2ZKWA

Crystal structure of human cu-zn superoxide dismutase mutant g85r in space group p21
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
149
Chain Sequence
TKAVCVLKGDGPVQGIINFEQSNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLRNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Cu-Zn superoxide dismutase mutant G85R in space group P21
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 38
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zkwA00
3KBEA 1U3NA 3H2PA 3LTVA 1F1DA 3GTTA 2AQRA 1F18A 1L3NA 1PZSA 2XJLA 4BD4A 1COBA 1PU0A 1IBDA 1E9QA 1SOSA 2Z7UA 2VR8A 3QQDB 2VR7A 1UXMA 1JCVA 1IBHA 1EQWA 1F1GA 4FF9A 1ESOA 3HOGA 1E9OB 3SODB 2WZ0A 4B3EA 1SXAA 3F7KA 2NNXA 3L9EA 2ZKYA 1HL4A 2K4WA 2LU5A 2AQQA 4N3TA 2V0AA 1RK7A 1TO5A 4A7UA 4OH2A 1SXSA 2Z7YA 2Z7WA 3KH4A 3RE0A 1JK9B 2AQNA 1DO5A 2AQTA 1Z9NA 2WWNA 2AQPA 1JK9A 1SXNA 3S0PA 2GBVA 3PU7A 2ZOWA 3CQQA 3ECUA 2E47A 3GQFA 4A7QA 1CB4A 1DSWA 4BCZA 2XJKA 2ZKXA 1SXCA 1PTZA 3CE1A 3GTVA 4U4IA 3L9YA 1E9OA 2R27A 1YSOA 3ECWA 2AQSA 2Q2LA 2WZ5A 4OJAA 1OZUA 2SODB 1IB5A 3KM1A 3QQDA 1IBBA 1HL5A 1EJ8A 1OZTG 2E46A 4L05A 4N3UA 1IBFA 1S4IA 4A7GA 3KBFA 5KBLA 3GZPA 4A7VA 2WYZA 2GBUA 3HFFA 1OEZW 1SDAB 2AF2A 1QUPA 3KH3A 1MFMA 3KM2A 2WKOA 1CBJA 1SXZA 2APSA 4MCMA 3GZQA 2C9UA 1XTMA 2C9VA 2WZ6A 2GBTA 2C9SA 4BCYA 2Z7ZA 1BZOA 1XSOA 1SDYA 1N19A 1E9PB 1FUNA 1SPDA 3MKGA 3HW7A 1N18A 3H2QA 5CU9A 5KBMA 2VR6A 2AEOA 1BA9A 1B4LA 1F1AA 4A7GF 1TO4A 1UXLA 1YAZA 2JLPA 2ZKWA 1SRDA 5KBKA 1E9PA 1SXBA 1E9QB 1B4TA 1P1VA 2WWOA 1OALA 1KMGA 1YAIA 1Q0EA 3CQPA 4MCNA 2JCWA 4A7TA 1Z9PA 3T5WA 3F7LA 1AZVA 4A7SA 3GZOA 2WKOF 3K91A 1OAJA 1XTLA 3MNDA 3ECVA 2WYTA
chains in the Genus database with same CATH superfamily
3BP5A 1HHGA 4N0RA 5I17B 1PL3A 4LIQH 1YECH 3E2HB 1ID2A 4B9PA 4CN6A 3RA7H 3U0PA 3OZ9L 2SEBA 3VAEA 2GJRA 5KYYB 3CZFB 5CJ8A 4W9IC 1FI8C 3QJRB 4DSYA 1GAFL 5IZ7A 2Y7NA 3DX6A 3EOBB 1ZVSB 4PJ8C 1CGSH 1OPGH 2IV9A 3ML9A 5BRZA 3WFEL 5AB9A 1TCRA 3BKCH 2J2ZA 4GQ9H 4QHNB 4Y16D 1FHNA 3W38A 3PP4H 4NJ9L 2CIIB 3A24A 2WXJA 2VLJA 4YNYA 2OMZB 4B0MM 4Z0BH 1JE6A 1E8ZA 3CSYA 2NT1A 3TBWB 5C0CB 2D03L 2GEEA 1YJDH 5E1AA 3TN0D 4CSTA 3TEZA 2UXVA 1UURA 4RMTA 4YHLL 3NH7H 3H42H 1KYOK 2NX5A 3R1GH 1AE6L 5DMYA 1DQJB 1R3JA 1HDMA 4PRHA 1FAKT 4Q89A 3NFPB 4PJBB 3NSDA 3VG0H 1TNMA 4K73A 3C8KB 2B5IB 3QFDB 5A2BA 1RV6X 5JOFA 3B2VH 1U8QB 3VRJB 1JV5A 2ZJSH 5CJQL 4AKPA 1SOKA 2G9HB 1NGXB 3DX7A 2X89D 4G6JL 2CO1A 5DMIL 5AVRB 1S7SA 1WG3A 2ESVD 4RMWA 2WXMA 3SCMC 3BN3B 2VDMB 4Y5VC 3ZX1A 3AT8A 4YK4C 1JAEA 2B0SH 4J3OH 5DEFB 3T0EA 2QHRH 1F6AB 2CWRA 2PXYC 4OF6A 1H15A 1A1OA 1SYSB 2P5EE 5ALBH 3ABLB 2WLIB 1EEZB 3HZYB 5EO0A 4BH8B 3QUKA 4PWHA 3H9ZA 1YNTF 3QWRA 1EXHA 5ANHA 1I53A 2TRYA 3FU7A 3NCJH 4HD9A 1Q0XH 1XSOA 3ARDB 1S9YA 3K6IA 5JIKA 7PCYA 2F54B 1T0PB 4NRXB 3SGJC 2J1ZA 5A7BA 4ZI8A 2ZWLT 4WWID 3QJQB 3NACH 2QSCL 1IGCL 1ZK9A 4Z8FL 4EN3D 4HS3A 1WRFA 3GD1C 2QGCA 3ML8A 5J11C 5DUPH 3VDBA 1CIDA 3RNQB 5A2LH 2WMPB 2OI9C 3GSXA 2G75A 3CFIC 1OSPL 4Z7WE 5ECJE 5ESVA 1IL1B 4G8AC 5C0RL 5LWYH 2XKNA 4A1RA 1GRWA 5D2NB 4Z7VA 3NIDF 4NQED 3CFEB 3DOSB 1L0QA 3V2AR 1KEGL 4J8QA 4L5FE 3EYSL 5F89A 3MYJB 3LKSA 3VI3F 1VGKA 4RESB 3VWKB 5I6NA 1L3NA 3MV9E 5M7QA 1BVLA 3K2MC 2CD0A 3ARBD 1AZUA 4PJCA 4QKXB 4AIXA 1AQDA 1WAAA 35C8L 4R96B 5TDPA 3T2NH 4K7PH 1PY4A 2JV6A 2XV3A 3ULVE 3SE9H 3IXAA 5KANI 1LP9E 1X5IA 3CGTA 2AEIT 1JSYA 1YYMH 4Z7UE 1BZEA 4GRLD 4OJYA 2ZKYA 1CL7I 4X5PA 12E8H 2CO7B 3ZE0B 1TKWB 3M17B 5TQ2H 5I6LA 1S8DB 3W9EA 1GJUA 1A7QL 2EO7A 2V3FA 5BV7C 1I4FA 3EYVA 2D3LA 3KCWA 4MS8D 4Z77B 5AG9A 1LLAA 1RP8A 2A9NH 3IE9A 1BXXA 5MHSD 1T4KA 3W0WD 4AG4H 2NQDA 5JHDA 4K5LA 1RZFH 1L5GB 3CFNA 4NWTL 2FBOJ 4PI0A 4QO1A 1Y18B 1RUQH 5CZKA 5H35A 3BUPA 4KI5C 2CXGA 1J18A 4LAJH 3JYBA 5CP7B 5ID0B 2H9GB 4O02B 2NY5L 3SO3C 2H1PL 1XQ4A 3WIFB 2YPLA 4MASA 2FATL 1BD2B 1WDAA 5DRXB 5HHXL 3Q1SH 3GJFB 5BZWB 5KYUB 1HU8A 1BZ7B 1QATA 1BQRA 1FNGB 3BAIA 4DFIA 3ARTA 1QW9A 2ZSVB 1VEOA 2JCCB 1JZ4A 4WFFD 1VESA 5MP6L 4N2OA 3WLWC 5IWLC 4JM2F 3L3IB 4UZSA 4TL4A 3MRJB 2R1WA 1KIPA 2BSCA 5D2NA 1GY2A 1CK0H 3I9PA 4JPQA 5ESAA 2GABA 1OP9A 4FX5A 3TH4T 2RB8A 4IJ3C 5ESAB 3D4CA 5BO1H 1GZPA 3T77A 3SBPA 2FUTA 4PVLA 3I6GB 1QLFB 1GW0A 4BKTC 1N0XL 5K1NA 4LE8A 3OAUL 3MU3A 4H5SA 2E3VA 2QVTA 5LCVA 3MRDB 4LEXH 1SDDA 3T3PF 2PR4H 4ZD3H 2GUYA 1TVDA 4MMXA 3HRZC 4WWNA 3STLB 5ISZD 1N64H 4QHNA 5AVVB 5SX4H 4UT6H 4WI8A 3TU6A 3EFDL 5D4HA 4I48B 1H3VA 1TYRA 2JLPA 1BZ9B 3V0AC 5CMAB 1TR7A 1B4JH 3IE4A 4M8QA 4K8RH 4P2OA 4Y2DD 4OT1L 4UQIM 3J07A 4CMHC 3M1CA 3SGEI 4J2QA 5IV2A 4BH8A 5DVOA 1YDPB 4KI5D 3NQKA 4I9XA 1XH2A 1TETH 4PJHA 3BVDB 1V3LA 3HS9A 4JKWA 1U33A 5D7LB 3U4BL 1L5GA 2DQMA 4OM0H 1NCIA 4JHZA 4YQXH 1NBZB 1TNNA 3G6DL 1KPUB 4DVBB 4MNQD 5L2JB 3DMMB 2J8UA 5JA9A 1IGML 3ZKMC 2QKIC 2VQ1A 5HHVH 3SKNB 3TH3T 5CBEB 1NGXA 3UAAA 2QQLL 3RU8H 4K9JA 3S3PA 1TQCB 3VRJA 3ZBMA 5F7DB 4YHYB 3CAFA 1IFHL 1U3ZA 3BAEH 3CSBA 2IAMA 4H25B 4PJIB 1MCRA 5GRWA 4FJYA 1Z3RA 4FA8A 1D5BB 4L4VA 4MCYA 2X4SB 3BUTA 4HD5A 5BZDA 5IMMA 3WFZA 4PLKC 1RZQA 4PRDB 2X6UA 2RALA 4IIZA 3FUKA 2PABA 2X4PA 3TH2T 4FG6D 3AVEA 2DTMH 1KIUB 