW3A 4N1EA 1KJVB 3QFJB 1HHIA 5EU3B 3S35X 43CAB 2GEQA 2K1MA 3KPQA 2BIIA 1KCRH 3GBNL 3KBHE 4ZAKA 3BT2H 1C08B 4FA6A 4FXKB 3RYMA 5HVWA 1S9WB 1WHPA 2WP3O 4ZXBD 4GKZB 4MAYA 2AMGA 2YK1L 2O5ZL 4KXAA 2P8MB 1GPOL 4ADGA 2W9LA 2ZOTA 1NFDB 3ISRA 3BOVA 1DLHA 5KSUA 1KLGA 1QABA 5DYFA 3OR6A 5AG9A 3BAEH 1U2YA 5FUOH 4N2HA 3O8XC 1SHXA 2MCMA 4HUVA 5I1IL 3WGVB 3FUIA 4LHUB 2EXYD 4DP6X 1QKZH 1SZNA 2XTJE 1JN6A 4BFNA 5D6CB 1F58L 3ILDA 1MCKA 3MYZA 2EDEA 4JFFB 4MA3B 1KT2A 3O6LH 2GK0A 4HDIA 2V5RA 1CYWA 2GBAA 1XF2B 1OAYH 1TVDA 3LCYA 5EIIB 3FTVA 3AWGA 4XVUC 3MRHA 1AG6A 3ZYZA 2QSTA 5F7LB 2FLBT 2XWBB 3RDTB 5KYNA 2AXJA 2XG4A 5A6IA 4YDNA 3MNVA 4KZEH 5L2KB 1RLBA 2A6KA 3PP4L 4LSVH 3WY1A 1BX2A 3O2DL 1D5ZA 1BZDA 3SQOL 1Q9WB 4CSTA 2OZ4H 1XAKA 2ZSWB 4LPWA 4XVJH 5ICXA 3SCMB 2BSTA 3G5VA 1BVLA 3D3VA 3FOMA 1NGYA 2X28A 3KPMB 4IKKA 2CDEB 2N01B 4WTXA 3UZVA 5CBEB 4MJHA 3IFNH 4AXWA 3K80A 3JWNH 5FO9B 5FO7B 5C3LD 2ENSA 2IGLA 5HVGB 2CLVA 1YNLH 4LP5A 1LYQA 5IVOA 1TPXC 5E8EB 5GJTL 3T4AB 3K91A 4JFDB 2JJWA 4K7PL 4TNWK 1OT4A 1HHGA 2C7FA 2BERA 2CHWA 4P46A 4YX2L 5LGHL 2Z7UA 2VN6A 2ZAIA 4BDVA 4ALAL 1ZT4B 2CDFA 4N85A 2WSPA 3UXFA 5CUSL 1BQKA 4PJAA 5JIHA 5DVMA 1AGCB 3HI6H 1AC0A 3TTYA 2DW5A 1KCSH 2OL3L 4RNRB 5GGRA 2M2DA 1X5XA 5IV2A 4FC3E 4QHKI 4RLDA 3FUMA 1U9KA 1A4AA 3MODL 5A1AA 3A47A 4GMTH 1KENH 2H2PD 3Q6FB 4OKVA 2H0PA 3FO1B 2JI2A 5IFJA 1X5YA 4Y0GA 5K59E 3FB5A 2CO6B 4AYSA 5L2JB 2GJ6B 2XQBH 5CAYB 3C5ZA 4HUWA 1P4IH 1PX8A 4GAJL 4LHUD 2H41A 4M03A 4NQED 1WIPA 3BHBA 3MRJA 3RPBA 1RL1A 3ARFB 1EBPA 1NC2D 1JZ2A 3RIKA 4PTTA 3U46A 3QNYA 2OMUB 4UQAA 3NFNB 3DVNB 4HWUA 4A7QA 2E59A 3UYPA 1YEDB 3TIDB 1QNZH 4QHMA 5DURD 3QJOA 5HDLA 2BIMA 4MBRA 1R3LB 1RUPH 2CHXA 1UJ3B 1Z9NA 3TLRA 1UT2A 3UJTL 4Y4KA 4DP5X 2F6AA 2P52A 4OCSL 1VENA 4PQXA 3WN6A 4Z6AT 1KXQA 4IQHA 1Q0YH 3D2UD 3Q3GB 5IEKA 3HHSB 4AG4L 4NQUA 4L1TA 3ZT5A 4ZNCD 1B4RA 4OSUL 4XN1A 3RZCB 4JRYE 2WIIB 4JVUA 4HS8H 1MW0A 3CN2A 4JPIA 1GS7A 1IGCL 5E2VL 1KN4L 3IU3A 3R06A 4CVXB 3D08A 4DP1X 3BD3A 5BQDA 5DUMH 4HCRL 5DMIH 5HYSB 4R3SB 1J0KA 3HS9A 3S35H 5HYEA 3B2VH 1V55B 4XTRC 1K3IA 4LL1A 3GIVB 5E08H 5C0RH 3VX1A 1XTLA 3DMMB 5BPPA 2FLMA 5FGSA 2H6OA 2VABB 3K72B 4BWTA 1WQVT 1JHTB 4F7MB 2APBA 2EYSA 4WWKC 3OJ2C 1ZHLB 3LJ3A 1CICA 4KTYA 1XGTB 4FAAB 1DBBL 5AW5B 3WUWG 1DJIA 1RY7B 2ZX9A 2ITEA 3UADA 3W5MA 3BIKA 3RGVA 5IF0A 3QC5X 1BF8A 4TOYH 4FP8L 2AITA 1ET5A 4KROD 4E42B 3CZUB 3I50H 2LE9A 1QLEB 4Z7WA 1I1RA 3MOAL 5I1AA 1KF9B 4RFEA 1Q1PA 4AGLA 1MJ7H 1OZTG 5D7LA 5BV7B 4ZW5A 1S9VB 2QQLH 2BZDA 3SE8H 1AGBB 4DIXA 3AITA 3EGDB 2JIXB 2HPOA 5GZOD 3PWLB 4R7NB 5F3FA 2YSTA 5IROC 3VFGL 5ICZA 1S7TA 2Z35A 4OLUL 5CP7B 2IJ0C 3VVVA 5IWLC 2E7BA 5E8OB 4U1HB 4G9DA 3MJ7B 4HS6B 5E4OA 1NDMB 2OPCA 2SEBB 4IKNA 5LXGL 4KTDL 3MA9H 3EHBC 5D1XC 4AC2A 2J88H 5BJTB 4YWGL 3W3BA 4RAVB 1C7TA 2O6CA 1J9RA 2WNWA 5AG8A 5IT2H 4N22A 4PGBA 4ADJA 3QR2A 2BNRA 4J5VA 4ATWA 2V9TA 4KI5D 3K8LA 3TYGL 1JI2A 3MDJA 5DJ0B 4QRRA 3QQ3B 3TNMA 4RGMB 4X5PA 5KUKA 1XX9C 1UUNA 2NY3B 3FJTA 2IBGA 3NK4A 2KPNA 4MZIA 2V7HA 1NLBH 3UTSB 3L95B 2X12A 2VAJA 3BDYH 4M6ML 5DD0H 1HHKB 2WLLA 5D7JA 1VFBA 1KB9K 2JB6B 4LVNB 2J73A 2X2UA 2ZUUA 2G30A 2JH2A 3FU0A 5GHWL 1NSNH 1MHPL 4QRUA 5JHLL 1I9JH 4KH2A 4AIZB 1FFTB 4GOSA 4DAGH 1OM3H 2AI0L 2OLDA 2WUBH 1JPSH 4QO1A 3INUL 1JHKL 3RTLA 4OCRH 5BCAA 1QFWM 3KLQA 2GTQA 3WN5A 3MO1B 3E8UH 1KCUL 2F1EA 3SYCA 1OSZA 3IDNB 3ULVF 3QI9B 4FMKA 3PHOA 4ZO7A 4Q9CA 1A9BA 5JIIA 4KHTL 3VGBA 1BLNB 1J1XH 5C09B 1H15A 4PV1C 3IM1A 3W39A 4PGCA 1DL7H 3X12B 3HKZA 4ZDHB 3T8MA 3WIHL 2HVBA 2O5YH 1HILA 4JFOB 4XNQA 3US0A 2RBLA 3WV0A 5EFIA 3HLAA 3N43F 3SKNA 4RMBA 3HOGA 3QEUA 3QAZC 2JFCA 1KLUB 2AJSH 4BKLA 2YAHA 4XOBA 4IIQA 3EF7A 5IVXE 3COOA 4OZFG 5ANME 1SJXA 9PCYA 4BH8B 4Z7IA 5DK0B 5KN5B 1JFQL 1OPGL 1U8PB 1ZIBA 3PGCB 2VERA 5B39A 3F6JA 4KKPA 3BH8B 1F4XH 2ENPA 3HUJB 2VLJD 1IFGA 5F0MB 2I27N 5I5MA 5FUZH 4EI6B 3MREB 4PRAA 1FCCA 3M7FB 3AT8A 3TVMB 4KZ0A 2DPKA 1SF3A 1YY9C 1J5DA 5DRXB 3CNKA 4PLKC 3SDAA 1FYTA 1R3JB 1UM4L 2H4EA 2Z8SA 1XF5A 2JELH 1TCRB 3QQ4A 4QXUL 1TOXA 2YAPA 2J6EH 4IW4C 1FL6B 4F9LC 3MCLL 4UAOC 4K94H 5E9AA 3KYNA 2R59A 3P3SA 3M88A 3HHMA 1E42A 4GKLA 3DSFH 4JDTH 4KJWD 3RVUC 1HIML 2BMKB 1SEQL 3Q2WA 4BZ1L 4OAWB 4Y5VB 2ZUQB 4PFEA 5GRJL 3VGDA 3X1FA 3MLYH 4K7PY 3FRPG 3LKRA 4I3SH 3PGDA 1MFBL 1LLAA 1YNKL 1N64H 3HN3A 5CXPA 2YSSB 3L3GA 5AALA 1W80A 4OZGE 3T2QA 3RL1B 5CD3A 2ZCLH 3EG9A 4WY7H 3IAGC 3GYRA 2EO7A 4RZCA 2YC1B 4J3VA 3VE0B 3ATDA 4B7IA 1IC4L 2FX7L 3SE6A 3TTSA 5DHVA 3IS1X 4ELMA 5AW4B 2FBJH 4D9RD 4M1GL 4MWFA 3CFCH 5EEVA 3T1FA 2XY1A 3IE9A 3DJRA 1ZA3A 4PSPA 4D3CH 3VSQA 1QW9A 5I6LA 1YMMB 3OLDA 5ALCL 1YPZF 3CUPB 5I1HH 1J5OH 2VUOA 2X2HA 4PJBF 4JNXA 4J8QA 4HZ1A 4Y4FB 1S7WA 3DOSA 3S5LA 2HFGH 4WUUE 3UTTA 3DX6A 4YEFA 3VXRB 4H8UA 4TVPL 4UINH 3T2NH 3AG2B 5HPMA 2PTTB 4ZMXA 1BOGA 3GXUB 1IEAA 2IDFA 4APQB 3O11A 3ZXAC 4MQ7A 1M71A 3D9AH 2FJFB 4ZBJA 3P0VL 4M3KB 5I8OL 4PB0H 3UYRH 2JTYA 1AE6H 1EAJA 5KYWB 4Z3FA 1FZJA 2W9EL 1CLZH 1FV1A 4NRZB 1KXHA 1P7QB 2DM7A 3DGDA 4QRPA 2VXTL 4M4RB 5ADPL 3UTQA 4UT7H 4GW4A 5LB1A 3JVFC 5I17B 5EC1A 3VWKC 3ULVL 1HL8A 4YDMA 1CXEA 3E3QC 4RIRA 1ZE3H 4R4FH 3L5WA 4CL7A 1JGDB 1ZLSL 2HJLA 4NC2B 4BQBA 3ULUH 3MBEA 4OCXH 1IGMH 1QUNA 4OM0L 4UT6L 3IFLH 1UWYA 3OQRA 4U4IA 1O0VA 1U58A 2IH1A 2WLIB 3IMVA 4QCIA 4NZUH 5D2LB 3F2LA 2LFEA 2H3NB 3T8XA 4RGNC 3KDPB 1ZT7B 3LB6D 4JFZL 4RA0C 4YO0A 3GJEB 5C0IA 5I15H 4JB9L 1GVIA 4HSQA 5KBDA 4K3HA 2ZWZA 2E9GA 1KYFA 5DHVH 1OVZA 1MSPA 4HKJA 2NUTB 1LILA 4AIOA 2L0DA 3JWNG 4J3OC 1KPRB 1SLXA 32C2A 3TCTA 3UO1H 2NOYA 2F0CA 3SGJA 2Y6SC 2ERJB 2N3JA 5KSAD 1P1ZA 2GBTA 3HI1B 4HWZA 5TQ0H 3D85D 3NK3A 2WVUA 5KYXB 3WS3A 4QHNB 1RULH 1P7HL 4L8SB 5CKAA 3SKJH 5ENWB 1AKJA 2UWEB 4U0RC 4MNHB 3MYJB 1BSIA 1QSFA 1OIOA 5KOVC 2BINA 2NX5A 1OF0A 3II2A 4U3SA 1O9WA 1IEBA 2AXGB 2NR6A 4L4VA 4QRAA 5C08B 3DARA 4GI6A 1F3DH 4GJTB 4TLTA 2NQDA 3K8MA 4QI3A 1KIPA 4PSRA 1QSEB 5JHDD 5ITFB 4MD5A 2I9TA 3EYOB 4QXGL 4PS4H 5E2WH 4UDTA 3G5XB 3RVTC 2EXSA 1IC0A 1IE4A 2AS5M 3B7UX 2R2EB 3LHAA 1HL4A 4MJ2A 5HYJB 4H5SA 5TQ2L 2ZP8A 1H0DA 4TVSa 3KPSD 3QORC 4NP9A 4LEOB 2DD8H 1K2DA 3T0VA 5D1ZC 4Y16A 3TX4A 5HGBB 5EU7E 4Y9FA 5F7EL 4E9WA 4PY8J 3SY6A 1UWXK 2FCBA 3UBXA 4NO3A 1IC5H 1QVOA 5JIQA 2AAAA 1XO8A 2V8MA 1U8MB 4YE0A 5FGBC 4U6HA 2AKRA 2B1AL 1MAML 3RFZA 2FWUA 4DN3L 4IGBB 