2E8ZA 2X0WA 2AK4E 1WAAE 5C0CA 3CQQA 4KHXH 5IQMA 4YDKH 1NUNB 1WGOA 1A4JB 3KPNB 4V1DA 3BN9C 4BSVB 2G5BB 1SM3L 1HT6A 3A67H 4WNQA 1FL5B 1MN4A 4Z7IA 5BRZB 1Y0LA 3BE1H 4PG2A 4QHLB 4DW2L 4G70B 2DTML 5I2IB 4F2MB 1O9WA 3HCVA 1PD1A 5LXVA 3PV6B 3K6DA 2PYEE 2I07A 5EU5A 1G4RA 1WE5A 3BFQG 2F15A 4UV4H 5DUPL 2E6QA 3KPQB 3F5WA 1R33A 1JGEA 1WBZB 4G8GA 4LSRH 2BOCA 4FXGC 4I3RL 4KBPA 3W0WB 4R7VA 4UM9A 4RBPH 3UFIA 4A67A 2QTEA 5CGMA 4AENB 1MVYA 3ZTJH 3FKUS 4LKCA 4W9JC 3EJYC 5T33H 3RDTB 4LP8A 3EOTH 2A73A 2XLLA 3MBWB 1FDLH 1RXLA 4MB3A 2YSTA 3U6RA 1HXKA 1SGKA 2AJZB 2BIIA 2FWOB 4W6YB 5G4OA 3GM0A 3HMXA 4I1NB 1KTBA 4Z7QF 5GISH 3Q9PA 4XAKE 1BA9A 1J8HE 2B08A 4NC1E 1HC1A 4DN4H 3ZTEA 5FKPB 5L7XL 3DX9A 3DX4A 1QFUL 1YZZA 4PJ5E 4QRQB 1J1OH 2F8XC 1OCWH 5CR8A 1VB9A 4J39A 4LL9A 4NQDE 3RWIA 4PP2A 4JHWH 2PYFA 4AYFA 3RI5F 3QORB 4HXAL 1RZGB 3RVUD 4NQEB 4DKEL 2XFGB 1VADA 3QDGE 1AGDA 4JFSA 5F21B 3RKDD 3MAWA 1K4DA 2V2TA 5EHFA 1HDMB 2XZAH 5T3XE 4MXVE 5ICUA 3MCLH 2DMBA 4LPUA 1PG7L 3KZ8A 1VACB 3BFWA 3TWYA 4PY8I 5D5MF 2CBTA 5A43C 4GY4A 3CFQA 3MRCA 2BOBA 4BHUI 1JHTB 2H26B 4AQAA 4Q97A 1URZA 4IRSD 2UY7A 4G6MH 3RGHA 2I27N 3RUGF 5B1JC 1TCRB 2E9WA 2Y1AA 5D1ZA 3QUZA 4G5ZL 4J28A 3ARDD 1F02I 1A1NA 1EFQA 1A9EB 1X5KA 4MMYB 3U1QA 1ZXKA 3UOAB 3GLZA 3JWDH 5F3FA 3QNXA 4ORGA 5EULV 1GAFH 4EE2A 4QR7A 2C4XA 3QS3A 3US0A 1YEDB 5IGXH 4OIIL 3WCYA 3B37A 1CQKA 3V0VB 1F3RB 3LRSA 4IBQA 2FCBA 3MNMA 4TRPH 1SXCA 4MWFB 4OLEA 4Y1AA 4TKWA 1SYVA 2BC4A 3QAZB 4G7RB 2QTVA 1A6WH 4I77L 4M6ML 4Z6AT 4M8RA 1KC5H 5T3ZD 1J9SA 1HQRB 5KBPA 4ZUWB 3VXRE 4U3CA 3U25A 3QZWG 2LOEA 1OD7A 4QGYA 3VD5A 3QFJD 2PF6A 4XWOD 2AJSL 2XU9A 1T5KA 4NNPH 2NXZD 5DJ2B 4DP4X 5I23A 3RWDB 5TE6L 1B88A 1B0IA 2EDMA 1REIA 4YWGL 3RZCA 2OMVA 4NQQA 1KJMB 1UZGA 2JKWA 3L3OC 4KMLB 3OMAB 1HILA 4XNQA 4PP2B 1I85C 5AW4B 1CFVL 3G6JB 3EHBC 4JLRB 2Q8AH 3VXQA 1F6FB 1NGQL 2R0LH 5DWPA 1KIRA 3NZSA 3T8XA 1INEL 3S4SB 3GI9L 1NMCB 3PWVA 4XWGL 1TUPA 2ZWKA 2NY6D 2A9CA 4FABH 3AC0A 3AW5A 4XPBH 1RZJC 4MRCA 3TLRA 3ZXAC 12E8L 3EFOB 3BSZH 4JFDE 4NSKB 5TF1H 1TO4A 3CC5B 1RURL 4FG2A 2YZ1A 3R0MA 4AT6A 3QI9C 3DJRA 2JK5A 4KQ4H 5K9OA 1LTXA 2OP4H 4ZSOB 4WW2B 1EHAA 3MV8D 3FK3A 2VDKL 4Y19A 3B9DA 4WI4A 1JYVA 1OW0C 2VAAB 1T1XA 1BSIA 4PWJA 2PPDA 1KIQA 1NCBL 4JG0H 4QHKI 3VM5A 4XPFH 2XIDA 1WAAF 2F5BH 2HJLA 2YK1H 3VMOA 2WJ7A 2B2XL 3HTLX 1YMMB 3I9GH 4U6VL 4DP1X 2DEWX 2ZYRA 3EBAA 3D4ZA 2DJSA 3LMJH 4HK3N 4L1DA 1AKPA 2HUHA 2NR6D 3GI8H 1YMMD 3QQDB 3VI3A 2NXZC 5SWZA 5GIRB 1EEYB 1F1GA 1QUNB 4NC2B 2BDNL 1HEZB 4ZMVA 4ZUUB 5T5FL 1TZHB 1YY8B 3CLEH 4OSUL 4RSYA 4IQHA 5G2NA 4QLWA 4UOZA 1GPOH 2PWFA 4WO4A 4KO9A 4X6CB 4XAWH 4P48A 3RURA 1A3RL 3EGDA 4A04A 4NCDA 5D1QA 3T2LA 5IHZB 3BP4A 2G5RA 5JW5B 2E7BA 3A4EA 4B60A 1MWAB 2OYPA 4WFED 2R39A 1NAMH 1KTDA 2D03H 2A3TA 4FFWD 1XF4B 5IB2A 5KW9H 4F20A 1M4KA 3ECWA 1E5UI 2AQSA 3PAVA 1F3DJ 4OZHF 3ISWA 3RDTC 1ZT1B 4WFHE 3HNSL 2KH2B 2E46A 3S36X 2BERA 1PDKA 5L2JA 1J9RA 3OB0K 1CUOA 4HEMA 3RL1A 1NAKL 1TTFA 1GKEA 4OJCA 4TQHA 5CJOH 4NRYA 3HMWL 4ALAH 1MHPL 2A4CA 4GRLA 1A9BA 5EDSA 2O1AA 4NWUH 3P2DA 3BKJL 2MIZA 2VISA 1GJIA 3QFJB 4RZCB 3HPLB 4E5XA 3V9EA 4YEEA 3UZVA 3ZYOA 1LM8V 4M7KH 1EPFA 1GC1H 1PAZA 3HKZA 4Y88A 3I75B 2C1PB 1W8OA 1HS6A 3NCWA 4Q6IA 3SYPA 2CHNA 3BVUA 5IMOA 4UM8A 3VE0B 3ULVF 1E40A 4GMTL 1RZKC 4PIBA 1FVCA 2NTFB 4E41A 1IM3B 2AEPH 3LN9A 5ECGA 4N25A 4AKQA 1GZPB 2RQ8A 1P4LA 2YS4A 4OZGF 4S1RL 5TE4H 1NMAH 4DT2A 3RTQC 5IJDC 4RGMC 3P11L 2YAHA 3QEUB 3ZRSA 4HKZA 3ZTDC 2I24N 1LP9B 2X5PA 5E2VL 4JDEA 3L4CA 3QXDA 5MENA 4QXUH 4L0YA 4Z7OF 5DEGA 4IRJA 3UG5A 4L18A 2VAJA 1IM9A 3RPKA 1PKQE 1MFEH 2VWEC 1QLEB 2XV0A 2Z31D 3DO4A 2QGBA 1YC7A 3NRPA 3PUCA 4DH2A 1GGTA 5LAPA 5ITBH 5C7XL 4NUGL 3O45A 3WSQL 2L7UA 5C0NC 5DJZB 3QCVH 3L3HB 4Y4FD 3LAFA 3DX8A 4ETYA 4HGWB 4UF7C 3L3DB 4LEOA 1RUPH 1I3GL 3C5JB 1FZKA 4MD4A 4O58L 4NZUL 4PRPB 4ZSOE 4UOQA 3P4MB 4AYDC 1WBYB 2B16A 2MHAA 1NIEA 5AAWA 5BVJB 4R3SB 4QO1B 2QR0B 2Z8WC 2HRGA 4FP8L 5BW7A 4Z0BL 4K71B 3PWPB 2ZXEB 5KZCB 5SWZD 5AYTA 2UUDH 2XQBH 1OP5H 2NY7L 3S3CB 4D9LL 1XAUA 3UG3A 1TQSA 3ARSA 4WGWB 3ZGHA 2Z35B 4RWHA 3HR5B 3AY4C 4HHGA 1EX0A 1PJ9A 3VMPA 5DD6A 4FYSA 4WUUD 5AVTB 1ETA1 1DQQB 2CK2A 4DF9A 1NSNL 1CVRA 3QDHA 2BP0B 4FE9A 4HK0A 4U33A 5TDPB 3ILPB 2ZKMX 4XCEA 5IQ7L 4FYRA 5CGYD 3DJTA 2I9LA 5FA4B 4NO0A 4PRIE 1XF4A 5IB2B 5GGRY 4HMCA 1DLFH 4XVJH 5EA0H 2NNFA 3BIKB 2C9AA 4R7NB 1ZVYA 4LSVL 1QI5A 2E0PA 3DBXA 3IVKB 4OKVB 4NUPA 1CXEA 1JGVH 4M61B 4EF3A 2IPUG 2JCCF 2YA1A 1KJ2B 2CK0L 2MTPA 4HT1L 3FCTB 3R8BB 1HSAA 3NCXA 5INDB 3KNBA 4NBXB 3HFMH 1SPDA 1R17A 5FYLE 4X6CA 3QO0A 5IEKA 1QD0A 2BY3A 4LP4A 3L4XA 1R47A 4PJ7E 5CU9A 5FHAL 5JW4R 4TQIA 1UJTA 2AZAA 2WXQA 4F1SA 1B4LA 4HQQH 2VMDA 4IKIA 4NRXA 4FQHA 3U82B 3P4OA 5SWZB 1QHQA 4OTXH 4E9RA 3G9AB 1RZ8A 1YPZB 2K3HA 2XTJC 4U1IA 4PB0H 1J8KA 3JUYA 3QUYC 1J9TA 1NCJA 2BFGA 2CGZA 4PW9A 3L5IA 4UM8B 1DL7L 4YHML 2HYMA 3CVDA 3LSOB 3H3PH 1E4WL 4W9DC 3QISA 2AP2A 1OQXA 2AJXL 2XZCL 2P48B 4ZMQA 3LKRA 4MSWB 3LHPH 2MKLC 2HFGH 1FV1B 4RZCA 4E5XB 3PV7A 3BAYA 3KL5A 4KDTA 3ZIYA 4E41D 5L4JA 4XO8A 3OAWA 4UI2A 5BJTB 1BYOA 1N5YH 1S5HB 1GVIA 1LQSR 3RWHA 