1JNNL 3P4OA 4XBEL 3NRPA 3BP6B 3FSAA 1PG7X 4OQTA 1RZIB 1IAIM 4NM8L 3RWCA 3ASNB 4KJPD 4JVWA 4Y2OB 3NFSH 3AU1A 1U8QA 1QLRA 4HXBH 3SKMA 2WXHA 3V7AG 2YD6A 4Z0XA 5FOBB 1IO4C 2FK9A 2D3VA 4PGEA 1C5CH 3WE6A 4FZ8L 5F44A 5ICYA 1JNHB 3LEVH 1VACB 4MQXD 4TL4A 5SX5K 5EO0A 2HJFB 5DRWA 4YHZL 4HMDA 1YEKL 2JKWA 2VCOA 3POCA 1NCBH 1PSKH 3WTXA 1P9MC 5EUOF 3EOBB 5BVPL 3ZDYF 4FNLH 2VXQH 4UOZA 3GUTB 3SDCB 3L81A 1R3HA 2WB1A 5DO2D 1YLBB 1P84J 5ILTL 5EZOH 5TDOB 4N2CA 2F58L 3C2SA 5CWSB 2WUCH 1G7JB 3L5IA 1UB5B 2K6WA 3AC0A 3FQ2A 2VM4A 3VXTA 2GJPA 5J7CC 3LZFL 3PHAA 2HN7B 3OKYA 3WGUB 3F7QA 3R7QA 1RZQA 3FT4A 4L8BA 4JJ5A 5JW3L 4Z78B 4IEFB 4P5KB 4NQEE 5FKPA 3AS3A 4H88H 1FGNL 2D4FA 3KWUA 2WXLA 4TRPH 3BAYA 4FCHA 1JPTL 1SM3L 4XCEB 2NY0D 1GKEA 3KJ4C 3RPIB 5E1AA 4X7DC 4LLQA 1IL1B 4YHNB 5JXED 2ZAGA 4ODWA 3SDDA 4ODTL 2TRHA 3TT1H 1AQKL 5E4EC 1I8AA 3ZMNA 2VISB 3MTXA 2LAGB 1BXXA 3NIFB 2AC0A 4GUPB 4IM8A 1U3YA 1CD8A 2ZCKL 2WXPA 3EJJX 3NPSB 4HUKB 4MRCA 3QWNA 3ALWA 1NPJA 4FQ1H 4M43H 2E7DA 4ZXBC 4R5TA 4ATTA 5AYQA 1WBZB 5IBLC 3SKOA 4N86A 2G2RB 5D7SH 3CPLA 4K5NA 2ZUYA 3S8WA 4G42B 4L1DA 4L5FH 4UTBH 4P2OA 4JPKH 5IJBC 3QCVL 3C5JB 2GHZA 4OQTH 3V4UH 3A6BH 3GHBL 4NIYE 4R0LA 3LOWA 5E5MB 2FJSA 3BRGC 4OJFH 3ECBB 2YJQA 4K8RD 3GJFK 3TZVA 3DGGB 1PZBA 4OF6A 4LSQL 4Z7OE 2EXYC 2QR0B 3RWDB 1NINA 2MQ3A 1D7BA 2AAVA 2IMNA 1QFOA 2ADJA 3QC6X 2BSED 4NLHA 3MXVH 2R1YB 1RMFL 4IS6B 3LYRA 1CN4A 3QEHB 3KYMA 5DRZA 1DFBH 3GHPA 3S7GA 1UD6A 4OJDH 2YBGA 3LZRA 4HUNB 2DTSA 4DP8X 1T1YB 3VRIB 3QDAA 4M93B 1XH0A 2QTVA 1E30A 2J8UF 4U1IB 2JCCB 1NM4A 4XGZA 1LEKB 5JIKA 1XCQA 5F1OB 2DWYA 3UOAB 3F6IA 3VFSA 2XTJB 3DETD 5CIPB 5FYLL 3V0DA 1OEZW 1VGEL 1H6EA 1UEMA 3DJSA 1FCGA 3U0TB 3ZR5A 4PRBA 3QDME 4GXVH 1S4IA 4E0RB 4NT6B 2OMTB 4X7SH 3RE0A 3LQZA 4DKDC 3QNFA 4ZS6D 2BP0A 4FZEL 4Y9EA 1II4E 3HG5A 1CFVH 1IFHL 1BEYH 3I9IA 4E9YA 5EDXA 4YLBA 1L3WA 2NY1B 4DZ8B 1KFGA 4K55A 1U93A 3MRPA 1QSZA 1UOVA 4KKRA 3LKNA 3QJVB 3PUUA 4S0TD 1XZ0A 5AD0B 3KYOB 5DFWH 1TYJA 3IDGB 3VD7A 4U49A 3BSZA 1EJ8A 4UQ3B 3SDYH 1O6TA 5E8NA 1JK8B 4P06A 5I2IB 2Y5TB 2HJKB 2HG5B 1NEZA 2FSEB 3L9YA 3HS8A 3QXVA 1V8HA 3S5YA 5CCGE 4JM2B 3HN5A 3MLZL 2HTKC 1Q72H 5H37A 1CR9L 2PWFA 3OXRA 4PJ8C 1CDHA 1PG7H 4KGJA 2H2PC 5T3XH 1CUOA 5H94B 3JT0A 5DJYA 1AOHA 4KX9A 1UTDA 1BAGA 1CE1L 2FATH 3AQXA 5AVTB 5IMKB 1HKLH 5L8KB 3BFWA 3CVHB 3QUXC 3EDKA 3FYIB 3LNEA 5I6OA 4N2AA 5FB8B 1EO8H 1LEGA 3WJLC 4KZDH 1Z5HA 2CNYA 2EIZA 4XN8A 4ZX5A 4Z7NE 3MGOA 5FUCC 1JFHA 1WFMA 4P5RA 4TV3A 4XCYA 2VLKA 4JZOB 3NTCH 4LCIH 2HX9A 5IJDC 5GZND 3BE1L 2Z93A 3N1PC 1G7MB 1NDGA 1UWFA 4PJXF 3NN8A 4D7BA 1BQLH 4FLQA 1R24B 2AXHA 3AREB 4GSDL 2MOGA 5CJQL 1J5IA 2XG5B 4UWQB 3K2MC 3GWJA 5GS0C 2VYRE 3L54A 2V17H 1PLGH 3ZSSA 4XBMA 3ULUD 3UTOA 1UZ8B 2X4PB 4BM7A 2RHEA 1M7DB 1F00I 2PP9A 2VLMD 4AH2B 4XPFL 5T5NG 1MCBA 1DJXA 4LRIC 2XZAL 2I07B 5ESAA 2BSRA 5ISZA 3VD5A 4UUJB 3PWPB 3D25B 1XSOA 3MGTA 4RMWA 4K7FB 2JJSC 3I3EA 4BFBD 3DX9A 1BM3L 3HNVL 4WSJA 3PFUA 4XBGA 4WV1C 1VKXA 2WYHA 1V05A 4XMWA 4YHKH 4BA8A 2P8LB 4PBWD 1LE9B 4JM4H 3BSZH 4ZW8A 3G08A 2EIBA 1TG8A 2NYZA 4QHUA 5C0FA 4JRYB 4AITA 2DN7A 3HG4A 3MV01 1U8NA 2R8SH 3D50A 5TK2A 1FDLH 1XH3A 4HQQH 3AMKA 3AY4A 1V3LA 3P4LA 2BX5A 2VLJE 5EORH 2CUMA 2CO4A 2WZPD 1B0IA 1FI8C 1TENA 2ATPA 5E6ID 4C83A 5IEHA 5K9JL 1KZYA 5I6XB 2E9WA 2Z64C 4PRIA 4PVMA 2DY2A 5JR1H 3AQZA 3TH2T 1FO0A 2GJZA 2EZ0D 1DO6A 2ZPKH 5E0QA 5HY9A 4XO3A 1A3RH 3CSTA 1RZJH 4K2UH 1LK2B 3IBEA 5DD3H 1DJGA 1BOYA 3U7WL 3IMWA 1OSPH 4H7VA 4J3WA 4S11A 4YFDB 3TN0B 4JFQA 1A7PL 5J11B 2ITDB 3O0LA 3N9GL 2OK0H 3L1EA 3FMGL 5BRQA 3ZIMA 5IUCA 4MMXB 4HU2A 1MIMH 4L1SA 3ARBC 2AEPL 4EOWH 1CIDA 4OIFA 2RCSL 2V2XB 4KO9A 2DQCH 1WA2X 2F18A 1G1OA 2Y1VA 4ZQKB 3WFEH 3ELQA 2I60H 3GSQB 3LEYH 1OOAA 2NXZB 2XJKA 4FYSA 3V0HA 3FQRB 4DP7X 3WDJA 2FAUA 1XF1A 1EQWA 4JY4B 1VDGA 3GGWB 4PJ5E 4YZWA 1CL7H 1THAA 2ZG1A 3JYCA 1XBDA 4JBSA 4R97B 1W0VA 1MVUA 2EDDA 4RFOH 5KOMC 1LP9B 1A25A 1MZZA 3DJZA 4FQCH 1FL5B 4KI5C 5DJ2A 4F2MA 3BH9A 3L5XL 1T5XA 4LCUB 2ARJQ 4UIMA 5FGCE 1DCLA 4V2CB 4JPWL 2RAMA 3ETSA 1TSHA 1TU2A 5IHBA 5HJDA 2CK2A 2WTRA 4X9IA 1HZHL 1NJ9B 1NGPL 2BSBA 2ENJA 2ADGA 3C60A 1WF5A 1BQSA 3V2AR 1G0DA 1T0MA 1GR7A 4NKOA 4BIKA 4BRVA 2I25N 1P5UA 3GB7B 1VB9A 2CBPA 4XZUB 4Y8AA 4L0ZA 1EBAA 4EN3C 1I8IB 3PL6B 4IJTA 2VZSA 1E27A 4OGYL 3IBOA 3RG1C 3CFKB 4ZPTB 5E9DD 4CBPA 4PJGF 1G7QB 4ABUA 1RUAL 1X5FA 4G7RB 1IBGH 4AWJC 5J4MA 5KS9F 4GO9A 3L3DA 3U1SH 2GTWA 3ZU8A 1OTSD 2MTAA 2BDNL 4Z77B 4AVKA 1I85A 2W65A 4KKLC 3MRRA 2LTQB 2JVUA 3FQNA 1W0WB 4JAMA 4YSSA 4E5XB 3NMEA 5EOTB 5JNYA 2Z0UA 1MCOH 3JWOH 4YDJB 2H2SD 3GEWB 5CEXB 1GS8A 2DRUA 4ELKB 3J2PA 4JO4L 2C4FT 2CMRL 4MA1B 3I9GL 1L9NA 5D72H 3AT0A 2QQKH 2EQDA 1AMXA 4KWUA 2DH2A 4Z3EA 4Q4EA 1BYPA 1FSKC 1FWXA 3Q13A 1Z32X 3FFCD 3FUKA 1MFNA 4PJBA 3CVIL 1XR9A 4ZUUA 2E9JA 4MJ5A 2SODB 1ITBB 3ZZQA 3IDUA 1YN6B 2QGDA 2E0PA 4M3JA 4NRXB 4R83A 5GS1C 5KSVA 1GH7A 1TVHB 3BRDA 3V7AE 4N5EC 5B3NA 2BVQA 2XU9A 2Q8BH 5C0AA 2J5LC 1C1EH 3HN8A 1HHHA 2LAAA 2X9XA 5DC0A 1UZGA 1JD7A 5JXAL 5D5MB 4I3RL 5IVXB 1J0IA 4MDJB 5ANMB 4KAQH 5E2UL 1AXTL 2CRZA 3RRQA 2G3MA 1CFNB 3TV3H 2BVOB 5J6HA 3VM5A 3B83A 3W5NA 4Q2ZB 1J87A 4X5XB 4NZDA 4Z76A 1BXUA 3MRDB 2BOBA 5G4NA 4CC4C 1I8MB 3LKSB 3VW3L 5DK3A 4PRNA 4FKHA 3BAWA 3T0ED 3VFOA 3DA0A 2WQ8A 4JMNA 2XYCA 3KLSA 5DD6B 1LDSA 1MOEA 4M8QB 4PI2A 2VLLB 3U4BH 3MCYA 4NEHB 2WZ5A 2HT2D 1ZSDB 2OV0A 5JHDE 4WKZA 4GBXA 4AL8C 5B3JF 5HDBE 2Q7YA 2XZQL 3WNPA 4OF0A 4H0LC 3O6FB 4J23A 2R29A 3PWVB 3FHEA 1XHHA 2B4CH 2BWIA 2YPLA 4CVZB 3MUY1 2A5UA 4MDIA 1CGSL 2EXTA 1LMKA 1R47A 1WJ3A 4AYGA 4BUGA 3QUMB 4KO5A 5ELIA 1N5AA 4LASL 3MNMA 5CU5A 1OAQH 1FNEB 3CU1A 4DNLA 2C5DC 3DRQB 2KERA 4HK0A 4W6YB 1QRKA 1C16A 1R5IB 2UZYA 4X98A 4PREB 4NJAL 4UTCA 1WISA 4JKMA 5TD4A 5C7XH 4L3ED 5LHDA 5GGUB 1KXQE 2W9DH 3MRQB 3UBXG 3OG4B 2ICEC 2YD8A 3KYKH 5I0WA 5G2NA 2C7UB 2F8OA 4P3DB 4OZGB 2QZQA 2DM4A 2L3BA 3TJPA 5FEBA 5I28A 3WFDL 1KGCD 1WBYB 2VDLL 5TDPB 1DEEA 1KIRA 1TXKA 3QO0A 5SWSA 2NUPA 4KVPA 2KS0A 5FA3B 1JGVH 5CN3A 1CZ8H 3HRZA 3QDJA 1GZPB 1ZV5A 4OZHB 3L3OA 4PWEA 4AM0B 4KOCA 3I84A 4Y4HB 4ODHH 3S96B 5D6DA 2AJYL 3U9PH 5EB9A 5TF1H 1B3IA 1KCWA 2AZUA 1WH0A 4OGXL 5AUMA 4PLJC 5I1DA 4H44C 2HLAB 1F8TL 3OKKA 3TA3A 3W37A 4WUUB 5EPMA 1PTZA 1RHHB 2NXYB 1AGFA 4YSCA 3WEOA 4CMMB 3KBEA 1MFDH 1YEEH 1I1YA 4H20L 