5I75B 4JFHD 4MMZB 2JK5B 4HCIA 1K2DB 1KGXA 2EXWC 1P1ZB 4HEPA 4KXZI 2DDQL 4BDVA 4X7TA 5D7IA 5B38A 2V2XB 4LSQL 3GMMA 1MI5A 2CO2A 3BT2L 3AACA 4POZC 2Z4QB 1M7XA 5AYQA 1BIHA 3Q6GH 5CINL 2VJ8A 3C6SA 1MCPL 3ESOA 5JW3L 3H56A 3VRIB 4RGOL 3TJPA 2OJZH 3Q05A 3VXQB 4WSGA 2UZPA 5TK2A 3WNNA 4Z18A 3TWCH 2AHIA 4TNEA 1X5MA 2E47A 1S5IL 2VIRB 4O5LL 1L9RA 2X7LA 3F12B 5ISZB 4IBYA 1TZIB 3D39B 1Z66A 1LVEA 4KROB 3BP4B 4KTGA 4WI7A 3FUFA 3FT4B 2BMKA 3OKDB 4XP4H 3RVWD 1H3GA 3MR9B 2DY2A 3RVWC 4Y2DC 5J1TC 1ZSDB 3R7QA 3V5DA 4ZUWA 3I85A 1HQRA 1BLNB 3SOTA 1YY8A 3IDXH 4WEEA 2W0LA 4UQBA 1E2ZA 2J5WA 4GAFB 3GXUB 1H8NA 2BZCA 3BVNB 4ONFL 5JZ7D 5E6ZA 3LXCA 4EQ2A 3PPEA 2FJGB 4YFEA 3OKEB 4NO5B 3QNYB 1JPSH 4Y4HD 4RZKA 1RPUA 4JFEA 1T5WB 5FX3A 5D1XD 4PJ9B 2F1AA 2Q86A 3I3DA 4ZFOA 1LP9F 3E9UA 2Y25A 3KG5A 4ZOEA 5T1MB 3DO3A 2QFRA 1U21A 2N4IA 2NMSA 2YWZA 3N2JA 5J9PA 1MFNA 2HLAA 1U95B 2BNRA 1J8SA 4OGZA 2CRYA 4JJ5A 3GWJA 3R0NA 5B21A 5B39A 4KQ3H 4KKRA 4U7KA 4V33A 2YXVA 2R2EB 4DOHE 5GGVY 3C5ZA 2G0KA 3FPYA 3TBSA 2FWUA 3D48R 1E9QB 1FE8H 4IHOA 4KZ0A 5DA0B 3RGVC 1DQKA 2VR9A 4W6XB 1E4KA 2JTDA 3M1OA 4XWGH 1EDHA 3K5RA 5EU7C 1RHFA 5DD0H 1FNSL 1DUYA 3SE6A 3PL6A 4AY0A 3PWVB 3UABA 3QHTC 1ZA3B 2VERN 4WDIA 9CGTA 1PW3A 2FLBT 1HYSC 1U8OB 2WB7A 2FLRT 3IDNB 4XNQB 1JNHB 2TSAA 3P73A 4WSJA 2BIQA 1XBDA 4Y5YC 3R8QA 4HJJH 2VLKE 3ZE1E 3MSPA 4ODSL 3VSTA 2D31A 2DQIL 2OMVB 4EOWH 4FXGB 3ARFD 4G8GD 4JN2A 2F53B 1BQHB 2I26N 5T1DH 3CIQA 3GUTB 3EOTL 1BAWA 2ZPKH 2PW2B 1EZVY 1M7IA 1XIWC 2WVVA 3LQZA 3MOBL 4QGTA 1U8IB 4J3VA 5AKRA 2BVYA 3TYFA 2YD2A 3GUFA 5CEZH 2BS9A 3FUEA 5AFAA 2P5WD 4GO9A 5DI8B 5DHYB 4OLXL 1Z9NA 5TGBB 4NDMA 2V33A 2YQGA 1D5MB 2X10A 2DJUA 3QZMA 1ZRUA 2OLDA 3ATBA 5HVGB 5IY5B 3KVQA 2QPSA 4DKAA 4GUOA 2CDEA 2YGVA 2BH0A 3ZDYF 3RPBA 1BZQK 4G80B 1O5DT 4APQC 3CN3A 5D7KE 1GCYA 5L9DL 2DM7A 2QPFA 1DBBH 1OGTA 1E90A 2VXUL 3CU1A 1CZ8L 3CN4A 3M6DA 4OLWL 3KR3H 2QV2A 3RGVB 4ZYKA 2HCZX 1QFOA 1HKFA 1SM3H 4JZNB 3V6OA 4N2MA 3LRLA 5KWYC 3E0GA 2ZT9C 1NWPA 2RIKA 3D69B 3FT9A 4M7JH 4MA7H 3QB7C 3KXFE 4AQ1A 3HBGA 3VXUD 2EEFA 4ZTPH 2XN9E 3FQUA 4E2OA 2HRLA 4MB5A 1MAMH 1UJ3B 5C0EA 3QUYB 3MLYL 4NN5C 1RZJL 2X41A 4LNRB 4ZRGA 4M48L 4XPGL 1UJ3A 2EXSA 3QRLA 5AVWB 5J11B 1O6SA 1KCVH 4HIXL 2V2TB 1ADQA 2GPZA 4PLOB 3MKGA 3VNZA 4MXQC 2R2HA 4YZFF 3FUNA 4JQXC 4KVNH 3ZR6A 4AXWB 1GS8A 3QORA 1N6QL 5CHNA 4ZMYA 2HAZA 2V2XA 2WQUA 3P1VA 3CHRA 2OCCB 3GO1H 2OW7A 3ESVF 2MPAL 4UM9D 4MA3B 4ZFFB 4TVSa 1A47A 1T5XA 2BSTB 2J4WL 4TUJB 5MEQB 1KMGA 5C6TH 1AIFB 2ZYHA 4P46B 3ZE2F 3Q8BA 1QA9B 2PW1A 4P9HL 3L13A 4AIZB 5ICXB 5IG7B 1P6AB 4AK1A 2BXZA 5AVUB 4JL1A 4CU8A 3J2PA 1T7ZA 4OD3L 5DZJA 5BZZA 2RTTA 1NQBA 2ENYA 5HDBF 2NW3B 2ZXWB 4AE0A 3L4VA 1PGRB 4V2BA 1T1YB 2GIMA 2X4OB 3LDBB 3AWEA 5FWRA 2YUWA 2X0UA 1A14L 1ADQH 3K2IA 4LF3B 5C0GA 2XTJE 4OZIF 3ZTCC 3GS4A 1HSBA 1JVLA 1UTDA 3UO8B 1RZ8B 1PY0A 3TCXA 3TEYA 4YGAB 2CZNA 3TNNB 3U46A 1JMXA 4UTAA 4CL7A 2BSSB 5DURD 1KTKE 1SXAA 2WK2A 2YUVA 3GMNA 4NKMA 4LCWE 1OKEA 4EZMA 5EUOB 5HI5C 5I19L 4TLKA 5E6UB 2P9RA 1LMKA 3NN8A 4AM0A 1VDGA 5KVFE 4OH2A 4ODBD 5I1CH 5DMJB 1CK0L 3VQ1C 3MACH 3QO1B 3JSSA 4POUB 3GJEB 3QG7H 4PV9B 3VM7A 5L8LB 1G7PB 3QZWB 4KJQD 2R9HD 2YMXH 2WXOA 3LKOA 3GINA 2ZNXA 4GW5A 1J5CA 3IFNL 4BK8A 1XXDC 3CE1A 1CDGA 3V0WL 2PCYA 4N85A 4K3DH 4ZUSB 3IJSB 5CF3A 4ISVB 1N3NA 2QELA 3V6ZA 2IXQB 1P1ZA 4RMRA 4PJAF 4WGVB 1ZSHA 4P46C 4I5BA 3BEWA 4MXWL 4YSAA 4UTAH 4AOFA 3NCEB 3O3AB 4HK0B 3DPDA 2BP0A 1AQKH 1UD2A 2BZDA 2R2EA 3O6FC 1BJMA 3BI9X 2IF7A 2C3VB 2BNRD 4ZTEA 5L88H 1AQHA 4ODVH 1ZTMA 4O02H 5IHUL 1QUPA 3PHOA 5LGHL 2A6IB 4UQDA 3V4PA 4Q0XL 1OANA 2ZUYA 1OB1B 4GW1B 3EJYD 4KUZH 2XQ0A 3OAYK 4GINA 2EDXA 4KO7A 4WK2B 4U1IB 4O00A 5HTSA 2EIBA 2JELL 1TEGA 1FUNA 1JXJA 1W8EA 1UVQA 4YFLI 5DRZA 2WV3A 4PJHB 1WICA 1XHHA 3P4MA 1FWXA 1CFTB 1NCCL 1T2XA 1ZJAA 4ZO9A 5DD3H 4ZQTA 2G4GA 1NUDA 4UNUA 2BWDA 4Z0XB 2BS71 4YBLC 2KERA 3GK8L 3UG4A 2CAKA 2KZBA 4PGZA 4W6WB 2VSDA 5EEYA 5K59E 5DWUL 1P1VA 1ECZA 2BMKB 3OKDA 5E4EB 5DDHA 5SWQA 2R4SH 3C12A 5DC4B 3GLAA 4MMXB 2JJSC 5BOZG 2VLKA 3G5XA 4G3YH 1I3VA 1XH3B 1RLBA 2X87A 4G42A 5IWLA 1S3KL 2TRHA 4PJCF 2P5ED 2FD6L 4ENEC 1XT5A 3O9WC 3QH3A 4QRRD 3SE4A 2XFXA 1ES0B 3B83A 3G6AB 1XB3A 5CKAA 5CR1A 1CMOA 1DSFL 1MHPH 1ZE3H 4K15A 1AMYA 3ZT5A 5D1XA 3P0VH 1Y6NR 5I5JA 2XPGB 5AUMA 2EVJA 2A99A 1XO8A 4L3CB 4M1CC 3TJHD 2XG5A 5FO8A 1J10A 4GIOA 5E08H 5C08B 3VXUA 1OY3B 4P2RA 3QEHA 2HVBA 4FTVB 2PTUA 3QDJD 4PREA 1FCGA 3EYUH 3GHBH 4UILH 1DANT 4XCCL 1UEMA 3T08A 1D5RA 4TQEL 2LU3A 3OX8B 2WBJD 1YA5A 4NRZA 4NZRL 2XX0A 2YN5A 1Z9SA 3WJLA 1CD1B 3GSNL 4CVXA 1FV1A 5GGSB 2QQKL 4LHQB 3CNKA 4EN3B 1EEZA 3HZYA 4LCUB 5EO0B 1MIEH 3V10A 5D4QA 4HG4J 4JPIB 1SEBB 4Q2ZA 2XT1B 1WBYA 2DPKA 2BSRB 2LFEA 1XGUB 3VFUA 2VXVL 1SHXA 1P69B 3BZFA 3LB6C 5TFSH 2H2PC 3BHBA 2AJVH 1B0RA 2HX8A 4NPJA 4EDWL 2QBWA 1NMCC 2AQ2A 2CKBA 5JXEC 2NPLX 4WI5A 4X6BA 2QQKH 3IM1A 2F7PA 5DJZA 5SWSE 1ITCA 1WFUA 2OAAA 3A6CL 1Z32X 4O2EB 3QCTL 2BM3A 4ZQKB 3CDZB 2FYVA 4J3OC 2CO7A 3VFWB 5F7WC 1WFTA 2GKIA 4ZTOH 3SDDD 2WYZA 4FHBD 3ARRA 3MLRL 3PP3H 3C8KA 1DSYA 3L9RA 1FQ9C 3MV7D 4N0UE 4QYAA 4HUWB 1BX2B 1XV8A 3J7HA 3T2QA 4LLYA 3ENEA 1UT9A 3FQNA 4NQVB 2FJFB 2QZQA 3ASWA 4Q4IA 5F89B 1XCXA 2ZWSA 4LHUD 1I1YA 3UL4A 4M9OA 3FOLB 3O9WD 1WSST 3FUMA 2R0WL 5IBTH 3IDMA 3SQRA 1ZA6A 1L6ZA 1GH7A 1RK1A 2G3NA 2ZKWA 4KKPA 4L8BB 4OLYH 2O5ZH 1X9UA 1QBLL 4R4BB 2X1XR 3CDYA 5D2LA 3CFJA 1OOWA 2K0RA 2EEXA 2GI0A 2GJJA 3FO0H 4EQ3A 4U1SA 1NTDA 4YHOL 5TPWL 5H2BA 2EXYD 3U0PB 1HCZA 5IHLB 3EG9A 4XN1A 2VO5A 5DRWA 2X2JA 1QFWL 2ENSA 1J0JA 3PFQA 1T1XB 5LBGA 4V11A 3H6JA 4YAQA 3MOAH 4OKDA 3QUMH 1SN5A 2P3YA 4TSBH 3HZKB 1TLKA 5J6GA 3SE8L 4LLVB 5IT2H 3ZN6A 3UJTH 2DD8H 3L2NA 4CJ0A 4FD0A 4DP9X 1N6QH 5TPWH 2AJYL 4AQ8C 4R8WL 1QFWI 3OR7A 4ELDA 5D7JB 1OP3H 2A6KB 1N3NB 1FL6A 4NUGH 3WSQH 2YLHA 3WKML 1DQVA 4HJGA 4NM8H 1KGCD 4LVOB 1EBPA 4E9VA 3T6ZA 1RK7A 4GW5B 4TPRH 5KSBF 3S8GB 5ICYB 3ARFB 2WXRA 5FYKH 1U3HB 1P7KA 2OXGB 4BXVA 1PKOA 5IHZA 5HY9B 4LSDA 5DO2C 2VN4A 4GNKB 5HYJD 1C12A 1RZIA 1TYEB 1BGXH 2FH8A 4G82A 1MVUB 2VITB 2XZZA 2PMZA 1JG9A 4P2RD 3HG5A 3PWJB 3CFBB 3QIWD 5IW6B 3CZKA 2VLJD 1MCLA 3CBJB 5C0IB 1DQDL 4P57B 4DIXA 3CFKB 1KBBA 1F8TL 2WD0A 2WTRA 4GKZB 4ELME 3C08L 3UZEC 3FB7A 3F6JA 4BM7A 5HHME 3KWVA 2YSSB 3GSUB 4MA8L 2GW5A 3HC4H 4XHJD 3U2IA 1BVZA 5E4OA 4FQ1H 3DIVA 1NANI 3EFFA 3L2MA 3RJQB 5HYQB 3G5VB 4N5EC 3HPLA 4TQ8A 1M2OA 4HS6A 43C9B 1Q38A 1FLRL 4LRIC 1NFDE 3DBSA 2UVEA 2HJKA 3GBMH 4G1EA 4L8CB 5D1ZI 1TITA 2FE0A 1T21B 3SDXA 1L0YA 5E8NA 2E9GA 2AXWA 1FZOB 2IAMD 4HWZB 1KJVB 4PJFB 2YGPA 5D1ZB 4BHUA 1QLEL 3O6LH 2IQAB 4DVRH 4XGZB 2YRZA 4AXWA 1A6UL 4K8RC 5GSRB 5IJVB 5KYXA 5AAWC 1HJBC 5D8JH 1KTRL 2H0PA 3QZBA 3SDDB 3S4SA 4WKXA 1B4TA 2H1LM 4XPTH 4Y8DC 4F2ME 4CDHA 4XE5B 1SJXA 3M88A 3O2WH 3RIAK 5BRPA 2OS7A 5BO0D 5C0CD 3BUQA 1CDUA 1X5GA 1BQKA 2AK4A 4XCCH 1AC0A 3JV0A 2YRBA 4AK2A 3NTCH 1BF5A 2X0VA 4TVPH 2Y5TA 3GTTA 1FE8L 3QRFM 2NLJB 3JQOB 3HC0A 3JZYA 3DYOA 1EDYA 1U8PA 4LSRL 5CZVH 4K2UL 3T0WA 3ARGB 4TUOB 3OHXA 3IJHB 2OR8A 2P24A 1BJ1J 5JW4Q 3BYTA 2EYRB 4N86A 3MBEC 3L1EA 3DGGB 4G43B 3ZKND 1P84J 1LEIA 4LBEA 1ADWA 4XAKD 2E76C 3QCUL 4PRPE 1B0WA 3X14B 5D2LF 3BQVA 3BLPX 4PJ5D 4XVOA 2IMNA 1EJFA 2R0LL 3L3GA 2F5BL 5KSAB 4Y4KD 1II4E 2OZ4H 4L8CA 3CK0L 1E4KC 1UB6A 4IEFB 5AZEL 4Z7OB 2HX9A 3TF7C 2GTZA 2O6DA 1NEZG 3QDGD 1PF3A 3MO1A 3UJIH 1JIBA 3QR0A 3VQ2C 3VFGL 4Y4FA 5EV7A 5GRZA 1NL0H 3TYFB 4J3OG 5D1ZC 5HYFA 3ZGIA 2EYTB 1RUAH 4ZSOA 1KTJA 1UUSA 4JGUA 4RQQA 4QRRA 1XGZA 2X88A 1FO0H 1H0DA 4XNZB 1CBVL 4DZBB 2HP4A 3V6FB 1UD5A 5LNDA 2DIBA 5K9KA 3JBG7 1Z9LA 3VG9B 4ZJ9A 2YD7A 3APCA 3HUJF 4JKKA 4P5SA 3D3VE 4H7VA 4QHKJ 2K7PA 4A2DA 2Z1PA 1OTUD 3HHSA 4BIKA 5HYSA 1CICA 1G7IA 2IANB 1FZJA 4RWYH 2VXQA 3KGSA 3GSWB 4HWUA 3OG6B 3P77B 4QHUB 3OHXB 1YEIL 5I6XC 4RGNE 3BZDA 1GOFA 1ZIBA 3KAAA 1KCWA 1NFIB 1W0VB 3EH1A 3GMQA 3KL0A 5DZOA 5FB8B 3DDGA 1UADC 3B1TA 3US9A 2EZ0C 1CGWA 2UWEF 2H2SD 4LEXL 2O61B 2Z3FA 3ARPA 3L3JB 2EDRA 2Y6TE 5DJXA 1WIOA 4BZ2L 4XTRC 4P9HC 4YN3A 3RPIB 1KB5H 2J43A 5T3ZE 3O8XA 1H6TA 4UIKL 1Z5YD 4Y4KA 1F1AA 2BNRB 4M48H 4XPGH 1KUMA 2V7NB 4AGQA 2FB4H 2RCSL 3CVHB 4KQ3L 3CHQA 4L1BA 3VFSA 5E2WL 5TDNB 1PIGA 3SKNA 5LUMA 1MRFL 2DW5A 1BECA 5EN2B 3QXTA 3FF8A 5AYUH 4LARL 4DCQA 1Y1DA 3BVTA 1VLXA 3GB7B 1IGFL 5F7YC 5J6GB 1AXTL 2J57A 1SYVB 2BC4B 4QAMB 2LU4A 3RY5A 4XN4A 4XCYB 1A7OH 3DPBA 3ESUF 1RJLA 4XXDA 1F3JB 1A3ZA 1UWEH 3WEMA 2DQDH 1IEAB 1F3DH 3KPMB 4J23A 4CW1A 1WK0A 5EIIA 1DN2A 4HC1L 1GIGL 1X3DA 3DO7B 1R3KB 2ICWJ 5E2WH 4BE5A 5KS9F 3LNHA 1XH1A 3QIBD 4G9FB 1LMIA 1COBA 1J1XH 1I31A 4PJGF 3NMEA 3EFFB 3FQWA 2VR7A 2VN3A 3T2PA 1CG9A 3C2AL 3PXHA 4HOMA 4LSTH 5EEZA 1A0QL 4MX7A 3RZCD 2NRDA 2VSCA 5IESL 1IQWH 4JAMB 1WEJH 4Z3HA 4WY7H 3BT2H 2VZ3A 2G2RB 2A74B 3AS3A 2D7OA 3B56A 4JPKH 2JSFA 4N3TA 4X9IA 3A6BL 4JZJA 3TBYA 5SV4A 5CN3A 2ARJA 3C2AH 2YD6A 4DEWA 1TVBA 2ZKHL 1J9QA 1B3IA 5I6KA 3TO4C 2MPAH 3TEWA 3O41B 2OCFD 4F33B 3MRJA 5D9SA 3AXLA 2VDRB 2X4SA 3GSOB 1TF4A 2DQHL 2PO6A 5E5MB 3SE9L 1DVFB 1LNUA 3C5ZD 3RFZB 5LXGH 1L9TA 3ABMB 1A25A 1WQVT 3CDZA 4CRPA 4LLMA 1D5ZB 5KS9E 4K5NA 4P46D 5J5EA 5DYOA 3HE7A 1G6RA 2OSLA 3IWVA 4NQTA 5I8CB 2GHWB 4YSCA 3OQRA 2PWGA 3TBCA 5F9WC 2ED9A 1R5IB 2EC9U 3MJ7A 4FYTA 3EDJA 4M7JL 2YD3A 4N26A 5T1LD 1DQLH 4APQD 4UQCA 4HUVA 1W15A 4Z3EA 2C7UB 4RMSA 3OAYH 3QJSB 4HUXA 4HW6A 4XRCA 3VI4F 4D3CH 3KGRA 2NY4D 4BSJA 1Z9SB 4GG6E 5E99H 3QUMA 4Z77A 3L4WA 5GRVL 4TNVK 4WFEE 1RZJH 4P3WA 1P5UB 3VFNA 3V4UL 2Z34A 2I69A 1KGWA 1S9KC 2HB0A 1WC7B 2FQDA 3NSYA 4PJXF 1JZJA 4U0RB 1F00I 4KOCA 5AOLA 2YAOA 4I0PC 4OTXL 3OR6B 2X6AA 5D70H 1R0AL 1I7ZA 4UU9A 1DBKH 4N8VA 4CU7A 1I9RH 4JREB 4MDIA 2UX6A 1YAIA 3WXWH 5HDLA 3PABA 3J27A 2GJ6E 4PJCB 4CN4A 1R46A 5FOBA 4PGCA 3LKSB 5FM5O 4XNUL 2WCPA 1NSNH 3IFPA 1MSPA 3HS0C 5CP3H 4AMKH 4IRZA 3P69A 3IFPB 1F4XL 3JUZA 2MNUA 3N85L 2NQCA 2HKFL 1N5AA 3LXUX 4Q6YA 2IWKA 3QXUA 1FHGA 3L48A 1UD6A 3OJ2C 4XP6H 3DYMA 3C60B 1XD0A 2CMRH 3GBDA 4FL4B 2DS4A 3TYGL 4BA8A 4GBXB 4U6YB 3TV8A 3RNQA 4YJZL 1I7UB 3TV3H 2GY5A 2ATKB 4K8RL 3VFPB 4N22A 4IRJC 5L0QB 4H1LB 4CNIA 2PWEA 1QFWM 4V1DD 2QDWA 1DO6A 1JFQH 3ZRFC 2Y7MA 2R2BB 3E9TA 2P8LB 3QUMB 1XXFC 3U4BH 3WEXB 1FZMB 3RUGA 1YEJL 2JJSA 4FFVC 2NYKA 3ECBA 5EMYA 2P1YA 4RA0C 5D7LA 4RBPK 2C7UA 1QLRA 4R3SA 2APWA 