5I19H 4C4UA 4WF7A 3PHSA 4KHXL 5JW4R 1KBGH 3DK2A 3QEGH 1FFNA 1GGTA 3OB0K 4GW1B 4P2CG 4Y19A 2VDNB 1E7UA 2EEAA 2R29H 1DSFH 3CDYA 4X4XA 1OW0A 2IWEA 1AXSA 1Q38A 3PGFL 1MCFA 1KIQA 3OAUH 3E6HB 1A9EB 4GSUA 5AAMA 1ZWIA 2NNAA 4B9KC 4WU5A 5I30H 2AQQA 3DRTB 2D7MA 1K5WA 4ZUVB 1R3KB 3EAKA 4FFZL 1T7XA 5K9KA 1R5WB 1GOFA 5HYQB 1D9KC 3MBWB 1M4KA 2X70B 3ZHLA 2G0LA 1WITA 3DV4A 4DGIH 5DXWA 3APCA 3OWRA 4XVSH 3SBWC 4KGLA 1LD9B 4URKA 2A99A 1D6VL 5IOPB 3U7AA 4NQXB 4RBPK 1N59A 3JV4A 4PAZA 2XVLA 3CFIC 3H6AA 3ZKMD 1V5JA 1F4HA 4N8CH 3P0GB 4JO5A 4RAUB 1DZBA 5F89A 1B4LA 4NQDD 1ZT1B 4BE6A 1MH5B 4GP4B 4Y8DC 3S6CA 3HMXH 2YMTA 3WOVA 5LBGA 4KY1H 3GHEH 4WWNA 3ZKXB 4UBDC 3OGCB 4YNYB 5IW6A 2R4RL 2EYTA 3CAFA 4G8EB 3EOAA 1GZHC 3VFUA 4U0QB 4J2XA 1W72L 5HDWA 4F2EA 1T2QH 2A9AA 2YGNA 4X6CF 4FADA 4DTGL 2HMID 4I0CC 2O6DA 4Z7VE 4DKFH 2MPAL 3MLTB 3NABH 4HIXH 1ZEAL 4LGRB 5MEOA 1UA6H 4W93A 5CGYC 2FJGB 3PV7A 1W15A 4GQRA 3W9EB 2PLTA 1E9QA 2C9QA 4MXWL 3LH8A 3LD8B 1FNAA 4WWID 2BVUA 1E4WH 1K4CB 4LMQE 3BO8B 3QUYA 3LV3A 1XF3B 4Q7DA 5FX3A 5IEHB 3ISWA 3W56A 1I9IH 3P73B 5DMGC 1WZKA 4K3EH 2KZWA 1J1OH 3S37X 3WL9B 3OZ9L 5HHOB 1T0NA 3EADA 3HBZA 3VFTA 4ZFFB 4KXCA 1JPST 1JV5A 4LGSB 3BFQG 1DCEA 1PZ5A 4G8GD 4XPGH 2BP5M 2TSBA 4O2EB 5INCB 4W9GC 4N9OB 2ID5A 1OAZH 1CB4A 3MCKA 4N90E 5HBBA 1MCNA 1V3MA 1ZGLM 1CTNA 2GIYA 3WNKA 1SF5A 4JRXA 3K71B 1FZMB 3KWWB 3FCTB 4J4PC 4PJCF 4WNQA 3ZTJH 2EEBA 4XP5H 3P3UA 3IFOA 4QY8A 5ITBL 1FHNA 4I5BA 4IOFD 5F0PB 4ODUB 3AQDA 1NFIB 3S8FB 4P9MH 1EJOH 3L4XA 4E9XA 3ATAA 1S7XB 1HE7A 1T5WB 2Y07H 1GSMA 3AXLA 3HCVB 3ETBF 1A7OL 4JO2H 5DO2C 2W59A 3OKMB 1TZIA 3W0WA 3E2HC 4OB5L 4ZMVA 2P8PB 4M1DL 3VFMA 1NGXB 1JZ3A 3H3PL 2HKHL 4CU7A 3NP3A 4IOSA 5KVDL 1NEZG 4LK4A 1CG9A 5FC9A 4HS3B 1T1WB 5H37G 4L3CA 1HXYA 3DUUA 5I75C 3VG9B 4GQPH 1HFUA 2H26B 2DKSA 4OI9A 4NERA 5DSCA 2YAQA 3GFUA 4JG9A 1AJ7H 3WXWH 3B7TA 4MNGA 4PG2A 4YOKA 5JHBA 3V4PL 5E70A 4FFWC 1S7VB 2CZNA 2NY0C 2A2QT 2GCYA 4U6XA 5INDA 4CSZA 5I1GL 1MHCB 3P9LA 1NIDA 3T2OA 1AO7A 3Q7JA 4HK3N 2UXVA 5F96L 5E8DL 2YN3A 1JV2B 2IBZY 3K74B 4QRTB 5J0BA 4QNPE 3WTSA 5FO8B 4OLVH 1EXUA 3BZEA 5GS2H 4JX0A 2DJSA 4QOKA 5KJRL 2O6PA 1XR8A 2BHUA 1IBDA 2D7TL 4HKZA 3OJMB 4OCWH 4NUGH 4NGHL 4TUKL 4P8QA 5T5FA 1GJWA 1N6VA 2DQFA 2KL6A 3LTVA 4D0BB 4CADB 3ULUE 2LW3A 4NQEB 2FZ3B 1FRGL 3FXIC 3VYPA 3D69B 4H8WH 3BMVA 4U7KA 2F1BA 1ASOA 1NC2B 1S8DA 2HG0A 3H53A 1DVTA 2IADA 1N70A 1A1OB 2OW7A 4LLAA 2RFXB 3FC8A 4GXUM 5CMAA 4LMQI 4M29A 3WHE0 3WFZA 2VL5A 4UB0H 3BW9B 4BZYA 3VQ1C 2Y7QA 2VR9A 4RISH 3WTWA 3AWFA 4GLRH 4N0FB 3U6RA 1A47A 3F5WB 3I6LD 3MJ9A 4R90H 3PQYA 5D9SB 6CGTA 4XPAL 5B22A 2Z31A 1U8CB 2GIMA 3O0RH 4C56A 5LAXB 2V6HA 3D2UB 3HIZA 1GJUA 3FB8B 3GRWH 1JWUB 3CXDH 2PW1A 2EIEA 4PV9B 5BS0A 5LNDA 3NAAL 4NQSA 2ZNXA 1X4ZA 3FQWB 4PWIA 5DT1H 4XE5B 1JBJA 1OP4A 1UT1A 4HV8A 3O2WH 5FF6B 4FQXC 4YHYB 3RVVD 5JYMA 2YS4A 2Q3AA 4LLUA 4WV1B 1FE8H 4YHPB 5EOQL 1MUJB 4H8HA 4KK9D 5I26A 3L2MA 2KDGA 4HJSA 5JPMC 3GSXB 3TBBA 4EPSA 3IDXL 2AFNA 1IKNA 3A6CL 1R34A 1BXAA 4ZS6C 2ADYA 1BQHA 1DBML 4AX3A 3SZ6A 3CDGA 1JF6A 3IJ8A 1J9TA 5TFSL 2A1WL 1TVBA 3PJSB 5DTFA 4JGNA 3P9WB 1PJ9A 1XIWD 4OQ1A 