2PXYB 4N8PA 4HH9A 4NKIH 2CCWA 1DSWA 4Z9KB 4PVBA 2R1XA 2MJWA 1B4JL 1XSKA 3NZUA 3DROA 1AANA 1I1AC 1LWHA 2QSVA 4GO8A 3P3RA 5E4EC 2EAEA 3ASNB 3WEXA 3MLZL 4ZMLA 2IBGA 2XYBA 5KW9L 4WI3A 1C5BL 2R29L 3NK3A 4H8QA 1DEEB 4HIQA 1U3JA 3IS1X 1EFXD 3QEHB 3S2AA 1FYTD 1DVFA 1LNUB 4L2LA 4R26L 5EIQA 3CDGB 2DMGA 3NFNA 2QSCH 4QTHA 4NS0A 1JDDA 4YDMA 1Z7JA 2AJ3B 3AAZA 2D0FA 3C60A 2NYZA 4JO1H 3T6VA 4IDJH 4NGHH 2BSDA 3H2WA 1C16B 2EABA 4J4PD 3N06B 3P2BA 3RWCA 4PJ8A 3PF2A 3IDYC 4J4PC 4KMTL 4OGQC 4B9IA 1MLCB 1GGUA 2F1BA 4HCRA 4N0YL 4Y4HB 3FT2A 2D7PA 3LN4A 2A6JA 4NKMB 5LAXB 2BVTA 1N59A 2P8PA 3JT0A 2ZSVA 3HHRB 5KJRL 1TETL 1QR1B 2EDJA 4F5CA 5ESQB 4GRMA 1L6PA 1SOQA 1ZVSA 4IS6B 3Q44A 1S9YB 4QJ5B 3KW8A 3UZVB 3V7AG 1WWCA 3L1FA 4G6AD 3T4AC 4XO9A 3E2HC 3FSOA 4HBCL 4P5TA 3FYEB 1KENL 4HVBA 4ENZA 2Y7OA 3FH5A 4ZT1A 1PZ2A 3EO9H 4KRPD 4DK3A 5HHMB 1G7HB 2IH8A 2MRYA 5DC0A 2YN3A 4P46A 2K3TA 2GHZA 2VDRL 4ADGA 5TDNA 4H40A 1ONQA 4R90H 1IUZA 3TC9A 1U8MB 2VXVH 5DVLA 4D0DB 5KBDA 3REVA 2IGFH 1GSMA 4P5RA 4RAVA 3HE6D 2BX5A 2DQEL 3CVIH 3NVQA 4X8CA 5ADOL 3L3JA 1Q4NX 3UJTL 4ZX5A 1P7BA 3WHE0 4XMWA 1UYWL 2XRAH 4S1RH 5TE4L 2VRQA 3AM8A 3A23A 5FB8A 4HH8A 2Y7LA 3G3LA 4ACTA 1QQDA 5HHOD 2DL2A 4EVNA 3SGJA 3TBYB 5I24A 3OZLA 4XBGA 4U3SA 5I1EL 1TT6A 2OJEA 3DRTB 2A9MH 5E2UH 1ZLUK 3MYZA 4ZUVB 4FXKA 3CV5A 1FN4A 2QVMA 1E8XA 3QO1A 2XN2A 4K9EH 5FW7A 1ZT7A 4B9JA 3Q2WA 4HWEH 3NIGB 5JDJA 4JZNA 2DICA 4L8SC 4XPAH 3QCVL 1JNLH 1OTSD 5EEVA 1QNZL 1S46A 4FZEL 4L3EB 5EC2B 1EZSA 4WWKD 2AZUA 3WEOA 1NPUA 2EEBA 4BK5A 4CADB 1P5UA 1QSVA 2BNUA 2BY1A 1IGTA 1KCSH 3VFNB 3UTZA 3ARDC 4R2GB 3WIHH 3AWGA 1HSBB 3J8F7 5D93C 5AVQB 2W38A 2C9UA 4B9FA 3HPJB 1YY9C 3B9VA 3CJJA 2XQBL 3PQYB 4NKDB 3THML 1A6TB 3UGUA 5AW3B 4OI7A 1B3JA 3VQMA 2ICEC 4G6JH 1T3FA 3VWJC 3DRQB 4L4TB 5IKCB 2OX5A 1E28B 5DYOB 2EXTA 3CDCA 4YOKA 3IEAA 1DUZA 3MLWH 1MCEA 4FL4C 2R0WH 4TUJA 5GGVL 1IC0A 2OMTB 2WWOA 1FBIL 4GG6B 4P5MB 4N1CA 1JV5B 1A8ZA 2OMUB 1NCDH 3LDBC 2X4QA 3RL2B 3I9AA 3AFLA 1NGQH 4AYSA 1H5BA 2PP9A 3KS0J 4LESA 5EOTA 4R4ND 4QI3A 5B1CA 1CICB 2DEXX 4EBQL 5DJ6A 2Y2YA 3LJ3A 3QUXB 3B7TA 4PQXA 5E1AB 1IGIL 1A4KB 5F6IB 5BRQA 5SWSB 4OD2B 1E4XI 2Y7SA 1E9QA 1LO0L 3QDMD 4M9PA 2Y3NA 4UNIA 2ATPB 4JM0A 5B4MD 5I16B 5K9KB 3RDJA 1INQA 1OE1A 3HHMA 1KN2L 1F4AA 4P9ML 4UBDC 5FYJH 3GRWA 4YSTA 2P8MB 3F05A 4JMXA 3VGEA 3DSFL 2FYYA 2Z91B 3ETSA 4PBXA 4X0NA 1EXGA 2WIIA 1T0MB 4JJ5B 4MA1C 2BCKB 2Y07H 4DKDC 4M43L 4Y4FB 4GJTB 5JW4N 1DO5A 4XBEH 1HH6B 4GMSH 2ADGB 4NZFA 3X2QB 3IN2A 5T5NG 3L4TA 3QNXB 1AXSB 2YPVH 4JFEB 4ZAKC 1CFBA 2LW3A 5F7BA 1A4AA 5I1IH 4K0OA 3GXPA 2B20A 3DUUA 5BQ7B 3TEUA 3Q6FB 5IROC 3AQXA 2WIIB 2F58H 3QUZB 4NO3A 2P5EA 1Q0YH 3O6FB 4MXWH 1KCKA 4UTAL 2CNYA 2UY7B 1UM5L 3SQBB 3UTPD 4OZ4A 2GQHA 5EN2A 2HTKD 5GRXG 2VZOA 2EIJB 3O81A 6FABH 2H1XA 4M62L 1PYWB 3TIEB 2RH0A 2ENQA 1IBYA 3I50H 3RY6A 5M95B 1CE1L 3RUGE 4HPYH 3T3PB 3QIUB 5D6DA 1FVDB 3LQZB 1NGYA 2OA9A 4Z5RA 1IM3D 4A7GA 4CVUA 2C9RA 2OMNA 3HG0A 3B6SA 4OFDA 1VERA 1S78D 2JJWA 5TJWK 5E0QA 5KTEH 4U6VH 4PRNA 5JORB 3C2SA 3QC5X 5LNGA 2DIJA 3MRGB 1PZBA 4M93C 1FSKB 4IOSD 2I5YL 5GZOD 3O2VH 1BAGA 2C5DC 4FNUA 3MRBA 5LQBL 1GGCH 2GAZA 1WLHA 2VLME 5I19H 1P7KB 2OXGA 1XMWA 3HR6A 4JY6B 2CUIA 4A6YB 3T3MB 2KYIA 4OR1A 2VXTH 5CUSL 3B7YA 4LEEA 5KN5A 1A3RH 4N68A 4QY8B 1UQSB 4EXPX 1MCJA 1A6VH 2PO6D 1JPFA 2ETWA 1QSED 2OTUB 4KKQA 5EZOL 4WJ5A 1SXBA 4LFHD 3V0DA 1UWYA 3WG7B 2GBAA 5AVZB 2IMMA 2GUOA 1UT1A 4Y7OC 1SJHB 3ZRCC 4WAFA 3KLDA 4NOFA 4F92B 4D9RE 3M8OL 1GYAA 3VXUE 5AZUA 2J21A 3HC2A 3MJ8B 4KDWA 3NG5A 2VE6B 5JMOC 1BEYL 5GGTA 3TA3B 5IFAH 1K4CB 2K78A 4KXZH 1K8IB 1QBAA 4TULH 4HMDA 4G1EB 3VXMD 3WN6A 4PD4K 4P3DB 4F57H 3P4NB 4PG2C 5FUOH 4CVWA 3D0AA 5F1KC 4MAUH 1L9PA 3ZDZF 4GIAA 4ECNA 3QWRD 1F4YH 1UWXH 4ZW8A 3LZFL 3UROR 3WTXA 1OAXH 4IIQC 2VT0A 1E67A 1SMOA 1IAKB 4P59H 2DQDL 2I32A 2ZQKA 3GSUA 3K8MA 5F9DC 4WHTA 1JI2A 1X5ZA 3TX4A 1RMFH 3QHZL 4BFIA 5I73B 3EXLA 1MCCA 3PGFL 5GRJH 5F0JB 1OARH 4P4RB 1A6WL 4YXKL 3AG4B 1I8MB 2Y4SA 5DFVD 3HAEA 3SKJL 5KSVA 2CQVA 4F27A 4X99B 1LILA 2BP8A 1WD8A 2AXGA 4X80H 4NQVA 1XF5B 2HMID 3BVWA 4U1KB 1HCVA 4DKEH 1NCAH 1DDHA 3CBKB 4PJEA 2DI8A 1UWGL 3IDJA 2VC2L 2E4TA 4LCWB 4MVBD 5IVOA 3WO4C 2XWRA 3CWGA 4R4FL 5KOVC 4AUJA 3A6BH 3L9YA 4RFOL 3EZJB 2DM3A 3FQ2A 4FFZL 1I8KA 2HKAA 4P2QE 3W9DB 1U8MA 1ZLDA 5F71A 4AGOA 4KKZA 3BT0A 2ERJB 1QOKA 4UT7H 5F7HA 3D06A 2F7QA 2P7TB 2WYHA 2JIXD 4F8QA 5IKCA 2X38A 2VC2H 3I3BA 4LCWD 4P2AA 2FR4B 4CC1A 4L0ZA 1IO4C 3TCLB 5JO5A 1E6JH 4WHCA 3SD2A 4HISA 1RZFL 1JV2A 1MI5D 1URIA 2O5XL 4H1LG 3IMBA 4N2FA 2APFA 2N0KA 1DJYA 3CUPA 1W8NA 2FIKA 1MNUL 2P52A 1HQ4A 3OMNB 4UT7L 1BFOB 5LBVA 1JGLL 2DIEA 2LABA 4UCFA 2R1YA 4DP2X 5IGXL 4OFQA 1X5LA 3A67L 3EUUA 5B8CA 2Y72A 2NZ9D 2EIEA 2A74C 4IDLA 3ZZLA 1OAQL 4F8OA 5F93C 1RJYA 3ILDA 2YAEA 5MP6H 2ZF9A 1CWVA 4JB9L 3TO4B 1HI6B 2NXZB 4KU1A 3T4YB 3K4ZA 1CE6B 5BW7C 5I0DA 5A2FA 1BW8A 2OK0L 1FNSH 4BFOA 3K91A 3O4LE 4BSWB 1OAJA 4XBGB 2YOAA 2VITA 4PJ5A 5HHPB 1PG7H 1GHFH 2NY1D 3WIAA 1T03H 2GSIB 4PJFF 3WYRA 2MPVA 2OR7A 1FVEA 4URTB 3I74A 3HIZA 4HUWA 2NTFA 5C0JB 4D3CL 3DBXB 4NQCB 3IVKA 3TN0B 3KYAA 4LXFA 1UCBL 3H4FA 3IPFA 5A3IC 2JKRM 2EVGA 2QQNL 3SN6N 1OGAA 1V7MH 5IBLD 5IMOB 2GTQA 3I02A 3G6JF 2DBJA 5GGRA 3B2UC 4ZQKA 3EO0A 5GZOA 4I4WB 5DLLA 4U2YA 4GQPH 2MQ0A 1M9WA 1E5AA 3LS5L 4JFVA 1OAYL 4XP1L 3NAAL 3SY0B 4YZWA 5C6TL 2AI0H 5GRVK 2QV4A 1T4KB 1KLUB 1MJ7L 2QDVA 4WJG3 5I66A 3C5SA 2OBGA 3HJ0A 4GSRA 4JFQA 3VFUB 1EDQA 3UJIL 2RMNA 3UTSB 1N0LB 1E4XL 2KHAA 1S8DA 3W9EB 2DL9A 4XZUA 3MXWL 1CS6A 2X9YA 5C08A 4DZ8B 1XF2A 4GB9A 2C1OB 3V7MA 1RY7B 1EAPB 4KK9C 4KY2A 3SY0A 1OZUA 1N68A 3MZTA 4GBXA 4FKHA 4MLSA 4U6YA 1J05A 4MNQA 2ZZUT 1CT8A 4CDGC 1LO3L 2JJTC 5BXFB 1K6QH 1SBBA 5DJ0A 2A6JB 3UPRB 5FECA 5IVZB 5ILTL 4EUPG 3VGBA 4JR9H 5C09E 1XF3B 3BQUA 3HI6L 3Q8CA 4GG6A 4F80A 3TZVC 4JX0A 4AZ8A 1TENA 3TESA 5IFAL 2X6BA 2I9TA 3FAWA 3BE1L 4PM1A 1UM5H 1FL3B 4BEIA 1E3XA 2CPCA 4PS8A 3F2LA 3TVMD 1U42A 4JDEB 1OGAD 4JUTA 1KN2H 1I1AA 3IDXL 3S35L 3OGOE 3MRRB 3O4OB 2AXHA 3P9WB 2LTQB 1SY6L 4GUQA 4K23H 5C86A 2JKNA 2WLLA 3ILQD 1EERB 2X6CA 1SMAA 5ELIA 3OTTA 2WLKA 3K81A 3OXSB 1QP1A 2CKBB 3LNEA 4IU3B 1CO1A 1QEWB 3BZFB 1MCWM 4KMQA 5BRZD 2LVEA 4E0RA 2MQ3A 3T9WA 4NN6C 4YXLL 1FNFA 4HKXB 1A9VA 1CI3M 4OF3A 5JIHA 1KN4H 5IP4A 1OGSA 3MNWB 4S0TD 3RB5A 3ECBB 3ZE1F 1P53A 2V37A 4NUMA 2DQIH 5D8JL 3UTTD 2JQZA 5ACZA 5A2AA 1OB1A 2CHXA 3UZEA 1D5ZA 1SOSA 4I5BB 5KSAC 2J88L 3AGVA 3S96A 4O4YH 4XO4A 3SDAB 5CHNB 1IIKA 1HWHB 2G3ZA 4A68A 5L2KA 2MQGA 3PQYD 4EUPH 4A2EA 2K4WA 3SPIA 1G5AA 4YUEL 4DUWA 3GXMA 4MDRA 5HGGS 4P23D 1XCTB 4J8RA 4XNZC 5IMKA 2H3NB 3R1GL 2R7EB 2ZOWA 2XQYG 1JGUL 2XBZA 2X4RB 5CCKH 3IJEA 4RMBA 1WJ3A 3GBNL 2V4LA 1BHGA 3CN1A 4E36A 1XF5A 3RWEA 2Y07L 3DUSA 4FLQA 3ILQC 4MDJB 5E6IA 1X5JA 4LT7A 2Q10A 4YHKL 4FFZH 1UH3A 1OL0A 3KW7A 1Q8MA 1I8MA 2N59A 3NACL 4OM1L 1F11A 1U8HA 3MRMA 4NKOA 2AQ3A 3GMNB 4NQEE 5JHDE 2LHAA 5CGBA 4C58B 4PRAA 2HZHA 1XX9C 1WC7A 4MWFA 1G9NC 5F1NB 3LS4L 5JHMA 4H0GA 4ZTOL 1I8LC 1H3UA 1V3JA 4QF1A 4LPYA 2UUDK 3V6OC 2PW1B 4AIZA 1FNEB 3WE1A 4ORGB 3U83A 3EBIA 4DN3L 2VR4A 4F37K 4ZXBB 1VIWA 2HJFB 4FLRA 1T5XB 2BSTA 2N7BA 2NW3A 5MEQA 5K69A 3BRGC 1OM3H 1J12A 4L8DA 2DN7A 4AC2A 5E9AA 1LO4H 2AJXH 1JP5A 4JY5L 3RKDC 4M6NH 4TMPA 2JFCA 4GBXC 5CKGA 1IGCH 4MMZC 1FNHA 5IT2L 1NC2B 2K6ZA 5IBTL 3SO5A 4Z7QB 1B0GA 3DETD 3Q5YA 1CF8L 3MFFA 5HHMD 3IMWA 1Z9PA 4ZUSA 4X6DA 1D6VL 3CVIL 4YE4L 4PV1C 3MLRH 5EOQL 4YSQA 3ECVA 3GSWA 3BMVA 2R2HB 4A6YA 4FP8H 3D2TA 3DHMA 1DUYB 4ODUB 1CPUA 4PCSA 4BUGA 1G7PA 1W0YT 2QGDA 3BCDA 3QZWA 1PG7X 1RUQL 3L1OL 3IU4L 3MFFB 2BVUA 2DQGL 1D6VH 3R18A 2LU7A 5F7EL 5CCGE 5C92A 1QABA 2JB5L 1MCOH 4PRNB 5LGJA 3B5TA 5LHDA 3PDOB 4KJPD 1FGNL 1E9OB 3VYNA 2NZ1A 3RWDA 3SDYL 4DGVL 1AO7A 3KHOA 4BFGA 2OL3H 2UWEA 9PCYA 2JTYA 4HIHA 2ALAA 3MCYA 2VDPB 3MOQA 4MJ5A 1WF5A 5GS3A 5ICZB 4Z7QE 1MXGA 4RDBA 4BYHA 1QASA 2NSQA 2VL4A 2Z7WA 5FLUA 1MFCH 3SBWA 4AQZA 4KITB 3QI9A 2W1NA 4PB0L 4U0QB 5DZAA 1F8TH 4K4KA 3IJYB 4HSAC 1E27B 3JVGC 4YHNA 3LZFH 4DP8X 5JR1L 1SXNA 3KBHE 2HX7A 3TF4A 4PMFA 5JUEL 1S7WB 2YD4A 1EFXA 1E42A 1FG2A 4PWIA 2K1MA 1WTGT 2EIKB 5ISZE 1EFXB 1T22B 4IOFC 1JGEB 1WBZA 4OUUA 7TAAA 4XH2B 2VDNB 4DCQB 1KB9J 3O11B 4X6EB 4FI8A 3IJ7A 2ZXGA 3WN5B 3U9PH 3VB8A 1AY1H 2EKSA 4LLWA 4LGPB 4LDLB 4CSSA 1MQKL 2J6EA 2WXNA 1WD9A 2CE6A 3ROOA 5D7SH 1H3TA 1S7TA 3U4EB 4OQ1A 1GZHC 2IFGA 4X9YA 5CN2A 1SDAB 1M6OA 3T0DA 1AR1C 1G0XA 4NM8L 3ZTNH 1Z5LA 3O9WA 1JMZA 2FBRA 4G7SB 4M6MH 4PJDB 1ZHBA 4KTDL 4Z78A 5KVEE 4JRLA 1QSFD 5DQJA 4ZMWA 4JGMA 4XCFH 1VPOH 3DTUB 1Q9OA 2DYRB 3K4AA 3ZE0F 3GIVB 2ITDB 2ZUXA 2CO4A 4PRDA 1J8RA 4U3HA 2WWKO 3O4LA 2YRPA 2XC8A 3PL6B 4MCYB 4JO4L 4ZMPA 3FZUD 4KKBD 3SDCD 1MFAH 4URKA 2E27H 2W0FA 4EIZC 4NFDA 4PJFA 4WENB 4YX2H 4XXWA 3IFLL 4B9GA 3JV4A 3IB4A 4XPFL 5CBEA 3WN5A 4C8XA 2VM4A 2YEQA 4NBYB 5KJ4A 1T6WA 2IWGA 1F4WH 2UZYA 5EFIB 2YGOA 5I6MA 3VXMB 4JR9L 1A02N 4KGJA 4Q8BA 4AMKL 4WI9A 4YDNA 4LK4A 5D6CA 1JGIA 2EDKA 5DQ9A 4OUUB 3TA3D 3L95A 3WS6A 3U9UB 4LLDA 3OKEA 4KNSA 1MFCL 4LEBA 1TQCC 2HTKC 5DQDL 3KLHD 2Q86B 3QULB 4H8HA 3PWLA 4BZ2A 3GK8H 5I1IL 3V5DB 3AXIA 3FMGL 3TM6A 1CGUA 1RULH 1KBGH 3BDXA 1BZ9A 1LYQA 2H0JA 3F04A 4E42A 1UA3A 2OFQA 4IW4C 4XC1H 3TIDA 3ZKXB 4OAWA 2F53A 1S7XA 4RGNB 1KEMH 4NKOB 1Z6JT 1M2VA 4LBEB 2AK1H 1SDDB 3OB0H 4YR6A 4Q9RH 2V6HA 1GTFA 1UGKA 2ZUQB 3N41B 3LEXA 4FI6A 4P4KB 4PYGA 4ABVA 2NY4B 1TJGH 4QJ3B 2D73A 4BRJA 5J13C 4M7LL 1KXHA 2J25A 3DUSB 1Q1JL 2NLJA 2CKNA 2XACC 4YWGH 5F2FA 1ET5A 2XUWA 1HWWA 4F7PB 2AJVL 1JHLL 2J12B 2O72A 1XFPA 4AL8C 3S3BB 5C09A 2NDFA 5LBSA 3BIKA 1W91A 1CD0A 4M4RA 1W6WA 3GMMB 2JCCA 3SGKC 2B1HL 4MRBA 4U3XA 3IFOB 4O02L 4E9XA 1RCYA 4NO0B 2IQ9H 4PGEA 4N2LA 3RJDA 4NQDD 1SBSH 5GSVB 2Z31A 4JBSA 3BKJH 2CR0A 4QRAA 4TVUA 2VABB 1L3WA 2Z4QA 2WB1A 3LY6A 4OD1L 3AUWB 3A5VA 4LRNH 5CFAA 2UX7A 4KY1H 4UIMA 2K8QA 1RIHH 2H9GA 1CDCA 2ZX6A 3PWUB 3REVB 2Z35A 3VX1A 1AH1A 1KJ3L 2IAMC 1WP6A 3IGAA 3QW9A 3FXIC 2EDBA 4RRPM 1XH0A 3VFVA 4ZFOB 2OXHB 3TO2B 5KSBB 4YDKL 1NBZA 2HSIA 2C3HA 2BRRH 1BZOA 3M1BA 3V6OE 3OKOB 3AREC 4P9HH 5CGYC 4NAQA 4ZODA 3DVNA 3QEQA 5ILTH 3MRFA 2AV1B 4GRWF 1BV8A 1BLNA 4O51B 3QPXL 1UXLA 5DLML 4M6NL 1BFVL 3PJNA 2B9AA 3QEGH 5DR5L 3DOHA 4MHHI 2EUZA 1SLWA 4BUQA 4GQQA 3A47A 5E6IB 3WE6B 2FJFA 4MA1B 1N59B 