2ED9A 2R0WL 2JKRM 1DJWA 4Z5RB 5T5FH 3S37H 1YECH 4JDEB 5DHMC 4Y2DD 4KROB 4WW1A 2QHRH 3VCLA 3VI4F 2ED8A 3D1MC 4YEEA 3BN9C 2Y3NA 4I0PB 5KZCD 4DZBB 3CFDA 4X6DA 1QR1B 1EVUA 2YEZA 2XWJA 3HAEH 4NC1C 3GMOA 1I7ZA 4OCNC 4XNUH 3ZE0E 5GGSY 1MFCL 2FBRA 5BQ7B 3F58H 4V1DA 4ES8A 2GYSA 4GAGL 1PD0A 3MJ9H 2BVYA 3RAJH 4ZFOL 5AVUB 1BZQK 1TJHH 2VXVL 5DUBB 2P24A 5DFTA 4J28A 2WYTA 4KOBA 5AW6B 3SOBL 1B2WH 2ESVD 4DVRL 4JN2B 1ZXQA 2OMVA 2VN5A 5DFAA 1EDHA 3GNML 1MCCA 3ORJA 3L48A 3T77A 1D6EB 1U8HB 3P0YH 3QQDB 1NL0L 1TEGA 1YC8A 4RA3A 4QXVA 1USZA 4HFUL 1A1MA 1W8NA 1U42A 2IF7A 2KQMA 1KB5L 4TLSA 3P2TA 4NO2B 4ZNEA 3NA9H 3NFPA 3APDA 2WQRA 1MI5A 3EFOB 4NXKA 3WNNA 1NCNA 4N2GA 4M6NH 3MRGA 3IXTA 5J12C 4PU2A 2X44D 3VAEA 2R4SH 5BNXD 2D7QA 4Z7NB 5LCVL 4GKSA 2JE8A 5DJCA 5E94A 1JRHL 4ERSL 3LZNA 4XMUA 2HRPH 1RFDL 4I87A 1QQDA 3NCWA 2A9MH 4FLOA 2I7OA 1DVXA 4FQIH 4Q9QH 3FRPB 2CAKA 1WGVA 5EEUA 3ZL4L 3H9YA 5AW0B 1OANA 2H32H 2R69A 5EU6E 5EZIH 1U95B 3K6SB 2X4SA 2YOAA 4Q6YA 3QIWB 2EE3A 1EH9A 5AKTA 5DYOB 4DN4L 2CUAA 1FVCA 2MCAA 5F71A 5FDWB 5SWQA 5HHVH 1HH6A 3B37A 3GXNA 1SGKA 1N0XH 3M45A 3HS0B 3Q5OA 1P4LA 4L5FE 4YXKL 4B53A 5DJ8B 4PJGA 3NJGA 1CFTB 4UV4H 5KS9A 1Z0MA 3ZT6A 3D0LA 2EVIA 4D8PB 1LO4L 3LXUX 2Y36L 1PCXA 3GUFA 3NGBB 1IKFL 1XGYH 1IQDB 4KFMA 2YBRA 5TH2A 2XXFA 2VIRB 4AT6B 1UM5L 3QEQD 4FFTA 3EJYD 1LWJA 3MVSA 4WI0A 3BPNB 1JG9A 5I18L 2YGQA 1HEZA 3BP7A 3E0GA 4P4KC 4CNIB 3GD1C 5MEQB 2EDJA 1EO7A 3ASWA 4JE0A 3CSGA 3QPQD 4KK5D 1WEJH 3RTQC 2VLJB 3T0EE 1TZGL 2FO4B 2ZP0T 5IBUG 1MJ8H 1SOXA 3R4RA 1B9ZA 2HFTA 3GMLA 5JORB 3C6LB 3MRFB 4Y1AD 3GI9L 4PYGA 3DX8A 5ACMA 5D1QE 1M7IA 4PP2A 3MX0A 4F33B 1HI6B 3GSWA 4FQQB 4P23A 3LEXB 3L08A 4KDTC 2LLLA 3QRFM 1DJYA 1ZLWK 1S7QB 2NSXA 3MRIA 4DW2H 2ZYHA 3V4VA 2YXMA 3QYMA 4BELD 3RUGF 4B41A 5AAWC 5EN2B 2BNQE 5GS3A 1J9QA 5IQNA 3X3FH 4F7CA 4QRBA 1RSYA 3ABGA 4XNYH 2R69H 1TQUA 3HJEA 3QZNA 4N0RA 2IQ9H 2ZXDA 2WKOF 1TQBC 4PJ5B 4WI4A 3KLAB 1AR2A 2K9UA 3IT8D 5DGRA 1F4AA 3KGTA 4GAYB 4PJFE 1KGCE 5DJXA 5FWQA 3UBXI 1A6AB 2WN3A 1PKQE 4KTEH 1PZSA 5T3XE 3AT9A 2EH8L 1Q8MA 4Q9BA 5FGCB 5C0BA 3K5SA 3VB9A 1U6AH 1CXKA 4ZAKB 1OTSC 3BD4A 2XC8A 4RVBA 3FFOA 1ZGLP 2A83B 2XQ0A 2X6UA 3DGCR 2FGZA 2XBZA 3EZ8A 4OIIH 5CD5D 5KW9L 4AC4A 1T22A 2WXNA 2AJVL 3LNDA 4A2DA 1OCRB 2ICEB 4KZCA 3HI5H 4OUUA 4NNPL 3V0WL 5IMLB 3IMBA 1LHZA 4MLIA 1BGXH 2AJZA 4GNKB 2IMMA 5EBLA 4NZRH 4HZAA 4G71B 2JK5A 3Q43A 4TQPA 1AFVL 3RBSA 2PPEA 4S0HA 1K6QH 3IJHA 3SE4A 1RZFL 3D18A 2DLIA 1WGOA 4NKMB 4CW1B 1E4JA 5CEZH 3MN8A 2GJRA 1OOWA 1JN6B 1JIBA 2LOEA 3DTUB 3FH8A 1KT2B 1ZHNB 5LNEA 4QKXB 4PRDB 3RWGB 3F12A 3VQ2C 4U31A 4U6VL 1N9PA 35C8H 2HKFL 4X99B 3KLHC 2P42B 4WO4A 1EMTH 4QRSB 5DA4A 2XG4B 2Q20A 4O02H 1H8LA 4N8VG 3EYSH 1ACXA 1KOAA 5KVGH 4HA1A 4PWKA 2D03H 4CA4A 3ZTJG 1KTBA 3BIAX 3HKFA 3LKQA 3X13B 2WQAA 2NSQA 4QWWD 3DJTA 1MCWM 4M6OL 5ICXB 1LE5B 2N7BA 5CP3H 1L7TL 1NGYB 4XCCL 3RGBA 4G8IA 4K71C 2AANA 5CU9A 3THML 1VADB 3VFNB 4DVBA 5E7FA 2AHIA 2GABA 4TQHA 4NQDE 4FNPA 1A7QH 4QPEA 4XXWC 5AOMA 2HT2C 3W1ZA 2LLNA 2YGPA 5BO1H 4CN1A 4XP1L 2WLHA 4YDVA 3M17B 3HZVB 1UA7A 2HA1A 4X5WB 5KSAB 3FQTB 4P3WA 2Y25A 4H40A 3D85B 1A5FL 