1TOXA 3CN2A 1A7NL 3LIUA 4IYKA 2J20A 3PWJA 4OSUH 2G0LA 4L23A 4XBMA 4TUKH 5IR1B 5IESH 5MENB 5F7KC 1MG3C 3MLXL 1OOAA 4QNPE 1R3HB 1XB6A 1OM3L 5DU7A 4Y5XC 4UDTB 3CDFA 1GY1A 4EXKA 4UT9L 3N44B 5AW5B 5EG6C 3QI9D 1Q72L 1O6TA 1XVSA 1E5BA 2A2QT 2X3BA 4M1CD 3CLWA 4R26H 4EPSA 5LN4A 4F15B 4K94H 1CGVA 1XIWB 5L9DH 1T1WA 3F7VB 3OMZA 5C0ND 5FECB 1SLXA 3BZ4A 3MKKA 4Y19E 5DJ0B 3AY2A 3UC0H 2EDTA 4MQ7B 5FC9A 2WCSA 3S96B 4JGNA 4HG4K 1PY9A 4YHYC 1XGUA 3L08A 3Q01A 3N1GC 4JPIA 1KTLA 1J5OL 1BD2A 1PAMA 3EO1B 3HZKA 4R2GD 3OSVA 4FLSA 3EO1A 5D55A 3ZY7A 1Z1WA 4YBQC 4ODWB 3II2A 3RNKA 3C09B 3U0TA 2LLGA 2R1XB 4G6KH 3V95A 4G2AA 2GJPA 4AGMA 1OWRM 4I0PA 5H2BB 4XNMB 5A2KH 3JWDC 3ZL1A 1KLUA 3GI9H 5IUSA 3L4UA 4PWFA 1XF1A 1MW2A 3ZHFA 1OZTG 1ZLWH 1RK1B 2Q87A 2GB2A 4N3UA 3IGLA 5D93B 3IKCB 3QQ9C 3BVVA 4LOVA 2E6JA 3ATEA 3MRRA 1YHPA 2PPFA 2CMRL 3M46A 1UZ6E 1WEJL 3HZVA 4AEIL 3QO0B 1ASOA 2FX7L 1VCAA 1M71B 4JFFB 5EF1A 2UXGA 3FCTA 1BYNA 5I74B 3WE6A 1YMME 1T2JA 1M71A 4JFFA 3EGXB 2YEVB 1A7NH 1P4LB 2OMWB 4XP4L 4WIQA 4PJ5B 1ZLSH 1TEFA 3FHEA 2X4UA 5HHPA 3CSYB 4Y16A 2B5IC 3BP7A 5FYJD 4NT6A 4X7DC 1JDCA 1MJJA 2JKSA 3AGWA 1KXQA 2VN6A 4M8VA 4UAHA 1IL1A 5T8IA 5K39A 4JANA 1I3UA 1QHPA 1GGIH 1F0LA 4Q9BA 4XZ4A 1PMYA 2E9IA 4KXAA 3SPHA 5IBUG 3TJHC 4KRPB 4YVUA 4OZFH 5KYYA 3F7LA 3EBGA 3HAEH 2ZCLH 5KSBA 3LHAA 3E80A 4YSUA 5C0BA 3HUJE 4Z1PA 1I7TB 4MQSB 3S97C 3TS8A 2DDQH 5DC2A 3RZCC 5EF3A 1KDIA 3NAAH 4ODWA 3RNKB 3U0TB 1BOYA 2PLTA 3F58H 4NRYB 4TULL 3BWAB 3CQFA 1AGCA 2EDQA 2JVUA 3HMXL 3IF1B 2F8VA 4CVXB 2WAHA 3FL7A 5E4AA 5EOCH 1PLGH 4I4WA 3KWXA 3S3DB 4WJ5B 5D2LE 2CM5A 4FQ2L 1HK6A 1QW8A 4WI0A 2PCFA 1OAXL 5T5FA 5JO5B 5F3HB 2H32H 3N6YA 1ZPLA 3TCLA 1ZLUH 2FECI 1J88A 2ITFA 4GAGL 3H3BC 2P7TA 5E95B 2VDNL 1RMFL 1V54B 1YCSA 5DFVC 2XPGA 3I6LE 3VW3H 3EYQC 4OCRL 1EJOL 2OI9B 5I74C 2QQLH 2YQBA 3KPOA 3RU8L 3ARVA 1Y6MR 4QAWA 4RIRB 1EV2E 4PBDA 4G8IA 3IXTB 1KTDB 2EVHA 3ZMNA 4U1NB 3WNLA 2ITEA 4LCWA 3GSOA 4PJIE 3G08B 3PL6D 4EOWL 2DV6A 1YYLH 3T8MA 1RUKL 3HB3D 4Z5RB 3AUVA 5KSVB 4FQXB 3E1ZA 4RVBA 3WDJA 2VW6A 3F01A 5IB5B 1V7NL 2QADC 4Y5YA 1TLMA 4PFEA 4JQIA 4UINH 5AOKA 2ILLA 3PHAA 4HHAA 4J2XA 1BFVH 1O7DC 4PMEA 3FQYA 4ONHA 3V6BR 2DWSA 3VXNB 5BUPA 5HHQA 4JM4H 3SYAA 3FQ1A 3NBNA 5E5UB 2EDNA 1HHKA 2X70A 4KDTC 4M5TA 1RUAL 5C08E 1JNNL 1MOEA 5ABZA 3CZFA 2AEWA 3EOAB 4NB7A 1WZ1H 2HH0H 3P4NA 3QT2A 4BGDA 4MYPA 1CBVH 3H3PL 3M07A 1I9EA 1IEAA 3KPMA 3BP5B 3GSRA 3TA3A 1NM9A 4UANA 4OM0L 2NUTB 2D3JA 1RP9A 2BIPA 1AXIB 3NCMA 4P0DA 1KDJA 4ELMF 1R19A 4DKFL 5E8DH 4YHIA 3TN0C 3SE8H 3QIBA 1KT2B 4NO2A 3VA6A 4F15C 1TCMA 2ITDA 1YEIH 4QHPA 3V6ZB 3KVDD 1ANUA 4Y9BA 1N67A 3O8XB 3W5MA 5LB1A 4TTDD 2IIJA 1HL8A 3FFDA 4LVOC 1CFQB 5I5RA 4AQ1B 1RZKH 1JNLL 1MFDH 1JI1A 3HLAB 4PJ7A 2P42B 3BAKA 3NIFB 4W93A 1LL1A 1EHLL 2YBRA 1F1DA 3DGCR 3T65A 2IBBA 3IDIA 3MRBB 4OUOA 3O0LA 5DZNA 5GS1C 5I1LA 5JPNC 2MCPH 4NQXA 2IPKA 3RWIB 5MI0B 3L7FB 2WY3B 5B38G 4WJKB 1CU4H 3CZLA 4K3JL 3STZA 2OMTA 3MRGA 4F7TB 5EWIH 1G7IB 2IANA 3DWTA 1JUFB 5TK4A 5F0MB 5HJBA 2Y6SD 2VDOB 1BF2A 1O6VA 2R0ZL 3QEGL 1ZEAH 5DR5H 3TIDB 3KYMA 3TNNA 5F96H 4XMKH 1CXFA 1U58A 3HB3C 4X4YA 1M53A 3H9SA 3NH7L 3FSZA 1AVAA 1BREA 1A6TA 4ZXBC 5CBAA 4DZBA 1UASA 3UEZA 5BUGA 5T1LB 3SQBA 4YL4A 1FFTB 3QPKA 5F9JA 2OR9H 2DH2A 1F6LL 1T20B 3LH2H 4UBDD 3FB8B 1D7DA 3SIKA 3ARWA 2HRPL 1K4CA 1S7UA 1IRAY 5DS8A 1KIQB 2XWCA 4U4BA 1G9HA 2PTTB 3QDJA 4FTDA 1RU9H 4K9EC 3VXTB 5EC2A 3LIZA 2FEDD 4IOFD 1S7QA 4JDVB 4PJGB 3LYRA 3GBLA 1DVUA 5EU5B 1PLBA 1E3FA 3UCRA 1TXKA 1CLZH 2D31B 4IRZL 3L3GB 4JFFD 2BVPA 4ZZFA 1T0MA 1QSFB 4LIQL 3KJ4B 4M1GH 5F7FA 1U2YA 1JHLH 2KQMA 4M3JA 3I6KB 1RKRA 4HDIA 3PHQB 4MNGB 3T1WA 4N0FA 3VXSA 3FZUC 4KKBC 2MH4A 4KKAD 3W11C 2GAZB 4DO4A 2HRHA 1HZKA 4JUSA 3SQOL 5I18H 1GR7A 2YPLE 2PYFB 3HC0B 4JFHE 4XPHH 2WZ6A 1AIZA 4YE4H 1P4BL 2IJ0C 1SDYA 3SPVA 2HFGL 1K4DB 3QUML 3RZCB 3H4HA 4P5TD 2FNWA 3GRGA 1R5WB 2WLHA 1R75A 1BPLB 2D3VA 4HZAA 1CFSB 4AW4A 5ID1A 4HPOH 1N4XL 5GGQH 4P23B 4LLWB 5TE7H 3H3KA 3M7FB 3MBWA 1E4JA 2WNWA 1TMCB 1QBMH 2DWEB 3UP1A 3PG2A 1PX8A 3L45A 5IIEB 4MJIE 5JDSA 1JGVL 1KPUA 3F7RA 2VM3A 4GUCA 3BKML 2P5EB 2H0FA 1INDL 4Z7UA 3GT6A 3BDYH 3OJDA 2W9EL 1NCHA 3UADA 2R69A 4KJYB 3S34H 2CJUL 3BH8A 3PPSA 1DVXA 3PRZA 3U30C 2UWEE 5FA3B 4PJHF 1I9IH 1LEGA 5CZXC 3KWTA 3W0WA 3EBHA 2D9QB 3GC3A 3WY2A 1U8JB 4UQEA 3U2SA 2BFVL 4XNXL 4JM2A 3BUIA 1ZLVK 1C5CL 5ADOH 4AQAB 1OAZL 4HUUA 3NQIA 4OF5A 1MY7A 4AL8L 3MRIB 5E6ID 3VH8B 1UZ8A 4DFHA 1S9WA 1FBIH 2O6PA 4FCAA 4J8RB 5DO8A 2P80D 4WNQB 4PD4J 3V0GA 1BGXL 1G6VK 3FTWA 3DOIA 3ZTNL 3VD4A 3GJFH 2BVOB 2WZPA 1RZ7H 2D4FA 4S1QH 1IQDA 3D87B 2A9ML 1THCA 1E43A 4R8WH 3BUBA 1MFVA 4AEFA 4AYID 3SDAA 4X7TB 5D7IB 4LU5L 4ZMTA 1DEDA 2YJQA 4R97C 3A4DA 3EYUL 1RLWA 1HIML 3X3FL 1DBJH 2X9WA 4QRQA 1MELA 3U7WH 4JO4H 1C7SA 2FX9H 5J3HC 4EJ1C 2RD0A 3CZSA 2A83A 5EU7E 3UC2A 5FKAA 2XY2A 2DEYX 5KBNC 3WKYA 4JFPB 3O3UN 2KL6A 2VSMB 5SX4I 5I1HH 3D18A 3OR7B 4NOBA 4WW1A 5DS1A 3NZ8A 2Y2TA 3PQYA 4HETA 4NKDA 2BNQE 4X6DF 2ZWYA 3JV5A 1SEQL 5IV2B 3AWFA 4JFYA 5HP5A 2P45B 4IU3A 1MHEA 4LB8A 3VB9A 4M8QB 4HZ1A 1ACCA 3LXBA 1XZWA 2R8SH 1AYOA 4IRSA 4OZIB 