3L7FB 2DDQH 1IAKB 1MW1A 4TLUA 3DX3A 1RUML 3MZTA 3ETTA 4AL8L 1DE4A 5DC9B 1Q1JH 3IB4A 3LH2L 4L4TA 5B3SB 3FW6A 2I9LB 2PO6D 5CLZA 1FPTH 5EU4B 1EZVY 1XSJA 1K4DB 3J07A 4XHJD 5JHDB 1GY2A 5HDBB 2XBTA 4XXCA 2VR6A 1QYGH 1HSBA 3HPLA 5JLZB 1G6RA 4NPYB 1EGJL 4Y5YB 3MUHL 4MKMA 1SQ2N 2WO2B 4YHOL 5GSRA 4ELDA 2VAAA 4OJEH 1N68A 2FSDA 3EO9L 2KDYA 2J5WA 5ISZE 1N67A 4A37A 1JPGA 2V5TA 2CJTA 4P59H 4BWUA 4NKIL 1FFOB 1UD4A 5GGQL 3W11D 5C07D 3C2AH 2B14A 4XNXL 4O2FB 2XA8L 4FKEA 4JDVB 1PX3A 3K8KA 5EZJA 2CK0H 2ZUXA 3KPNA 2BHFA 4J27A 3BGFC 3OAWA 3MJGX 1TJIL 4OJAA 3CQQA 2X89D 1DYZA 2QKIC 4G6AD 3DO3A 4OZ4A 4EUPH 1PYWA 2PXYB 4Z7QE 1LK3L 1S78C 4G6KH 2R1XA 3WFCL 4FGMA 1X5AA 1B2YA 3QWRD 3U7YH 4UOW1 5EO1B 4DEPC 1H5BB 1UH4A 3MLVH 2CIKB 1IGYA 4XPBH 3IN0A 5E95B 4P48A 4PCKA 5LGKA 3LKOA 1ACYH 3LH9A 1RJLB 3G6DH 4PJ9A 2AQ3A 2WQVA 3S4SG 5HJBA 4HLZH 4KMQA 1FNGB 4S1SH 4F5CE 3TEZA 4NZJA 2BM3A 3L45A 1S3KL 2P7TB 4HKXB 5AW7B 2HVJA 2ZT9C 2NW3B 5KVEL 5IMOA 3VXNA 3WKML 3KPPA 1RIUH 3OR7A 4HHWA 4HJJL 4PJCA 2QPFA 1OO2A 3E2HB 4LP4A 4HZLB 1SLWA 3LZLA 4LO9A 1IM3A 3VD0A 3EFDL 5FKAA 5JHMA 1AS7A 1G9NC 1NBVL 4IK7A 5JPNB 3H7BA 2OFQA 4FS0A 4U1KA 5H35B 2KYIA 3VFRA 3QGVA 1QO3B 1RZKH 3TONA 5MENA 5D2LF 1WFOA 4XR8C 3P4MB 2OMZB 3NSJA 3ZKMC 2BPBA 2OS7A 5I1EL 5ACZB 2BIOA 3E9UA 5J6SA 2A6DB 4L9LA 3CLEH 3TESA 4GP5B 2GI7A 2NY0B 2GUOB 3GDCA 2CDGA 8PAZA 3WIFA 3ZHDA 4ZTOL 3QJTB 2BVPB 4ONGL 4UT9L 5E99L 4F9PC 5BVJA 2Z35B 3HAEG 1GZQB 1UD2A 4I89A 4FYQA 3DYPA 1FVEA 1RIHL 2X09A 3GBNH 3L3JA 1WA1X 5B4MD 3ISYA 2E3VA 4AIEA 1TEFA 3I6LE 2KI6A 1A22B 4MS8D 4ODSL 3TU6A 3MRLA 1CL7I 4L2LA 2H0JA 1ILUA 4XVTL 1XGPB 3MRNB 3FF8A 2YK1H 2O5ZH 3AXIA 5FWRA 1GPOH 3NIDE 2I85A 4IMLB 3S5ZA 5CM1A 2DQDL 4PGBB 4GUQA 2OBGA 4WRLA 1BJMA 4NO5B 1H19A 4Z23A 3J27A 4UANA 1UGKA 2IALA 1L9OA 4FI8A 3V5HB 1QI5A 5I1IH 2EYRA 4JDZA 1NGWB 2DJ4A 1CD1A 3OF6D 5D4QA 5EC2A 3CZFA 3OKDA 1F58H 2HX8A 1RIVL 4P46D 3WD5H 3T6QC 1KJVA 4PS7A 5E9NA 3QFJA 4ZSOE 1D5XB 4Z7VB 5EU3A 5EZPA 43CAA 1QFWL 1W8OA 1C08A 2L8AA 4TTGA 1PS3A 4OD1L 4FXKA 4WFED 5DEZA 4GKZA 4OF5A 2PR4L 4P0DA 1BQHG 4JR9L 4LIQL 3ZL2A 2OW6A 2P8MA 4HETA 4S1DC 4MX7B 4S0SD 3Q0HA 3V79C 5AB1A 4H1LH 3WN5B 1ZV9A 3PP4H 2ZKXA 1NFDA 4OUOA 1Q0XL 1GOGA 4M48L 3SBRA 3SQOH 5L0QB 3RNQB 3OKLB 4PN6A 4F57L 3C5ZD 2VR4A 5I8KL 3H55A 1QRND 4XPTH 1TQWA 3ESOA 4NQQA 4RFNC 3SE9L 1WFJA 3T0WA 5D6CA 4MA3A 4JFFA 5GJTH 5C0AE 4K7PH 5D96C 3ELAT 1XF2A 5EIIA 1DO5A 2Y0SA 2GSIB 4YX2H 5LGHH 4CUCA 1KBBA 4Y4KD 4ALAH 2NZ1A 3RDTA 5CUSH 2LQRA 1UOLA 1B0WA 1KYOJ 3MV7D 5L2KA 4K3JL 2OL3H 4YXHL 3HB3C 4IU3B 1HVXA 1Q9WA 3R1GL 5HTSA 3MODH 3V0GA 3EOYG 2ZSWA 3SCMA 1XF4B 5B38B 3FSZA 2PCXA 3KPMA 2CDEA 4XH2B 5CBEA 4GQZA 3QUZD 2DI8A 3GMRB 3I6SA 5FO9A 5FO7A 5CEZD 1EAPB 4GAJH 3BWSA 9CGTA 2MNUA 5E8EA 2XN9E 4MA7L 3T4AA 4JFDA 2R0ZL 4KJQC 2FWSA 5MP6L 2I32A 3FTYA 4Q58C 2NY5H 3KD4A 1IT9L 1FZKA 5KYUB 3QYNA 3NIFF 4AEIL 2Z65C 4IRJD 3UH8A 1ZT4A 1QHQA 4HG4K 3I75B 3OMNB 5HI4D 5DLML 1AGCA 4IDJL 2QADB 2WPGA 3UJTH 3SDXF 4RNRA 5A6LA 1IV8A 4OCSH 5AOKA 1BM7A 3CMGA 2A73B 3PGDB 3E80A 4OSUH 3SPJA 3FO1A 1E9OB 5A3ID 3DJ9A 5CD3B 4RZKA 2CO6A 5L2JA 2VM9A 4U4BA 2D2OA 2GJ6A 3QQXA 5IJKC 5FA4B 1IGCH 5E2VH 1KN4H 1PG7W 3VTAA 1ZS2A 3TEWA 2DEXX 1DLFL 4N2EA 3VO0A 2J6WA 4HCRH 5DUJA 2V5SA 2IIJA 5KVMC 2Y23A 3HRPA 2IFFL 4FQLL 3RVVC 2OMUA 1BLIA 2VR7A 4E9TA 3NFNA 3DVNA 4KK9C 4HCGA 4MB1A 1YEDA 3GLEA 2BJML 1CVRA 3QEQE 4QHPA 5CSZB 5C71A 5L6YL 2IPUK 4FG4A 4A38A 1R3LA 1KLFB 3NCXA 4WNJA 1J8KA 4EIGB 1BP3B 1CC3A 3N85L 4DF9A 3HHSA 2M26A 1DBBH 2JQMA 3EYVA 4UCFA 4URTB 3RZCA 2BNRD 2WIIA 2C9XA 1UKQA 2G9HB 5E6IB 3S48A 2W07B 1IEAB 3QARA 4E9VA 3N2JA 4FP8H 4QRRD 5FIEA 4CVXA 3CHRA 3OHXC 4AGOA 4MB5A 3ZE2F 2XTSA 3MOAH 4KKCD 1KCBA 2C4XA 2AV7B 2IANE 4MXQD 4R3SA 4Q4IA 5HYSA 2CLRA 3S3PA 5DHEA 3AACA 1J12A 3GIVA 2Q3XA 3JBG7 2CA4A 2PP8A 3BGMB 4HF5L 5HHPB 4YGAB 4OLUH 3DMMA 4W6WB 4BSVB 2JI3A 2JKLA 2VABA 3K72A 3AZUA 4F7MA 4TQ8A 1JHTA 1RKRA 1ZHLA 5LXGH 4KTDH 1XGTA 2ZX8A 4QTHB 2PCYA 4YWGH 2WO3B 1MAJA 3MBEB 4WSGA 4DK6A 4HFWB 4JFTA 2AQRA 2W38A 2IH1B 3P9MB 2E9IA 5AZUA 1HCVA 2KZKA 3QIBA 4ZO9A 2NMSA 3DHMA 1DBAL 2FQFA 5F8QC 4AIXA 3KGUA 4K9EL 4LSPL 3TYGH 3FTGB 1G1CA 3K0YA 4KRNA 4X8CA 1S9VA 1C12A 3WS6C 1AGBA 2VZ3A 1UXMA 4XOEA 3EGDA 2JIXA 3QPXL 4LCYB 4LSSL 4GKNB 3PWLA 4R7NA 1P1ZB 4U2ZA 1BBDL 5LGJB 3K6IA 4M6MH 2B16A 4IJ3C 3QJSB 4JQIL 5CP7A 4BK5A 4LSUL 4HOXA 5E8OA 3N41B 2JKJA 4HS6A 3EGXB 1OHZA 1J0JA 4HMCA 4LLVB 1NDMA 4OR1A 4XC3L 5GHWH 1MHPH 2SEBA 5HHXL 1QUPA 2ZX5A 5JHLH 3TT3L 2P46B 4ONHB 5BJTA 5K59F 2AI0H 3I9AA 1T1ZB 1H8OA 2MNJB 2P80A 4RAVA 1ZD6A 3INUH 5E2JA 5KUMA 3TBWA 4DGWC 2Z92B 3HG2A 3H2PA 1ZJBA 4WI8A 3MMEB 4ZK8A 4MD5B 4KUCF 1ULVA 4EVNB 1XMWA 4HXAL 1LVEA 2CBMA 3FT2B 3CFEB 4KHTH 2RALA 3ASOB 5DJ0A 3QQ3A 3PXHA 1X5HA 2K9FB 5G5DB 4AYMC 4ORZC 3VWJC 3WIHH 4AEEA 1PQZA 1MFUA 3L95A 3UTSA 5F9OL 4AENB 2CHZA 4PY7B 4KRMB 1HHKA 5F2FA 2A0LD 4M5ZL 3LS5L 2ZWLT 2JB6A 4UQBA 4LP8A 2BY3A 3RWEB 4DP0X 3BRFA 1QA9A 2NY6B 5EU6B 4AIZA 1IAIL 1JFQH 1OPGH 1HJCA 1MRCL 2AKRB 4YMPA 1Y6NR 3RFZB 2AQPA 1KBPA 2Q5BA 2A9NL 5DS1A 2NY2D 3MO1A 1P4BL 3M1OA 1XSKA 3C6SB 3IDNA 3GSNL 2XETA 3QI9A 4LF3B 4EUPG 4K3DL 3T3PF 2WBJD 2H6PB 5SX4H 3II3A 3AU1B 5LG1A 1BLNA 5I76B 4ILDA 5C09A 3U25A 1NMCB 4HUMB 1G1YA 4W81A 5AYUL 3QT2A 4XPHL 3X12A 4ODBD 4ZDHA 5ICYB 1UM4H 4JFOA 5AKSA 2WWOA 1EEQA 3VXMD 1CYXA 3VQMA 2E27L 3GTVA 4QXUH 4MMZC 1NC4D 3MCLH 3OG6B 1KLUA 2DWDB 2ICWJ 2DTML 3F7VB 5MI0C 1CLOL 3KYAA 1MNNA 2WV3A 4BH8A 1G87A 5DK0A 5KN5A 1U8PA 3TIEB 4KY2A 3PGCA 4LAJH 4EI5C 4K71B 2ZKYA 3T0EB 3VXTB 3VXUD 2GITB 3BH8A 1A4CA 1HIMH 1SEQH 5IY5B 4BZ1H 3DXAD 4RSVA 4XP4L 2Y22A 3SO3B 3AG4B 4AGQA 4ZMOA 3HUJA 3VGHA 2HVKB 1PU0A 4LSTL 4MTMA 5D1QB 3WFHB 4L8BB 4EI6A 2ZOWA 1MFBH 3MREA 5CBAB 2G2PA 1YNKH 5AOIA 3ZX1A 3IVKB 3B9KC 3TVMA 4X9HA 4Y89A 1VJSA 4M7ZB 5CLWA 5DRXA 3HBGA 1R3JA 3EOTL 1NQBA 3QUHA 4ODWB 3K1DA 1TCRA 1IC4H 3EYFB 2FX7H 2FQGA 1FL6A 2BNQB 2WGNB 2XYBA 5C07E 2FRGP 1X4XA 2YD4A 4M1GH 3HBPA 2XXMB 3RY5A 3X3GL 3D8MA 4JG0L 1IGFL 1ETA1 1KTJA 3WJJC 5GGVL 1RUKL 4C56E 5ALCH 1KTCA 2BMKA 2OULB 3LPGA 2EEXA 3EYQC 3QIUD 4Y5VA 3ZTEA 2E8YA 4KKZA 1RVFL 1FYHB 3MR9B 4TNVF 5BS0E 5IB3B 4PJFB 5AW9B 4BSJA 1JZ7A 3RURA 4TVPH 1PKQB 2YSSA 1F3JB 4B5ZA 2IOIA 2VXSL 4QF1B 3RL1A 4YFLI 4HD5A 5G55A 2LU3A 2YC1A 3VE0A 3MV9D 1B6UA 1WG3A