2R4SL 1R3IH 3W2DL 4AQ1C 1NEZA 1YDPA 3O6MH 3QHFL 3IRPX 3QDAA 4XI5D 5C0BB 3T0BA 4Z76B 2FHCA 5IW3A 1U8HB 3MRMB 4I0PD 2RFXA 2V17H 2VQTA 5A2JH 4IBLT 4HFWB 5I15L 5I2IA 1CDBA 4GSDL 4XPBL 3MR9A 4JANB 3WTWA 4HKBA 1J0HA 2BFVH 2P28B 5DZVA 4KTEH 2ZG1A 2VDQB 1QR1A 1PZ3A 2R56H 4HLZH 5HVHB 3MQIA 4A7SA 1NBVH 1YQVH 3NJIA 1MI5E 3MRDA 4KXBA 4ANXA 5JPMA 4POZD 4UYPA 4I85A 3PP4L 2OP4L 4NJ9H 2X4UB 3VVWA 4TVPD 5E08L 2MOVA 3SSGA 4HLEA 2QVKA 3MBEB 1RPQA 1R6VA 2AC0A 3N1MC 4JKLA 5GZNC 1TYJA 4YHKH 1LE5B 1OHZA 3OHMB 3VSVA 3AAZB 1E6OH 1N12A 4GAAA 3RGBA 3UTTB 4JQVC 2NY1B 3HZVB 4G7YL 2GK0A 1MFUA 2CR6A 2IAMB 3D3VA 4H25A 4PJIA 2WCGA 1PFOA 4WTXA 4F8TA 3OM3B 1AFVH 2XXFA 5D71L 3NSFA 1CXLA 4DGVH 2LU5A 1ZGLB 4UTBA 1RJZA 2OULB 2XWJB 4PLJC 5EBGA 1NOFA 5DRXA 5KYUA 3DMMA 1RHHA 1WZKA 3RE0A 3C5SB 4QXTB 5FK9A 3JWDL 5DHMC 4XAWL 4AUYA 2VH5L 1QFHA 3F83A 5MEPB 4K7PY 4XNMA 4HWBA 5D72L 3ECUA 3HBPA 2M26A 3Q8EA 5ERWA 1JZHA 1BM3L 4PJBE 3SQOH 5I18L 1RIUL 4Y4KC 1VA9A 1OGAB 2BINA 4PWGA 4ADIA 5HYIA 5FHBL 1CD1A 4JDTL 1OCZB 2DQEH 4TNGA 1L9OA 3NIGE 1DBBL 4FI7A 4N9OB 5DHEA 2A4EA 3ZDWA 1UJ3C 1UYWH 2MMXA 2XRAL 3B9KD 2NX5E 3K4DA 4MQ7A 4P2RB 3VWKA 4RH4A 1OEZW 4GAJH 2J5LC 2X53A 4UAOB 4Q9QL 3NGBB 4JKPL 5I71B 1LQBC 2HT4C 1VEPA 5HYJB 5F88A 3CFEA 4UWQB 2X4TA 3BX7C 5IQ9B 3NJJA 4BSWA 4HKZB 3MCLL 3BEVA 5B22A 5J56B 2AMGA 5KVDH 4R90L 2R23B 4Y2NA 1B2YA 5HPMB 1VGKB 5IFHL 2PCPB 4WV1A 2Q8AL 4Z7NE 1A7PL 1I1FB 5HHOA 5G5DA 4DO6A 1JYXA 4ABUA 1S3RA 4CILA 4G42B 4YPJA 3VFRB 1QVOB 4JAMA 4RMVA 2PPAA 2APTA 3MGOB 5FOBB 5IHBA 2WWMC 1BCIA 1X4YA 4X7SL 3EW3B 4I9WE 2XN9A 3STBA 3SPJA 4JW3A 2GYSA 2G2NA 1G7JB 3ME0B 4G6AC 5FR3A 1JL8A 2NXYD 3WV0A 1DQQA 1BBDL 3GRWL 4OU3A 5PAZA 2VDML 1QO3A 1JZFA 3HNVH 1HQ4B 3OPUA 1FDLL 1JZ6A 4P4KC 1FRGH 5EZIH 4TLUA 3DV6B 5E5RB 4H20L 1F90H 3AITA 5C09D 4F7EA 3BLKA 5K9QI 4Q6KA 3NT0A 4WUUA 1RU9L 1U3YA 5FXCH 4JHAH 5JXED 4NQCD 3GHEL 4H8WC 1NGPH 3RVXC 4NHCH 1KELL 1MIEL 1NAMB 5IB1B 5E99L 3WHXB 2XWEA 4ETQA 3QARA 4WW1B 3RHWK 3LPWA 4K3DL 1ZGLA 3D25B 1LJMA 1I82A 3DLQR 2E9BA 2Q7YA 1QTSA 1D5XA 2J44A 1HN1A 4PJAE 4XT1C 5F44A 4JNXA 3WY4A 1QX1A 2WN3A 3II1A 1XBRA 1UT2A 2D7QA 5IVXE 4JL2A 1BVNT 4AEHL 3BEWB 4XMLL 3D5OF 3A4FA 3TPUB 5GGSY 3N50A 4TL5A 4PGEB 1NC2D 2AXGB 5HI3D 2GSIA 4OQTH 5DJDB 4M7ZB 2BZ7A 3RFZC 2PO6B 5E5MA 1ECYA 2FH6A 3WTVA 2EDDA 4P4RA 3F6LA 2XYCA 3CH8A 1NINA 1ITBB 1J5HA 3VGHA 1HX0A 1BBJB 4IMKC 4WLCA 2K6WA 3K46A 2BVPB 3FQRA 2Y7QA 2J3SA 2YIHA 3QQDA 5GRUH 1T0NB 3TO4A 3LEXB 4MQXC 4OLXH 3BPNB 3PWPE 3V6FA 4KROD 3L5WA 4OY9A 5B3SB 4L3EE 1ET7A 1ZHKB 3MNVB 2J2ZB 4B9YA 1T89A 3BWZA 1GZQB 3N44F 1K8IA 2PPCA 2ZP8A 4QRRE 3TFBA 2EVFA 4NP9A 1LWJA 5JXEA 1FYTB 1CBJA 2FT6A 4JEGB 2JIXB 4NPYB 3ZHDA 4MCMA 1IC5H 1KFAH 4WW2A 2NUPB 1P4IH 4PGBB 3QULA 4R5XA 3EHBB 5EUOF 3IKKA 5H37G 2IOMA 3BGAA 3P30L 3NIDB 4NN5B 2F0CA 2X1PA 3NZ8B 3W57A 4L29B 2VW7A 4JO2L 5L6YH 4QYOA 4M03A 1JV2B 1ZANL 2IPTH 1ZS2A 4LLDB 2UXTA 3AMLA 4PCKA 1USZA 3MV7A 3ES6B 3VXMA 1KELH 2VRKA 4FG4A 1IAOA 1HZHL 3JWNG 2G9HA 3DUHA 2F1EA 3POCA 4P23A 3JVGA 1NWOA 5JHDD 3OD3A 4LOEA 4TRPL 2IPTL 3HZMB 2W81C 4NP4L 1N8ZA 5E9NA 4KZEL 4WTZG 5DT1H 5DJXB 3TVMC 3MNDA 3SDXE 5DS2A 3OKLB 1PX4A 2X4NA 2FHFA 1T03L 3O41A 3V0WH 1DQJA 1R3JB 2GTWB 4GLRH 5D5MB 4HFUH 5J57B 2GITA 5D1QB 3C09C 1Q9OB 4KNTA 4LNRA 4QRBA 1WUZA 5SWSD 1NGYB 2B15A 3DTXA 2NZIA 1JK8B 1ACYL 1G1OA 2YHGA 5FWQA 3RAJH 3PJSA 2QL1A 4Q74A 3QRGL 4X4XA 3SODB 1J86A 4MNHB 3CZUB 2X42A 1KULA 4HSCX 4YXHL 1R24A 4ESKA 6PAZA 3NA9H 4X80L 2I25N 1DZBA 4BINA 4CMHB 2A9NL 2EIDA 2IVFC 2KZWA 1KV3A 2JF1A 3ET9F 5GS2D 1JK9B 1HNFA 1PZDA 4A6YL 1J5OH 4KJWC 4GFTB 1PX3A 4GPVA 1OE2A 2CH8A 1HL9A 3TPKA 4A63A 2ESVE 4DGIL 2QPDB 4R6UA 3JWNE 1CIUA 1HHKB 2B1HH 1MREL 4NUJB 4YVNA 2KKQA 2Y22A 4KH9A 1IIIA 3DA0A 3NSXA 4I3SH 1NUFA 1ZT4B 1N6VA 1SF3A 5T1LA 3QJOA 3M8OH 3OJMB 3HJEA 4P2OD 3WLBA 3ATFA 1DDTA 2WGXA 4HF5L 1JK8A 1A4KA 5EIVA 3ELQA 3DXAB 4AQ8A 2ADIA 5I9QC 3X13A 4KDVA 3GZPA 3MROA 4BZ1H 5L8KB 1JTOA 2GTWA 4G9DA 5D5MA 4ES8A 1DN0A 5A6IA 2HVKA 1U8PB 5AL8A 4I3RH 4H20H 2GC4C 4H0IA 5DD0L 1OAKH 5IVNA 4MNGA 4KY1L 2IADA 3FTVA 2GG1A 3QQ4B 3R4DA 4QT5A 2A9AA 1KFGA 2Z93A 1YEHL 3V8OA 2Q8BH 3MJGX 4PN6A 3RYMA 5KUMA 5I6OA 4DQOH 2PCFB 3CX2A 5D7JA 3QUGA 1Q1PA 1DLHA 4OT1H 4OGYL 3IETA 2F5AH 3NCFB 2BRQA 4M29A 4PJIF 5I1JH 5CZXD 5CNHA 3GZOA 1F4YL 3SO3B 2NY7H 1CZ8H 1KJVA 3DECA 4XP9H 2EYTA 2NZ9C 4Y1SA 1FYTA 3TT3L 2VLJE 3GSRB 3DUUB 4U6HB 3OKYA 3CPLB 3L5XL 5FOJA 2NSXA 3QR2A 4HP5A 1P0SE 4FQJH 4MJ2A 1RIUH 4EZLA 3KPQA 3H2PA 3FCBA 4L4VD 3FTXA 1A6AA 1VFOA 2C3GA 3Q9QA 3NJXA 4MZ3A 4A38A 1THAA 1AXTH 2D9CA 5LCVH 5MHSE 4GMSL 3H9SB 1N7MH 1JRHI 3FQRB 4L8BA 4NPKA 1NDMA 2YC1B 4F91B 2XZQH 8FABB 1NIDA 4ZUVA 1QBLH 2P8MA 3RRQA 3QJFA 4BWWA 1NJ9B 4Q9QH 2CR3A 1KB5B 3MRCB 3S8WA 1XCQB 1JERA 2AQQA 3MBXL 4QOKB 3S7GA 5SWSA 1TVHA 4ICXA 3QIUC 5TDOA 3ARGA 4X98B 3BUDA 5DCCA 1KIUA 3VSQA 1OT2A 2YD9A 3LEVH 4JE4B 1AY1L 3FT4A 5JOPD 1A65A 1J48A 5JYMA 3IPEA 2V7HA 1R4XA 3D09A 3VDAA 4M93B 2Q7NA 4X4ZA 4U1JA 4PJAA 4NQEA 1HHIA 4N0CD 5IF0B 3MUY1 4XVTH 4DERA 3IKCA 1UOVA 1RFDH 1KT2A 4NO2B 1UATA 4YHZH 2QSTA 4JG1L 1GW6A 2W0KA 4L1SA 1IZKA 2BCMA